BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23115_g1_i5 len=2103 path=[2478:0-734 494:735-974 3450:975-981
517:982-1155 3630:1156-1285 4438:1286-1424 3760:1425-2102]

Length=2103
                                                                      Score     E

ref|XP_010916359.1|  PREDICTED: carbon catabolite repressor prote...    284   4e-113   
ref|XP_010916358.1|  PREDICTED: carbon catabolite repressor prote...    284   9e-112   
ref|XP_008797847.1|  PREDICTED: carbon catabolite repressor prote...    280   1e-111   
ref|XP_008797844.1|  PREDICTED: carbon catabolite repressor prote...    273   1e-109   
ref|XP_008797846.1|  PREDICTED: carbon catabolite repressor prote...    273   2e-109   
ref|NP_683491.2|  DNAse I-like superfamily protein                      285   7e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341614.1|  PREDICTED: carbon catabolite repressor prote...    342   8e-106   
ref|XP_010663593.1|  PREDICTED: carbon catabolite repressor prote...    340   5e-105   
ref|XP_010916357.1|  PREDICTED: carbon catabolite repressor prote...    256   1e-104   
emb|CDO98437.1|  unnamed protein product                                339   2e-104   
ref|XP_009403959.1|  PREDICTED: carbon catabolite repressor prote...    262   2e-104   
ref|XP_010663592.1|  PREDICTED: carbon catabolite repressor prote...    333   2e-102   
ref|XP_010318609.1|  PREDICTED: carbon catabolite repressor prote...    329   2e-100   
ref|XP_004235772.1|  PREDICTED: carbon catabolite repressor prote...    327   3e-100   
ref|XP_004512931.1|  PREDICTED: carbon catabolite repressor prote...    320   5e-98    
ref|XP_009403960.1|  PREDICTED: carbon catabolite repressor prote...    241   7e-98    
gb|KEH27037.1|  carbon catabolite repressor-like protein                319   2e-97    
ref|XP_006440962.1|  hypothetical protein CICLE_v10020074mg             317   2e-96    
ref|XP_003543162.1|  PREDICTED: carbon catabolite repressor prote...    314   6e-96    
ref|XP_006485785.1|  PREDICTED: carbon catabolite repressor prote...    315   2e-95    
ref|XP_011005500.1|  PREDICTED: carbon catabolite repressor prote...    309   6e-95    
ref|XP_007209399.1|  hypothetical protein PRUPE_ppa009194mg             306   3e-94    
ref|XP_002533410.1|  conserved hypothetical protein                     310   5e-94    Ricinus communis
ref|XP_011005499.1|  PREDICTED: carbon catabolite repressor prote...    309   2e-93    
ref|XP_011072943.1|  PREDICTED: carbon catabolite repressor prote...    309   2e-93    
ref|XP_007152763.1|  hypothetical protein PHAVU_004G157500g             308   2e-93    
ref|XP_008240276.1|  PREDICTED: carbon catabolite repressor prote...    307   1e-92    
ref|XP_007036514.1|  DNAse I-like superfamily protein, putative i...    305   9e-92    
ref|XP_007036515.1|  DNAse I-like superfamily protein, putative i...    304   2e-91    
ref|XP_006341615.1|  PREDICTED: carbon catabolite repressor prote...    303   2e-91    
ref|XP_009625173.1|  PREDICTED: carbon catabolite repressor prote...    304   2e-91    
emb|CBI15444.3|  unnamed protein product                                296   4e-91    
ref|XP_010519234.1|  PREDICTED: carbon catabolite repressor prote...    301   1e-90    
ref|XP_010263633.1|  PREDICTED: carbon catabolite repressor prote...    302   1e-90    
ref|XP_010036884.1|  PREDICTED: carbon catabolite repressor prote...    302   1e-90    
ref|XP_009403961.1|  PREDICTED: carbon catabolite repressor prote...    264   2e-90    
ref|XP_004300529.1|  PREDICTED: carbon catabolite repressor prote...    299   1e-89    
ref|XP_009106044.1|  PREDICTED: carbon catabolite repressor prote...    294   7e-88    
ref|XP_008374749.1|  PREDICTED: carbon catabolite repressor prote...    293   2e-87    
ref|XP_009347068.1|  PREDICTED: carbon catabolite repressor prote...    293   2e-87    
emb|CDX73024.1|  BnaC06g34720D                                          292   5e-87    
gb|KDP20114.1|  hypothetical protein JCGZ_05883                         293   6e-87    
emb|CDX96494.1|  BnaA07g31050D                                          290   2e-86    
gb|KFK41825.1|  hypothetical protein AALP_AA2G176400                    288   1e-85    
ref|XP_006390497.1|  hypothetical protein EUTSA_v10018567mg             288   1e-85    
ref|XP_008453389.1|  PREDICTED: carbon catabolite repressor prote...    287   3e-85    
ref|XP_010677985.1|  PREDICTED: carbon catabolite repressor prote...    280   4e-84    
ref|XP_010428337.1|  PREDICTED: carbon catabolite repressor prote...    279   4e-84    
ref|XP_002887512.1|  endonuclease/exonuclease/phosphatase family ...    284   6e-84    
ref|XP_004155030.1|  PREDICTED: carbon catabolite repressor prote...    284   8e-84    
ref|XP_010428336.1|  PREDICTED: carbon catabolite repressor prote...    281   8e-83    
gb|KGN63816.1|  hypothetical protein Csa_1G023040                       281   1e-82    
ref|XP_010677984.1|  PREDICTED: carbon catabolite repressor prote...    281   1e-82    
ref|XP_010416214.1|  PREDICTED: carbon catabolite repressor prote...    278   1e-81    
ref|XP_010471466.1|  PREDICTED: carbon catabolite repressor prote...    277   2e-81    
ref|XP_010428334.1|  PREDICTED: carbon catabolite repressor prote...    277   3e-81    
ref|XP_006845304.1|  hypothetical protein AMTR_s00005p00269440          274   2e-80    
ref|XP_011072945.1|  PREDICTED: carbon catabolite repressor prote...    273   7e-80    
ref|XP_011072944.1|  PREDICTED: carbon catabolite repressor prote...    272   1e-79    
ref|XP_002438205.1|  hypothetical protein SORBIDRAFT_10g009570          233   3e-79    Sorghum bicolor [broomcorn]
ref|XP_010263640.1|  PREDICTED: carbon catabolite repressor prote...    270   1e-78    
ref|XP_002975880.1|  hypothetical protein SELMODRAFT_104238             226   1e-78    
gb|KEH27038.1|  carbon catabolite repressor-like protein                267   2e-78    
ref|XP_007036516.1|  DNAse I-like superfamily protein, putative i...    262   8e-76    
ref|XP_010094762.1|  hypothetical protein L484_019972                   266   1e-75    
ref|XP_004138343.1|  PREDICTED: carbon catabolite repressor prote...    259   1e-74    
ref|XP_007036517.1|  DNAse I-like superfamily protein, putative i...    257   2e-74    
ref|XP_007036461.1|  DNAse I-like superfamily protein, putative i...    244   1e-68    
ref|XP_010265226.1|  PREDICTED: carbon catabolite repressor prote...    232   1e-66    
emb|CDX92241.1|  BnaA05g21660D                                          236   6e-66    
ref|XP_007210064.1|  hypothetical protein PRUPE_ppa018606mg             236   6e-66    
gb|AAR24199.1|  At1g73875                                               227   2e-65    
ref|XP_002511969.1|  conserved hypothetical protein                     234   2e-65    Ricinus communis
ref|XP_010265224.1|  PREDICTED: carbon catabolite repressor prote...    233   2e-65    
ref|NP_001141499.1|  uncharacterized protein LOC100273611               234   2e-65    Zea mays [maize]
gb|AFW87610.1|  hypothetical protein ZEAMMB73_612868                    234   2e-65    
ref|XP_009145888.1|  PREDICTED: carbon catabolite repressor prote...    234   3e-65    
ref|XP_006655986.1|  PREDICTED: carbon catabolite repressor prote...    231   3e-65    
ref|XP_010909785.1|  PREDICTED: carbon catabolite repressor prote...    232   7e-65    
ref|XP_006440934.1|  hypothetical protein CICLE_v10020050mg             233   1e-64    
ref|XP_008244021.1|  PREDICTED: carbon catabolite repressor prote...    232   1e-64    
ref|XP_008801141.1|  PREDICTED: carbon catabolite repressor prote...    231   2e-64    
ref|XP_004965191.1|  PREDICTED: carbon catabolite repressor prote...    229   2e-64    
ref|XP_010909783.1|  PREDICTED: carbon catabolite repressor prote...    231   2e-64    
ref|XP_006406597.1|  hypothetical protein EUTSA_v10020715mg             231   2e-64    
ref|XP_010663575.1|  PREDICTED: carbon catabolite repressor prote...    231   3e-64    
ref|XP_006485766.1|  PREDICTED: carbon catabolite repressor prote...    231   4e-64    
emb|CAN69164.1|  hypothetical protein VITISV_015324                     223   7e-64    Vitis vinifera
emb|CDY24484.1|  BnaC05g34700D                                          230   8e-64    
ref|XP_009789801.1|  PREDICTED: carbon catabolite repressor prote...    228   3e-63    
ref|XP_009789802.1|  PREDICTED: carbon catabolite repressor prote...    228   3e-63    
ref|XP_009789800.1|  PREDICTED: carbon catabolite repressor prote...    228   3e-63    
ref|XP_004235743.1|  PREDICTED: carbon catabolite repressor prote...    228   4e-63    
ref|XP_010663594.1|  PREDICTED: carbon catabolite repressor prote...    226   4e-63    
ref|XP_009346877.1|  PREDICTED: carbon catabolite repressor prote...    228   7e-63    
dbj|BAB01117.1|  unnamed protein product                                227   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341629.1|  PREDICTED: carbon catabolite repressor prote...    227   1e-62    
gb|KHN21555.1|  Carbon catabolite repressor protein 4 like 3            226   1e-62    
ref|XP_003524384.1|  PREDICTED: carbon catabolite repressor prote...    226   2e-62    
ref|NP_001189925.1|  DNAse I-like superfamily protein                   226   2e-62    
ref|XP_010416212.1|  PREDICTED: carbon catabolite repressor prote...    224   2e-62    
ref|NP_188479.3|  DNAse I-like superfamily protein                      225   3e-62    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078178.1|  DNAse I-like superfamily protein                   226   3e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374735.1|  PREDICTED: carbon catabolite repressor prote...    225   5e-62    
ref|XP_010471468.1|  PREDICTED: carbon catabolite repressor prote...    223   1e-61    
ref|XP_003630828.1|  Carbon catabolite repressor protein-like pro...    223   1e-61    
ref|XP_010318600.1|  PREDICTED: carbon catabolite repressor prote...    224   1e-61    
emb|CDO98461.1|  unnamed protein product                                223   1e-61    
ref|XP_003563977.1|  PREDICTED: LOW QUALITY PROTEIN: carbon catab...    223   2e-61    
ref|XP_004301074.1|  PREDICTED: carbon catabolite repressor prote...    222   3e-61    
ref|XP_010416210.1|  PREDICTED: carbon catabolite repressor prote...    221   3e-61    
gb|KFK39180.1|  hypothetical protein AALP_AA3G210600                    222   4e-61    
ref|XP_001763073.1|  predicted protein                                  219   4e-61    
ref|XP_010549138.1|  PREDICTED: carbon catabolite repressor prote...    217   5e-61    
ref|XP_006297580.1|  hypothetical protein CARUB_v10013601mg             223   5e-61    
ref|XP_007160361.1|  hypothetical protein PHAVU_002G315100g             222   5e-61    
ref|XP_006341628.1|  PREDICTED: carbon catabolite repressor prote...    222   5e-61    
ref|XP_004503421.1|  PREDICTED: LOW QUALITY PROTEIN: carbon catab...    221   8e-61    
ref|XP_011072946.1|  PREDICTED: carbon catabolite repressor prote...    219   9e-61    
ref|XP_010549137.1|  PREDICTED: carbon catabolite repressor prote...    218   1e-60    
ref|XP_010037355.1|  PREDICTED: carbon catabolite repressor prote...    221   2e-60    
gb|KDP20095.1|  hypothetical protein JCGZ_05864                         221   2e-60    
ref|XP_009595088.1|  PREDICTED: carbon catabolite repressor prote...    220   3e-60    
dbj|BAJ85841.1|  predicted protein                                      221   3e-60    
ref|XP_009595089.1|  PREDICTED: carbon catabolite repressor prote...    220   3e-60    
ref|XP_010465953.1|  PREDICTED: carbon catabolite repressor prote...    216   4e-60    
ref|XP_001778811.1|  predicted protein                                  217   5e-60    
ref|XP_002883134.1|  hypothetical protein ARALYDRAFT_898218             219   6e-60    
ref|XP_010506947.1|  PREDICTED: carbon catabolite repressor prote...    218   2e-59    
ref|XP_008801143.1|  PREDICTED: carbon catabolite repressor prote...    214   9e-59    
ref|XP_010549136.1|  PREDICTED: carbon catabolite repressor prote...    216   1e-58    
ref|XP_010465951.1|  PREDICTED: carbon catabolite repressor prote...    216   2e-58    
ref|XP_010465952.1|  PREDICTED: carbon catabolite repressor prote...    216   2e-58    
gb|KDO64533.1|  hypothetical protein CISIN_1g021001mg                   209   7e-58    
ref|XP_008658270.1|  PREDICTED: uncharacterized protein LOC100273...    212   2e-57    
ref|XP_009773807.1|  PREDICTED: carbon catabolite repressor prote...    202   3e-57    
ref|XP_006485765.1|  PREDICTED: carbon catabolite repressor prote...    213   4e-57    
ref|XP_010909784.1|  PREDICTED: carbon catabolite repressor prote...    211   4e-57    
ref|XP_010416213.1|  PREDICTED: carbon catabolite repressor prote...    208   6e-57    
ref|XP_007036462.1|  DNAse I-like superfamily protein, putative i...    207   8e-57    
ref|XP_004965189.1|  PREDICTED: carbon catabolite repressor prote...    209   1e-56    
ref|XP_009773815.1|  PREDICTED: carbon catabolite repressor prote...    199   3e-56    
ref|XP_008453378.1|  PREDICTED: carbon catabolite repressor prote...    206   2e-55    
ref|XP_004965188.1|  PREDICTED: carbon catabolite repressor prote...    206   5e-55    
ref|XP_004155032.1|  PREDICTED: carbon catabolite repressor prote...    204   1e-54    
ref|XP_004138235.1|  PREDICTED: carbon catabolite repressor prote...    202   7e-54    
ref|XP_009409259.1|  PREDICTED: carbon catabolite repressor prote...    200   2e-53    
ref|XP_009595090.1|  PREDICTED: carbon catabolite repressor prote...    199   5e-53    
ref|XP_010037356.1|  PREDICTED: carbon catabolite repressor prote...    198   2e-52    
ref|XP_009771291.1|  PREDICTED: carbon catabolite repressor prote...    193   5e-52    
ref|NP_001141416.1|  hypothetical protein                               197   3e-51    Zea mays [maize]
ref|XP_004965190.1|  PREDICTED: carbon catabolite repressor prote...    192   4e-51    
gb|EMS55006.1|  hypothetical protein TRIUR3_35285                       191   1e-48    
ref|XP_008453380.1|  PREDICTED: carbon catabolite repressor prote...    186   2e-48    
ref|XP_010265225.1|  PREDICTED: carbon catabolite repressor prote...    180   7e-47    
ref|XP_009409260.1|  PREDICTED: carbon catabolite repressor prote...    179   3e-46    
ref|XP_008801142.1|  PREDICTED: carbon catabolite repressor prote...    179   6e-46    
gb|EYU45447.1|  hypothetical protein MIMGU_mgv1a022739mg                173   2e-45    
gb|KEH27039.1|  carbon catabolite repressor-like protein                174   2e-45    
ref|XP_008658269.1|  PREDICTED: uncharacterized protein LOC100273...    176   6e-45    
gb|KHN16588.1|  Carbon catabolite repressor protein 4 like 3            171   3e-44    
ref|XP_008453381.1|  PREDICTED: carbon catabolite repressor prote...    172   5e-44    
ref|XP_002324275.2|  hypothetical protein POPTR_0018s01290g             173   2e-43    Populus trichocarpa [western balsam poplar]
ref|XP_002968603.1|  hypothetical protein SELMODRAFT_89183              165   5e-43    
ref|XP_009409262.1|  PREDICTED: carbon catabolite repressor prote...    169   1e-42    
ref|XP_003588706.1|  Carbon catabolite repressor protein-like pro...    122   6e-42    
emb|CBI15445.3|  unnamed protein product                                154   3e-39    
ref|XP_002318554.2|  hypothetical protein POPTR_0012s05370g             153   2e-38    Populus trichocarpa [western balsam poplar]
gb|KHN20726.1|  Carbon catabolite repressor protein 4 like 5            147   9e-38    
ref|XP_002318553.2|  hypothetical protein POPTR_0012s053602g            146   3e-37    Populus trichocarpa [western balsam poplar]
ref|XP_009409261.1|  PREDICTED: carbon catabolite repressor prote...    151   2e-36    
dbj|BAJ91292.1|  predicted protein                                      147   3e-35    
emb|CAN77912.1|  hypothetical protein VITISV_014763                     143   7e-35    Vitis vinifera
ref|XP_006341630.1|  PREDICTED: carbon catabolite repressor prote...    144   2e-34    
gb|EYU21940.1|  hypothetical protein MIMGU_mgv1a002905mg                137   1e-30    
ref|XP_004293013.1|  PREDICTED: carbon catabolite repressor prote...    137   3e-30    
ref|XP_010102811.1|  hypothetical protein L484_004664                   137   3e-30    
ref|XP_011026500.1|  PREDICTED: carbon catabolite repressor prote...    137   4e-30    
ref|XP_009759627.1|  PREDICTED: carbon catabolite repressor prote...    133   4e-29    
ref|XP_006450508.1|  hypothetical protein CICLE_v10007580mg             132   4e-29    
ref|XP_011026499.1|  PREDICTED: carbon catabolite repressor prote...    134   4e-29    
ref|XP_011026497.1|  PREDICTED: carbon catabolite repressor prote...    134   4e-29    
ref|XP_008394028.1|  PREDICTED: carbon catabolite repressor prote...    134   4e-29    
ref|XP_009334790.1|  PREDICTED: LOW QUALITY PROTEIN: carbon catab...    134   4e-29    
ref|XP_009759626.1|  PREDICTED: carbon catabolite repressor prote...    133   4e-29    
ref|XP_002514362.1|  conserved hypothetical protein                     133   6e-29    Ricinus communis
ref|XP_002282223.2|  PREDICTED: carbon catabolite repressor prote...    132   1e-28    Vitis vinifera
ref|XP_008466384.1|  PREDICTED: carbon catabolite repressor prote...    132   1e-28    
ref|XP_009614089.1|  PREDICTED: carbon catabolite repressor prote...    132   1e-28    
ref|XP_009614091.1|  PREDICTED: carbon catabolite repressor prote...    132   1e-28    
ref|XP_008672447.1|  PREDICTED: hypothetical protein isoform X2         129   1e-28    
ref|XP_008672445.1|  PREDICTED: hypothetical protein isoform X1         129   1e-28    
ref|XP_008466385.1|  PREDICTED: carbon catabolite repressor prote...    132   2e-28    
ref|XP_009759623.1|  PREDICTED: carbon catabolite repressor prote...    132   2e-28    
ref|XP_009759625.1|  PREDICTED: carbon catabolite repressor prote...    132   2e-28    
gb|AES58957.2|  carbon catabolite repressor-like protein                132   2e-28    
gb|KEH39822.1|  carbon catabolite repressor-like protein                131   2e-28    
ref|XP_006483303.1|  PREDICTED: carbon catabolite repressor prote...    131   3e-28    
ref|XP_006450507.1|  hypothetical protein CICLE_v10007580mg             131   3e-28    
gb|KDO61648.1|  hypothetical protein CISIN_1g047201mg                   131   3e-28    
gb|EPS58822.1|  hypothetical protein M569_15991                         125   3e-28    
ref|XP_009614088.1|  PREDICTED: carbon catabolite repressor prote...    131   4e-28    
ref|XP_009614085.1|  PREDICTED: carbon catabolite repressor prote...    131   4e-28    
ref|XP_009614084.1|  PREDICTED: carbon catabolite repressor prote...    131   4e-28    
gb|KGN60117.1|  hypothetical protein Csa_3G878860                       130   4e-28    
ref|XP_004136470.1|  PREDICTED: carbon catabolite repressor prote...    130   4e-28    
ref|XP_009614087.1|  PREDICTED: carbon catabolite repressor prote...    130   4e-28    
ref|XP_009614086.1|  PREDICTED: carbon catabolite repressor prote...    130   5e-28    
ref|XP_004162062.1|  PREDICTED: carbon catabolite repressor prote...    130   5e-28    
ref|XP_010325138.1|  PREDICTED: carbon catabolite repressor prote...    130   6e-28    
gb|KCW81438.1|  hypothetical protein EUGRSUZ_C02819                     129   6e-28    
ref|XP_010325136.1|  PREDICTED: carbon catabolite repressor prote...    129   1e-27    
ref|XP_010325135.1|  PREDICTED: carbon catabolite repressor prote...    129   1e-27    
ref|XP_010325137.1|  PREDICTED: carbon catabolite repressor prote...    129   1e-27    
ref|XP_010051192.1|  PREDICTED: carbon catabolite repressor prote...    128   2e-27    
ref|XP_010541622.1|  PREDICTED: carbon catabolite repressor prote...    127   4e-27    
ref|XP_006854929.1|  hypothetical protein AMTR_s00052p00118920          127   6e-27    
gb|KFK25402.1|  hypothetical protein AALP_AA8G109900                    125   1e-26    
ref|XP_007013800.1|  DNAse I-like superfamily protein, putative i...    126   1e-26    
ref|XP_002871471.1|  endonuclease/exonuclease/phosphatase family ...    126   1e-26    
gb|KFK25403.1|  hypothetical protein AALP_AA8G109900                    125   1e-26    
ref|XP_007013799.1|  DNAse I-like superfamily protein, putative i...    126   1e-26    
ref|XP_010541621.1|  PREDICTED: carbon catabolite repressor prote...    125   2e-26    
ref|NP_196696.2|  DNAse I-like superfamily protein                      125   2e-26    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009824634.1|  hypothetical protein H257_02618                    122   2e-26    
ref|XP_008863800.1|  hypothetical protein H310_02156                    122   2e-26    
ref|XP_010254301.1|  PREDICTED: carbon catabolite repressor prote...    124   2e-26    
emb|CDP04807.1|  unnamed protein product                                125   3e-26    
ref|XP_006399637.1|  hypothetical protein EUTSA_v10012752mg             125   3e-26    
ref|XP_010254300.1|  PREDICTED: carbon catabolite repressor prote...    124   3e-26    
ref|XP_010254297.1|  PREDICTED: carbon catabolite repressor prote...    124   4e-26    
ref|XP_010254296.1|  PREDICTED: carbon catabolite repressor prote...    124   4e-26    
ref|XP_010670716.1|  PREDICTED: carbon catabolite repressor prote...    123   4e-26    
ref|XP_007161236.1|  hypothetical protein PHAVU_001G053400g             124   4e-26    
ref|XP_009121962.1|  PREDICTED: carbon catabolite repressor prote...    124   5e-26    
ref|XP_006287178.1|  hypothetical protein CARUB_v10000347mg             124   5e-26    
emb|CDX97099.1|  BnaC09g45260D                                          124   5e-26    
ref|XP_009121961.1|  PREDICTED: carbon catabolite repressor prote...    124   6e-26    
ref|XP_010670715.1|  PREDICTED: carbon catabolite repressor prote...    123   9e-26    
ref|XP_010453180.1|  PREDICTED: carbon catabolite repressor prote...    123   1e-25    
ref|XP_008219887.1|  PREDICTED: carbon catabolite repressor prote...    123   1e-25    
ref|XP_008219886.1|  PREDICTED: carbon catabolite repressor prote...    123   1e-25    
ref|XP_010419693.1|  PREDICTED: carbon catabolite repressor prote...    122   2e-25    
gb|KDP33634.1|  hypothetical protein JCGZ_07205                         122   2e-25    
ref|XP_004969137.1|  PREDICTED: carbon catabolite repressor prote...    122   2e-25    
gb|AAL47464.1|  At5g11350/F2I11_240                                     122   2e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491857.1|  PREDICTED: carbon catabolite repressor prote...    122   3e-25    
ref|XP_003545500.1|  PREDICTED: carbon catabolite repressor prote...    122   3e-25    
emb|CDX69764.1|  BnaA10g21130D                                          121   3e-25    
ref|XP_007225253.1|  hypothetical protein PRUPE_ppa001585mg             121   3e-25    
ref|XP_010021273.1|  PREDICTED: protein angel homolog 1               73.9    4e-25    
ref|XP_001417218.1|  predicted protein                                  118   4e-25    Ostreococcus lucimarinus CCE9901
ref|XP_004498648.1|  PREDICTED: LOW QUALITY PROTEIN: carbon catab...    121   5e-25    
ref|XP_008672448.1|  PREDICTED: hypothetical protein isoform X3         117   1e-24    
ref|NP_001057339.2|  Os06g0264900                                       115   1e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001367467.1|  PREDICTED: protein angel homolog 1 isoform X1    74.3    1e-24    Monodelphis domestica
ref|XP_007472829.1|  PREDICTED: protein angel homolog 1 isoform X2    74.3    2e-24    
ref|XP_007472832.1|  PREDICTED: protein angel homolog 1 isoform X5    73.9    2e-24    
ref|XP_008796429.1|  PREDICTED: carbon catabolite repressor prote...    119   2e-24    
ref|XP_003566869.1|  PREDICTED: carbon catabolite repressor prote...    119   2e-24    
ref|XP_008796428.1|  PREDICTED: carbon catabolite repressor prote...    119   2e-24    
gb|EAZ00434.1|  hypothetical protein OsI_22458                          114   2e-24    Oryza sativa Indica Group [Indian rice]
ref|XP_002458143.1|  hypothetical protein SORBIDRAFT_03g027610          119   3e-24    Sorghum bicolor [broomcorn]
emb|CAN78259.1|  hypothetical protein VITISV_026646                     115   3e-24    Vitis vinifera
ref|XP_008796427.1|  PREDICTED: carbon catabolite repressor prote...    118   4e-24    
dbj|BAJ99435.1|  predicted protein                                      118   4e-24    
ref|XP_009055764.1|  hypothetical protein LOTGIDRAFT_118950           74.7    4e-24    
emb|CDM83409.1|  unnamed protein product                                118   5e-24    
emb|CAN65720.1|  hypothetical protein VITISV_004443                     116   7e-24    Vitis vinifera
ref|XP_010648600.1|  PREDICTED: carbon catabolite repressor prote...    116   1e-23    
dbj|BAF02225.1|  hypothetical protein                                   108   3e-23    
ref|XP_009401779.1|  PREDICTED: carbon catabolite repressor prote...    115   4e-23    
gb|ACN26508.1|  unknown                                                 109   9e-23    Zea mays [maize]
ref|XP_006646087.1|  PREDICTED: carbon catabolite repressor prote...    112   2e-22    
ref|XP_010918013.1|  PREDICTED: uncharacterized protein LOC105042...    110   1e-21    
ref|XP_010917938.1|  PREDICTED: carbon catabolite repressor prote...    110   1e-21    
ref|XP_008607011.1|  hypothetical protein SDRG_03166                    107   2e-21    
ref|NP_001043546.1|  Os01g0610600                                       109   3e-21    Oryza sativa Japonica Group [Japonica rice]
gb|EEC71070.1|  hypothetical protein OsI_02823                          108   4e-21    Oryza sativa Indica Group [Indian rice]
gb|EMS67234.1|  hypothetical protein TRIUR3_32569                       108   9e-21    
ref|XP_008902779.1|  hypothetical protein PPTG_09524                    102   4e-20    
gb|KDO33783.1|  hypothetical protein SPRG_01662                         102   5e-20    
gb|ETI51282.1|  hypothetical protein F443_05347                         101   1e-19    
gb|ETO80005.1|  hypothetical protein F444_05394                         101   1e-19    
gb|ETM50877.1|  hypothetical protein L914_05163                         101   2e-19    
ref|XP_006376741.1|  hypothetical protein POPTR_0012s053601g          94.4    2e-19    
ref|XP_003060680.1|  predicted protein                                  100   2e-19    
ref|XP_009014424.1|  hypothetical protein HELRODRAFT_191048           63.9    2e-19    
gb|ACJ61482.1|  hypothetical protein                                  98.2    3e-19    
gb|KFK35106.1|  hypothetical protein AALP_AA5G236700                  74.3    4e-19    
gb|ETP48970.1|  hypothetical protein F442_05397                       97.8    2e-18    
ref|XP_003029309.1|  hypothetical protein SCHCODRAFT_58593            70.5    3e-18    
emb|CBK20428.2|  unnamed protein product                              69.3    3e-18    
ref|XP_006301409.1|  hypothetical protein CARUB_v10021824mg           99.0    4e-18    
gb|EEE54972.1|  hypothetical protein OsJ_02572                        98.2    1e-17    
ref|XP_010254298.1|  PREDICTED: carbon catabolite repressor prote...  97.4    1e-17    
ref|XP_010057655.1|  PREDICTED: carbon catabolite repressor prote...  93.6    2e-17    
gb|KGB76557.1|  glucose-repressible alcohol dehydrogenase transcr...  63.5    3e-17    
gb|EMT24945.1|  hypothetical protein F775_20624                       96.3    4e-17    
dbj|BAN21580.1|  carbon catabolite repressor protein                  64.3    4e-17    
ref|XP_011026501.1|  PREDICTED: carbon catabolite repressor prote...  96.3    4e-17    
ref|XP_003195102.1|  component of the CCR4-NOT transcriptional co...  63.2    4e-17    
ref|XP_774450.1|  hypothetical protein CNBG0960                       62.8    1e-16    
ref|XP_572083.1|  hypothetical protein                                62.8    1e-16    
gb|AFR96417.1|  glucose-repressible alcohol dehydrogenase transcr...  62.0    2e-16    
gb|KHN32493.1|  Carbon catabolite repressor protein 4 like 6          92.0    2e-16    
ref|XP_006497250.1|  PREDICTED: protein angel homolog 2 isoform X5    90.1    3e-16    
gb|EMS22570.1|  CCR4-NOT transcription complex subunit 6              63.9    5e-16    
dbj|BAE41277.1|  unnamed protein product                              89.0    1e-15    
gb|KGK38087.1|  hypothetical protein JL09_g2733                       59.7    1e-15    
ref|XP_011082245.1|  PREDICTED: LOW QUALITY PROTEIN: carbon catab...  90.9    2e-15    
emb|CAN64423.1|  hypothetical protein VITISV_032275                   90.1    2e-15    
ref|XP_003686905.1|  hypothetical protein TPHA_0H02680                59.3    2e-15    
ref|XP_006497249.1|  PREDICTED: protein angel homolog 2 isoform X4    89.0    2e-15    
emb|CAB96670.1|  putative protein                                     90.5    2e-15    
ref|XP_002963537.1|  hypothetical protein SELMODRAFT_270348           89.7    3e-15    
ref|XP_008823074.1|  PREDICTED: protein angel homolog 2 isoform X2    88.6    3e-15    
gb|EYE92770.1|  hypothetical protein EURHEDRAFT_404932                57.8    7e-15    
emb|CDH10652.1|  probable Glucose-repressible alcohol dehydrogena...  56.6    8e-15    
ref|XP_001643659.1|  hypothetical protein Kpol_1040p14                58.2    1e-14    
ref|XP_006250524.1|  PREDICTED: protein angel homolog 2 isoform X2    86.3    1e-14    
ref|NP_001185949.1|  protein angel homolog 2 isoform 2                87.0    2e-14    
ref|NP_067396.3|  protein angel homolog 2 isoform 1                   87.0    2e-14    
ref|XP_007245542.1|  PREDICTED: protein angel homolog 2 isoform X2    87.0    2e-14    
ref|XP_007245541.1|  PREDICTED: protein angel homolog 2 isoform X1    86.7    2e-14    
emb|CDF90578.1|  ZYBA0S07-04302g1_1                                   56.2    2e-14    
ref|XP_005849544.1|  hypothetical protein CHLNCDRAFT_50978            82.8    4e-14    
ref|XP_008823072.1|  PREDICTED: protein angel homolog 2 isoform X1    85.9    4e-14    
ref|XP_005963432.1|  PREDICTED: protein angel homolog 2               84.7    5e-14    
ref|XP_004471049.1|  PREDICTED: protein angel homolog 2 isoform 5     84.7    5e-14    
ref|XP_010947807.1|  PREDICTED: protein angel homolog 2 isoform X4    84.3    5e-14    
ref|XP_004578707.1|  PREDICTED: protein angel homolog 2               85.1    6e-14    
ref|XP_006089948.1|  PREDICTED: protein angel homolog 2 isoform X1    84.3    7e-14    
ref|XP_006089949.1|  PREDICTED: protein angel homolog 2 isoform X2    84.3    7e-14    
ref|XP_006772985.1|  PREDICTED: protein angel homolog 2 isoform X3    84.3    7e-14    
ref|XP_010947805.1|  PREDICTED: protein angel homolog 2 isoform X3    84.3    7e-14    
ref|XP_009236049.1|  PREDICTED: protein angel homolog 2 isoform X4    83.6    8e-14    
ref|XP_006193351.1|  PREDICTED: protein angel homolog 2 isoform X2    84.0    8e-14    
ref|NP_001128591.2|  protein angel homolog 2                          84.7    8e-14    
ref|XP_008352179.1|  PREDICTED: carbon catabolite repressor prote...  79.0    8e-14    
ref|XP_006772984.1|  PREDICTED: protein angel homolog 2 isoform X2    84.0    8e-14    
ref|XP_010851348.1|  PREDICTED: protein angel homolog 2 isoform X4    83.6    8e-14    
ref|XP_001782595.1|  predicted protein                                84.7    9e-14    
ref|XP_010811879.1|  PREDICTED: protein angel homolog 2 isoform X3    83.2    1e-13    
ref|XP_007647240.1|  PREDICTED: protein angel homolog 2               84.3    1e-13    
ref|XP_006198828.1|  PREDICTED: protein angel homolog 2 isoform X2    83.6    1e-13    
ref|XP_002801971.1|  PREDICTED: protein angel homolog 2-like          82.0    1e-13    
gb|KFZ57990.1|  Protein angel 2                                       84.0    1e-13    
ref|XP_007147585.1|  hypothetical protein PHAVU_006G136900g           79.3    2e-13    
emb|CDH15053.1|  probable Glucose-repressible alcohol dehydrogena...  56.6    2e-13    
ref|XP_002552825.1|  KLTH0D02310p                                     53.9    2e-13    
ref|XP_010851346.1|  PREDICTED: protein angel homolog 2 isoform X3    83.2    2e-13    
ref|XP_005888604.1|  PREDICTED: protein angel homolog 2 isoform X2    83.2    2e-13    
ref|XP_006972149.1|  PREDICTED: protein angel homolog 2 isoform X3    82.4    2e-13    
ref|XP_010811877.1|  PREDICTED: protein angel homolog 2 isoform X2    82.8    2e-13    
ref|XP_005329473.1|  PREDICTED: protein angel homolog 2 isoform X2    82.8    2e-13    
ref|XP_001768291.1|  predicted protein                                83.6    2e-13    
ref|XP_008534553.1|  PREDICTED: protein angel homolog 2 isoform X2    83.2    3e-13    
ref|XP_005160799.1|  PREDICTED: protein angel homolog 2 isoform X1    83.2    3e-13    
ref|XP_009418830.1|  PREDICTED: carbon catabolite repressor prote...  83.2    3e-13    
ref|XP_006972148.1|  PREDICTED: protein angel homolog 2 isoform X2    82.4    3e-13    
ref|NP_001191852.1|  protein angel                                    82.4    3e-13    
ref|XP_008534551.1|  PREDICTED: protein angel homolog 2 isoform X1    82.8    3e-13    
ref|XP_002760577.1|  PREDICTED: protein angel homolog 2 isoform X5    82.4    3e-13    
ref|XP_008983483.1|  PREDICTED: protein angel homolog 2 isoform X6    82.0    3e-13    
ref|NP_001025131.1|  protein angel homolog 2                          83.2    3e-13    
dbj|BAH71781.1|  ACYPI000743                                          82.4    3e-13    
ref|XP_004699939.1|  PREDICTED: protein angel homolog 2               82.8    4e-13    
ref|XP_001488584.1|  PREDICTED: protein angel homolog 2 isoform X1    82.8    4e-13    
ref|XP_008291596.1|  PREDICTED: protein angel homolog 2-like          83.2    4e-13    
ref|XP_004471046.1|  PREDICTED: protein angel homolog 2 isoform 2     82.8    4e-13    
ref|XP_010339260.1|  PREDICTED: protein angel homolog 2 isoform X5    82.0    4e-13    
gb|KHN06664.1|  Carbon catabolite repressor protein 4 like 6          78.6    4e-13    
gb|AAI24748.1|  Si:ch211-181h6.2 protein                              82.8    4e-13    
ref|XP_004471045.1|  PREDICTED: protein angel homolog 2 isoform 1     82.4    4e-13    
ref|XP_007175649.1|  PREDICTED: protein angel homolog 2 isoform X3    81.6    5e-13    
ref|XP_010371247.1|  PREDICTED: protein angel homolog 2 isoform X3    81.3    5e-13    
ref|XP_005082941.1|  PREDICTED: protein angel homolog 2               82.0    5e-13    
ref|XP_005348922.1|  PREDICTED: protein angel homolog 2               82.0    6e-13    
ref|XP_001782568.1|  predicted protein                                82.4    6e-13    
ref|XP_010339259.1|  PREDICTED: protein angel homolog 2 isoform X4    81.3    6e-13    
ref|XP_010947804.1|  PREDICTED: protein angel homolog 2 isoform X2    82.0    6e-13    
ref|XP_006772983.1|  PREDICTED: protein angel homolog 2 isoform X1    82.0    7e-13    
ref|XP_001374687.3|  PREDICTED: protein angel homolog 2 isoform X1    81.6    7e-13    
ref|XP_007481437.1|  PREDICTED: protein angel homolog 2 isoform X10   81.3    7e-13    
ref|XP_004303362.1|  PREDICTED: carbon catabolite repressor prote...  82.0    7e-13    
ref|XP_005865221.1|  PREDICTED: protein angel homolog 2               81.6    7e-13    
ref|XP_006907778.1|  PREDICTED: protein angel homolog 2 isoform X2    80.5    8e-13    
ref|XP_006193350.1|  PREDICTED: protein angel homolog 2 isoform X1    81.6    8e-13    
ref|XP_009197305.1|  PREDICTED: protein angel homolog 2 isoform X4    80.9    8e-13    
ref|XP_009236028.1|  PREDICTED: protein angel homolog 2 isoform X1    81.6    8e-13    
ref|XP_008144197.1|  PREDICTED: protein angel homolog 2               81.6    8e-13    
gb|EMG49813.1|  Glucose-repressible alcohol dehydrogenase transcr...  53.1    8e-13    
ref|XP_007564846.1|  PREDICTED: protein angel homolog 2 isoform X3    82.0    9e-13    
ref|XP_007564847.1|  PREDICTED: protein angel homolog 2 isoform X4    82.0    9e-13    
ref|XP_007564842.1|  PREDICTED: protein angel homolog 2 isoform X1    82.0    9e-13    
ref|XP_004694953.1|  PREDICTED: protein angel homolog 2               81.6    1e-12    
ref|XP_003918850.1|  PREDICTED: protein angel homolog 2 isoform X3    80.9    1e-12    
ref|XP_007564845.1|  PREDICTED: protein angel homolog 2 isoform X2    81.6    1e-12    
ref|XP_004880463.1|  PREDICTED: protein angel homolog 2 isoform X6    81.3    1e-12    
ref|XP_009236017.1|  PREDICTED: protein angel homolog 2 isoform X2    81.3    1e-12    
ref|XP_005540871.1|  PREDICTED: protein angel homolog 2 isoform X5    80.5    1e-12    
gb|KDD76993.1|  hypothetical protein H632_c46p4                       79.7    1e-12    
ref|XP_005652254.1|  hypothetical protein COCSUDRAFT_45960            81.6    1e-12    
ref|XP_006054116.1|  PREDICTED: protein angel homolog 2               81.3    1e-12    
ref|XP_010597695.1|  PREDICTED: protein angel homolog 2 isoform X2    80.5    1e-12    
ref|XP_004424957.1|  PREDICTED: protein angel homolog 2               81.3    1e-12    
ref|XP_006198827.1|  PREDICTED: protein angel homolog 2 isoform X1    81.3    1e-12    
ref|XP_004671356.1|  PREDICTED: LOW QUALITY PROTEIN: protein ange...  81.3    1e-12    
ref|XP_007481435.1|  PREDICTED: protein angel homolog 2 isoform X8    80.9    1e-12    
ref|XP_008266662.1|  PREDICTED: LOW QUALITY PROTEIN: protein ange...  80.9    1e-12    
ref|XP_006890613.1|  PREDICTED: protein angel homolog 2               80.5    1e-12    
ref|XP_006972147.1|  PREDICTED: protein angel homolog 2 isoform X1    80.9    1e-12    
ref|XP_005888603.1|  PREDICTED: protein angel homolog 2 isoform X1    80.9    1e-12    
ref|XP_010851345.1|  PREDICTED: protein angel homolog 2 isoform X2    80.9    1e-12    
ref|XP_010243421.1|  PREDICTED: carbon catabolite repressor prote...  81.3    1e-12    
gb|ETO10218.1|  hypothetical protein RFI_27159                        80.1    1e-12    
ref|XP_010851344.1|  PREDICTED: protein angel homolog 2 isoform X1    80.9    2e-12    
ref|XP_006972150.1|  PREDICTED: protein angel homolog 2 isoform X4    80.9    2e-12    
ref|XP_005217436.1|  PREDICTED: protein angel homolog 2 isoform X1    80.5    2e-12    
ref|XP_009895815.1|  PREDICTED: protein angel homolog 2               80.9    2e-12    
ref|XP_009417151.1|  PREDICTED: carbon catabolite repressor prote...  80.9    2e-12    
ref|XP_003357635.1|  PREDICTED: protein angel homolog 2 isoformX2     80.5    2e-12    
ref|NP_001092580.1|  protein angel homolog 2                          80.5    2e-12    
ref|XP_006163781.1|  PREDICTED: protein angel homolog 2 isoform X1    80.5    2e-12    
ref|XP_005691156.1|  PREDICTED: protein angel homolog 2               80.5    2e-12    
ref|XP_003265167.1|  PREDICTED: protein angel homolog 2 isoform 2     79.7    2e-12    
ref|XP_009406539.1|  PREDICTED: carbon catabolite repressor prote...  80.9    2e-12    
ref|XP_008590851.1|  PREDICTED: protein angel homolog 2 isoform X5    79.3    2e-12    
ref|XP_008370952.1|  PREDICTED: carbon catabolite repressor prote...  80.5    2e-12    
ref|XP_008395561.1|  PREDICTED: protein angel homolog 2               80.9    2e-12    
ref|NP_001125837.1|  protein angel homolog 2                          80.1    2e-12    
ref|XP_008983482.1|  PREDICTED: protein angel homolog 2 isoform X4    80.1    2e-12    
ref|XP_005329472.1|  PREDICTED: protein angel homolog 2 isoform X1    80.5    2e-12    
ref|XP_004471047.1|  PREDICTED: protein angel homolog 2 isoform 3     80.1    2e-12    
ref|XP_003130450.1|  PREDICTED: protein angel homolog 2 isoformX1     80.1    2e-12    
ref|XP_008350261.1|  PREDICTED: carbon catabolite repressor prote...  80.5    2e-12    
gb|ETO17102.1|  hypothetical protein RFI_20231                        80.5    2e-12    
ref|XP_008983480.1|  PREDICTED: protein angel homolog 2 isoform X1    80.1    2e-12    
ref|XP_004013937.1|  PREDICTED: protein angel homolog 2               80.1    3e-12    
ref|XP_004322894.1|  PREDICTED: protein angel homolog 2 isoform 2     80.1    3e-12    
ref|XP_008699379.1|  PREDICTED: protein angel homolog 2 isoform X3    79.0    3e-12    
ref|XP_004275302.1|  PREDICTED: protein angel homolog 2 isoform 2     80.1    3e-12    
ref|XP_005806506.1|  PREDICTED: protein angel homolog 2-like          80.1    3e-12    
ref|XP_008983481.1|  PREDICTED: protein angel homolog 2 isoform X3    80.1    3e-12    
ref|XP_003073924.1|  glucose-repressible alcohol dehydrogenase tr...  59.3    3e-12    
ref|XP_008796675.1|  PREDICTED: carbon catabolite repressor prote...  80.1    3e-12    
ref|XP_008796674.1|  PREDICTED: carbon catabolite repressor prote...  80.1    3e-12    
ref|XP_009094659.1|  PREDICTED: protein angel homolog 2               80.1    3e-12    
ref|XP_007175648.1|  PREDICTED: protein angel homolog 2 isoform X2    79.7    3e-12    
ref|XP_005374790.1|  PREDICTED: protein angel homolog 2 isoform X4    79.3    3e-12    
ref|XP_002760575.1|  PREDICTED: protein angel homolog 2 isoform X2    79.7    3e-12    
ref|XP_004322893.1|  PREDICTED: protein angel homolog 2 isoform 1     79.7    3e-12    
ref|XP_007175650.1|  PREDICTED: protein angel homolog 2 isoform X4    79.7    3e-12    
ref|XP_007481429.1|  PREDICTED: protein angel homolog 2 isoform X2    79.7    3e-12    
ref|XP_004275301.1|  PREDICTED: protein angel homolog 2 isoform 1     79.7    3e-12    
ref|XP_007481432.1|  PREDICTED: protein angel homolog 2 isoform X5    79.7    4e-12    
ref|XP_010339257.1|  PREDICTED: protein angel homolog 2 isoform X3    79.7    4e-12    
ref|XP_003648000.1|  hypothetical protein Ecym_7354                   58.5    4e-12    
ref|XP_007481431.1|  PREDICTED: protein angel homolog 2 isoform X4    79.7    4e-12    
ref|XP_004387584.1|  PREDICTED: protein angel homolog 2               79.7    4e-12    
ref|XP_004880459.1|  PREDICTED: protein angel homolog 2 isoform X2    79.3    4e-12    
ref|XP_010880907.1|  PREDICTED: protein angel homolog 2 isoform X1    79.7    4e-12    
ref|NP_001287686.1|  protein angel homolog 2 isoform c                78.6    4e-12    
ref|XP_004275303.1|  PREDICTED: protein angel homolog 2 isoform 3     79.7    4e-12    
ref|XP_010339256.1|  PREDICTED: protein angel homolog 2 isoform X2    79.7    4e-12    
ref|XP_008590849.1|  PREDICTED: protein angel homolog 2 isoform X4    79.0    4e-12    
ref|XP_010923332.1|  PREDICTED: carbon catabolite repressor prote...  79.7    4e-12    
ref|XP_010880908.1|  PREDICTED: protein angel homolog 2 isoform X2    79.7    4e-12    
ref|XP_004322895.1|  PREDICTED: protein angel homolog 2 isoform 3     79.7    4e-12    
ref|XP_007175647.1|  PREDICTED: protein angel homolog 2 isoform X1    79.3    4e-12    
gb|KHG01958.1|  Carbon catabolite repressor 4 -like protein           73.2    4e-12    
ref|XP_010923335.1|  PREDICTED: carbon catabolite repressor prote...  79.7    4e-12    
ref|XP_009335881.1|  PREDICTED: carbon catabolite repressor prote...  79.7    4e-12    
ref|XP_010036513.1|  PREDICTED: carbon catabolite repressor prote...  79.7    4e-12    
ref|XP_003930411.1|  PREDICTED: protein angel homolog 2 isoform X1    79.3    4e-12    
ref|XP_004880458.1|  PREDICTED: protein angel homolog 2 isoform X1    79.3    5e-12    
ref|XP_004853607.1|  PREDICTED: protein angel homolog 2 isoform X1    79.3    5e-12    
ref|XP_009344520.1|  PREDICTED: carbon catabolite repressor prote...  76.6    5e-12    
ref|XP_007481430.1|  PREDICTED: protein angel homolog 2 isoform X3    79.0    5e-12    
ref|XP_010371246.1|  PREDICTED: protein angel homolog 2 isoform X2    79.0    6e-12    
ref|XP_009236040.1|  PREDICTED: protein angel homolog 2 isoform X3    79.0    6e-12    
ref|XP_009197301.1|  PREDICTED: protein angel homolog 2 isoform X2    79.0    6e-12    
ref|XP_005540868.1|  PREDICTED: protein angel homolog 2 isoform X2    78.6    6e-12    
ref|XP_006834076.1|  PREDICTED: protein angel homolog 2               79.0    7e-12    
ref|XP_007109815.1|  PREDICTED: protein angel homolog 2 isoform X2    78.6    7e-12    
ref|NP_001287684.1|  protein angel homolog 2 isoform b                78.2    7e-12    
ref|XP_007109814.1|  PREDICTED: protein angel homolog 2 isoform X1    78.6    7e-12    
ref|XP_005540867.1|  PREDICTED: protein angel homolog 2 isoform X1    78.6    7e-12    
ref|XP_004017298.1|  PREDICTED: nocturnin                             60.8    8e-12    
ref|XP_003918849.1|  PREDICTED: protein angel homolog 2 isoform X1    78.6    8e-12    
ref|XP_007950855.1|  PREDICTED: protein angel homolog 2               78.6    8e-12    
ref|XP_010371245.1|  PREDICTED: protein angel homolog 2 isoform X1    78.6    8e-12    
gb|EHH50549.1|  hypothetical protein EGM_01402                        78.6    8e-12    
ref|XP_010188353.1|  PREDICTED: protein angel homolog 1               77.8    8e-12    
ref|XP_010597693.1|  PREDICTED: protein angel homolog 2 isoform X1    78.2    9e-12    
dbj|BAH11783.1|  unnamed protein product                              77.8    9e-12    
ref|XP_004613103.1|  PREDICTED: protein angel homolog 2               78.2    1e-11    
ref|XP_004494306.1|  PREDICTED: carbon catabolite repressor prote...  78.2    1e-11    
ref|XP_005962095.1|  PREDICTED: nocturnin isoform X1                  60.8    1e-11    



>ref|XP_010916359.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X3 [Elaeis guineensis]
Length=457

 Score =   284 bits (727),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 196/272 (72%), Gaps = 9/272 (3%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECS----NDSNALTSEDMSSQSFLVG  1127
             E  FTLLH+E IEF +FGLR+NVAQ C+FK      +     D++   +E  S ++ LV 
Sbjct  178   EEEFTLLHQEDIEFRKFGLRDNVAQLCLFKVSHNNSNMSKNKDASCQIAEPRSCRTLLVV  237

Query  1126  NIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKL  947
             NIHVLFNP RGDIKLGQIR+L+E A +LSQE+G  P+V++GDLNSMP+SA+YQF TSS++
Sbjct  238   NIHVLFNPNRGDIKLGQIRVLLERANKLSQEYGKTPVVISGDLNSMPQSAIYQFFTSSEI  297

Query  946   DIRMHERIHISGQIDPSVKPTYRFKSVPAARARK----PLMHRWTDEELRLATGTVS-VH  782
             DI  ++R  ISGQI+  ++         A R  K     + ++W++EE+RLA G+    H
Sbjct  298   DILAYDRKKISGQIEFPLRQMPVIAQNDALRTPKCISYGMKYKWSEEEIRLAAGSRGYTH  357

Query  781   LLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpV  602
             L + LKLCSAY G+PG   TRDD GEPLATS+HSKF+GTVDYIWH++ LVP+ V++ LP+
Sbjct  358   LQNPLKLCSAYQGIPGHDNTRDDNGEPLATSYHSKFMGTVDYIWHSSALVPVAVVETLPI  417

Query  601   NILRRTRGLPSEEWGSDHLALVCELAFAGEGD  506
             N+L+R  GLPSE WGSDHLALVC+ AF  + +
Sbjct  418   NVLKRLGGLPSERWGSDHLALVCKFAFVDDAN  449


 Score =   154 bits (388),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  +D F+ VSYN+L VENA KHPDLY  + P+ ++WD RK+ + KE+  
Sbjct  72    RQWVFSPRDLSAFRDRFIIVSYNILGVENASKHPDLYDRIDPQHLNWDTRKKQIHKELTC  131

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVDR++DL  LLQKDGF GVY+ RTG++ DGCAIFWK E + L
Sbjct  132   YNPSILCFQEVDRFNDLAYLLQKDGFVGVYKGRTGEASDGCAIFWKEEEFTL  183



>ref|XP_010916358.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Elaeis guineensis]
Length=458

 Score =   284 bits (727),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 196/272 (72%), Gaps = 9/272 (3%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECS----NDSNALTSEDMSSQSFLVG  1127
             E  FTLLH+E IEF +FGLR+NVAQ C+FK      +     D++   +E  S ++ LV 
Sbjct  179   EEEFTLLHQEDIEFRKFGLRDNVAQLCLFKVSHNNSNMSKNKDASCQIAEPRSCRTLLVV  238

Query  1126  NIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKL  947
             NIHVLFNP RGDIKLGQIR+L+E A +LSQE+G  P+V++GDLNSMP+SA+YQF TSS++
Sbjct  239   NIHVLFNPNRGDIKLGQIRVLLERANKLSQEYGKTPVVISGDLNSMPQSAIYQFFTSSEI  298

Query  946   DIRMHERIHISGQIDPSVKPTYRFKSVPAARARK----PLMHRWTDEELRLATGTVS-VH  782
             DI  ++R  ISGQI+  ++         A R  K     + ++W++EE+RLA G+    H
Sbjct  299   DILAYDRKKISGQIEFPLRQMPVIAQNDALRTPKCISYGMKYKWSEEEIRLAAGSRGYTH  358

Query  781   LLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpV  602
             L + LKLCSAY G+PG   TRDD GEPLATS+HSKF+GTVDYIWH++ LVP+ V++ LP+
Sbjct  359   LQNPLKLCSAYQGIPGHDNTRDDNGEPLATSYHSKFMGTVDYIWHSSALVPVAVVETLPI  418

Query  601   NILRRTRGLPSEEWGSDHLALVCELAFAGEGD  506
             N+L+R  GLPSE WGSDHLALVC+ AF  + +
Sbjct  419   NVLKRLGGLPSERWGSDHLALVCKFAFVDDAN  450


 Score =   149 bits (376),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  +D F+ VSYN+L VENA KHPDLY  + P+ ++WD RK+ + KE+  
Sbjct  72    RQWVFSPRDLSAFRDRFIIVSYNILGVENASKHPDLYDRIDPQHLNWDTRKKQIHKELTC  131

Query  1571  YNPGIMCF-QEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CF QEVDR++DL  LLQKDGF GVY+ RTG++ DGCAIFWK E + L
Sbjct  132   YNPSILCFQQEVDRFNDLAYLLQKDGFVGVYKGRTGEASDGCAIFWKEEEFTL  184



>ref|XP_008797847.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X3 [Phoenix dactylifera]
Length=458

 Score =   280 bits (716),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 195/276 (71%), Gaps = 17/276 (6%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--------S  1139
             E  FTLLH E IEF +FGLR+NVAQ C+FK       N SN   ++D S Q        +
Sbjct  178   EEEFTLLHHEDIEFRKFGLRDNVAQLCLFKVSH----NHSNMSKNKDASCQIAAPRPCQT  233

Query  1138  FLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLT  959
              LVGNIHVLFNPKRGDIKLGQ+R+L++ A  LSQE+GN P+V++GDLNSMP+SA+YQF T
Sbjct  234   LLVGNIHVLFNPKRGDIKLGQVRVLLQRANTLSQEYGNTPVVISGDLNSMPQSAIYQFFT  293

Query  958   SSKLDIRMHERIHISGQIDPSVKPTYRFKSVPAARARKPLMHR----WTDEELRLATGTV  791
             SS+LDI  ++R  ISGQI+  V+         A R  K + +R    W++EE+ LA G+ 
Sbjct  294   SSELDILAYDRKKISGQIEFPVRQMPFIARNDALRTPKCISYRMKYKWSEEEIHLAAGSR  353

Query  790   S-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvld  614
                 L + LKLCSAY G+PG   TRD  GEPLATS+HSKF+GTVDYIWH++ LVP+ V++
Sbjct  354   GCTRLQNPLKLCSAYQGIPGHDNTRDGNGEPLATSYHSKFMGTVDYIWHSSALVPVGVVE  413

Query  613   plpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGD  506
              LP+N+L+R  GLPSE+WGSDHLALVC+ AF  + +
Sbjct  414   TLPINVLKRLGGLPSEKWGSDHLALVCKFAFVDDAN  449


 Score =   153 bits (386),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  +D FV VSYN+L VENA +H DLY  + P+ + WD RK+ + KE+  
Sbjct  72    RQWVFSPRDLSSFRDSFVIVSYNILGVENASEHVDLYDKINPQHLSWDTRKRQIHKELSC  131

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVDR++DL NLLQKDGF GVY+ RTG + DGCAIFWK E + L
Sbjct  132   YNPSILCFQEVDRFNDLANLLQKDGFVGVYKGRTGQASDGCAIFWKEEEFTL  183



>ref|XP_008797844.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Phoenix dactylifera]
Length=474

 Score =   273 bits (698),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/293 (52%), Positives = 197/293 (67%), Gaps = 35/293 (12%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--------S  1139
             E  FTLLH E IEF +FGLR+NVAQ C+FK       N SN   ++D S Q        +
Sbjct  178   EEEFTLLHHEDIEFRKFGLRDNVAQLCLFKVSH----NHSNMSKNKDASCQIAAPRPCQT  233

Query  1138  FLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLT  959
              LVGNIHVLFNPKRGDIKLGQ+R+L++ A  LSQE+GN P+V++GDLNSMP+SA+YQF T
Sbjct  234   LLVGNIHVLFNPKRGDIKLGQVRVLLQRANTLSQEYGNTPVVISGDLNSMPQSAIYQFFT  293

Query  958   SSKLDIRMHERIHISGQIDPSV---------------------KPTYRFKSVPAARARKP  842
             SS+LDI  ++R  ISGQI+  V                     K +Y     P   + + 
Sbjct  294   SSELDILAYDRKKISGQIEFPVRQMPFIARNDALSISNLLNRAKASYLSCRTPKCISYR-  352

Query  841   LMHRWTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGT  665
             + ++W++EE+ LA G+     L + LKLCSAY G+PG   TRD  GEPLATS+HSKF+GT
Sbjct  353   MKYKWSEEEIHLAAGSRGCTRLQNPLKLCSAYQGIPGHDNTRDGNGEPLATSYHSKFMGT  412

Query  664   VDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGD  506
             VDYIWH++ LVP+ V++ LP+N+L+R  GLPSE+WGSDHLALVC+ AF  + +
Sbjct  413   VDYIWHSSALVPVGVVETLPINVLKRLGGLPSEKWGSDHLALVCKFAFVDDAN  465


 Score =   153 bits (387),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  +D FV VSYN+L VENA +H DLY  + P+ + WD RK+ + KE+  
Sbjct  72    RQWVFSPRDLSSFRDSFVIVSYNILGVENASEHVDLYDKINPQHLSWDTRKRQIHKELSC  131

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVDR++DL NLLQKDGF GVY+ RTG + DGCAIFWK E + L
Sbjct  132   YNPSILCFQEVDRFNDLANLLQKDGFVGVYKGRTGQASDGCAIFWKEEEFTL  183



>ref|XP_008797846.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   273 bits (697),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 195/285 (68%), Gaps = 26/285 (9%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--------S  1139
             E  FTLLH E IEF +FGLR+NVAQ C+FK       N SN   ++D S Q        +
Sbjct  178   EEEFTLLHHEDIEFRKFGLRDNVAQLCLFKVSH----NHSNMSKNKDASCQIAAPRPCQT  233

Query  1138  FLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKS-------  980
              LVGNIHVLFNPKRGDIKLGQ+R+L++ A  LSQE+GN P+V++GDLNSMP+S       
Sbjct  234   LLVGNIHVLFNPKRGDIKLGQVRVLLQRANTLSQEYGNTPVVISGDLNSMPQSYASLLMT  293

Query  979   --AVYQFLTSSKLDIRMHERIHISGQIDPSVKPTYRFKSVPAARARKPLMHR----WTDE  818
               A+YQF TSS+LDI  ++R  ISGQI+  V+         A R  K + +R    W++E
Sbjct  294   QSAIYQFFTSSELDILAYDRKKISGQIEFPVRQMPFIARNDALRTPKCISYRMKYKWSEE  353

Query  817   ELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTA  641
             E+ LA G+     L + LKLCSAY G+PG   TRD  GEPLATS+HSKF+GTVDYIWH++
Sbjct  354   EIHLAAGSRGCTRLQNPLKLCSAYQGIPGHDNTRDGNGEPLATSYHSKFMGTVDYIWHSS  413

Query  640   ElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGD  506
              LVP+ V++ LP+N+L+R  GLPSE+WGSDHLALVC+ AF  + +
Sbjct  414   ALVPVGVVETLPINVLKRLGGLPSEKWGSDHLALVCKFAFVDDAN  458


 Score =   153 bits (387),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  +D FV VSYN+L VENA +H DLY  + P+ + WD RK+ + KE+  
Sbjct  72    RQWVFSPRDLSSFRDSFVIVSYNILGVENASEHVDLYDKINPQHLSWDTRKRQIHKELSC  131

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVDR++DL NLLQKDGF GVY+ RTG + DGCAIFWK E + L
Sbjct  132   YNPSILCFQEVDRFNDLANLLQKDGFVGVYKGRTGQASDGCAIFWKEEEFTL  183



>ref|NP_683491.2| DNAse I-like superfamily protein [Arabidopsis thaliana]
 sp|Q0WKY2.2|CCR4E_ARATH RecName: Full=Carbon catabolite repressor protein 4 homolog 5; 
Short=CCR4 homolog 5 [Arabidopsis thaliana]
 gb|AEE35519.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
Length=454

 Score =   285 bits (729),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 193/268 (72%), Gaps = 12/268 (4%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNA-LTSEDMSSQSFLVGNIH  1118
             E  F LL  + IEF++FG+RNNVAQ CV +     C  D  + L       +  +VGNIH
Sbjct  190   ENLFELLDHQHIEFDKFGMRNNVAQLCVLEMN---CEEDPKSKLRVRSSDPRRLVVGNIH  246

Query  1117  VLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIR  938
             VLFNPKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD +
Sbjct  247   VLFNPKRGDIKLGQVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQ  306

Query  937   MHERIHISGQ--IDP---SVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLL  776
             +H+R  ISGQ  ++P   S +  Y F +  +A     L++ W+ EEL+LATG   + H+ 
Sbjct  307   LHDRRQISGQTEVEPKERSFRNHYAFSA--SASISGSLLNEWSQEELQLATGGQETTHVQ  364

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             HQLKL SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++
Sbjct  365   HQLKLNSAYSGVPGTYRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPADV  424

Query  595   LRRTRGLPSEEWGSDHLALVCELAFAGE  512
             LRRT GLPSE WGSDHLA+ CEL F  +
Sbjct  425   LRRTGGLPSENWGSDHLAIACELGFVND  452


 Score =   139 bits (350),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  +  D  V VSYNLL V+NA  H DLY NV  + ++W  RK ++CKEI  
Sbjct  84    REWVFSANNFENLADKLVLVSYNLLGVDNASNHMDLYYNVPRKHLEWSRRKHLICKEISR  143

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD LL+  GFRGV++ RTG++ DGCAIFWK  L++L
Sbjct  144   YNASILCLQEVDRFDDLDVLLKNRGFRGVHKSRTGEASDGCAIFWKENLFEL  195



>ref|XP_006341614.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X1 [Solanum tuberosum]
Length=456

 Score =   342 bits (876),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 210/262 (80%), Gaps = 10/262 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F +LH+ESIEF+ F LRNNV Q C FK   K  S D +A  SE ++S SFLVGNIHVL+N
Sbjct  205   FDILHEESIEFQNFNLRNNVCQLCAFKMNVKSSSKDMSASNSESVTSPSFLVGNIHVLYN  264

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E+AQRLS EWG+IP+VLAGDLNSMP+SA+YQFLTS+KLDI+MH+R
Sbjct  265   PNRGDIKLGQVRLFLESAQRLSHEWGDIPVVLAGDLNSMPQSAMYQFLTSNKLDIQMHDR  324

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAYA  746
               ISGQI P    ++  +          L +RW++EEL LATGT + HL+HQL+L SAYA
Sbjct  325   KQISGQIYPLQNRSFNPR----------LSYRWSNEELMLATGTGASHLIHQLQLRSAYA  374

Query  745   GVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSE  566
             G PG+S+TR++ GEPLATS+HSKF+GTVDYIWHT E VP+RVLD LPV+ILRRTRGLPSE
Sbjct  375   GAPGSSRTRENSGEPLATSYHSKFMGTVDYIWHTTEFVPVRVLDTLPVDILRRTRGLPSE  434

Query  565   EWGSDHLALVCELAFAGEGDET  500
             +WGSDHL+LVCELAF  EG ET
Sbjct  435   KWGSDHLSLVCELAFTDEGSET  456


 Score =   190 bits (482),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = -2

Query  2045  MGRFTGGEMPPAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNS  1866
             MGR   G  PPA++ ++   S K +  +++  +   +KK+RV+  +TE  + TL+     
Sbjct  1     MGRTGDGRDPPAEQPSRFSASMKSRISQHDIGKHRSKKKQRVSISKTETETATLT----L  56

Query  1865  NRTSTSHMHAYAHANYhrggehrgkrkrqRPP-ANTVDRRKWVYSPRDVSHCKDGFVFVS  1689
             N TSTS+ H+YA++  +     + KR + +   A   D+RKWVYS   VS  +D  VF+S
Sbjct  57    NHTSTSYTHSYANSYSYSYSRGKEKRHKGKAKRAIADDKRKWVYSTHVVSPNQDRVVFMS  116

Query  1688  YNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLL  1509
             YN+L V+NA  H DLY NV P+ +DWDYRK+++CKEIR YNPGIMCFQEVDR+DDLD LL
Sbjct  117   YNILGVKNAAAHEDLYRNVSPKYLDWDYRKKLICKEIRDYNPGIMCFQEVDRFDDLDYLL  176

Query  1508  QKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             QK+GF+GVYQ RTGD+ DGCAIFW ++L+D+
Sbjct  177   QKEGFKGVYQARTGDASDGCAIFWNSKLFDI  207



>ref|XP_010663593.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Vitis vinifera]
Length=463

 Score =   340 bits (871),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 218/264 (83%), Gaps = 3/264 (1%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             FTLLH+E+IEF+ FGLR+NVAQ CV K  R + ++D +   S+   ++S +VGNIHVLFN
Sbjct  201   FTLLHQENIEFQNFGLRHNVAQLCVLKMNRNQSNSDVDTKASQIPPTRSLIVGNIHVLFN  260

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E A +LSQEWG IP+VLAGDLNSMP+SA+YQFL SS+LD+R+H+R
Sbjct  261   PNRGDIKLGQMRLFLEKAHKLSQEWGCIPVVLAGDLNSMPQSALYQFLASSELDVRLHDR  320

Query  925   IHISGQID-PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLCSA  752
               ISGQ++  S    YR+++  A+R+R PL+HRW++EELRLATG+  V HL H LKLCSA
Sbjct  321   RKISGQVEHQSQHRAYRYQNEDASRSR-PLVHRWSNEELRLATGSDGVTHLQHCLKLCSA  379

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y G+PG+ +TRD+ GEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LPV+ILR+T GLP
Sbjct  380   YYGIPGSCRTRDNYGEPLATSYHSKFMGTVDYIWHTEELVPVRVLETLPVDILRKTGGLP  439

Query  571   SEEWGSDHLALVCELAFAGEGDET  500
             SE+WGSDHLALVCELAFA +G  +
Sbjct  440   SEKWGSDHLALVCELAFADDGSSS  463


 Score =   154 bits (390),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A T   R+WV+S RD+S  KD  V VSYN+L VENA  HPDLY  V  +L+DW+ R++++
Sbjct  86    ATTEAHRRWVFSTRDLSDYKDKVVVVSYNILGVENASNHPDLYSKVPTKLLDWNRRRKLI  145

Query  1589  CKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              KEI  YNP I+CFQEVDR++DL+NLL+K GF+GVY+ RTG++ DGCA+FWK++L+ L
Sbjct  146   NKEINQYNPSILCFQEVDRFNDLNNLLKKGGFKGVYKARTGEAYDGCAMFWKDDLFTL  203



>ref|XP_010916357.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Elaeis guineensis]
Length=462

 Score =   256 bits (653),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 181/252 (72%), Gaps = 9/252 (4%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECS----NDSNALTSEDMSSQSFLVG  1127
             E  FTLLH+E IEF +FGLR+NVAQ C+FK      +     D++   +E  S ++ LV 
Sbjct  178   EEEFTLLHQEDIEFRKFGLRDNVAQLCLFKVSHNNSNMSKNKDASCQIAEPRSCRTLLVV  237

Query  1126  NIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKL  947
             NIHVLFNP RGDIKLGQIR+L+E A +LSQE+G  P+V++GDLNSMP+SA+YQF TSS++
Sbjct  238   NIHVLFNPNRGDIKLGQIRVLLERANKLSQEYGKTPVVISGDLNSMPQSAIYQFFTSSEI  297

Query  946   DIRMHERIHISGQIDPSVKPTYRFKSVPAARARK----PLMHRWTDEELRLATGTVS-VH  782
             DI  ++R  ISGQI+  ++         A R  K     + ++W++EE+RLA G+    H
Sbjct  298   DILAYDRKKISGQIEFPLRQMPVIAQNDALRTPKCISYGMKYKWSEEEIRLAAGSRGYTH  357

Query  781   LLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpV  602
             L + LKLCSAY G+PG   TRDD GEPLATS+HSKF+GTVDYIWH++ LVP+ V++ LP+
Sbjct  358   LQNPLKLCSAYQGIPGHDNTRDDNGEPLATSYHSKFMGTVDYIWHSSALVPVAVVETLPI  417

Query  601   NILRRTRGLPSE  566
             N+L+R  GLPSE
Sbjct  418   NVLKRLGGLPSE  429


 Score =   154 bits (389),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  +D F+ VSYN+L VENA KHPDLY  + P+ ++WD RK+ + KE+  
Sbjct  72    RQWVFSPRDLSAFRDRFIIVSYNILGVENASKHPDLYDRIDPQHLNWDTRKKQIHKELTC  131

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVDR++DL  LLQKDGF GVY+ RTG++ DGCAIFWK E + L
Sbjct  132   YNPSILCFQEVDRFNDLAYLLQKDGFVGVYKGRTGEASDGCAIFWKEEEFTL  183



>emb|CDO98437.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   339 bits (869),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 212/264 (80%), Gaps = 3/264 (1%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
              TLLH+ES+EF+ FGLRNNV+Q C+F+  + +   D N+   +  SS++FLVGNIHVLFN
Sbjct  213   LTLLHEESLEFQTFGLRNNVSQLCIFRMNQSQLLMDMNSQAPKYSSSRTFLVGNIHVLFN  272

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E AQ+LSQEWG IP+V+AGDLNSMP+SA+YQFLTSS+LD++ H+R
Sbjct  273   PSRGDIKLGQMRLFLEKAQKLSQEWGGIPVVIAGDLNSMPQSAMYQFLTSSELDVQQHDR  332

Query  925   IHISGQIDPSVKPTYRFKSVPAA---RARKPLMHRWTDEELRLATGTVSVHLLHQLKLCS  755
               ISGQI P   P++  +S  AA    ++KPLMHRW+ +ELRLA G+   H+ H LKLCS
Sbjct  333   KQISGQICPLENPSFDCRSSHAASFYSSKKPLMHRWSQDELRLAAGSAVSHVRHPLKLCS  392

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             AY GVPG++++R+++GEPLATS+HSKF+GTVDYIWHT EL+P++VL+ LP+N L+ T GL
Sbjct  393   AYVGVPGSTRSRNNIGEPLATSYHSKFMGTVDYIWHTGELLPVKVLETLPINRLKETGGL  452

Query  574   PSEEWGSDHLALVCELAFAGEGDE  503
             PS+ WGSDHLAL CELAFA  G E
Sbjct  453   PSKRWGSDHLALACELAFADRGTE  476


 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 134/212 (63%), Gaps = 18/212 (8%)
 Frame = -2

Query  2015  PAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQT--EAHSETLSLADNSNRTSTSHM  1842
             P  E +  P S+KRKT + N       +K ++ A +T  E+  ETL+L     R ST   
Sbjct  10    PTAEQSPPPKSAKRKTSQLNHHYHHTSRKEKLIASKTGTESEIETLTL----TRCSTVST  65

Query  1841  HAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENA  1662
               +     HR  +HR KR  + P   T D R+W YS RD S+CKD  + VSYN+L VENA
Sbjct  66    ANFTSHQIHRKQKHRRKRTSKLPI--TGDYRQWSYSTRDFSYCKDRVLLVSYNILGVENA  123

Query  1661  KKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQ----------EVDRYDDLDNL  1512
              KHPDLY N+ P+ +DWDYRK++L KEI+ Y PG++CFQ          EVDR+DDLD+L
Sbjct  124   AKHPDLYSNISPKYLDWDYRKRLLHKEIKNYKPGVICFQAISYSLRALTEVDRFDDLDDL  183

Query  1511  LQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             L++DGFRGVY+ RTG++ DGCAIFW NEL  L
Sbjct  184   LKRDGFRGVYKARTGEASDGCAIFWNNELLTL  215



>ref|XP_009403959.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=438

 Score =   262 bits (670),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 196/268 (73%), Gaps = 15/268 (6%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSN--DSNALTS-EDMSSQSFLVGN  1124
             E  FTLL++E IEF++FGLRNNVAQ C+ K    + ++  D +A +  E +S ++ LVGN
Sbjct  162   EKEFTLLYQEDIEFQKFGLRNNVAQLCLLKVSLNQSNDQVDKDAGSEIEPVSCRTLLVGN  221

Query  1123  IHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLD  944
             IHVLFNP RGDIKLGQ+R+L+E A  LS+++GN P+V++GDLNS PKSA+ QFLTS++LD
Sbjct  222   IHVLFNPNRGDIKLGQMRVLLERANTLSKQYGNTPVVISGDLNSTPKSAICQFLTSNELD  281

Query  943   IRMHERIHISGQID-PSVKPTY-----RFKSVPAARARKPLMHRWTDEELRLATGTVS-V  785
             I  ++R +ISGQI+ P  + TY     RF+ + + +       RW++EE+ LA+G     
Sbjct  282   ILQYDRKNISGQIEYPVRQMTYAIQHDRFRCMASQQK-----FRWSEEEVCLASGRRGCT  336

Query  784   HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplp  605
              L + L L SAY GVPG   TRD+ GEPLATS HSKF+GTVDYIWH++ LVP+ V+D L 
Sbjct  337   RLQNPLTLSSAYRGVPGNLHTRDENGEPLATSCHSKFMGTVDYIWHSSALVPVGVVDTLT  396

Query  604   VNILRRTRGLPSEEWGSDHLALVCELAF  521
             + +LRR RGLPS++WGSDHLALVC+ AF
Sbjct  397   IKVLRRLRGLPSKKWGSDHLALVCKFAF  424


 Score =   147 bits (370),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  K+ FV VSYN+L VENA KH DLY ++  E + WD RK+ + KE+R 
Sbjct  56    RQWVFSPRDLSSFKERFVIVSYNILGVENALKHLDLYDSIPSECLSWDLRKRRMHKELRS  115

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVD++DDL +L ++DG+ G+Y+ RTG++ DGCAIFWK + + L
Sbjct  116   YNPSILCFQEVDKFDDLADLFREDGYTGIYKQRTGEATDGCAIFWKEKEFTL  167



>ref|XP_010663592.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Vitis vinifera]
Length=468

 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 218/269 (81%), Gaps = 8/269 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             FTLLH+E+IEF+ FGLR+NVAQ CV K  R + ++D +   S+   ++S +VGNIHVLFN
Sbjct  201   FTLLHQENIEFQNFGLRHNVAQLCVLKMNRNQSNSDVDTKASQIPPTRSLIVGNIHVLFN  260

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E A +LSQEWG IP+VLAGDLNSMP+SA+YQFL SS+LD+R+H+R
Sbjct  261   PNRGDIKLGQMRLFLEKAHKLSQEWGCIPVVLAGDLNSMPQSALYQFLASSELDVRLHDR  320

Query  925   IHISGQID-PSVKPTYRFKSVPA-----ARARKPLMHRWTDEELRLATGTVSV-HLLHQL  767
               ISGQ++  S    YR+++  A     +R+R PL+HRW++EELRLATG+  V HL H L
Sbjct  321   RKISGQVEHQSQHRAYRYQNEDASSFCMSRSR-PLVHRWSNEELRLATGSDGVTHLQHCL  379

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KLCSAY G+PG+ +TRD+ GEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LPV+ILR+
Sbjct  380   KLCSAYYGIPGSCRTRDNYGEPLATSYHSKFMGTVDYIWHTEELVPVRVLETLPVDILRK  439

Query  586   TRGLPSEEWGSDHLALVCELAFAGEGDET  500
             T GLPSE+WGSDHLALVCELAFA +G  +
Sbjct  440   TGGLPSEKWGSDHLALVCELAFADDGSSS  468


 Score =   154 bits (390),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A T   R+WV+S RD+S  KD  V VSYN+L VENA  HPDLY  V  +L+DW+ R++++
Sbjct  86    ATTEAHRRWVFSTRDLSDYKDKVVVVSYNILGVENASNHPDLYSKVPTKLLDWNRRRKLI  145

Query  1589  CKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              KEI  YNP I+CFQEVDR++DL+NLL+K GF+GVY+ RTG++ DGCA+FWK++L+ L
Sbjct  146   NKEINQYNPSILCFQEVDRFNDLNNLLKKGGFKGVYKARTGEAYDGCAMFWKDDLFTL  203



>ref|XP_010318609.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Solanum lycopersicum]
Length=502

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 176/263 (67%), Positives = 211/263 (80%), Gaps = 10/263 (4%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +LH+ESIEF+ F LRNNV Q CVFK   K  + D +A  SE +SS SFLVGNIHVL+
Sbjct  250   RFDILHEESIEFQNFNLRNNVCQLCVFKMNVKSSTKDVSASNSESVSSPSFLVGNIHVLY  309

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGDIKLGQ+RL +E+AQRLS EWG+IP+VLAGDLNSMP+SA+YQFLTS+KLDI+MH+
Sbjct  310   NPNRGDIKLGQVRLFLESAQRLSHEWGDIPVVLAGDLNSMPQSAMYQFLTSNKLDIQMHD  369

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAY  749
             R  ISGQI P    ++  +          L +RW++EEL LATGT +  L+HQL+L SAY
Sbjct  370   RKQISGQIYPLQNRSFNPR----------LSYRWSNEELLLATGTGASQLIHQLQLRSAY  419

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPS  569
             AG PG+S+TR++ GEPLATS+HSKFLGTVDYIWHT E VP+RVLD LPV+ILRRT GLPS
Sbjct  420   AGAPGSSRTRENSGEPLATSYHSKFLGTVDYIWHTTEFVPVRVLDTLPVDILRRTGGLPS  479

Query  568   EEWGSDHLALVCELAFAGEGDET  500
             E+WGSDHL+LVCELAFA EG ET
Sbjct  480   EKWGSDHLSLVCELAFADEGSET  502


 Score =   187 bits (476),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 143/208 (69%), Gaps = 6/208 (3%)
 Frame = -2

Query  2045  MGRFTGGEMPPAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNS  1866
             MGR   G   PA++ ++  ++ K +  +++  +   +KK+RV+  +TE  S T++L    
Sbjct  1     MGRTGDGRDQPAEQPSRF-SAMKSRIRQHDIGKHRSKKKQRVSIRKTETESATVTL----  55

Query  1865  NRTSTSHMHAYAHANYhrggehrgkrkrqRPP-ANTVDRRKWVYSPRDVSHCKDGFVFVS  1689
             N TSTS+ H+YA++  +     + KR + +   A   D+RKWVYS  DVS  +D  + +S
Sbjct  56    NHTSTSYTHSYANSYSYSYSRGKEKRHKGKAKRAIADDKRKWVYSTHDVSPNQDRVILMS  115

Query  1688  YNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLL  1509
             YN+L V+NA  H DLY NV P+ +DWDYRK+++CKEIR YNP IMCFQEVDR+DDLD LL
Sbjct  116   YNILGVKNAAAHEDLYRNVSPKYLDWDYRKKLICKEIRDYNPDIMCFQEVDRFDDLDYLL  175

Query  1508  QKDGFRGVYQPRTGDSCDGCAIFWKNEL  1425
             QK+GF+GVYQ RTGD+ DGCAIFW N+L
Sbjct  176   QKEGFKGVYQARTGDASDGCAIFWNNKL  203



>ref|XP_004235772.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Solanum lycopersicum]
Length=455

 Score =   327 bits (838),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/262 (67%), Positives = 210/262 (80%), Gaps = 10/262 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F +LH+ESIEF+ F LRNNV Q CVFK   K  + D +A  SE +SS SFLVGNIHVL+N
Sbjct  204   FDILHEESIEFQNFNLRNNVCQLCVFKMNVKSSTKDVSASNSESVSSPSFLVGNIHVLYN  263

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E+AQRLS EWG+IP+VLAGDLNSMP+SA+YQFLTS+KLDI+MH+R
Sbjct  264   PNRGDIKLGQVRLFLESAQRLSHEWGDIPVVLAGDLNSMPQSAMYQFLTSNKLDIQMHDR  323

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAYA  746
               ISGQI P    ++  +          L +RW++EEL LATGT +  L+HQL+L SAYA
Sbjct  324   KQISGQIYPLQNRSFNPR----------LSYRWSNEELLLATGTGASQLIHQLQLRSAYA  373

Query  745   GVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSE  566
             G PG+S+TR++ GEPLATS+HSKFLGTVDYIWHT E VP+RVLD LPV+ILRRT GLPSE
Sbjct  374   GAPGSSRTRENSGEPLATSYHSKFLGTVDYIWHTTEFVPVRVLDTLPVDILRRTGGLPSE  433

Query  565   EWGSDHLALVCELAFAGEGDET  500
             +WGSDHL+LVCELAFA EG ET
Sbjct  434   KWGSDHLSLVCELAFADEGSET  455


 Score =   192 bits (489),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 146/211 (69%), Gaps = 6/211 (3%)
 Frame = -2

Query  2045  MGRFTGGEMPPAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNS  1866
             MGR   G   PA++ ++  ++ K +  +++  +   +KK+RV+  +TE  S T++L    
Sbjct  1     MGRTGDGRDQPAEQPSRF-SAMKSRIRQHDIGKHRSKKKQRVSIRKTETESATVTL----  55

Query  1865  NRTSTSHMHAYAHANYhrggehrgkrkrqRPP-ANTVDRRKWVYSPRDVSHCKDGFVFVS  1689
             N TSTS+ H+YA++  +     + KR + +   A   D+RKWVYS  DVS  +D  + +S
Sbjct  56    NHTSTSYTHSYANSYSYSYSRGKEKRHKGKAKRAIADDKRKWVYSTHDVSPNQDRVILMS  115

Query  1688  YNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLL  1509
             YN+L V+NA  H DLY NV P+ +DWDYRK+++CKEIR YNP IMCFQEVDR+DDLD LL
Sbjct  116   YNILGVKNAAAHEDLYRNVSPKYLDWDYRKKLICKEIRDYNPDIMCFQEVDRFDDLDYLL  175

Query  1508  QKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             QK+GF+GVYQ RTGD+ DGCAIFW N+L+D+
Sbjct  176   QKEGFKGVYQARTGDASDGCAIFWNNKLFDI  206



>ref|XP_004512931.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
[Cicer arietinum]
Length=421

 Score =   320 bits (820),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 217/272 (80%), Gaps = 12/272 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHVL  1112
             F+LLH+E IEF++FGLRNNVAQ CV +       +D++ LT+E+ S++   FL+GN HVL
Sbjct  146   FSLLHQEDIEFQKFGLRNNVAQLCVLEVNHDNPESDTSKLTTEEQSTRKKRFLIGNTHVL  205

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQIRLL++ A +LSQEWGNIP++LAGDLNS+P+SA+Y+FL+SSKLDIR+H
Sbjct  206   FNPNRGDIKLGQIRLLIDQAYKLSQEWGNIPVILAGDLNSVPQSAIYEFLSSSKLDIRLH  265

Query  931   ERIHISGQIDPSVKPTYR-FKSVPAARA------RKPLMHRWTDEELRLATGTVSV-HLL  776
             +R ++SGQ++  ++P  R F+S     A       + L+H+W+ EEL LATG   V  L 
Sbjct  266   DRRNMSGQLE--IRPNDRVFRSKIGDDASISMSVSRQLLHKWSAEELILATGAKGVTRLK  323

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             HQLKL SAY+GVPG  +TRDD+GEPLATS+HSKF+GTVDYIWH+ +L+P+RVL+ LPV++
Sbjct  324   HQLKLRSAYSGVPGKHRTRDDIGEPLATSYHSKFMGTVDYIWHSEDLIPIRVLETLPVDV  383

Query  595   LRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
             LRRTRGLP+E+WGSDHLA+VCELAFA   + +
Sbjct  384   LRRTRGLPNEKWGSDHLAVVCELAFAKSAESS  415


 Score =   123 bits (309),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S  D S C D  V VSYN+L VENA  H DLY N+    ++W  RK+++ +EI  
Sbjct  37    RKWVFSSEDCSDCTDTIVVVSYNILGVENASNHLDLYSNIPRRFLEWGRRKRLILEEIDS  96

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVD +DDLD+L + +GF+ VY+ RTG++ DGCAIFWK++L+ L
Sbjct  97    YNANILCFQEVDHFDDLDDLFKNNGFKSVYKGRTGEANDGCAIFWKDKLFSL  148



>ref|XP_009403960.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   241 bits (614),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 186/268 (69%), Gaps = 26/268 (10%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSN--DSNALTS-EDMSSQSFLVGN  1124
             E  FTLL++E IEF++FGLRNNVAQ C+ K    + ++  D +A +  E +S ++ LVGN
Sbjct  162   EKEFTLLYQEDIEFQKFGLRNNVAQLCLLKVSLNQSNDQVDKDAGSEIEPVSCRTLLVGN  221

Query  1123  IHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLD  944
             IHVLFNP RGDIKLGQ+R+L+E A  LS+++GN P+V++GDLNS PK           LD
Sbjct  222   IHVLFNPNRGDIKLGQMRVLLERANTLSKQYGNTPVVISGDLNSTPK-----------LD  270

Query  943   IRMHERIHISGQID-PSVKPTY-----RFKSVPAARARKPLMHRWTDEELRLATGTVS-V  785
             I  ++R +ISGQI+ P  + TY     RF+ + + +       RW++EE+ LA+G     
Sbjct  271   ILQYDRKNISGQIEYPVRQMTYAIQHDRFRCMASQQK-----FRWSEEEVCLASGRRGCT  325

Query  784   HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplp  605
              L + L L SAY GVPG   TRD+ GEPLATS HSKF+GTVDYIWH++ LVP+ V+D L 
Sbjct  326   RLQNPLTLSSAYRGVPGNLHTRDENGEPLATSCHSKFMGTVDYIWHSSALVPVGVVDTLT  385

Query  604   VNILRRTRGLPSEEWGSDHLALVCELAF  521
             + +LRR RGLPS++WGSDHLALVC+ AF
Sbjct  386   IKVLRRLRGLPSKKWGSDHLALVCKFAF  413


 Score =   146 bits (369),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+SPRD+S  K+ FV VSYN+L VENA KH DLY ++  E + WD RK+ + KE+R 
Sbjct  56    RQWVFSPRDLSSFKERFVIVSYNILGVENALKHLDLYDSIPSECLSWDLRKRRMHKELRS  115

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YNP I+CFQEVD++DDL +L ++DG+ G+Y+ RTG++ DGCAIFWK + + L
Sbjct  116   YNPSILCFQEVDKFDDLADLFREDGYTGIYKQRTGEATDGCAIFWKEKEFTL  167



>gb|KEH27037.1| carbon catabolite repressor-like protein [Medicago truncatula]
Length=433

 Score =   319 bits (818),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/260 (61%), Positives = 215/260 (83%), Gaps = 6/260 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHVL  1112
             F+LLH+E IEF++FG+R+NVAQ CV +       +D+  LT+E+ S+++  F++GNIHVL
Sbjct  153   FSLLHQEDIEFQKFGMRHNVAQLCVLEVNNNNPESDTCKLTAEEQSTKNKRFVIGNIHVL  212

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RLL++ A +LSQEWG+IP++LAGDLNS+P+SA+Y+FL+SSKLDI+ H
Sbjct  213   FNPNRGDIKLGQVRLLIDKAYKLSQEWGDIPVILAGDLNSVPQSAIYKFLSSSKLDIQSH  272

Query  931   ERIHISGQIDPSVKPTYR-FKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLC  758
             +R ++SGQ++  ++P +R F+S  +    + L+H+W+ EEL LATG   V  L HQLKL 
Sbjct  273   DRRNMSGQLE--IRPNHREFRSNISMSVSRQLLHKWSAEELILATGAKGVTCLQHQLKLR  330

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY+GVPG  +TRDD+GEPLATS+HSKF+GTVDYIWH+ EL P+RVL+ LPV++LRRTRG
Sbjct  331   SAYSGVPGKHRTRDDIGEPLATSYHSKFMGTVDYIWHSEELTPVRVLETLPVDVLRRTRG  390

Query  577   LPSEEWGSDHLALVCELAFA  518
             LP+E+WGSDHLA+VCELAFA
Sbjct  391   LPTEKWGSDHLAVVCELAFA  410


 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S  D S C D  V VSYN+L VENA  H DLY N+    +DW  RK+++ +EI  
Sbjct  44    RKWVFSSEDYSDCADTIVVVSYNILGVENASNHLDLYSNIPRRFLDWGRRKRLILEEIDS  103

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVD +DDLD+L Q +GF+ VY+ RTG++ DGCAIFWK++L+ L
Sbjct  104   YNASILCFQEVDHFDDLDDLFQNNGFKSVYKGRTGEANDGCAIFWKDKLFSL  155



>ref|XP_006440962.1| hypothetical protein CICLE_v10020074mg [Citrus clementina]
 gb|ESR54202.1| hypothetical protein CICLE_v10020074mg [Citrus clementina]
Length=460

 Score =   317 bits (813),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 200/265 (75%), Gaps = 3/265 (1%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             FTLLH+E+IEF+ FGLR+NVAQ CV K  +    +   +L S    SQS +VGNIHVLFN
Sbjct  196   FTLLHQENIEFQNFGLRHNVAQLCVLKMNQSLLESAEESLLSMVSQSQSLVVGNIHVLFN  255

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQIRL +E A +LSQEWG IP++LAGDLNS P SA+YQFL SS+LD+  H+R
Sbjct  256   PNRGDIKLGQIRLFLEKAYKLSQEWGGIPVLLAGDLNSSPNSALYQFLASSELDVCQHDR  315

Query  925   IHISGQIDP--SVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLCS  755
              HISGQ      ++   R  +       +PL+++WTD ELRLATG   V  L HQL LCS
Sbjct  316   RHISGQFAKCRDIEFQKRNSTSDWISISRPLLYQWTDVELRLATGCEGVTELQHQLNLCS  375

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             AY G+PG+ +TRD+LGEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LPVNILRR  GL
Sbjct  376   AYFGIPGSHRTRDNLGEPLATSYHSKFMGTVDYIWHTEELVPVRVLETLPVNILRRNGGL  435

Query  574   PSEEWGSDHLALVCELAFAGEGDET  500
             PSE WGSDHLALVCELAFA  GD T
Sbjct  436   PSERWGSDHLALVCELAFANNGDGT  460


 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -2

Query  1763  TVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCK  1584
             T D R+W +S RD+S  K  FV VSYN+L VENA KHPDLY  V P+ + W+ RK+++ +
Sbjct  83    TDDHRQWTFSSRDLSKFKGKFVVVSYNILGVENALKHPDLYDKVPPKFLKWERRKKLIRE  142

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  YN  I+C QEVD +DDLD+LLQ DGFRGVY+ RTGD+ DGCAIFWK +L+ L
Sbjct  143   EMSSYNASILCLQEVDHFDDLDDLLQMDGFRGVYKARTGDANDGCAIFWKEKLFTL  198



>ref|XP_003543162.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X1 [Glycine max]
 gb|KHN32038.1| Carbon catabolite repressor protein 4 like 5 [Glycine soja]
Length=405

 Score =   314 bits (805),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 214/268 (80%), Gaps = 10/268 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS--QSFLVGNIHVL  1112
             F LLH+E IEF+RFG+RNNVAQ CVF+    +  +D+  LT+   S+  + F+VGNIHVL
Sbjct  138   FKLLHQEDIEFQRFGMRNNVAQLCVFEANHDKKESDACNLTTMTPSTGKRRFVVGNIHVL  197

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RLL++ A +LSQEWGNIP+++AGDLNS+P+SA+Y+FL+SSKLDI++H
Sbjct  198   FNPNRGDIKLGQVRLLLDKAYKLSQEWGNIPVIIAGDLNSVPQSAIYKFLSSSKLDIQLH  257

Query  931   ERIHISGQIDPSVKPTYRFK-----SVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQ  770
             +R ++SGQ++      +R +     S+  + +R+  ++RW+ EELRLA+G   V  L HQ
Sbjct  258   DRRNMSGQLEIQTNRVFRSQIGDDASISMSVSRQ--LYRWSVEELRLASGAEGVTRLQHQ  315

Query  769   LKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILR  590
             LKLCSAY+GVPG  +TRDD+GEPLATS+HSKF+GTVDYIWH+ +L+P+RVL+ LP++ LR
Sbjct  316   LKLCSAYSGVPGNHRTRDDIGEPLATSYHSKFMGTVDYIWHSEDLIPVRVLETLPIDTLR  375

Query  589   RTRGLPSEEWGSDHLALVCELAFAGEGD  506
             R+RGLPSE+WGSDHLA+VCE AFA   +
Sbjct  376   RSRGLPSEKWGSDHLAVVCEFAFANNAN  403


 Score =   147 bits (372),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             RR+WV S +D S+C D  + VSYN+L VENA  HPDLY N+    ++WD RK+++ +EI 
Sbjct  28    RRRWVVSSKDSSNCTDKVLVVSYNILGVENASNHPDLYSNIPHSFLEWDRRKRLILEEIN  87

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              YN  I+CFQEVD ++DLD+L Q  GF+GVY+ RTG++ DGCA+FWK++L+ L
Sbjct  88    NYNASILCFQEVDHFNDLDDLFQNSGFKGVYKARTGEAQDGCAVFWKDKLFKL  140



>ref|XP_006485785.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X1 [Citrus sinensis]
 gb|KDO57443.1| hypothetical protein CISIN_1g012486mg [Citrus sinensis]
Length=462

 Score =   315 bits (806),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/265 (63%), Positives = 198/265 (75%), Gaps = 3/265 (1%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             FTLLH+E+IEF+ FGLR+NVAQ CV K  +    +   +  S    SQS +VGNIHVLFN
Sbjct  198   FTLLHQENIEFQNFGLRHNVAQLCVLKMNQSLLESAEESSLSMVSQSQSLVVGNIHVLFN  257

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQIRL +E A +LSQEWG IP++LAGDLNS P SA+YQFL SS+LD+  H+R
Sbjct  258   PNRGDIKLGQIRLFLEKAYKLSQEWGGIPVLLAGDLNSSPNSALYQFLASSELDVCQHDR  317

Query  925   IHISGQIDP--SVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLCS  755
              HISGQ      +    R  +       +PL+++WTD ELRLATG   V  L HQL LCS
Sbjct  318   RHISGQFAKCRDIDFQKRNSTSDWISISRPLLYQWTDVELRLATGCEGVTELQHQLNLCS  377

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             AY G+PG+ +TRD+LGEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LPVNILRR  GL
Sbjct  378   AYFGIPGSHRTRDNLGEPLATSYHSKFMGTVDYIWHTEELVPVRVLETLPVNILRRNGGL  437

Query  574   PSEEWGSDHLALVCELAFAGEGDET  500
             PSE WGSDHLALVCELAFA  GD T
Sbjct  438   PSERWGSDHLALVCELAFANNGDGT  462


 Score =   140 bits (354),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -2

Query  1763  TVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCK  1584
             T D R+W +S RD+S  KD FV VSYN+L VENA KHPDLY  V P+ + W+ RK+++ +
Sbjct  85    TDDHRQWTFSSRDLSKFKDKFVVVSYNILGVENALKHPDLYDKVPPKFLKWERRKKLIRE  144

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  YN  I+C QEVD +DDLD+LLQ DGFRGVY+ RTGD+ DGCAIFWK +L+ L
Sbjct  145   EMSSYNASILCLQEVDHFDDLDDLLQMDGFRGVYKARTGDANDGCAIFWKEKLFTL  200



>ref|XP_011005500.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Populus euphratica]
Length=345

 Score =   309 bits (792),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 205/263 (78%), Gaps = 7/263 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--SFLVGNIHVL  1112
             FTLLH+E IEF+ FGLRNNVAQFCV K    +         S+ +S +  S +VGNIHVL
Sbjct  83    FTLLHEEHIEFQSFGLRNNVAQFCVLKMNENQSETGLRTEASKIISPKRRSLVVGNIHVL  142

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+R+ +E A +LSQEWGNIPI++ GDLNS+P+SA+YQFLT+S+L+I +H
Sbjct  143   FNPNRGDIKLGQVRIFLEKAYKLSQEWGNIPIIIGGDLNSLPQSAIYQFLTASELEILLH  202

Query  931   ERIHISGQID-PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLC  758
             +R +ISGQ++ P  +   R +    AR+   L++RW+DEELRLATG   + HL H+LKL 
Sbjct  203   DRRNISGQLECPPQQKDLRSRDENVARS---LIYRWSDEELRLATGNEELTHLQHELKLY  259

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY GVPG+   RD+ GEPLATS+HSKF+GTVDYIWHT  L+P+RVL+ LP+NILRR+ G
Sbjct  260   SAYLGVPGSRGLRDNRGEPLATSYHSKFMGTVDYIWHTKGLIPVRVLETLPINILRRSAG  319

Query  577   LPSEEWGSDHLALVCELAFAGEG  509
             LP+E+WGSDHLALVCELAFA +G
Sbjct  320   LPNEKWGSDHLALVCELAFANDG  342


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -2

Query  1547  QEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             QEVDR+DDLD+ LQKDGFRGVY+ RTG++CDGCA+FWK++L+ L
Sbjct  42    QEVDRFDDLDDRLQKDGFRGVYKARTGEACDGCAVFWKDKLFTL  85



>ref|XP_007209399.1| hypothetical protein PRUPE_ppa009194mg [Prunus persica]
 gb|EMJ10598.1| hypothetical protein PRUPE_ppa009194mg [Prunus persica]
Length=302

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 199/258 (77%), Gaps = 5/258 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--SFLVGNIHVL  1112
             F+LLH+E+IEF+ FGLRNNVAQ CV K K+ +  ++    TS    +Q  S ++GN HVL
Sbjct  45    FSLLHQENIEFQSFGLRNNVAQLCVLKSKQNQLESEITPQTSVSPCTQNRSVVIGNTHVL  104

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RL +E A  LSQEWG+IP++++GDLNS+P+S +YQFL SS+LDIR+H
Sbjct  105   FNPNRGDIKLGQVRLFLEKAHELSQEWGSIPVIISGDLNSIPQSPMYQFLASSELDIRLH  164

Query  931   ERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTV-SVHLLHQLKLCS  755
              R HISGQ+D S      F+S    +A +P  + W +EE+RLATG   +  L H LKLCS
Sbjct  165   NRRHISGQVD-SGSENISFRS-QNGKASRPSQYIWNEEEVRLATGIEGATRLQHHLKLCS  222

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             AY GVPG+ +TRD  GEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LPVNILRR  GL
Sbjct  223   AYLGVPGSCRTRDRCGEPLATSYHSKFMGTVDYIWHTEELVPVRVLETLPVNILRRNGGL  282

Query  574   PSEEWGSDHLALVCELAF  521
             PS++WGSDHLALVCELAF
Sbjct  283   PSKKWGSDHLALVCELAF  300


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  1556  MCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             MC QEVDR+DDL +L QKDGF GVY+ RTG++ DGCAIFWK E++ L
Sbjct  1     MCLQEVDRFDDLAHLFQKDGFEGVYKARTGEASDGCAIFWKKEMFSL  47



>ref|XP_002533410.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28968.1| conserved hypothetical protein [Ricinus communis]
Length=447

 Score =   310 bits (795),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 201/262 (77%), Gaps = 6/262 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LLH+E+IEF+ FGLRNNVAQ CV K    +  +D    +SE   S+ F+VGN+HVLFN
Sbjct  185   FSLLHEENIEFQSFGLRNNVAQLCVLKMNESQSKSDQFMQSSETSKSRRFVVGNVHVLFN  244

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL +E A +LSQEWG IP+VL GDLNS+P+SAVYQFL SS+L+I +H+R
Sbjct  245   PKRGDIKLGQVRLFLERAYKLSQEWGGIPVVLGGDLNSLPQSAVYQFLASSELNILVHDR  304

Query  925   IHISGQIDPSVKPTYRFKSVPAARAR-----KPLMHRWTDEELRLATGTVSV-HLLHQLK  764
              +ISGQ+D   +  Y       A +      +P +H W DEE+ LATG   V HL HQLK
Sbjct  305   RNISGQLDHLPQHEYFKSQNKNAESNHRSISRPSIHTWNDEEVSLATGRKGVTHLCHQLK  364

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L SAY GVPG+ +TRD+ GEPLATS+HS F+GTVDYIWHT EL+P+RVL+ LP++ILRR+
Sbjct  365   LGSAYHGVPGSRRTRDNHGEPLATSYHSMFMGTVDYIWHTQELIPVRVLETLPIDILRRS  424

Query  583   RGLPSEEWGSDHLALVCELAFA  518
              GLP+E+WGSDHLALVCELAFA
Sbjct  425   AGLPNEKWGSDHLALVCELAFA  446


 Score =   162 bits (409),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  D S  KD  V VSYN+L VENA  HPDLY  + P+ +DWD RK+++C+EI  
Sbjct  76    RRWVFSDNDFSAYKDRVVVVSYNILGVENASNHPDLYFKIPPKFLDWDRRKELICEEINH  135

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN GI+CFQEVDR+DDLD LLQ+D FRGVY+ RTG++CDGCAIFWK+ L+ L
Sbjct  136   YNAGILCFQEVDRFDDLDCLLQEDSFRGVYKARTGEACDGCAIFWKDMLFSL  187



>ref|XP_011005499.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Populus euphratica]
Length=456

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 205/263 (78%), Gaps = 7/263 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--SFLVGNIHVL  1112
             FTLLH+E IEF+ FGLRNNVAQFCV K    +         S+ +S +  S +VGNIHVL
Sbjct  194   FTLLHEEHIEFQSFGLRNNVAQFCVLKMNENQSETGLRTEASKIISPKRRSLVVGNIHVL  253

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+R+ +E A +LSQEWGNIPI++ GDLNS+P+SA+YQFLT+S+L+I +H
Sbjct  254   FNPNRGDIKLGQVRIFLEKAYKLSQEWGNIPIIIGGDLNSLPQSAIYQFLTASELEILLH  313

Query  931   ERIHISGQID-PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLC  758
             +R +ISGQ++ P  +   R +    AR+   L++RW+DEELRLATG   + HL H+LKL 
Sbjct  314   DRRNISGQLECPPQQKDLRSRDENVARS---LIYRWSDEELRLATGNEELTHLQHELKLY  370

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY GVPG+   RD+ GEPLATS+HSKF+GTVDYIWHT  L+P+RVL+ LP+NILRR+ G
Sbjct  371   SAYLGVPGSRGLRDNRGEPLATSYHSKFMGTVDYIWHTKGLIPVRVLETLPINILRRSAG  430

Query  577   LPSEEWGSDHLALVCELAFAGEG  509
             LP+E+WGSDHLALVCELAFA +G
Sbjct  431   LPNEKWGSDHLALVCELAFANDG  453


 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKW +S  D    +D  VFVSYN+L VENA KHPDLY  +  E M+W+ RK+++CKE+  
Sbjct  85    RKWTFSCHDSPAYEDRVVFVSYNILGVENASKHPDLYFKIPSEFMEWERRKELICKEMHH  144

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN GI+CFQEVDR+DDLD+ LQKDGFRGVY+ RTG++CDGCA+FWK++L+ L
Sbjct  145   YNAGILCFQEVDRFDDLDDRLQKDGFRGVYKARTGEACDGCAVFWKDKLFTL  196



>ref|XP_011072943.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Sesamum indicum]
Length=451

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 199/261 (76%), Gaps = 3/261 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +FTLLH+ESIEF+RFGLRNNVAQFCV K  +   S    A      +S++FLVGNIHVL+
Sbjct  194   QFTLLHEESIEFQRFGLRNNVAQFCVLKMNQDLPSTGVTARPPCPSTSRNFLVGNIHVLY  253

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+ +E A  LSQEWG IP+V+ GDLNS+P+SA+YQFL SSKL I+ ++
Sbjct  254   NPKRGDIKLGQMRIFLEKAYELSQEWGCIPVVITGDLNSLPQSAMYQFLASSKLHIQQYD  313

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAY  749
             R H+SGQI PS    Y        R  +PLM+RWT+EE+ LATG+    L H LKLCSAY
Sbjct  314   RRHVSGQIFPS---EYAESQSRRNRITRPLMNRWTNEEIMLATGSRLSVLRHHLKLCSAY  370

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPS  569
             AGVPGT + RD +GEPL TS+H  F GTVDYIWHT++LVP+RVL+ LP+  L++T GLP 
Sbjct  371   AGVPGTPEVRDKIGEPLTTSYHCLFTGTVDYIWHTSDLVPVRVLETLPICSLKKTGGLPC  430

Query  568   EEWGSDHLALVCELAFAGEGD  506
             ++WGSDHLA+ CELAFA EGD
Sbjct  431   KKWGSDHLAVACELAFADEGD  451


 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 16/181 (9%)
 Frame = -2

Query  1952  DRREKRKKRRVTAVQTEA--HSETLSLADNSNRTSTSHMHAYAHANYhrggehrgkrkrq  1779
             +R+  RKKR+V + +TE     +TL  +  ++R + S++    ++               
Sbjct  31    ERQRSRKKRKVISSETETRIQIQTLRPSSYTHRRTNSYVQKQGNSR--------------  76

Query  1778  RPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             + P     +RKW YS  DVS+  D FV VSYN+L VENA KHP+LY  V P+ +DW +RK
Sbjct  77    KKPRKPQCQRKWTYSTHDVSNYNDRFVIVSYNILGVENATKHPELYRGVSPKYLDWGHRK  136

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             ++LCKE++ Y   I+CFQEVD ++DL  +L  DGFRG+++ R+G++ DGCAIFWK E + 
Sbjct  137   KLLCKEVKDYQASILCFQEVDHFNDLKEILGSDGFRGLHKARSGETRDGCAIFWKTEQFT  196

Query  1418  L  1416
             L
Sbjct  197   L  197



>ref|XP_007152763.1| hypothetical protein PHAVU_004G157500g [Phaseolus vulgaris]
 gb|ESW24757.1| hypothetical protein PHAVU_004G157500g [Phaseolus vulgaris]
Length=427

 Score =   308 bits (789),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 214/266 (80%), Gaps = 9/266 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS--QSFLVGNIHVL  1112
             F LLH+E IEF+RFG+RNNVAQ C+ +    +  +D+  LT  + S+  + F+VGNIHVL
Sbjct  155   FNLLHQEDIEFQRFGMRNNVAQLCILEANHDKKESDACNLTPMEPSTGKRRFVVGNIHVL  214

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+R+L++ A +LSQ+WGNIP+++AGDLNS+P+SA+Y+FL+SSKLDI++H
Sbjct  215   FNPNRGDIKLGQVRILLDKAYKLSQKWGNIPVIIAGDLNSVPQSAIYKFLSSSKLDIQLH  274

Query  931   ERIHISGQIDPSVKPTYRFK-----SVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQ  770
             +R ++SGQ++      +R +     S+    +R+ L++RW+ EELRLATG   + HL HQ
Sbjct  275   DRRNMSGQLEIQSNRIFRSQIPDDASISMTLSRQ-LLYRWSVEELRLATGAKGITHLQHQ  333

Query  769   LKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILR  590
             LKL SAY+GVPG  KTRDD+GEPLATS+HSKF+GTVDYIWH+ +LVPLRVL+ LP++ILR
Sbjct  334   LKLRSAYSGVPGDHKTRDDIGEPLATSYHSKFMGTVDYIWHSDDLVPLRVLETLPIDILR  393

Query  589   RTRGLPSEEWGSDHLALVCELAFAGE  512
             R+ GLPSE+WGSDHLA+VCELAF+ +
Sbjct  394   RSGGLPSEKWGSDHLAVVCELAFSKQ  419


 Score =   140 bits (352),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 87/122 (71%), Gaps = 7/122 (6%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHC-------KDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYR  1602
             V  R+WV+S +D S+C       +D  V VSYN+L VENA  H DLY N+   L+ WD R
Sbjct  36    VCSRRWVFSSKDCSNCMGQNSELQDKIVVVSYNILGVENASNHLDLYSNIPHRLLRWDRR  95

Query  1601  KQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
             K+++ +EI  YN  I+CFQEVD ++DLDNL Q  GF+G+Y+ RTG++ DGCA+FWK++L+
Sbjct  96    KRLILEEINNYNASILCFQEVDHFNDLDNLFQNSGFKGIYKARTGEAQDGCAVFWKDKLF  155

Query  1421  DL  1416
             +L
Sbjct  156   NL  157



>ref|XP_008240276.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 [Prunus 
mume]
Length=457

 Score =   307 bits (786),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 202/263 (77%), Gaps = 8/263 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQ--SFLVGNIHVL  1112
             F+LLH+E+IEF+ FGLRNNVAQ CV K K+ +  ++    TS    +Q  S ++GN HVL
Sbjct  193   FSLLHQENIEFQSFGLRNNVAQLCVLKSKQNQLESEITPQTSVSPCTQNRSVVIGNTHVL  252

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RL +E A  LSQEWG+IP++++GDLNS+P+S +YQFL SS+LDIR+H
Sbjct  253   FNPNRGDIKLGQVRLFLEKAHELSQEWGSIPVIISGDLNSIPQSPMYQFLASSELDIRLH  312

Query  931   ERIHISGQIDP-SVKPTYRFKSVPAARARK----PLMHRWTDEELRLATGTV-SVHLLHQ  770
              R HISGQ+D  S   ++R ++  A+  RK    PL + W +EE+RLA G   +  L H 
Sbjct  313   NRRHISGQVDSGSENRSFRSQNEKASSIRKYVSRPLQYIWNEEEVRLAAGIEGATRLQHH  372

Query  769   LKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILR  590
             LKLCSAY GVPG+ +TRD  GEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LP+NILR
Sbjct  373   LKLCSAYLGVPGSCRTRDGCGEPLATSYHSKFMGTVDYIWHTEELVPVRVLETLPINILR  432

Query  589   RTRGLPSEEWGSDHLALVCELAF  521
             R  GLPS++WGSDHLALVCELAF
Sbjct  433   RNGGLPSKKWGSDHLALVCELAF  455


 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 2/114 (2%)
 Frame = -2

Query  1751  RKWVYSP--RDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             R+W +SP     S  KD FV VSYN+L VENA KHPDLY  V P  ++W  RK+++ KEI
Sbjct  82    RQWAFSPCNSSTSTYKDNFVVVSYNILGVENASKHPDLYYKVPPRFLEWGRRKKLIRKEI  141

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               YN  IMC QEVDR+DDL +L QKDGF GVY+ RTG++ DGCAIFWK E++ L
Sbjct  142   NRYNASIMCLQEVDRFDDLAHLFQKDGFEGVYKARTGEASDGCAIFWKKEMFSL  195



>ref|XP_007036514.1| DNAse I-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY21015.1| DNAse I-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=473

 Score =   305 bits (782),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 204/268 (76%), Gaps = 10/268 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSE--DMSSQSFLVGNIHVL  1112
             FTLL +E+IEF+ FGLRNNVAQ CV K  + +  +DS    S+   M S+S LVGNIH L
Sbjct  202   FTLLQEENIEFQDFGLRNNVAQLCVLKINQHQLESDSCRKQSKITPMQSRSLLVGNIHAL  261

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RL +E A +LSQEWG+IP++L GD NS+P+SA+YQFL SS+L+I++H
Sbjct  262   FNPNRGDIKLGQVRLFLEKAYKLSQEWGSIPVILVGDFNSIPQSAIYQFLASSELNIQLH  321

Query  931   ERIHISGQID-PSVKPTYRFKSVPAAR------ARKPLMHRWTDEELRLATGTVSV-HLL  776
             +R  ISGQ++ PS     R ++   AR        + L HRW+DEEL LATG   V HL 
Sbjct  322   DRRRISGQLEYPSQGREIRAQNKYTARRHVWMPVSRQLSHRWSDEELVLATGDEGVTHLQ  381

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             H+LKLCSAYAG+PG+S+TRD  GEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LP++I
Sbjct  382   HKLKLCSAYAGIPGSSRTRDSHGEPLATSYHSKFMGTVDYIWHTGELVPVRVLETLPIDI  441

Query  595   LRRTRGLPSEEWGSDHLALVCELAFAGE  512
             LRR   LP+E  GSDHLALVCELAFA +
Sbjct  442   LRRNASLPNERLGSDHLALVCELAFADD  469


 Score =   154 bits (388),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S R+ S+ KD  V VSYN+L  EN  KHPDLY +V P+ ++W  RK ++ +E+  
Sbjct  93    RKWVFSSRNCSNYKDKLVIVSYNILGAENVAKHPDLYLDVPPKFLEWSRRKDLISEEVNR  152

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVDR+ DLD+LLQKDGF+GVY+ RTG+ CDGCA+FWK++++ L
Sbjct  153   YNASILCFQEVDRFKDLDDLLQKDGFKGVYKARTGNGCDGCALFWKDKIFTL  204



>ref|XP_007036515.1| DNAse I-like superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY21016.1| DNAse I-like superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=469

 Score =   304 bits (779),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 205/267 (77%), Gaps = 12/267 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSE--DMSSQSFLVGNIHVL  1112
             FTLL +E+IEF+ FGLRNNVAQ CV K  + +  +DS    S+   M S+S LVGNIH L
Sbjct  202   FTLLQEENIEFQDFGLRNNVAQLCVLKINQHQLESDSCRKQSKITPMQSRSLLVGNIHAL  261

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RL +E A +LSQEWG+IP++L GD NS+P+SA+YQFL SS+L+I++H
Sbjct  262   FNPNRGDIKLGQVRLFLEKAYKLSQEWGSIPVILVGDFNSIPQSAIYQFLASSELNIQLH  321

Query  931   ERIHISGQID-PSVKPTYRFKS-----VPAARARKPLMHRWTDEELRLATGTVSV-HLLH  773
             +R  ISGQ++ PS     R ++     +P +R    L HRW+DEEL LATG   V HL H
Sbjct  322   DRRRISGQLEYPSQGREIRAQNKRHVWMPVSRQ---LSHRWSDEELVLATGDEGVTHLQH  378

Query  772   QLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNIL  593
             +LKLCSAYAG+PG+S+TRD  GEPLATS+HSKF+GTVDYIWHT ELVP+RVL+ LP++IL
Sbjct  379   KLKLCSAYAGIPGSSRTRDSHGEPLATSYHSKFMGTVDYIWHTGELVPVRVLETLPIDIL  438

Query  592   RRTRGLPSEEWGSDHLALVCELAFAGE  512
             RR   LP+E  GSDHLALVCELAFA +
Sbjct  439   RRNASLPNERLGSDHLALVCELAFADD  465


 Score =   154 bits (388),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S R+ S+ KD  V VSYN+L  EN  KHPDLY +V P+ ++W  RK ++ +E+  
Sbjct  93    RKWVFSSRNCSNYKDKLVIVSYNILGAENVAKHPDLYLDVPPKFLEWSRRKDLISEEVNR  152

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVDR+ DLD+LLQKDGF+GVY+ RTG+ CDGCA+FWK++++ L
Sbjct  153   YNASILCFQEVDRFKDLDDLLQKDGFKGVYKARTGNGCDGCALFWKDKIFTL  204



>ref|XP_006341615.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X2 [Solanum tuberosum]
Length=444

 Score =   303 bits (777),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 10/240 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F +LH+ESIEF+ F LRNNV Q C FK   K  S D +A  SE ++S SFLVGNIHVL+N
Sbjct  205   FDILHEESIEFQNFNLRNNVCQLCAFKMNVKSSSKDMSASNSESVTSPSFLVGNIHVLYN  264

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E+AQRLS EWG+IP+VLAGDLNSMP+SA+YQFLTS+KLDI+MH+R
Sbjct  265   PNRGDIKLGQVRLFLESAQRLSHEWGDIPVVLAGDLNSMPQSAMYQFLTSNKLDIQMHDR  324

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAYA  746
               ISGQI P    ++  +          L +RW++EEL LATGT + HL+HQL+L SAYA
Sbjct  325   KQISGQIYPLQNRSFNPR----------LSYRWSNEELMLATGTGASHLIHQLQLRSAYA  374

Query  745   GVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSE  566
             G PG+S+TR++ GEPLATS+HSKF+GTVDYIWHT E VP+RVLD LPV+ILRRTRGLPSE
Sbjct  375   GAPGSSRTRENSGEPLATSYHSKFMGTVDYIWHTTEFVPVRVLDTLPVDILRRTRGLPSE  434


 Score =   190 bits (482),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 146/211 (69%), Gaps = 5/211 (2%)
 Frame = -2

Query  2045  MGRFTGGEMPPAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNS  1866
             MGR   G  PPA++ ++   S K +  +++  +   +KK+RV+  +TE  + TL+     
Sbjct  1     MGRTGDGRDPPAEQPSRFSASMKSRISQHDIGKHRSKKKQRVSISKTETETATLT----L  56

Query  1865  NRTSTSHMHAYAHANYhrggehrgkrkrqRPP-ANTVDRRKWVYSPRDVSHCKDGFVFVS  1689
             N TSTS+ H+YA++  +     + KR + +   A   D+RKWVYS   VS  +D  VF+S
Sbjct  57    NHTSTSYTHSYANSYSYSYSRGKEKRHKGKAKRAIADDKRKWVYSTHVVSPNQDRVVFMS  116

Query  1688  YNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLL  1509
             YN+L V+NA  H DLY NV P+ +DWDYRK+++CKEIR YNPGIMCFQEVDR+DDLD LL
Sbjct  117   YNILGVKNAAAHEDLYRNVSPKYLDWDYRKKLICKEIRDYNPGIMCFQEVDRFDDLDYLL  176

Query  1508  QKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             QK+GF+GVYQ RTGD+ DGCAIFW ++L+D+
Sbjct  177   QKEGFKGVYQARTGDASDGCAIFWNSKLFDI  207



>ref|XP_009625173.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5, partial 
[Nicotiana tomentosiformis]
Length=466

 Score =   304 bits (779),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/240 (68%), Positives = 194/240 (81%), Gaps = 10/240 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LLH+ESIEF++F LRNNV Q CVFK   K  S D  A  SE +SS+SF+VGNIHVLFN
Sbjct  208   FDLLHEESIEFQKFDLRNNVCQLCVFKMNVKNSSKDMGASNSESISSRSFVVGNIHVLFN  267

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E+AQRLS EWG+IP+VLAGDLNSMP+SA+YQFLTSSKLDI+MHER
Sbjct  268   PNRGDIKLGQVRLFLESAQRLSLEWGDIPVVLAGDLNSMPQSAMYQFLTSSKLDIQMHER  327

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAYA  746
               ISGQI PS   ++          +  L++RW+DEELRLATGT + HL+HQL+L SA A
Sbjct  328   KQISGQIYPSQNRSF----------KSSLIYRWSDEELRLATGTGASHLIHQLQLSSANA  377

Query  745   GVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSE  566
             GVPG+S TRD+ GEPL TS+HSKF+GTVDYIWHT E VP+RVLD LP++ILRRTRGLPS+
Sbjct  378   GVPGSSGTRDNSGEPLVTSYHSKFMGTVDYIWHTTEFVPVRVLDTLPIDILRRTRGLPSK  437


 Score =   204 bits (518),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 132/187 (71%), Gaps = 5/187 (3%)
 Frame = -2

Query  1973  KTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNSNRTSTSHMHAYA-HANYhrggehr  1797
             +T +++  +   +KK+RVT  QTE  SETL+L    N TSTS+ H YA  + Y       
Sbjct  28    RTSQHDVGQHRSKKKQRVTIRQTETKSETLTL----NHTSTSYTHTYATSSTYSYNRRKE  83

Query  1796  gkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELM  1617
              + K +    +  D+RKWVYS  +VS  +D  VF+SYN+L V+NA  H DLY NV P+ +
Sbjct  84    KRHKGKSKRTSAEDKRKWVYSTHNVSPYQDRVVFMSYNILGVKNAADHEDLYHNVAPKYL  143

Query  1616  DWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFW  1437
             DWDYRKQ++ KEIR YNPG+MCFQEVD YDDLD LL+K+GF+GVYQ RTGD+CDGCAIFW
Sbjct  144   DWDYRKQLIRKEIREYNPGVMCFQEVDCYDDLDYLLKKEGFKGVYQARTGDTCDGCAIFW  203

Query  1436  KNELYDL  1416
             K EL+DL
Sbjct  204   KRELFDL  210



>emb|CBI15444.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 195/239 (82%), Gaps = 3/239 (1%)
 Frame = -3

Query  1210  FKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEW  1031
              +  R + ++D +   S+   ++S +VGNIHVLFNP RGDIKLGQ+RL +E A +LSQEW
Sbjct  16    LEMNRNQSNSDVDTKASQIPPTRSLIVGNIHVLFNPNRGDIKLGQMRLFLEKAHKLSQEW  75

Query  1030  GNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIHISGQID-PSVKPTYRFKSVPAAR  854
             G IP+VLAGDLNSMP+SA+YQFL SS+LD+R+H+R  ISGQ++  S    YR+++  A+R
Sbjct  76    GCIPVVLAGDLNSMPQSALYQFLASSELDVRLHDRRKISGQVEHQSQHRAYRYQNEDASR  135

Query  853   ARKPLMHRWTDEELRLATGTVSV-HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSK  677
             +R PL+HRW++EELRLATG+  V HL H LKLCSAY G+PG+ +TRD+ GEPLATS+HSK
Sbjct  136   SR-PLVHRWSNEELRLATGSDGVTHLQHCLKLCSAYYGIPGSCRTRDNYGEPLATSYHSK  194

Query  676   FLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
             F+GTVDYIWHT ELVP+RVL+ LPV+ILR+T GLPSE+WGSDHLALVCELAFA +G  +
Sbjct  195   FMGTVDYIWHTEELVPVRVLETLPVDILRKTGGLPSEKWGSDHLALVCELAFADDGSSS  253



>ref|XP_010519234.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5, partial 
[Tarenaya hassleriana]
Length=420

 Score =   301 bits (770),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 201/272 (74%), Gaps = 15/272 (6%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKE-----CSNDSNALTSEDMSSQSFLVGNI  1121
             F LLH + IEFERFGLRNNVAQ CV +   ++     C   SN+  +    S+  +VGNI
Sbjct  150   FKLLHHQDIEFERFGLRNNVAQLCVLEMNHEDSESKLCVQQSNSRPA-STGSRRLVVGNI  208

Query  1120  HVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDI  941
             HVLFNPKRGDIKLGQ+RLL+E A +LSQEWGN P+++ GD+NS PKSA+Y+F+ S+KLD+
Sbjct  209   HVLFNPKRGDIKLGQVRLLLEKANKLSQEWGNTPVIICGDMNSTPKSAIYEFMASAKLDM  268

Query  940   RMHERIHISGQID----PSVKPTYRFKSVPAARARKP----LMHRWTDEELRLATGTVS-  788
             ++H+R  ISGQ +     S +  +R+ +  AA A  P    L + WT EELRLATG+   
Sbjct  269   QLHDRRQISGQFELESIQSKQRLFRWNNRYAASATMPISRSLSYEWTSEELRLATGSEEC  328

Query  787   VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldpl  608
              H+ HQLKL SAY   PGT +TRD LGEPLATS+HS+FLGTVDYIWHT +LV +RVL+ L
Sbjct  329   THVQHQLKLQSAYTRAPGTGRTRDHLGEPLATSYHSRFLGTVDYIWHTEQLVTVRVLESL  388

Query  607   pVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
             P++ L+R+RGLPSE+WGSDHLA+ CELAFA +
Sbjct  389   PIDELKRSRGLPSEKWGSDHLAIACELAFAND  420


 Score =   144 bits (364),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + KD  V VSYNLL V+NA  H DLY NV  + ++W+ RK ++CKEI  
Sbjct  41    REWVFSSSNSKNLKDKVVVVSYNLLGVDNASNHMDLYFNVPAKCLEWNRRKHLICKEISR  100

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD LLQK GF+GV++ RTG++ DGCAIFWK +L+ L
Sbjct  101   YNASILCLQEVDRFDDLDGLLQKSGFQGVHKSRTGEASDGCAIFWKEKLFKL  152



>ref|XP_010263633.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Nelumbo nucifera]
Length=461

 Score =   302 bits (773),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 203/264 (77%), Gaps = 7/264 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSND---SNALTSEDMSSQSFLVGNIHV  1115
             FTLLH+E+IEF++FGLR+NVAQ CV K     CS+    S A  SE   ++S LVGNIH+
Sbjct  199   FTLLHEENIEFQKFGLRDNVAQLCVLKMN-NHCSSSHHGSEAQASETSPARSLLVGNIHM  257

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             LFNP RGDIKLGQIRL ++NA R+SQEWGNIP+V+AGDLNS+P+SA+Y+FL SS+LDI +
Sbjct  258   LFNPNRGDIKLGQIRLFLDNAHRISQEWGNIPVVIAGDLNSIPQSAIYRFLDSSELDILL  317

Query  934   HERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLC  758
             H+R  ISGQ++  +   + FK+     + +PL +RW+ EE+RLATG   + HL H LKL 
Sbjct  318   HDRRKISGQVEYPIGLKH-FKT-QREDSYRPLRYRWSQEEIRLATGCDGITHLRHHLKLS  375

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S Y GV G+ +TRD   EPLATS+HSKF+GTVDYIWH+ EL+P+ V++ LPVNILR T G
Sbjct  376   SVYRGVAGSCRTRDSNEEPLATSYHSKFMGTVDYIWHSRELIPVGVIETLPVNILRETGG  435

Query  577   LPSEEWGSDHLALVCELAFAGEGD  506
             LPSE+WGSDHLALVCELAFA   +
Sbjct  436   LPSEKWGSDHLALVCELAFADNSN  459


 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = -2

Query  1934  KKRRVTAVQTEAHSETLSLADNSNRTSTSHMHAYAHANYhrggehrgkrkrqRPPANTVD  1755
             K+RR+ ++++EAH   LSL   S+R    ++ + +  N       + + +++R   +   
Sbjct  27    KRRRLASLESEAHVHCLSLHQISSRDE--YLPSPSGRNVKLSSVRQVRNRKRRSSRSKKR  84

Query  1754  R----RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILC  1587
                  RKWV+S  D S  KD  V VSYN+L VEN  KHPDLYP V P+ ++W++RK+++ 
Sbjct  85    TKDGYRKWVFSSHDCSRYKDKVVVVSYNILGVENVLKHPDLYPQVPPQFLNWEWRKKLIR  144

Query  1586  KEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             KE+  Y P I+C QEVDR++DL +LLQKDGFRGVY+ RTG++CDGCA+FWK EL+ L
Sbjct  145   KELNHYMPSIVCLQEVDRFNDLSDLLQKDGFRGVYKARTGEACDGCALFWKEELFTL  201



>ref|XP_010036884.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 [Eucalyptus 
grandis]
 gb|KCW48545.1| hypothetical protein EUGRSUZ_K02220 [Eucalyptus grandis]
Length=471

 Score =   302 bits (774),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 205/268 (76%), Gaps = 16/268 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHV  1115
             RFTL+H+++IEF+ FGLR+NVAQ CV K K++    DS A +S  +  Q+   LV NIHV
Sbjct  205   RFTLVHQDNIEFKTFGLRDNVAQLCVLKMKQR-VMPDSPAQSSASLLDQNQLLLVANIHV  263

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             LFNP RGD+KLGQIRLL+E A +LS+ WG IP+++ GDLNSMP+SA+YQFL SS+LDIR+
Sbjct  264   LFNPNRGDVKLGQIRLLLEKAHQLSEIWGKIPVIIGGDLNSMPQSAIYQFLASSELDIRL  323

Query  934   HERIHISGQID-----PSVKPTYR----FKSVPAARARKPLMHRWTDEELRLATGTVSV-  785
             ++R  ISGQID       VK   R     K  PA+R     ++RW D++LRLATG+  V 
Sbjct  324   YDRRKISGQIDCLSANSCVKHQNRNSLSIKWKPASRQ---CVYRWNDDDLRLATGSAKVT  380

Query  784   HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplp  605
             HL H L LCSAY G+PG+ +TRDD GEPLATS+HS+F+GTVDYIWHT ELVP+RVL+ LP
Sbjct  381   HLQHHLDLCSAYFGIPGSCRTRDDCGEPLATSYHSRFMGTVDYIWHTKELVPVRVLETLP  440

Query  604   VNILRRTRGLPSEEWGSDHLALVCELAF  521
             ++ L+RT GLPS++WGSDHLALVCELAF
Sbjct  441   IDALKRTGGLPSKKWGSDHLALVCELAF  468


 Score =   144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 125/216 (58%), Gaps = 14/216 (6%)
 Frame = -2

Query  2045  MGRFTGGEMPPAKELAKHPTSSKRKTPRYNGDRREKRK-----KRRVTAVQTEAHSETLS  1881
             M + +  E PP+ +   H  +++    +   D RE+ +     +R+   ++T   SETL 
Sbjct  1     MAKRSRREPPPSDD--SHSLATRSNQHKRLPDSREEEESRSGCRRKAKKIKTFTASETLL  58

Query  1880  LADNSNRTSTSHMHAYAHANYhrggehrgkrkrqRPPANTVDRRK-WVYSPRDVSHCKDG  1704
             +   +  T +      A   Y         R+ ++P     + R+ W Y+ RD+S C+D 
Sbjct  59    VQSETTGTPS------ASNRYASLACSVELRREEKPRRRGREDRREWAYTSRDLSGCRDN  112

Query  1703  FVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDD  1524
              VFVSYN+L V+NA KH DLY  V P  + W  RK+++ KE+  Y+  I+CFQEVDR+DD
Sbjct  113   VVFVSYNILGVDNAMKHQDLYTEVQPRFLKWRRRKKLIRKELNVYDASIVCFQEVDRFDD  172

Query  1523  LDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             L +LL+KDGF GVY+ RTG++ DGCAIFWK++ + L
Sbjct  173   LADLLKKDGFGGVYKARTGEANDGCAIFWKDDRFTL  208



>ref|XP_009403961.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   264 bits (674),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 196/268 (73%), Gaps = 15/268 (6%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSN--DSNALTS-EDMSSQSFLVGN  1124
             E  FTLL++E IEF++FGLRNNVAQ C+ K    + ++  D +A +  E +S ++ LVGN
Sbjct  95    EKEFTLLYQEDIEFQKFGLRNNVAQLCLLKVSLNQSNDQVDKDAGSEIEPVSCRTLLVGN  154

Query  1123  IHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLD  944
             IHVLFNP RGDIKLGQ+R+L+E A  LS+++GN P+V++GDLNS PKSA+ QFLTS++LD
Sbjct  155   IHVLFNPNRGDIKLGQMRVLLERANTLSKQYGNTPVVISGDLNSTPKSAICQFLTSNELD  214

Query  943   IRMHERIHISGQID-PSVKPTY-----RFKSVPAARARKPLMHRWTDEELRLATGTVS-V  785
             I  ++R +ISGQI+ P  + TY     RF+ + + +       RW++EE+ LA+G     
Sbjct  215   ILQYDRKNISGQIEYPVRQMTYAIQHDRFRCMASQQK-----FRWSEEEVCLASGRRGCT  269

Query  784   HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplp  605
              L + L L SAY GVPG   TRD+ GEPLATS HSKF+GTVDYIWH++ LVP+ V+D L 
Sbjct  270   RLQNPLTLSSAYRGVPGNLHTRDENGEPLATSCHSKFMGTVDYIWHSSALVPVGVVDTLT  329

Query  604   VNILRRTRGLPSEEWGSDHLALVCELAF  521
             + +LRR RGLPS++WGSDHLALVC+ AF
Sbjct  330   IKVLRRLRGLPSKKWGSDHLALVCKFAF  357


 Score = 99.0 bits (245),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  1679  LAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKD  1500
             + + N     + YP    E + WD RK+ + KE+R YNP I+CFQEVD++DDL +L ++D
Sbjct  13    MGLANGSSPLETYPLSRRECLSWDLRKRRMHKELRSYNPSILCFQEVDKFDDLADLFRED  72

Query  1499  GFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             G+ G+Y+ RTG++ DGCAIFWK + + L
Sbjct  73    GYTGIYKQRTGEATDGCAIFWKEKEFTL  100



>ref|XP_004300529.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
[Fragaria vesca subsp. vesca]
Length=437

 Score =   299 bits (765),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 195/257 (76%), Gaps = 4/257 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRK-ECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             F+LLH+ESIEF+ FGLR+NVAQFCV K + + E     +A        +S +VGNIHVLF
Sbjct  181   FSLLHQESIEFQSFGLRHNVAQFCVLKLQDQLESDIPPDASMRPCTQCRSLVVGNIHVLF  240

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGDIKLGQ+RL +E A +LS EWG+IP+++AGDLNS P+S +YQFL SSKLDI+ H+
Sbjct  241   NPNRGDIKLGQVRLFLEKAFKLSLEWGSIPVIVAGDLNSTPQSPIYQFLASSKLDIQKHD  300

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLCSA  752
             R HISGQ++   +  YR     A R  KP ++RW  EE+RLATG   V HL H LKL SA
Sbjct  301   RRHISGQME--FESQYRTFMYNATRYGKPFVYRWKAEEVRLATGCEEVTHLQHHLKLGSA  358

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y GVPG+ +TRD  GEPLATS+HS FLGTVDYIWHT ELVP+RVL+ LP++IL+ T GLP
Sbjct  359   YHGVPGSKRTRDRCGEPLATSYHSNFLGTVDYIWHTEELVPVRVLETLPIDILKGTSGLP  418

Query  571   SEEWGSDHLALVCELAF  521
             S+ WGSDHLALVCELAF
Sbjct  419   SKRWGSDHLALVCELAF  435


 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV +    S   + FV VSYN+L V+NA  H D+Y NV P+ M W  R++++ KE+  
Sbjct  72    REWVCNSSTSSAYGEKFVVVSYNILGVDNASNHSDMYSNVPPKYMKWKRRRRLIRKEVNS  131

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN GI+CFQEVDR+DDL +  +KDGF GV++ RTG++ DGCAIFWK +++ L
Sbjct  132   YNAGIVCFQEVDRFDDLAHKFRKDGFEGVHKARTGEASDGCAIFWKQDMFSL  183



>ref|XP_009106044.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 [Brassica 
rapa]
Length=434

 Score =   294 bits (752),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 196/263 (75%), Gaps = 10/263 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS--QSFLVGNIHVL  1112
             F LLH + IEF+RFGLRNNVAQ CV +   ++  +     +SE  S+  +  +VGNIHVL
Sbjct  177   FKLLHHQEIEFDRFGLRNNVAQLCVLEMNCEDPESKLRVQSSEQTSTSPRRLVVGNIHVL  236

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGDIKLGQ+RLL+E A +LSQEWGNIP+ +AGDLNS PKSA+Y F+ S+ LD ++H
Sbjct  237   FNPKRGDIKLGQVRLLLERAYKLSQEWGNIPVAIAGDLNSTPKSAIYDFVASADLDTQLH  296

Query  931   ERIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKL  761
             +R  ISGQ  +D +  P     +V A++  +     W++EEL+LATG   + H+ H+LKL
Sbjct  297   DRRQISGQSDLDTNRSPFRNHYAVSASQTNE-----WSEEELQLATGGQATTHVRHELKL  351

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              SAYAGVPGT +TRD  GEPLAT+ HS+F GTVDYIWHT ELVP+RVL+ LP ++LRRT 
Sbjct  352   NSAYAGVPGTQRTRDQCGEPLATTCHSRFQGTVDYIWHTKELVPVRVLETLPTDVLRRTG  411

Query  580   GLPSEEWGSDHLALVCELAFAGE  512
             GLPSE+WGSDHLA+ CEL F GE
Sbjct  412   GLPSEKWGSDHLAIACELGFVGE  434


 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A++   R+WV+S  +  + KD  V VSYNLL V+NA  H DLY N+ P+ ++W  RK ++
Sbjct  62    ASSSVERQWVFSASNSRNIKDKLVLVSYNLLGVDNASNHMDLYYNIPPQHLEWSRRKHLI  121

Query  1589  CKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             CKEI  YN  I+C QEVDR+DDLD+LL+  GF GV++ RTG++ DGC+IFWK +L+ L
Sbjct  122   CKEISRYNATILCLQEVDRFDDLDSLLKLRGFEGVHKRRTGEASDGCSIFWKEKLFKL  179



>ref|XP_008374749.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 [Malus 
domestica]
Length=451

 Score =   293 bits (751),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 199/257 (77%), Gaps = 5/257 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LLH+E+IEF+ FGLRNNVAQ CV K  + +  +     TS    S+S ++GN H+LFN
Sbjct  196   FSLLHEENIEFQSFGLRNNVAQLCVLKSNQNQLESGIPPGTSPYTQSRSLVIGNTHLLFN  255

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL ++ A  LSQEWG+IP++++GDLNS+P+S +Y FL SS+LDIR+H+R
Sbjct  256   PKRGDIKLGQVRLFLKKAYELSQEWGSIPVIISGDLNSIPQSPMYHFLASSELDIRLHDR  315

Query  925   IHISGQ-IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGT-VSVHLLHQLKLCSA  752
               ISGQ +  S    +RF++  A+R   P  + W++EE+RLATG+ V   L H LKLCSA
Sbjct  316   RGISGQFVLNSNHRGFRFQNEQASR---PFSYIWSEEEVRLATGSEVVTCLRHNLKLCSA  372

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y GVPG+ +TRD  GEPLATS+HS+F+GTVDYIWHT ELVP+RVL+ LPVN LRR  GLP
Sbjct  373   YLGVPGSCRTRDRSGEPLATSYHSEFMGTVDYIWHTEELVPVRVLETLPVNALRRDGGLP  432

Query  571   SEEWGSDHLALVCELAF  521
             S++WGSDHLA+VCELAF
Sbjct  433   SKQWGSDHLAVVCELAF  449


 Score =   135 bits (341),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  1709  DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRY  1530
             + FV VSYN+L VENA KHP+LY  V P  ++W+ R++++ KEI  YN  IMC QEVDR+
Sbjct  101   EKFVVVSYNILGVENASKHPELYYKVPPMFLEWNRRRKLIRKEINRYNASIMCLQEVDRF  160

Query  1529  DDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             DDL +L QKDGF GVY+ RTG++ DGCAIFWK E++ L
Sbjct  161   DDLAHLFQKDGFEGVYKARTGEANDGCAIFWKKEMFSL  198



>ref|XP_009347068.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 [Pyrus 
x bretschneideri]
Length=452

 Score =   293 bits (750),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 198/257 (77%), Gaps = 5/257 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LLH+E+IEF+ FGLRNNVAQ CV K  + +  +D    TS    S+S ++GN H+LFN
Sbjct  197   FSLLHEENIEFQSFGLRNNVAQLCVLKSNQNQLESDIPPGTSPYTQSRSLVIGNTHLLFN  256

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL ++ A  LSQEWG+IP++++GDLNS+P+S +Y FL SS+LDIR+H+R
Sbjct  257   PKRGDIKLGQVRLFLKKAYELSQEWGSIPVIISGDLNSIPQSPMYHFLASSELDIRLHDR  316

Query  925   IHISGQ-IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGT-VSVHLLHQLKLCSA  752
               ISGQ +  S    +RF++  A+R   P  + W++EE+RLATG+ V   L H LKLCSA
Sbjct  317   RGISGQFVLNSNHRGFRFQNEQASR---PFSYIWSEEEVRLATGSEVVTCLRHDLKLCSA  373

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y GVPG+ +TRD  GEPLATS+HS+F+GTVDYIWHT ELVP+RVL+ LPV  LRR  GLP
Sbjct  374   YLGVPGSCRTRDRSGEPLATSYHSEFMGTVDYIWHTEELVPVRVLETLPVKALRRDGGLP  433

Query  571   SEEWGSDHLALVCELAF  521
             S +WGSDHLA+VCELAF
Sbjct  434   SRQWGSDHLAVVCELAF  450


 Score =   133 bits (335),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -2

Query  1709  DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRY  1530
             + FV VSYN+L VENA KHP+LY  V P  ++W+ R++++ KEI  YN  IMC QEVDR+
Sbjct  102   EKFVVVSYNILGVENASKHPELYYKVPPMFLEWNRRRKLIRKEINRYNASIMCLQEVDRF  161

Query  1529  DDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             DDL +L +KDGF GVY+ RTG++ DGCAIFWK E++ L
Sbjct  162   DDLAHLFRKDGFEGVYKARTGEANDGCAIFWKKEMFSL  199



>emb|CDX73024.1| BnaC06g34720D [Brassica napus]
Length=454

 Score =   292 bits (748),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 194/261 (74%), Gaps = 6/261 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS--QSFLVGNIHVL  1112
             F LLH + IEF+ FGLRNNVAQ CV +   ++  +     +SE  S+  +  +VGNIHVL
Sbjct  197   FKLLHHQEIEFDSFGLRNNVAQLCVLEMNCEDPESKLRVQSSEQTSTSPRRLVVGNIHVL  256

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGDIKLGQ+RLL+E A +LSQEWGNIP+ +AGDLNS PKSA+Y F+ S+ LD ++H
Sbjct  257   FNPKRGDIKLGQVRLLLERAYKLSQEWGNIPVAIAGDLNSTPKSAIYDFVASADLDTQLH  316

Query  931   ERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCS  755
             +R  ISGQ +   KP+  F++  A    +   + W+ EEL+LATG   + H+ HQLKL S
Sbjct  317   DRRQISGQSELDTKPS-PFRNHYAVSVSQ--TNEWSQEELQLATGGQATTHVRHQLKLNS  373

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             AYAGVPGT +TRD  GEPLAT+ HS+F GTVDYIWHT ELVP+RVL+ LP ++LRRT GL
Sbjct  374   AYAGVPGTHRTRDQCGEPLATTCHSRFQGTVDYIWHTKELVPVRVLETLPTDVLRRTGGL  433

Query  574   PSEEWGSDHLALVCELAFAGE  512
             PSE+WGSDHLA+ CEL F GE
Sbjct  434   PSEKWGSDHLAIACELGFVGE  454


 Score =   128 bits (321),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (62%), Gaps = 20/138 (14%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A++   R+WV+S  +  + KD  V VSYNLL V+NA  H DLY N+ P+ ++W  RK ++
Sbjct  62    ASSSVERQWVFSASNSRNLKDKLVLVSYNLLGVDNASNHMDLYYNIPPQHLEWSRRKHLI  121

Query  1589  CKEIRGYNPGIMCFQ--------------------EVDRYDDLDNLLQKDGFRGVYQPRT  1470
             CKEI  YN  I+C Q                    EVDR+DDLD LL+  GF+GV++ RT
Sbjct  122   CKEISRYNATILCLQASSDLYYYILYWMINMDFACEVDRFDDLDGLLKNRGFQGVHKRRT  181

Query  1469  GDSCDGCAIFWKNELYDL  1416
             G++ DGC+IFWK +L+ L
Sbjct  182   GEASDGCSIFWKEKLFKL  199



>gb|KDP20114.1| hypothetical protein JCGZ_05883 [Jatropha curcas]
Length=475

 Score =   293 bits (749),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 205/274 (75%), Gaps = 13/274 (5%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSND--SNALTSEDMSSQSFLVGNIHVL  1112
             FTLLH+E+IEF+ FGLR+NVAQ CV K    +  +D    +L ++   ++  +VGN+HVL
Sbjct  203   FTLLHEENIEFQNFGLRDNVAQLCVLKMNENQSESDLCMQSLKAKSTPARRLVVGNVHVL  262

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSK---LDI  941
             FNPKRGDIKLGQ+RL +E A +LSQEWG IP++L GDLNS+P+SA+YQFL+ S+   LD+
Sbjct  263   FNPKRGDIKLGQVRLFLERAHKLSQEWGGIPVILGGDLNSLPQSAIYQFLSQSEVILLDV  322

Query  940   RMHERIHISGQID--PSVK----PTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-H  782
              +H+R +ISGQ++  P  K    P    KS     +R+  M  W+D+ELRLATG+  V H
Sbjct  323   LVHDRRNISGQLEHPPQNKYFRSPNDNVKSNNMCISRRS-MRVWSDDELRLATGSRGVTH  381

Query  781   LLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpV  602
             L HQLKL SAY GVPGT ++RD  GEPLATS+HS+F+GTVDYIWHT EL+P+RVL+ LP+
Sbjct  382   LRHQLKLFSAYIGVPGTHRSRDSCGEPLATSYHSQFMGTVDYIWHTEELLPVRVLETLPM  441

Query  601   NILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
             +ILRR+ GLP+E+ GSDHLALVCELAF  +   T
Sbjct  442   DILRRSAGLPNEKLGSDHLALVCELAFVDDDSRT  475


 Score =   159 bits (402),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 124/205 (60%), Gaps = 3/205 (1%)
 Frame = -2

Query  2021  MPPAKELA---KHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNSNRTST  1851
             M  +K LA   KH  +S +   +Y  D+++   +      +    ++TL+L  +S+R++ 
Sbjct  1     MRESKRLAPQKKHSRASAQTKRKYFDDKQQNDLETGSKRQKLVYRTKTLTLKPHSSRSNL  60

Query  1850  SHMHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAV  1671
               ++ +           + K    R  +     RKWV+S  D S   D  VFVSYN+L V
Sbjct  61    PALNRFEPIYSSSSRSRKHKHDWSRSSSIAESNRKWVFSGDDFSAYSDRIVFVSYNILGV  120

Query  1670  ENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFR  1491
             ENA KHPDLY  + PE ++WD RK+++CKEI  YN  I+CFQEVDR++DLD LLQ DGFR
Sbjct  121   ENASKHPDLYFKIPPECLEWDRRKELICKEINRYNADILCFQEVDRFNDLDCLLQNDGFR  180

Query  1490  GVYQPRTGDSCDGCAIFWKNELYDL  1416
             G+Y+ RTG++ DGCAIFW++ L+ L
Sbjct  181   GLYKARTGEAYDGCAIFWRDTLFTL  205



>emb|CDX96494.1| BnaA07g31050D [Brassica napus]
Length=441

 Score =   290 bits (743),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 193/261 (74%), Gaps = 6/261 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS--QSFLVGNIHVL  1112
             F LLH + IEF+ FGLRNNVAQ CV +   +   +     +SE  S+  +  +VGNIHVL
Sbjct  184   FKLLHHQEIEFDSFGLRNNVAQLCVLEMNCEVPESKLRVQSSEQTSTSPRRLVVGNIHVL  243

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGDIKLGQ+RLL+E A +LSQEWGNIP+ +AGDLNS PKSA+Y F+ S+ LD ++H
Sbjct  244   FNPKRGDIKLGQVRLLLERAYKLSQEWGNIPVAIAGDLNSTPKSAIYDFVASADLDTQLH  303

Query  931   ERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCS  755
             +R  ISGQ +   KP+  F++  A    +   + W+ EEL+LATG   + H+ HQLKL S
Sbjct  304   DRRQISGQSELDTKPS-PFRNHYAVSVSQ--TNEWSQEELQLATGGQATTHVRHQLKLNS  360

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             AYAGVPGT +TRD  GEPLAT+ HS+F GTVDYIWHT ELVP+RVL+ LP ++LRRT GL
Sbjct  361   AYAGVPGTHRTRDQCGEPLATTCHSRFQGTVDYIWHTKELVPVRVLETLPTDVLRRTGGL  420

Query  574   PSEEWGSDHLALVCELAFAGE  512
             PSE+WGSDHLA+ CEL F GE
Sbjct  421   PSEKWGSDHLAIACELGFVGE  441


 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 86/125 (69%), Gaps = 7/125 (6%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A++   R+WV+SP D  + KD  V VSYNLL V+NA  H DLY N+ P+ ++W  RK ++
Sbjct  62    ASSSVERQWVFSPSDSRNLKDKLVLVSYNLLGVDNASNHMDLYYNIPPQHLEWSRRKHLI  121

Query  1589  CKEIRGYNPGIMCFQ-------EVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKN  1431
             CKEI  YN  I+C Q       EVDR+DDLD+LL+  GF GV++ RTG++ DGC+IFWK 
Sbjct  122   CKEISRYNATILCLQASFELDYEVDRFDDLDSLLKLRGFEGVHKRRTGEATDGCSIFWKE  181

Query  1430  ELYDL  1416
             +L+ L
Sbjct  182   KLFKL  186



>gb|KFK41825.1| hypothetical protein AALP_AA2G176400 [Arabis alpina]
Length=447

 Score =   288 bits (738),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 191/263 (73%), Gaps = 5/263 (2%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS--QSFLVGNIHVL  1112
             F LLH + IEF++FGLRNNVAQ CV +   ++  +   A +SE +S+  +  +VGNIHVL
Sbjct  185   FKLLHHQDIEFDKFGLRNNVAQLCVLEMNIEDPKSKLLAQSSEKLSTSPRRLVVGNIHVL  244

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS PKSA+Y F+ S+ LD ++H
Sbjct  245   FNPKRGDIKLGQVRLFLERAYKLSQEWGNIPVAIAGDLNSTPKSAIYDFIASADLDTQLH  304

Query  931   ERIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKL  761
             +R  ISGQ  +D   +    +             + W+ EEL+LATG   + H+ HQLKL
Sbjct  305   DRRQISGQSELDTKGRSFNHYAFSAGVSIYGSQTNEWSQEELQLATGGQATTHVQHQLKL  364

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              SAY GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++LRRT 
Sbjct  365   HSAYTGVPGTHRTRDQDGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLRRTG  424

Query  580   GLPSEEWGSDHLALVCELAFAGE  512
             GLPSE+WGSDHLA+ CEL F  E
Sbjct  425   GLPSEKWGSDHLAIACELGFVSE  447


 Score =   140 bits (353),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + K+  V VSYNLL V+NA  H DLY NV P+ ++W+ RK ++CKEI  
Sbjct  76    REWVFSSSNFENLKEKVVIVSYNLLGVDNALNHMDLYFNVSPKYLEWNRRKHLICKEISR  135

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD LL+  GF+GV++ RTG++ DGC+IFWK +L+ L
Sbjct  136   YNASILCLQEVDRFDDLDGLLKNRGFQGVHKNRTGEASDGCSIFWKEKLFKL  187



>ref|XP_006390497.1| hypothetical protein EUTSA_v10018567mg [Eutrema salsugineum]
 gb|ESQ27783.1| hypothetical protein EUTSA_v10018567mg [Eutrema salsugineum]
Length=440

 Score =   288 bits (737),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 192/269 (71%), Gaps = 19/269 (7%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNAL-----TSEDMSSQSFLVGNI  1121
             F LLH E IEF+RFGLRNNVAQ CV +     C +  + L          SS+  +VGNI
Sbjct  179   FKLLHHEEIEFDRFGLRNNVAQLCVLE---MNCEDPKSKLCTQSSKQTSTSSRRLVVGNI  235

Query  1120  HVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDI  941
             HVLFNPKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS PKS +Y F+TS+ LD 
Sbjct  236   HVLFNPKRGDIKLGQVRLFLERAYKLSQEWGNIPVAIAGDLNSTPKSPIYDFVTSADLDT  295

Query  940   RMHERIHISGQIDPSVKPT-----YRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHL  779
             ++H+R HISGQ +   K       Y F +  A+R     ++ W+ EEL+LATG   + H+
Sbjct  296   QLHDRRHISGQSELDTKERLFRNHYAFSAAYASR-----INEWSQEELQLATGGQATTHV  350

Query  778   LHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVN  599
              HQLKL SAY GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP +
Sbjct  351   QHQLKLNSAYTGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTD  410

Query  598   ILRRTRGLPSEEWGSDHLALVCELAFAGE  512
             +L RT GLP+E+WGSDHLA+ CEL F  E
Sbjct  411   VLERTGGLPTEKWGSDHLAIACELGFVSE  439


 Score =   141 bits (356),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + KD  V VSYNLL V+NA  H DLY NV P  ++W  RK ++CKEI G
Sbjct  70    REWVFSASNFRNLKDKVVLVSYNLLGVDNASNHMDLYFNVPPRHLEWSRRKHLICKEIGG  129

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+D+LD LL+  GF+GV++ RTG++ DGC+IFWK +L+ L
Sbjct  130   YNASILCLQEVDRFDELDGLLKNRGFQGVHKIRTGEASDGCSIFWKEKLFKL  181



>ref|XP_008453389.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 [Cucumis 
melo]
Length=455

 Score =   287 bits (735),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 201/266 (76%), Gaps = 13/266 (5%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LLH+E+IEF+ FGLRNNVAQ CV K          N   S+  +S+SF++GNIHVLFN
Sbjct  199   FSLLHQETIEFQSFGLRNNVAQLCVLK---------MNKSKSKSKTSRSFVIGNIHVLFN  249

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E A  LSQ WGNIP+++AGDLNS+PKSA+YQFL SS+LDI++H+R
Sbjct  250   PNRGDIKLGQVRLFLEKAHSLSQRWGNIPVIIAGDLNSIPKSAMYQFLASSELDIQLHDR  309

Query  925   IHISGQID-PSVKPTYRFKS--VPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLC  758
               ISGQ+D  S    +RF S     +         W+DEE+R+A+G+ +V  L HQLKL 
Sbjct  310   RKISGQLDFSSSHGAFRFCSGGTKWSNVSTSKSFGWSDEEIRIASGSENVTRLQHQLKLS  369

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY G+PG+ KTRD  GEPLATSFHSKFLGTVDYIWH+ +L P+RVL+ LPV+ L+RT G
Sbjct  370   SAYYGIPGSYKTRDTNGEPLATSFHSKFLGTVDYIWHSEKLAPVRVLETLPVDALKRTGG  429

Query  577   LPSEEWGSDHLALVCELAFAGEGDET  500
             LP+E+WGSDHLALVCELAF  + +++
Sbjct  430   LPNEKWGSDHLALVCELAFDDDENDS  455


 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 110/203 (54%), Gaps = 32/203 (16%)
 Frame = -2

Query  1988  TSSKRKTPRYNGDRREKRKKRRVTAVQTE------------AHSETLSLADNSNRTSTSH  1845
             T   ++ P  N    + RKKRR  AV +E            A S  L    + +RTS  H
Sbjct  19    TDKYKRKPSTNAATNDHRKKRRRLAVSSETAVPKSSNPQKLAASNRLKTIRSPSRTSRKH  78

Query  1844  MHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVEN  1665
                 +                    + T   R+WVYS RD S   D F+  SYN+L VEN
Sbjct  79    GKRRS--------------------SQTDGHRRWVYSARDCSRFIDTFMVASYNILGVEN  118

Query  1664  AKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGV  1485
             A KHPDLY  V  + +DW +RK+++C  I+ YN GI+C QEVDR++DLD L Q  G++GV
Sbjct  119   ALKHPDLYHRVPSKFLDWSFRKELICNAIKFYNAGILCLQEVDRFNDLDELFQNYGYKGV  178

Query  1484  YQPRTGDSCDGCAIFWKNELYDL  1416
             Y+ RTG++ DGCA+FW ++L+ L
Sbjct  179   YKARTGEANDGCAVFWIDKLFSL  201



>ref|XP_010677985.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=320

 Score =   280 bits (717),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 188/258 (73%), Gaps = 9/258 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E+IEF+ FGLRNNVAQFCV K    + ++D  AL+     S S +VGNIHVLF
Sbjct  65    RFKLLHEENIEFQSFGLRNNVAQFCVLKMNDDQLNSDP-ALSM----STSLVVGNIHVLF  119

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGDIKLGQIRL +E A RLS+EWG IP+VLAGD NS+P+SA+Y++++S+KLDI  H+
Sbjct  120   NPNRGDIKLGQIRLFLEKAHRLSEEWGGIPVVLAGDYNSVPQSALYEYVSSAKLDILQHD  179

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  I GQI+  ++    FK  P  + R  L + W DEEL+LA G+  V  L H LKL SA
Sbjct  180   RKRICGQIETPLRHNSLFKQ-PFRQKR--LQYGWNDEELKLAAGSEKVTCLQHSLKLHSA  236

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y GVPG   TRDD+GEP ATS HSKFLGTVDYIWH+  L+P+RVL+ LP N L    GLP
Sbjct  237   YLGVPGNIVTRDDVGEPWATSCHSKFLGTVDYIWHSEHLIPVRVLETLPRNALENIGGLP  296

Query  571   SEEWGSDHLALVCELAFA  518
             S+ WGSDHLALVCE A A
Sbjct  297   SKNWGSDHLALVCEFAVA  314


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  1619  MDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIF  1440
             M+WD+R+  +CKE+  Y+P I+CFQEVDR+ DL + LQ+DGF+GV + RTGD+ DGCAIF
Sbjct  1     MEWDHRRAAICKELTQYDPSILCFQEVDRFSDLHDALQQDGFKGVLKARTGDAQDGCAIF  60

Query  1439  WKNELYDL  1416
             WK+E + L
Sbjct  61    WKDERFKL  68



>ref|XP_010428337.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X3 [Camelina sativa]
Length=289

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 11/266 (4%)
 Frame = -3

Query  1291  CRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
              RF LL  + IEF+RF +RNNVAQ CV +   ++     + L+      +  +VGNIHVL
Sbjct  29    TRFELLDYQHIEFDRFDMRNNVAQLCVLEMNHED---PKSKLSVRPSDPRRLVVGNIHVL  85

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H
Sbjct  86    FNPKRGDIKLGQVRLFLEKAYQLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLH  145

Query  931   ERIHISGQIDPSVKPTYR-----FKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQ  770
             +R  ISGQ +  VKP  R     +    A      + + W+ EEL+ ATG   S H+ HQ
Sbjct  146   DRRQISGQSE--VKPKKRSFRNRYAVSAAVSTSGSVPNVWSQEELQFATGGQASTHVQHQ  203

Query  769   LKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILR  590
             LKL SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L 
Sbjct  204   LKLHSAYSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLT  263

Query  589   RTRGLPSEEWGSDHLALVCELAFAGE  512
             RT GLPSE+WGSDHLA+ CEL F  +
Sbjct  264   RTCGLPSEKWGSDHLAIACELGFVND  289



>ref|XP_002887512.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63771.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score =   284 bits (727),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 190/264 (72%), Gaps = 11/264 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF++FG+RNNVAQ CV +     C +  + L       Q  +VGNIHVLFN
Sbjct  193   FKLLDHQHIEFDKFGMRNNVAQLCVLEMN---CEDPKSKLRVRSSDPQRLVVGNIHVLFN  249

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R
Sbjct  250   PKRGDIKLGQVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDR  309

Query  925   IHISGQ--IDP---SVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
               ISGQ  ++P   S +  Y F +  +     P  + W+ EEL+LATG   +  + HQLK
Sbjct  310   RQISGQGEVEPEERSFRNHYAFSASVSISGSLP--NEWSQEELQLATGGQATTRVQHQLK  367

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++LRRT
Sbjct  368   LHSAYSGVPGTYRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLRRT  427

Query  583   RGLPSEEWGSDHLALVCELAFAGE  512
              GLPSE+WGSDHLA+ CEL F  +
Sbjct  428   GGLPSEKWGSDHLAIACELGFVND  451


 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 84/121 (69%), Gaps = 4/121 (3%)
 Frame = -2

Query  1766  NTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILC  1587
             +T   R+WV+S  +  + K+  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++C
Sbjct  75    STSIEREWVFSTNNFENLKEKLVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLIC  134

Query  1586  KEIRGYNPGIMCFQ----EVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             KEI  YN  I+C Q    EVDR+DDLD LL+  GF+GV++ RTG++ DGCAIFWK +L+ 
Sbjct  135   KEISRYNASILCLQASSGEVDRFDDLDVLLKNRGFQGVHKRRTGEASDGCAIFWKEKLFK  194

Query  1418  L  1416
             L
Sbjct  195   L  195



>ref|XP_004155030.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
[Cucumis sativus]
Length=462

 Score =   284 bits (726),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 200/269 (74%), Gaps = 12/269 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDM---SSQSFLVGNIHV  1115
             F+LLH+E+IEF+ FGLRNNVAQ CV K     C      LTS  +    S+SF++GNIHV
Sbjct  199   FSLLHQETIEFQNFGLRNNVAQLCVLK---SHCL--FFLLTSMHVFINCSRSFVIGNIHV  253

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             LFNP RGDIKLGQ+RL +E A  LSQ WGN+P+++AGDLNS+PKSA+YQFL SS+LDI++
Sbjct  254   LFNPNRGDIKLGQVRLFLEKAHSLSQRWGNVPVIIAGDLNSIPKSAIYQFLASSELDIQL  313

Query  934   HERIHISGQID-PSVKPTYRFKS--VPAARARKPLMHRWTDEELRLATGTVSV-HLLHQL  767
             H+R  ISGQ+D  S    +RF S     +         W+DEE+R+A+G+ +V  L H L
Sbjct  314   HDRRKISGQLDFSSSHGAFRFCSGGTKWSNVSTSKSFGWSDEEIRIASGSENVTRLQHPL  373

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KL SAY G+PG+ KTRD  GEPL TSFHSKF+GTVDYIWH+ +L P+RVL+ LPV+ L++
Sbjct  374   KLSSAYYGIPGSYKTRDTNGEPLVTSFHSKFMGTVDYIWHSEKLAPVRVLETLPVDALKK  433

Query  586   TRGLPSEEWGSDHLALVCELAFAGEGDET  500
             T GLP+E+WGSDHLALVCELAF  + +++
Sbjct  434   TGGLPNEKWGSDHLALVCELAFDDDENDS  462


 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 109/203 (54%), Gaps = 32/203 (16%)
 Frame = -2

Query  1988  TSSKRKTPRYNGDRREKRKKRRVTAVQTE------------AHSETLSLADNSNRTSTSH  1845
             T   ++ P  +    + RKKRR  AV +E            A S  L    + +RTS  H
Sbjct  19    TDKNKRKPSTSAAPNDHRKKRRRLAVSSETAIPKSSDPQKLAASSRLKTICSPSRTSRKH  78

Query  1844  MHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVEN  1665
                 +                    + T   R+WVYS RD S   D F+  SYN+L VEN
Sbjct  79    GKRRS--------------------SQTDGHRRWVYSARDCSRFIDKFMVASYNILGVEN  118

Query  1664  AKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGV  1485
             A  HPDLY  V  + +DW +RK+++C  I+ YN GI+C QEVDR+DDLD L Q  G++GV
Sbjct  119   ALNHPDLYHRVPSKFLDWSFRKELICNAIKFYNAGILCLQEVDRFDDLDELFQNYGYKGV  178

Query  1484  YQPRTGDSCDGCAIFWKNELYDL  1416
             Y+ RTG++ DGCA+FW ++L+ L
Sbjct  179   YKARTGEANDGCAVFWIDKLFSL  201



>ref|XP_010428336.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Camelina sativa]
Length=447

 Score =   281 bits (718),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 189/260 (73%), Gaps = 7/260 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV +   ++     + L+      +  +VGNIHVLFN
Sbjct  193   FELLDYQHIEFDRFDMRNNVAQLCVLEMNHED---PKSKLSVRPSDPRRLVVGNIHVLFN  249

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R
Sbjct  250   PKRGDIKLGQVRLFLEKAYQLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDR  309

Query  925   IHISGQIDPSVKPTYR-FKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
               ISGQ +  VKP  R F++  A      + + W+ EEL+ ATG   S H+ HQLKL SA
Sbjct  310   RQISGQSE--VKPKKRSFRNRAAVSTSGSVPNVWSQEELQFATGGQASTHVQHQLKLHSA  367

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT GLP
Sbjct  368   YSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRTCGLP  427

Query  571   SEEWGSDHLALVCELAFAGE  512
             SE+WGSDHLA+ CEL F  +
Sbjct  428   SEKWGSDHLAIACELGFVND  447


 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV  + ++W  RK ++CKEI  
Sbjct  84    RQWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPRKHLEWSRRKHLICKEISR  143

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DD+D +L+K GF+GV++ RTG++ DGCAIFWK +L++L
Sbjct  144   YNASILCLQEVDRFDDIDCILKKRGFQGVHKSRTGEASDGCAIFWKEKLFEL  195



>gb|KGN63816.1| hypothetical protein Csa_1G023040 [Cucumis sativus]
Length=455

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 199/266 (75%), Gaps = 13/266 (5%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LLH+E+IEF+ FGLRNNVAQ CV K          N   S+  +S+SF++GNIHVLFN
Sbjct  199   FSLLHQETIEFQNFGLRNNVAQLCVLK---------MNKSKSKSKTSRSFVIGNIHVLFN  249

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E A  LSQ WGN+P+++AGDLNS+PKSA+YQFL SS+LDI++H+R
Sbjct  250   PNRGDIKLGQVRLFLEKAHSLSQRWGNVPVIIAGDLNSIPKSAIYQFLASSELDIQLHDR  309

Query  925   IHISGQID-PSVKPTYRFKS--VPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLC  758
               ISGQ+D  S    +RF S     +         W+DEE+R+A+G+ +V  L H LKL 
Sbjct  310   RKISGQLDFSSSHGAFRFCSGGTKWSNVSTSKSFGWSDEEIRIASGSENVTRLQHPLKLS  369

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY G+PG+ KTRD  GEPL TSFHSKF+GTVDYIWH+ +L P+RVL+ LPV+ L++T G
Sbjct  370   SAYYGIPGSYKTRDTNGEPLVTSFHSKFMGTVDYIWHSEKLAPVRVLETLPVDALKKTGG  429

Query  577   LPSEEWGSDHLALVCELAFAGEGDET  500
             LP+E+WGSDHLALVCELAF  + +++
Sbjct  430   LPNEKWGSDHLALVCELAFDDDENDS  455


 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 109/203 (54%), Gaps = 32/203 (16%)
 Frame = -2

Query  1988  TSSKRKTPRYNGDRREKRKKRRVTAVQTE------------AHSETLSLADNSNRTSTSH  1845
             T   ++ P  +    + RKKRR  AV +E            A S  L    + +RTS  H
Sbjct  19    TDKNKRKPSTSAAPNDHRKKRRRLAVSSETAIPKSSDPQKLAASSRLKTICSPSRTSRKH  78

Query  1844  MHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVEN  1665
                 +                    + T   R+WVYS RD S   D F+  SYN+L VEN
Sbjct  79    GKRRS--------------------SQTDGHRRWVYSARDCSRFIDKFMVASYNILGVEN  118

Query  1664  AKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGV  1485
             A  HPDLY  V  + +DW +RK+++C  I+ YN GI+C QEVDR+DDLD L Q  G++GV
Sbjct  119   ALNHPDLYHRVPSKFLDWSFRKELICNAIKFYNAGILCLQEVDRFDDLDELFQNYGYKGV  178

Query  1484  YQPRTGDSCDGCAIFWKNELYDL  1416
             Y+ RTG++ DGCA+FW ++L+ L
Sbjct  179   YKARTGEANDGCAVFWIDKLFSL  201



>ref|XP_010677984.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=463

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 188/259 (73%), Gaps = 9/259 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E+IEF+ FGLRNNVAQFCV K    + ++D  AL+     S S +VGNIHVLF
Sbjct  208   RFKLLHEENIEFQSFGLRNNVAQFCVLKMNDDQLNSDP-ALSM----STSLVVGNIHVLF  262

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGDIKLGQIRL +E A RLS+EWG IP+VLAGD NS+P+SA+Y++++S+KLDI  H+
Sbjct  263   NPNRGDIKLGQIRLFLEKAHRLSEEWGGIPVVLAGDYNSVPQSALYEYVSSAKLDILQHD  322

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  I GQI+  ++    FK  P  + R  L + W DEEL+LA G+  V  L H LKL SA
Sbjct  323   RKRICGQIETPLRHNSLFKQ-PFRQKR--LQYGWNDEELKLAAGSEKVTCLQHSLKLHSA  379

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y GVPG   TRDD+GEP ATS HSKFLGTVDYIWH+  L+P+RVL+ LP N L    GLP
Sbjct  380   YLGVPGNIVTRDDVGEPWATSCHSKFLGTVDYIWHSEHLIPVRVLETLPRNALENIGGLP  439

Query  571   SEEWGSDHLALVCELAFAG  515
             S+ WGSDHLALVCE A A 
Sbjct  440   SKNWGSDHLALVCEFAVAN  458


 Score =   144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKW YS  D S  +D  V VSYN+LAVENA KHP LY  V  + M+WD+R+  +CKE+  
Sbjct  100   RKWSYSDCDSSAFRDKLVLVSYNILAVENASKHPHLYLEVPFKYMEWDHRRAAICKELTQ  159

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             Y+P I+CFQEVDR+ DL + LQ+DGF+GV + RTGD+ DGCAIFWK+E + L
Sbjct  160   YDPSILCFQEVDRFSDLHDALQQDGFKGVLKARTGDAQDGCAIFWKDERFKL  211



>ref|XP_010416214.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X4 [Camelina sativa]
Length=444

 Score =   278 bits (710),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 189/262 (72%), Gaps = 7/262 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV +   K+     + L+      +  +VGNIHVLFN
Sbjct  186   FKLLDYQHIEFDRFDMRNNVAQLCVLEMNHKD---PKSKLSIRPSDPRRLVVGNIHVLFN  242

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R
Sbjct  243   PKRGDIKLGQVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDR  302

Query  925   IHISGQ--IDPSVKPTYRFKSVPAA-RARKPLMHRWTDEELRLATG-TVSVHLLHQLKLC  758
               ISGQ  ++P  +   +  +V AA  A   L + W+ EEL+ ATG   S H+ HQLKL 
Sbjct  303   RQISGQSEVEPKKRSFRKRYAVSAAVSASGSLPNAWSKEELQFATGGQASTHVQHQLKLH  362

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT  
Sbjct  363   SAYSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRTCR  422

Query  577   LPSEEWGSDHLALVCELAFAGE  512
             LPSE+WGSDHLA+ CEL F  +
Sbjct  423   LPSEKWGSDHLAIACELGFVND  444


 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++CKEI  
Sbjct  77    REWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLICKEISR  136

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD +L+  GF+GV++ RTG++ DGCAIFWK +L+ L
Sbjct  137   YNASILCLQEVDRFDDLDGILKNRGFQGVHKSRTGEASDGCAIFWKEKLFKL  188



>ref|XP_010471466.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Camelina sativa]
 ref|XP_010471467.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Camelina sativa]
Length=444

 Score =   277 bits (708),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 191/264 (72%), Gaps = 11/264 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV +   ++     + L+      +  +VGNIHVLFN
Sbjct  186   FKLLDYQHIEFDRFDMRNNVAQLCVLEMNHED---PKSKLSVRPSDPRRLVVGNIHVLFN  242

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL +E A +LSQEWGNIP+V+AGDLNS P+SA+Y F+ S+ LD ++H R
Sbjct  243   PKRGDIKLGQVRLFLEKAYQLSQEWGNIPVVIAGDLNSTPQSAIYDFIASADLDTQLHNR  302

Query  925   IHISGQIDPSVKPTYR-FKSVPAARA----RKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
               ISGQ +  ++P  R F++  A RA       L + W+ EEL+ ATG   S H+ HQLK
Sbjct  303   RQISGQSE--MEPKKRSFRNRYAVRAAVSTSGSLPNVWSKEELQFATGGQASTHVQHQLK  360

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT
Sbjct  361   LHSAYSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRT  420

Query  583   RGLPSEEWGSDHLALVCELAFAGE  512
              GLPSE+WGSDHLA+ CEL F  +
Sbjct  421   CGLPSEKWGSDHLAIACELGFVND  444


 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++CKEI  
Sbjct  77    REWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLICKEISR  136

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD LL+  GF+GV++ RTG++ DGCAIFWK +L+ L
Sbjct  137   YNASILCLQEVDRFDDLDGLLKTRGFQGVHKSRTGEASDGCAIFWKEKLFKL  188



>ref|XP_010428334.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Camelina sativa]
 ref|XP_010428335.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X1 [Camelina sativa]
Length=451

 Score =   277 bits (708),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 187/264 (71%), Gaps = 11/264 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV +   ++     + L+      +  +VGNIHVLFN
Sbjct  193   FELLDYQHIEFDRFDMRNNVAQLCVLEMNHED---PKSKLSVRPSDPRRLVVGNIHVLFN  249

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGDIKLGQ+RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R
Sbjct  250   PKRGDIKLGQVRLFLEKAYQLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDR  309

Query  925   IHISGQIDPSVKPTYR-----FKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
               ISGQ +  VKP  R     +    A      + + W+ EEL+ ATG   S H+ HQLK
Sbjct  310   RQISGQSE--VKPKKRSFRNRYAVSAAVSTSGSVPNVWSQEELQFATGGQASTHVQHQLK  367

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT
Sbjct  368   LHSAYSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRT  427

Query  583   RGLPSEEWGSDHLALVCELAFAGE  512
              GLPSE+WGSDHLA+ CEL F  +
Sbjct  428   CGLPSEKWGSDHLAIACELGFVND  451


 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV  + ++W  RK ++CKEI  
Sbjct  84    RQWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPRKHLEWSRRKHLICKEISR  143

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DD+D +L+K GF+GV++ RTG++ DGCAIFWK +L++L
Sbjct  144   YNASILCLQEVDRFDDIDCILKKRGFQGVHKSRTGEASDGCAIFWKEKLFEL  195



>ref|XP_006845304.1| hypothetical protein AMTR_s00005p00269440 [Amborella trichopoda]
 gb|ERN06979.1| hypothetical protein AMTR_s00005p00269440 [Amborella trichopoda]
Length=432

 Score =   274 bits (701),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 187/262 (71%), Gaps = 20/262 (8%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LLH+ESIEF +FGLR+NVAQ C+ + K + C              ++ LVGNIHVLFN
Sbjct  185   FNLLHEESIEFRKFGLRDNVAQLCILRYKGRHCE-------------RNLLVGNIHVLFN  231

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             PKRGD+KLGQIRLL++ A  LSQ+WG IPIVL GD NS+P+SA+YQF+ SSKLD+ MH+R
Sbjct  232   PKRGDVKLGQIRLLLKKAHTLSQQWGKIPIVLTGDFNSLPQSALYQFVASSKLDLLMHDR  291

Query  925   IHISGQIDPSV--KPTYRFKSVPAARARKPLM-HRWTDEELRLATGTVS-VHLLHQLKLC  758
              +ISGQI+ S    P  + +++    AR P   + W+ EE  +ATG     HL H + L 
Sbjct  292   KNISGQIEHSSWQDPVEQQRNLS---ARSPWYSYIWSAEEREIATGKAGCTHLQHPINLR  348

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY+ V GT  TRD  GEPL +S+HSKF+GTVDYIWH+ ELVP+ V+D LP+NILRR RG
Sbjct  349   SAYSEVAGTHNTRDTCGEPLVSSYHSKFMGTVDYIWHSEELVPIGVVDTLPINILRRRRG  408

Query  577   LPSEEWGSDHLALVCELAFAGE  512
             LPSE  GSDHLALVCE AFA +
Sbjct  409   LPSENCGSDHLALVCEFAFANQ  430


 Score =   142 bits (358),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             +R+WV+S  D+S  +D FV VSYN+L V+N  KH DLY +V P++++WD+RK +L +EI+
Sbjct  75    QRRWVFSSHDLSSYRDRFVIVSYNILGVDNVLKHMDLYHHVSPQILNWDWRKNLLHEEIK  134

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              Y P I+C QEVD++DD+  LL+KDG+ GVY+ RTG++ DGCA+FWK  +++L
Sbjct  135   CYKPSILCLQEVDQFDDIVMLLKKDGYEGVYKGRTGNANDGCAVFWKEHMFNL  187



>ref|XP_011072945.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X3 [Sesamum indicum]
Length=429

 Score =   273 bits (697),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 180/239 (75%), Gaps = 3/239 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +FTLLH+ESIEF+RFGLRNNVAQFCV K  +   S    A      +S++FLVGNIHVL+
Sbjct  194   QFTLLHEESIEFQRFGLRNNVAQFCVLKMNQDLPSTGVTARPPCPSTSRNFLVGNIHVLY  253

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+ +E A  LSQEWG IP+V+ GDLNS+P+SA+YQFL SSKL I+ ++
Sbjct  254   NPKRGDIKLGQMRIFLEKAYELSQEWGCIPVVITGDLNSLPQSAMYQFLASSKLHIQQYD  313

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAY  749
             R H+SGQI PS    Y        R  +PLM+RWT+EE+ LATG+    L H LKLCSAY
Sbjct  314   RRHVSGQIFPS---EYAESQSRRNRITRPLMNRWTNEEIMLATGSRLSVLRHHLKLCSAY  370

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             AGVPGT + RD +GEPL TS+H  F GTVDYIWHT++LVP+RVL+ LP+  L++T GLP
Sbjct  371   AGVPGTPEVRDKIGEPLTTSYHCLFTGTVDYIWHTSDLVPVRVLETLPICSLKKTGGLP  429


 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 16/181 (9%)
 Frame = -2

Query  1952  DRREKRKKRRVTAVQTEA--HSETLSLADNSNRTSTSHMHAYAHANYhrggehrgkrkrq  1779
             +R+  RKKR+V + +TE     +TL  +  ++R + S++    ++               
Sbjct  31    ERQRSRKKRKVISSETETRIQIQTLRPSSYTHRRTNSYVQKQGNSR--------------  76

Query  1778  RPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             + P     +RKW YS  DVS+  D FV VSYN+L VENA KHP+LY  V P+ +DW +RK
Sbjct  77    KKPRKPQCQRKWTYSTHDVSNYNDRFVIVSYNILGVENATKHPELYRGVSPKYLDWGHRK  136

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             ++LCKE++ Y   I+CFQEVD ++DL  +L  DGFRG+++ R+G++ DGCAIFWK E + 
Sbjct  137   KLLCKEVKDYQASILCFQEVDHFNDLKEILGSDGFRGLHKARSGETRDGCAIFWKTEQFT  196

Query  1418  L  1416
             L
Sbjct  197   L  197



>ref|XP_011072944.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Sesamum indicum]
Length=444

 Score =   272 bits (696),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 181/241 (75%), Gaps = 3/241 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +FTLLH+ESIEF+RFGLRNNVAQFCV K  +   S    A      +S++FLVGNIHVL+
Sbjct  194   QFTLLHEESIEFQRFGLRNNVAQFCVLKMNQDLPSTGVTARPPCPSTSRNFLVGNIHVLY  253

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+ +E A  LSQEWG IP+V+ GDLNS+P+SA+YQFL SSKL I+ ++
Sbjct  254   NPKRGDIKLGQMRIFLEKAYELSQEWGCIPVVITGDLNSLPQSAMYQFLASSKLHIQQYD  313

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAY  749
             R H+SGQI PS    Y        R  +PLM+RWT+EE+ LATG+    L H LKLCSAY
Sbjct  314   RRHVSGQIFPS---EYAESQSRRNRITRPLMNRWTNEEIMLATGSRLSVLRHHLKLCSAY  370

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPS  569
             AGVPGT + RD +GEPL TS+H  F GTVDYIWHT++LVP+RVL+ LP+  L++T GLP 
Sbjct  371   AGVPGTPEVRDKIGEPLTTSYHCLFTGTVDYIWHTSDLVPVRVLETLPICSLKKTGGLPC  430

Query  568   E  566
             +
Sbjct  431   K  431


 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 16/181 (9%)
 Frame = -2

Query  1952  DRREKRKKRRVTAVQTEA--HSETLSLADNSNRTSTSHMHAYAHANYhrggehrgkrkrq  1779
             +R+  RKKR+V + +TE     +TL  +  ++R + S++    ++               
Sbjct  31    ERQRSRKKRKVISSETETRIQIQTLRPSSYTHRRTNSYVQKQGNSR--------------  76

Query  1778  RPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             + P     +RKW YS  DVS+  D FV VSYN+L VENA KHP+LY  V P+ +DW +RK
Sbjct  77    KKPRKPQCQRKWTYSTHDVSNYNDRFVIVSYNILGVENATKHPELYRGVSPKYLDWGHRK  136

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             ++LCKE++ Y   I+CFQEVD ++DL  +L  DGFRG+++ R+G++ DGCAIFWK E + 
Sbjct  137   KLLCKEVKDYQASILCFQEVDHFNDLKEILGSDGFRGLHKARSGETRDGCAIFWKTEQFT  196

Query  1418  L  1416
             L
Sbjct  197   L  197



>ref|XP_002438205.1| hypothetical protein SORBIDRAFT_10g009570 [Sorghum bicolor]
 gb|EER89572.1| hypothetical protein SORBIDRAFT_10g009570 [Sorghum bicolor]
Length=468

 Score =   233 bits (594),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 172/264 (65%), Gaps = 26/264 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ CVF                E   +  F++GNIHVLF
Sbjct  197   RLHLLEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKFVLGNIHVLF  240

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQIR+L+E A  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+
Sbjct  241   NPKRGDIKLGQIRMLLEKANALAEKWDKIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHD  300

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y   S+        L ++WTDEE+R ATG  +V +  H LKL S+
Sbjct  301   RRQLSG-LDSSDFGLYELCSL--------LKYQWTDEEVRNATGCSNVVVAEHPLKLSSS  351

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G S  R   GEP ATS+H KFLGTVDY+WHT  +   RVLD LP+ +LRRTRGLP
Sbjct  352   YAMLKGNSDNRGLHGEPSATSYHKKFLGTVDYLWHTRGIECSRVLDTLPIGVLRRTRGLP  411

Query  571   SEEWGSDHLALVCELAFAGEGDET  500
             + E GSDHL +V E +F    D++
Sbjct  412   TREIGSDHLPIVAEFSFPESVDDS  435


 Score = 92.4 bits (228),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = -2

Query  1751  RKWVYSP-RDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R WV S     S   D    +SYN+LA  NA+ HPDLY +V  + + WD R++++ +EIR
Sbjct  88    RLWVCSEDASTSPSGDACTIMSYNILADYNAQNHPDLYLDVPWDALRWDSRRRLIIREIR  147

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDLHLI  1407
              ++P ++C QEVDR+ D+   ++  G+ G+YQ RTGD+ DGCA+FWK++   LHL+
Sbjct  148   HWDPDLVCLQEVDRFQDIATGMKSRGYEGIYQRRTGDTRDGCAMFWKSK--RLHLL  201



>ref|XP_010263640.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Nelumbo nucifera]
Length=446

 Score =   270 bits (689),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 186/244 (76%), Gaps = 7/244 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSND---SNALTSEDMSSQSFLVGNIHV  1115
             FTLLH+E+IEF++FGLR+NVAQ CV K     CS+    S A  SE   ++S LVGNIH+
Sbjct  199   FTLLHEENIEFQKFGLRDNVAQLCVLKMN-NHCSSSHHGSEAQASETSPARSLLVGNIHM  257

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             LFNP RGDIKLGQIRL ++NA R+SQEWGNIP+V+AGDLNS+P+SA+Y+FL SS+LDI +
Sbjct  258   LFNPNRGDIKLGQIRLFLDNAHRISQEWGNIPVVIAGDLNSIPQSAIYRFLDSSELDILL  317

Query  934   HERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSV-HLLHQLKLC  758
             H+R  ISGQ++  +   + FK+     + +PL +RW+ EE+RLATG   + HL H LKL 
Sbjct  318   HDRRKISGQVEYPIGLKH-FKT-QREDSYRPLRYRWSQEEIRLATGCDGITHLRHHLKLS  375

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S Y GV G+ +TRD   EPLATS+HSKF+GTVDYIWH+ EL+P+ V++ LPVNILR T G
Sbjct  376   SVYRGVAGSCRTRDSNEEPLATSYHSKFMGTVDYIWHSRELIPVGVIETLPVNILRETGG  435

Query  577   LPSE  566
             LPSE
Sbjct  436   LPSE  439


 Score =   162 bits (409),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = -2

Query  1934  KKRRVTAVQTEAHSETLSLADNSNRTSTSHMHAYAHANYhrggehrgkrkrqRPPANTVD  1755
             K+RR+ ++++EAH   LSL   S+R    ++ + +  N       + + +++R   +   
Sbjct  27    KRRRLASLESEAHVHCLSLHQISSRDE--YLPSPSGRNVKLSSVRQVRNRKRRSSRSKKR  84

Query  1754  R----RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILC  1587
                  RKWV+S  D S  KD  V VSYN+L VEN  KHPDLYP V P+ ++W++RK+++ 
Sbjct  85    TKDGYRKWVFSSHDCSRYKDKVVVVSYNILGVENVLKHPDLYPQVPPQFLNWEWRKKLIR  144

Query  1586  KEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             KE+  Y P I+C QEVDR++DL +LLQKDGFRGVY+ RTG++CDGCA+FWK EL+ L
Sbjct  145   KELNHYMPSIVCLQEVDRFNDLSDLLQKDGFRGVYKARTGEACDGCALFWKEELFTL  201



>ref|XP_002975880.1| hypothetical protein SELMODRAFT_104238, partial [Selaginella 
moellendorffii]
 gb|EFJ22785.1| hypothetical protein SELMODRAFT_104238, partial [Selaginella 
moellendorffii]
Length=359

 Score =   226 bits (577),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 173/273 (63%), Gaps = 23/273 (8%)
 Frame = -3

Query  1294  ECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSS---QSFLVGN  1124
             E RF LL +ESI+F+ +GLR+N+ Q CV +  R+       A    D+SS   Q  +V N
Sbjct  96    EKRFLLLEEESIDFKDYGLRDNIGQICVLRSTRE-------AALEGDVSSIENQVLVVAN  148

Query  1123  IHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLD  944
              H+LFNPKRGDIKLGQ R   + AQ LS  WG   +++AGD NS P S +Y+++++++LD
Sbjct  149   THILFNPKRGDIKLGQARF--DFAQELSSSWGGAQVIVAGDFNSTPSSPLYRYISTAELD  206

Query  943   IRMHERIHISGQIDPSVKPTYRFK-SVPAARARKP---------LMHRWTDEELRLATGT  794
             +   +R  ISGQI       YR   S P  R   P         L   WT EEL  ATGT
Sbjct  207   VSSLDRRSISGQIADGEGGYYRNPFSKPWIRGHNPSSAGFSRINLPSGWTVEELVNATGT  266

Query  793   VS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvl  617
              S   ++H LKL SAY+ + G + +RD  GEPLAT++H KF GTVDYIWHT  L PLRV+
Sbjct  267   SSSTKVVHDLKLSSAYSEIEGKAGSRDSQGEPLATTYHKKFKGTVDYIWHTERLRPLRVV  326

Query  616   dplpVNILRRTRGLPSEEWGSDHLALVCELAFA  518
             D L V++LR T GLPS++WGSDHLALVCE+ F+
Sbjct  327   DMLSVDVLRHTGGLPSQKWGSDHLALVCEMEFS  359


 Score = 96.7 bits (239),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -2

Query  1703  FVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYD  1527
             F+F+SYN+LA +NA++H  +LY ++    + WD+RK  L +EI  ++P I+C QEVDR+ 
Sbjct  5     FMFLSYNILAADNAREHYRELYYHIPMRYVKWDWRKVRLVQEIEYWSPDILCLQEVDRFA  64

Query  1526  DLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             DL   L K G+ G ++ RTG + DGCAIFW+ + + L
Sbjct  65    DLQGELVKRGYAGTFKRRTGTATDGCAIFWREKRFLL  101



>gb|KEH27038.1| carbon catabolite repressor-like protein [Medicago truncatula]
Length=366

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHVL  1112
             F+LLH+E IEF++FG+R+NVAQ CV +       +D+  LT+E+ S+++  F++GNIHVL
Sbjct  153   FSLLHQEDIEFQKFGMRHNVAQLCVLEVNNNNPESDTCKLTAEEQSTKNKRFVIGNIHVL  212

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RLL++ A +LSQEWG+IP++LAGDLNS+P+SA+Y+FL+SSKLDI+ H
Sbjct  213   FNPNRGDIKLGQVRLLIDKAYKLSQEWGDIPVILAGDLNSVPQSAIYKFLSSSKLDIQSH  272

Query  931   ERIHISGQIDPSVKPTYR-FKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLC  758
             +R ++SGQ++  ++P +R F+S  +    + L+H+W+ EEL LATG   V  L HQLKL 
Sbjct  273   DRRNMSGQLE--IRPNHREFRSNISMSVSRQLLHKWSAEELILATGAKGVTCLQHQLKLR  330

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIW  650
             SAY+GVPG  +TRDD+GEPLATS+HSKF+GTVDYIW
Sbjct  331   SAYSGVPGKHRTRDDIGEPLATSYHSKFMGTVDYIW  366


 Score =   125 bits (315),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S  D S C D  V VSYN+L VENA  H DLY N+    +DW  RK+++ +EI  
Sbjct  44    RKWVFSSEDYSDCADTIVVVSYNILGVENASNHLDLYSNIPRRFLDWGRRKRLILEEIDS  103

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVD +DDLD+L Q +GF+ VY+ RTG++ DGCAIFWK++L+ L
Sbjct  104   YNASILCFQEVDHFDDLDDLFQNNGFKSVYKGRTGEANDGCAIFWKDKLFSL  155



>ref|XP_007036516.1| DNAse I-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY21017.1| DNAse I-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=431

 Score =   262 bits (669),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 168/222 (76%), Gaps = 12/222 (5%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSE--DMSSQSFLVGNIHVL  1112
             FTLL +E+IEF+ FGLRNNVAQ CV K  + +  +DS    S+   M S+S LVGNIH L
Sbjct  202   FTLLQEENIEFQDFGLRNNVAQLCVLKINQHQLESDSCRKQSKITPMQSRSLLVGNIHAL  261

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RL +E A +LSQEWG+IP++L GD NS+P+SA+YQFL SS+L+I++H
Sbjct  262   FNPNRGDIKLGQVRLFLEKAYKLSQEWGSIPVILVGDFNSIPQSAIYQFLASSELNIQLH  321

Query  931   ERIHISGQID-PSVKPTYRFKS-----VPAARARKPLMHRWTDEELRLATGTVSV-HLLH  773
             +R  ISGQ++ PS     R ++     +P +R    L HRW+DEEL LATG   V HL H
Sbjct  322   DRRRISGQLEYPSQGREIRAQNKRHVWMPVSRQ---LSHRWSDEELVLATGDEGVTHLQH  378

Query  772   QLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWH  647
             +LKLCSAYAG+PG+S+TRD  GEPLATS+HSKF+GTVDYIW+
Sbjct  379   KLKLCSAYAGIPGSSRTRDSHGEPLATSYHSKFMGTVDYIWY  420


 Score =   154 bits (388),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S R+ S+ KD  V VSYN+L  EN  KHPDLY +V P+ ++W  RK ++ +E+  
Sbjct  93    RKWVFSSRNCSNYKDKLVIVSYNILGAENVAKHPDLYLDVPPKFLEWSRRKDLISEEVNR  152

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVDR+ DLD+LLQKDGF+GVY+ RTG+ CDGCA+FWK++++ L
Sbjct  153   YNASILCFQEVDRFKDLDDLLQKDGFKGVYKARTGNGCDGCALFWKDKIFTL  204



>ref|XP_010094762.1| hypothetical protein L484_019972 [Morus notabilis]
 gb|EXB56927.1| hypothetical protein L484_019972 [Morus notabilis]
Length=588

 Score =   266 bits (679),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 195/289 (67%), Gaps = 20/289 (7%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTS-EDMSSQSFLVGNIHVLF  1109
             FTLLH+E+IEF+ FGLRNNVAQ CV K K  +   D +  T      S+SF++GNIHVLF
Sbjct  196   FTLLHQENIEFQSFGLRNNVAQLCVLKMKPNQSELDEHPQTMLPPTQSRSFVIGNIHVLF  255

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGDIKLGQ+RLL+E A +LSQEWG+IP++L GD+NS+P+           LD+++H+
Sbjct  256   NPNRGDIKLGQVRLLLEKASKLSQEWGSIPVILCGDINSIPQ-----------LDVQLHD  304

Query  928   RIHISGQIDPSVK-PTYRFKSVPAARAR----KPLMHRWTDEELRLATGTVSV-HLLHQL  767
             R +ISGQ++   K   +R +   A+  R    +PL HRW+DEELRLATG+  V +L H L
Sbjct  305   RRNISGQVEFQSKCRVFRSQDEKASSIRTSISRPLFHRWSDEELRLATGSGEVTYLQHHL  364

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KLCSAY GVP + +TRDD GEP+ATSFHSKF+GTVDYIWHT E VP++VL+ LPV+IL+R
Sbjct  365   KLCSAYHGVPASCRTRDDFGEPVATSFHSKFMGTVDYIWHTEEFVPVKVLETLPVDILKR  424

Query  586   TRGLPSE--EWGSDHLALVCELAFAGEGDET*IAFVEAACLANHSRTVI  446
             T GLPS+    G+    +  +  F         + +   C A H R  I
Sbjct  425   TGGLPSKTIAAGTHRCDICTKFQFKPTPSYALTSLISLECRALHLRGKI  473


 Score =   145 bits (367),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+W YS RD S  KD  V VSYN+L VENA KHPDLY  V    M+W+ RK+++ KEI  
Sbjct  87    RRWAYSSRDSSSFKDKVVVVSYNILGVENASKHPDLYFKVPQRFMEWNRRKKLIRKEINR  146

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVD +DDL++L +KDGF+GVY+ RTG++ DGCAIFWK +L+ L
Sbjct  147   YNTSILCLQEVDNFDDLNDLFRKDGFKGVYKARTGEAYDGCAIFWKEDLFTL  198



>ref|XP_004138343.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
[Cucumis sativus]
Length=451

 Score =   259 bits (662),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 190/269 (71%), Gaps = 23/269 (9%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDM---SSQSFLVGNIHV  1115
             F+LLH+E+IEF+ FGLRNNVAQ CV K     C      LTS  +    S+SF++GNIHV
Sbjct  199   FSLLHQETIEFQNFGLRNNVAQLCVLK---SHCL--FFLLTSMHVFINCSRSFVIGNIHV  253

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             LFNP RGDIKLGQ+RL +E A  LSQ WGN+P+++AGDLNS+PK           LDI++
Sbjct  254   LFNPNRGDIKLGQVRLFLEKAHSLSQRWGNVPVIIAGDLNSIPK-----------LDIQL  302

Query  934   HERIHISGQID-PSVKPTYRFKS--VPAARARKPLMHRWTDEELRLATGTVSV-HLLHQL  767
             H+R  ISGQ+D  S    +RF S     +         W+DEE+R+A+G+ +V  L H L
Sbjct  303   HDRRKISGQLDFSSSHGAFRFCSGGTKWSNVSTSKSFGWSDEEIRIASGSENVTRLQHPL  362

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KL SAY G+PG+ KTRD  GEPL TSFHSKF+GTVDYIWH+ +L P+RVL+ LPV+ L++
Sbjct  363   KLSSAYYGIPGSYKTRDTNGEPLVTSFHSKFMGTVDYIWHSEKLAPVRVLETLPVDALKK  422

Query  586   TRGLPSEEWGSDHLALVCELAFAGEGDET  500
             T GLP+E+WGSDHLALVCELAF  + +++
Sbjct  423   TGGLPNEKWGSDHLALVCELAFDDDENDS  451


 Score =   146 bits (368),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 109/203 (54%), Gaps = 32/203 (16%)
 Frame = -2

Query  1988  TSSKRKTPRYNGDRREKRKKRRVTAVQTE------------AHSETLSLADNSNRTSTSH  1845
             T   ++ P  +    + RKKRR  AV +E            A S  L    + +RTS  H
Sbjct  19    TDKNKRKPSTSAAPNDHRKKRRRLAVSSETAIPKSSDPQKLAASSRLKTICSPSRTSRKH  78

Query  1844  MHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVEN  1665
                 +                    + T   R+WVYS RD S   D F+  SYN+L VEN
Sbjct  79    GKRRS--------------------SQTDGHRRWVYSARDCSRFIDKFMVASYNILGVEN  118

Query  1664  AKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGV  1485
             A  HPDLY  V  + +DW +RK+++C  I+ YN GI+C QEVDR+DDLD L Q  G++GV
Sbjct  119   ALNHPDLYHRVPSKFLDWSFRKELICNAIKFYNAGILCLQEVDRFDDLDELFQNYGYKGV  178

Query  1484  YQPRTGDSCDGCAIFWKNELYDL  1416
             Y+ RTG++ DGCA+FW ++L+ L
Sbjct  179   YKARTGEANDGCAVFWIDKLFSL  201



>ref|XP_007036517.1| DNAse I-like superfamily protein, putative isoform 4, partial 
[Theobroma cacao]
 gb|EOY21018.1| DNAse I-like superfamily protein, putative isoform 4, partial 
[Theobroma cacao]
Length=405

 Score =   257 bits (657),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 168/223 (75%), Gaps = 13/223 (6%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSE--DMSSQSFLVGNIHVL  1112
             FTLL +E+IEF+ FGLRNNVAQ CV K  + +  +DS    S+   M S+S LVGNIH L
Sbjct  175   FTLLQEENIEFQDFGLRNNVAQLCVLKINQHQLESDSCRKQSKITPMQSRSLLVGNIHAL  234

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMP-KSAVYQFLTSSKLDIRM  935
             FNP RGDIKLGQ+RL +E A +LSQEWG+IP++L GD NS+P +SA+YQFL SS+L+I++
Sbjct  235   FNPNRGDIKLGQVRLFLEKAYKLSQEWGSIPVILVGDFNSIPQQSAIYQFLASSELNIQL  294

Query  934   HERIHISGQID-PSVKPTYRFKS-----VPAARARKPLMHRWTDEELRLATGTVSV-HLL  776
             H+R  ISGQ++ PS     R ++     +P +R    L HRW+DEEL LATG   V HL 
Sbjct  295   HDRRRISGQLEYPSQGREIRAQNKRHVWMPVSRQ---LSHRWSDEELVLATGDEGVTHLQ  351

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWH  647
             H+LKLCSAYAG+PG+S+TRD  GEPLATS+HSKF+GTVDYIW+
Sbjct  352   HKLKLCSAYAGIPGSSRTRDSHGEPLATSYHSKFMGTVDYIWY  394


 Score =   153 bits (386),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S R+ S+ KD  V VSYN+L  EN  KHPDLY +V P+ ++W  RK ++ +E+  
Sbjct  66    RKWVFSSRNCSNYKDKLVIVSYNILGAENVAKHPDLYLDVPPKFLEWSRRKDLISEEVNR  125

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVDR+ DLD+LLQKDGF+GVY+ RTG+ CDGCA+FWK++++ L
Sbjct  126   YNASILCFQEVDRFKDLDDLLQKDGFKGVYKARTGNGCDGCALFWKDKIFTL  177



>ref|XP_007036461.1| DNAse I-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20962.1| DNAse I-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=479

 Score =   244 bits (623),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 182/267 (68%), Gaps = 18/267 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL +ESIEF+ FGLR+NVAQ  VF+  R E              S+  ++GNIHVL+
Sbjct  204   KFRLLERESIEFKGFGLRDNVAQLSVFEICRVE--------------SRRLVIGNIHVLY  249

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQIR L   AQ LS  WGN+P+VL GD NS P+SA+Y+FL++S+LDI+++ 
Sbjct  250   NPSRGEVKLGQIRFLSTRAQMLSNRWGNVPVVLGGDFNSTPQSAIYKFLSTSELDIKLYN  309

Query  928   RIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    PS V    R    P       L   WTDEE+R+ATG+   HL +H LKL
Sbjct  310   RKELSGQRSCHPSQVLGVNRESRSPFTIMDGFLNDCWTDEEVRVATGSADSHLVVHPLKL  369

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G++ TRD  GEPLATS+HSKFLGTVDY+W++  ++P RVLD LP++ILRRT 
Sbjct  370   SSSYATVKGSTNTRDFNGEPLATSYHSKFLGTVDYLWYSEGILPTRVLDTLPIDILRRTG  429

Query  580   GLPSEEWGSDHLALVCELAFAGEGDET  500
             GLP ++ GSDHLALV E AF+    +T
Sbjct  430   GLPCKKLGSDHLALVTEFAFSKSAKDT  456


 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R WV   + ++  +D F   SYN+L   NA KH DLY  V  + + W YRK++LC+E+ G
Sbjct  97    RHWVEVQQPLAS-QDRFTVASYNILGDRNASKHKDLYITVPSDYLRWGYRKRVLCEELMG  155

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y DL N ++K G+ G Y+ RTG + DGCA FWK + + L
Sbjct  156   WNPDIICMQEVDKYFDLRNTMKKAGYVGSYKRRTGGNVDGCATFWKPDKFRL  207



>ref|XP_010265226.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Nelumbo nucifera]
Length=283

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 177/256 (69%), Gaps = 24/256 (9%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  ESIEF  FGLR+NVAQ  VF+  R +              S+  LVGNIHVLFN
Sbjct  28    FRLLEGESIEFRMFGLRDNVAQLSVFEMCRAD--------------SRRVLVGNIHVLFN  73

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQIRLL++ A  LS++WGNIP+VL GD NS P+SAVY+FL+SS+L++ +++R
Sbjct  74    PSRGDIKLGQIRLLLQRAHALSEKWGNIPVVLVGDFNSTPQSAVYKFLSSSELNVTLYDR  133

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAY  749
              ++SGQI P  +P               L + W+ E++ +ATG+ +  ++ H LKL S+Y
Sbjct  134   RYLSGQI-PMRRPFVLIDGC--------LNYSWSGEQVNIATGSPNRTIVEHPLKLNSSY  184

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPS  569
               V G+++TR   GEPLAT++HS+FLGTVDY+W++  L P RVLD  PV++LR+T GLPS
Sbjct  185   LTVKGSARTRGSHGEPLATTYHSRFLGTVDYLWYSDGLFPTRVLDTPPVDMLRKTGGLPS  244

Query  568   EEWGSDHLALVCELAF  521
             ++ GSDHLALV E AF
Sbjct  245   KKLGSDHLALVSEFAF  260



>emb|CDX92241.1| BnaA05g21660D [Brassica napus]
Length=450

 Score =   236 bits (601),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 179/269 (67%), Gaps = 28/269 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++ +              S+  LVGNIHVL+
Sbjct  201   RFRVLERENIEFSQFGMRDNVAQLSVLELRKSK--------------SRRLLVGNIHVLY  246

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++WG+IPIVL GD NS+P+S +Y FL SS+L+I  H+
Sbjct  247   NPSRGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDYNSLPQSPLYNFLASSELNIMKHD  306

Query  928   RIHISGQ--------IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-L  776
             +  +SGQ        ++   KP+    S+      + L   WT+EE+RLATG  + +  +
Sbjct  307   KRELSGQRNRLPNQVLETGSKPSNTITSIS-----RCLSSSWTNEEIRLATGQENSYWAV  361

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             H LKL S+YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  + P RVLD LP+++
Sbjct  362   HPLKLNSSYASVKGSTNTRDSIGEPLATSYHSKFLGTVDYLWYSDGIAPARVLDTLPIDV  421

Query  595   LRRTRGLPSEEWGSDHLALVCELAFAGEG  509
             L RTRGLP +E GSDHLALV E  F   G
Sbjct  422   LCRTRGLPCQELGSDHLALVSEFFFEPNG  450


 Score =   105 bits (263),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   D F  VSYN+L   N+  H DLY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTSTVSEDSDRFTVVSYNILGDRNSSYHKDLYSNVSFPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                P I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  152   RLRPDIICMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAMFWKADRF  202



>ref|XP_007210064.1| hypothetical protein PRUPE_ppa018606mg [Prunus persica]
 gb|EMJ11263.1| hypothetical protein PRUPE_ppa018606mg [Prunus persica]
Length=446

 Score =   236 bits (601),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 176/259 (68%), Gaps = 18/259 (7%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL + SIEF+ +GLR+NVAQ  VF+ ++ E              S+ F++GNIHVL+N
Sbjct  187   FQLLEEHSIEFKGYGLRDNVAQLSVFEMQKAE--------------SRRFVIGNIHVLYN  232

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RG++KLGQIR L+  AQ LS+ WGN PIVL GD NS P+SA+Y+FL++S+L+I +++R
Sbjct  233   PSRGEVKLGQIRFLISRAQILSERWGNAPIVLCGDFNSTPQSAIYKFLSTSELNIMLYDR  292

Query  925   IHISGQIDPSVKPTYRFK---SVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
               +SGQ D         K   S P       L H WTDEE+R+ATG    +L +H LKL 
Sbjct  293   RELSGQRDCHPAQVLGVKQEISSPLTLIDGLLKHCWTDEEVRVATGDAESNLVVHPLKLN  352

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V GT++TR   GEPLATS+HSKFLGTVDY+W++  LVP  V+D +PV+IL+R   
Sbjct  353   SSYATVRGTTRTRGSNGEPLATSYHSKFLGTVDYLWYSDGLVPTGVIDTVPVDILQRIGS  412

Query  577   LPSEEWGSDHLALVCELAF  521
             LP ++ GSDHLALV E AF
Sbjct  413   LPCKKVGSDHLALVSEFAF  431


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 11/131 (8%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSH-----------CKDGFVFVSYNLLAVENAKKHPDLYPNVL  1629
             P  N + RR+  ++P  V H            +D F   SYN+L   NA  H D+Y NV 
Sbjct  59    PLYNPLKRRQSSHAPDVVRHWIQTDNQQPLSSQDRFTVASYNILGDRNAFAHRDMYRNVP  118

Query  1628  PELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGC  1449
                + WD RK+++C E+  +NP I+C QEVD+Y +L  +L K G+ G Y+ RTGD+ DGC
Sbjct  119   SHYLKWDRRKRVICDELVQWNPDIICLQEVDKYFELSEILAKVGYLGSYKRRTGDTVDGC  178

Query  1448  AIFWKNELYDL  1416
             AIFWK + + L
Sbjct  179   AIFWKADNFQL  189



>gb|AAR24199.1| At1g73875 [Arabidopsis thaliana]
 gb|AAR92339.1| At1g73875 [Arabidopsis thaliana]
Length=220

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 158/215 (73%), Gaps = 9/215 (4%)
 Frame = -3

Query  1189  CSNDSNA-LTSEDMSSQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIV  1013
             C  D  + L       +  +VGNIHVLFNPKRGDIKLGQ+RL +E A +LSQEWGNIP+ 
Sbjct  3     CEEDPKSKLRVRSSDPRRLVVGNIHVLFNPKRGDIKLGQVRLFLEKAYKLSQEWGNIPVA  62

Query  1012  LAGDLNSMPKSAVYQFLTSSKLDIRMHERIHISGQ--IDP---SVKPTYRFKSVPAARAR  848
             +AGDLNS P+SA+Y F+ S+ LD ++H+R  ISGQ  ++P   S +  Y F +  +A   
Sbjct  63    IAGDLNSTPQSAIYDFIASADLDTQLHDRRQISGQTEVEPKERSFRNHYAFSA--SASIS  120

Query  847   KPLMHRWTDEELRLAT-GTVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFL  671
               L++ W+ EEL+LAT G  + H+ HQLKL SAY+GVPGT +TRD  GEPLAT++HS+FL
Sbjct  121   GSLLNEWSQEELQLATGGQETTHVQHQLKLNSAYSGVPGTYRTRDQRGEPLATTYHSRFL  180

Query  670   GTVDYIWHTAElvplrvldplpVNILRRTRGLPSE  566
             GTVDYIWHT ELVP+RVL+ LP ++LRRT GLPSE
Sbjct  181   GTVDYIWHTKELVPVRVLETLPADVLRRTGGLPSE  215



>ref|XP_002511969.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50638.1| conserved hypothetical protein [Ricinus communis]
Length=440

 Score =   234 bits (597),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 181/270 (67%), Gaps = 21/270 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +  LL  ESIEF+  GLR+NVAQ  VF+  + E              S+  LVGNIHVL+
Sbjct  165   KLRLLGGESIEFKALGLRDNVAQLSVFEICKAE--------------SRRLLVGNIHVLY  210

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQIR L+  AQ L+++WG+IP++LAGD NS PKSA+Y+F  SS+L+  +H+
Sbjct  211   NPSRGEVKLGQIRFLLSRAQILAEKWGDIPVILAGDFNSTPKSAIYKFFASSELNFMLHD  270

Query  928   RIHISGQID---PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKL  761
             R  +SGQ +   P V    +    P +     L  RWT+EE++ ATG     LL H LKL
Sbjct  271   RRELSGQRNCHPPQVFGVEKEMRNPLSLIDGYLKSRWTEEEVKTATGNSDCQLLTHPLKL  330

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+Y+ V  +++TRD  GEPLATS+HSKFLGTVDY+W++  +VP+RVLD LP +ILRRT 
Sbjct  331   KSSYSTVKASTRTRDSNGEPLATSYHSKFLGTVDYLWYSDGVVPVRVLDTLPFDILRRTG  390

Query  580   GLPSEEWGSDHLALVCELAF---AGEGDET  500
             GLP ++ GSDHLALV E AF   A EG+ T
Sbjct  391   GLPFKKLGSDHLALVSEFAFTQGAKEGNNT  420


 Score = 81.3 bits (199),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 17/90 (19%)
 Frame = -2

Query  1703  FVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDD  1524
             F  VSYN+LA  NA KH DLY NV P  + W +RK+                 EVDRY D
Sbjct  90    FTVVSYNILADRNASKHKDLYANVDPLYLKWAHRKR-----------------EVDRYFD  132

Query  1523  LDNLLQKDGFRGVYQPRTGDSCDGCAIFWK  1434
             L  +++K G+ G Y+ RTGD+ DGCA+FWK
Sbjct  133   LLKIMEKAGYAGSYKRRTGDNVDGCAMFWK  162



>ref|XP_010265224.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Nelumbo nucifera]
Length=396

 Score =   233 bits (594),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 177/256 (69%), Gaps = 24/256 (9%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  ESIEF  FGLR+NVAQ  VF+  R +              S+  LVGNIHVLFN
Sbjct  141   FRLLEGESIEFRMFGLRDNVAQLSVFEMCRAD--------------SRRVLVGNIHVLFN  186

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQIRLL++ A  LS++WGNIP+VL GD NS P+SAVY+FL+SS+L++ +++R
Sbjct  187   PSRGDIKLGQIRLLLQRAHALSEKWGNIPVVLVGDFNSTPQSAVYKFLSSSELNVTLYDR  246

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAY  749
              ++SGQI P  +P               L + W+ E++ +ATG+ +  ++ H LKL S+Y
Sbjct  247   RYLSGQI-PMRRPFVLIDGC--------LNYSWSGEQVNIATGSPNRTIVEHPLKLNSSY  297

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPS  569
               V G+++TR   GEPLAT++HS+FLGTVDY+W++  L P RVLD  PV++LR+T GLPS
Sbjct  298   LTVKGSARTRGSHGEPLATTYHSRFLGTVDYLWYSDGLFPTRVLDTPPVDMLRKTGGLPS  357

Query  568   EEWGSDHLALVCELAF  521
             ++ GSDHLALV E AF
Sbjct  358   KKLGSDHLALVSEFAF  373


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 78/142 (55%), Gaps = 20/142 (14%)
 Frame = -2

Query  1619  MDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIF  1440
             + W+ RK+++C+E+ G+ P I+C QEVDRY DL ++++K+G+ G Y+ RTG + DGCA+F
Sbjct  76    LKWERRKRLICQELIGWKPDIICLQEVDRYYDLLSIMEKNGYAGSYKRRTGHATDGCALF  135

Query  1439  WKNELYDL----HLIYRIWCF--------IIDHCAIGPR--IISNINL*QKAVLFCI*NK  1302
             W+   + L     + +R++          + + C    R  ++ NI+     VLF     
Sbjct  136   WRATTFRLLEGESIEFRMFGLRDNVAQLSVFEMCRADSRRVLVGNIH-----VLFNPSRG  190

Query  1301  HIGM-QIYPFAQRKHRVRKVWS  1239
              I + QI    QR H + + W 
Sbjct  191   DIKLGQIRLLLQRAHALSEKWG  212



>ref|NP_001141499.1| uncharacterized protein LOC100273611 [Zea mays]
 gb|ACF86496.1| unknown [Zea mays]
Length=443

 Score =   234 bits (597),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 173/254 (68%), Gaps = 27/254 (11%)
 Frame = -3

Query  1279  LLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFNPK  1100
             L+ ++SI+F  F LRNNVAQ CVF                E   +  F++GNIHVLFNPK
Sbjct  195   LVEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKFVLGNIHVLFNPK  238

Query  1099  RGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIH  920
             RGD+KLGQIR+L+ENA  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+R H
Sbjct  239   RGDVKLGQIRMLLENANALAEKWDKIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHDRRH  298

Query  919   ISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAYAG  743
             +SG +D S +  Y   S+        L ++WTDEE+R ATG  +V +  H LKL S+YA 
Sbjct  299   LSG-LD-STEFGYELCSL--------LKYQWTDEEVRNATGYSNVMVAEHPLKLSSSYAM  348

Query  742   VPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEE  563
             + G S  R   GEPLATS+H KFLGTVDY+WHT  +   RVL+ LP+++L+RTRGLP+ E
Sbjct  349   LKGNSNNRGLHGEPLATSYHRKFLGTVDYLWHTHGIECSRVLETLPISVLKRTRGLPTRE  408

Query  562   WGSDHLALVCELAF  521
              GSDHL +V E AF
Sbjct  409   IGSDHLPIVAEFAF  422


 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSP-RDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             P    +  R W+ S     S   D    +SYN+LA  NA+ HPDLY +   + M WD R+
Sbjct  75    PQPALLSSRLWICSEDASTSSSGDACTIMSYNILADYNARNHPDLYLDAPWDAMRWDSRR  134

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             +++ +EIR ++P ++C QEVDR+ D+   ++  G+ G++Q RTGD+ DGCAIFWK++   
Sbjct  135   RLIIREIRHWDPDVVCLQEVDRFQDIAAGMKSRGYEGIFQRRTGDTRDGCAIFWKSK--Q  192

Query  1418  LHLI  1407
             LHL+
Sbjct  193   LHLV  196



>gb|AFW87610.1| hypothetical protein ZEAMMB73_612868 [Zea mays]
Length=443

 Score =   234 bits (597),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 173/254 (68%), Gaps = 27/254 (11%)
 Frame = -3

Query  1279  LLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFNPK  1100
             L+ ++SI+F  F LRNNVAQ CVF                E   +  F++GNIHVLFNPK
Sbjct  195   LVEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKFVLGNIHVLFNPK  238

Query  1099  RGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIH  920
             RGD+KLGQIR+L+ENA  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+R H
Sbjct  239   RGDVKLGQIRMLLENANALAEKWDKIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHDRRH  298

Query  919   ISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAYAG  743
             +SG +D S +  Y   S+        L ++WTDEE+R ATG  +V +  H LKL S+YA 
Sbjct  299   LSG-LD-STEFGYELCSL--------LKYQWTDEEVRNATGYSNVMVAEHPLKLSSSYAM  348

Query  742   VPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEE  563
             + G S  R   GEPLATS+H KFLGTVDY+WHT  +   RVLD LP+++L+RTRGLP+ E
Sbjct  349   LKGNSNNRGLHGEPLATSYHRKFLGTVDYLWHTHGIECSRVLDTLPISVLKRTRGLPTRE  408

Query  562   WGSDHLALVCELAF  521
              GSDHL +V E AF
Sbjct  409   IGSDHLPIVAEFAF  422


 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSP-RDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             P    +  R W+ S     S   D    +SYN+LA  NA+ HPDLY +   + M WD R+
Sbjct  75    PQPALLSSRLWICSEDASTSSSGDACTIMSYNILADYNARNHPDLYLDAPWDAMRWDSRR  134

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             +++ +EIR ++P ++C QEVDR+ D+   ++  G+ G++Q RTGD+ DGCAIFWK++   
Sbjct  135   RLIIREIRHWDPDVVCLQEVDRFQDIAAGMKSRGYEGIFQRRTGDTRDGCAIFWKSK--Q  192

Query  1418  LHLI  1407
             LHL+
Sbjct  193   LHLV  196



>ref|XP_009145888.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 [Brassica 
rapa]
Length=450

 Score =   234 bits (597),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 178/269 (66%), Gaps = 28/269 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++ +              S+  LVGNIHVL+
Sbjct  201   RFRVLERENIEFSQFGMRDNVAQLSVLELRKSK--------------SRRLLVGNIHVLY  246

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++WG+IPIVL GD NS+P+S +Y FL SS+L+I  H+
Sbjct  247   NPSRGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDYNSLPQSPLYNFLASSELNIMKHD  306

Query  928   RIHISGQ--------IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-L  776
             +  +SGQ        ++   KP+    S+      + L   WT+EE+RLATG  + +  +
Sbjct  307   KRELSGQRNRLPNQVLEAGGKPSNTITSI-----NRCLSSSWTNEEIRLATGQENSYWAV  361

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             H LKL S+YA V G++ TRD  GEPLATS+HSKFLGTVDY+W++  + P RVLD LP+++
Sbjct  362   HPLKLNSSYASVKGSTNTRDSTGEPLATSYHSKFLGTVDYLWYSDGIAPARVLDTLPIDV  421

Query  595   LRRTRGLPSEEWGSDHLALVCELAFAGEG  509
             L RTRGLP +E GSDHLALV E  F   G
Sbjct  422   LCRTRGLPCQELGSDHLALVSEFFFEPNG  450


 Score =   105 bits (262),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   D F  VSYN+L   N+  H DLY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTSTVSEDSDRFTVVSYNILGDRNSSYHKDLYSNVSFPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                P I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  152   RLRPDIICMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAMFWKADRF  202



>ref|XP_006655986.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
[Oryza brachyantha]
Length=364

 Score =   231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 169/260 (65%), Gaps = 26/260 (10%)
 Frame = -3

Query  1279  LLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFNPK  1100
             LL ++SI+F  + LRNNVAQ  VF                E   +Q  +VGNIHVLFNPK
Sbjct  93    LLEEDSIDFSEYNLRNNVAQIFVF----------------ELNGAQKLVVGNIHVLFNPK  136

Query  1099  RGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIH  920
             RGD+KLGQIR+L+E A  L+++WG IPIVLAGD NS P SA+Y+FL++ KLDI +H+R  
Sbjct  137   RGDVKLGQIRMLLEKANVLAEKWGGIPIVLAGDFNSTPDSAIYKFLSTMKLDISLHDRRQ  196

Query  919   ISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAYAG  743
             +SG +D S    Y   S+        L ++WT EE+R ATG  +V +  H L LCS+YA 
Sbjct  197   LSG-LDSSEFALYDLCSL--------LKYQWTCEEVRNATGRSNVMVAKHPLNLCSSYAM  247

Query  742   VPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEE  563
             + G S  R   GEPLATS+H KFLGTVDY+W+TA L   RVLD LPV  LRRTRGLP+ E
Sbjct  248   LKGNSNNRGHHGEPLATSYHKKFLGTVDYLWYTAGLECSRVLDTLPVGFLRRTRGLPTRE  307

Query  562   WGSDHLALVCELAFAGEGDE  503
              GSDHL +V E  F    D+
Sbjct  308   IGSDHLPIVAEFVFTESVDD  327


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = -2

Query  1694  VSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDN  1515
             +SYN+LA  NA+ HPDLY +V  + + WD R++++  EIR ++P ++C QEVDR+ D+  
Sbjct  1     MSYNILADNNARNHPDLYLDVPWDALRWDSRRRLIIHEIRHWDPDLVCLQEVDRFWDIST  60

Query  1514  LLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
              ++  G+   ++ RTGD+ DGCA FWK++
Sbjct  61    EMKNRGYESSFKGRTGDAKDGCATFWKSK  89



>ref|XP_010909785.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X3 [Elaeis guineensis]
Length=408

 Score =   232 bits (591),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 171/257 (67%), Gaps = 24/257 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL ++ IEF  FGLR+NVAQ  VF+++              +   +  +VGNIHVLF
Sbjct  153   RFRLLEEDYIEFSAFGLRDNVAQLFVFEKR--------------EADPRRLVVGNIHVLF  198

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+RLL+     LS++W NIP+VLAGD NS P+SA+Y+FL++S+LDI  H+
Sbjct  199   NPKRGDIKLGQVRLLLSKVNALSEKWDNIPVVLAGDFNSTPESAIYEFLSTSELDIAAHD  258

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             R +I GQ     +  +    +P+      L   WTDEEL+ ATG +    L H LKL SA
Sbjct  259   RRYIFGQ----DRCEFALYDLPSF-----LKFHWTDEELKNATGQSKCTKLEHPLKLHSA  309

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G ++TR   GEPLAT++HSKFLGTVDYIW++  L   RVLD + ++ILR+  GLP
Sbjct  310   YASVKGNARTRGRHGEPLATTYHSKFLGTVDYIWYSTGLACTRVLDTISIDILRKLGGLP  369

Query  571   SEEWGSDHLALVCELAF  521
             S+E GSDH+AL+ E  F
Sbjct  370   SKEMGSDHIALLSEFIF  386


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -2

Query  1709  DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRY  1530
             D FV VSYN+LA +NA  H DLY  +  ++M WD RK ++ +EI  +N  I+C QEVDRY
Sbjct  59    DRFVLVSYNILADKNASHHRDLYWKIPFDVMKWDSRKGLIFQEICRWNADIVCLQEVDRY  118

Query  1529  DDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +D+   ++K G+ G Y+ RTG + DGCAIFWK + + L
Sbjct  119   EDILMNMKKKGYAGSYKGRTGLAKDGCAIFWKVKRFRL  156



>ref|XP_006440934.1| hypothetical protein CICLE_v10020050mg [Citrus clementina]
 gb|ESR54174.1| hypothetical protein CICLE_v10020050mg [Citrus clementina]
Length=464

 Score =   233 bits (594),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 178/261 (68%), Gaps = 18/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL + SIEF+ FGLR NVAQ   F+ +              +  S+  LVGNIHVL+
Sbjct  198   KFRLLEQTSIEFKEFGLRENVAQLSAFEMR--------------NTKSRRVLVGNIHVLY  243

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQI  L   AQ ++++WGNIP+VLAGD N  P+SA+Y+FL+SS+L+I+ ++
Sbjct  244   NPNRGEVKLGQICFLSSRAQIVAEKWGNIPVVLAGDFNITPQSAIYKFLSSSELNIKSYD  303

Query  928   RIHISGQIDPSVKPTYRFKSV---PAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    +   ++ K     P A   + L + WTDEE+++ATG    +L +H LKL
Sbjct  304   RRDLSGQRSCHLVQVFKVKKEIINPFAVMDRLLPNGWTDEEVKVATGNAQCYLAVHPLKL  363

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+ +TR   GEPLATS+HSKF GTVDY+W+T  LVP RVLD LPV+ILRRT 
Sbjct  364   NSSYASVKGSPRTRGINGEPLATSYHSKFFGTVDYLWYTKGLVPTRVLDTLPVDILRRTG  423

Query  580   GLPSEEWGSDHLALVCELAFA  518
             GLP ++ GSDHLALV E AFA
Sbjct  424   GLPCKKLGSDHLALVSEFAFA  444


 Score =   114 bits (286),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ +  +    ++ F  VSYN+L  +NA KH DLY NV  E M W+ RK+++C+E+ G
Sbjct  90    RHWIDADPNPISSQERFSVVSYNILGDKNAFKHRDLYQNVRYEYMKWNRRKRLICQELIG  149

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              NP I+C QEVDRY D+ N+++K G+ G Y+ RTGD+ DGCA+FWK + + L
Sbjct  150   LNPDIICMQEVDRYFDILNVMEKAGYAGCYKRRTGDNVDGCAMFWKADKFRL  201



>ref|XP_008244021.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 [Prunus 
mume]
Length=446

 Score =   232 bits (591),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 175/259 (68%), Gaps = 18/259 (7%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL + SIEF+ +GLR+NVAQ  VF+ ++ E              S+ F++GNIHVL+N
Sbjct  187   FQLLEEHSIEFKGYGLRDNVAQLSVFEMQKAE--------------SRRFVIGNIHVLYN  232

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RG++KLGQIR L+  AQ LS++WGN PIVL GD N  P+SA+Y+FL++S+L+I  ++R
Sbjct  233   PSRGEVKLGQIRFLISRAQILSEKWGNAPIVLCGDFNCTPQSAIYKFLSTSELNIMSYDR  292

Query  925   IHISGQIDPSVKPTYRFK---SVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
               +SGQ D         K   S P       L H WTDEE+R+ATG    +L +H LKL 
Sbjct  293   RELSGQRDCHPAQVLGVKQEISSPLTLIDGLLKHCWTDEEVRVATGDAESNLVVHPLKLN  352

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V G+++TR   GEPLATS+HSKFLGTVDY+W++  LVP  V+D +PV+IL+R   
Sbjct  353   SSYATVRGSTRTRGSNGEPLATSYHSKFLGTVDYLWYSDGLVPTGVIDTVPVDILQRIGS  412

Query  577   LPSEEWGSDHLALVCELAF  521
             LP ++ GSDHLALV E AF
Sbjct  413   LPCKKVGSDHLALVSEFAF  431


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSH-----------CKDGFVFVSYNLLAVENAKKHPDLYPNVL  1629
             P    ++RR+  ++P  V H            +D F   SYN+L   NA  H D+Y NV 
Sbjct  59    PLYKPLERRQSSHAPDVVRHWIQTDNQQPLSSQDRFTVASYNILGDRNAFAHRDMYRNVP  118

Query  1628  PELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGC  1449
                + WD+RK+++C E+  +NP I+C QEVD+Y +L  +L K G+ G Y+ RTGD+ DGC
Sbjct  119   SRYLKWDHRKRVICDELVQWNPDIICLQEVDKYFELSEILAKMGYLGSYKRRTGDTVDGC  178

Query  1448  AIFWKNELYDL  1416
             AIFWK + + L
Sbjct  179   AIFWKADNFQL  189



>ref|XP_008801141.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Phoenix dactylifera]
Length=429

 Score =   231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 171/257 (67%), Gaps = 24/257 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  + IEF  FGLR+NVAQ  VF+++              +   +  +VGNIHVLF
Sbjct  174   RFRLLEGDYIEFSAFGLRDNVAQLFVFEKR--------------EAVPRRLVVGNIHVLF  219

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+RLL+  A  LS++WGNIP+VLAGD NS P+SA+Y+FL++S+L+I  H+
Sbjct  220   NPKRGDIKLGQVRLLLSKANTLSEKWGNIPVVLAGDFNSTPESAIYEFLSTSELNIATHD  279

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             R HISGQ D      Y   S+        +  +WTD+EL+ ATG +    L H L L SA
Sbjct  280   RRHISGQ-DRCELALYDLPSL--------MTFQWTDKELKNATGQSKCTKLEHPLMLHSA  330

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G ++TR   GEPLAT++HSKF GTVDYIW++  L   RVLD LP++ILR+  GLP
Sbjct  331   YASVKGNARTRGPHGEPLATTYHSKFFGTVDYIWYSTGLACTRVLDTLPIDILRKLGGLP  390

Query  571   SEEWGSDHLALVCELAF  521
             S+E GSDH+ LV E  F
Sbjct  391   SKEIGSDHVGLVSEFIF  407


 Score = 99.8 bits (247),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSHC---KDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+W+ +  D+S      D FV VSYN+LA +NA  H DLY  +  ++M WD RK ++ +E
Sbjct  64    RRWIKA-EDLSLSDSRNDRFVLVSYNILADKNASYHRDLYWKIPFDVMKWDSRKGLILQE  122

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             I  +N  I+C QEVDRY+D+   + K G+ G Y+ RTG++ DGCAIFWK + + L
Sbjct  123   ICRWNADIVCLQEVDRYEDILINMNKKGYAGSYKGRTGEAKDGCAIFWKVKRFRL  177



>ref|XP_004965191.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X4 [Setaria italica]
Length=360

 Score =   229 bits (583),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 166/258 (64%), Gaps = 26/258 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ CVF                E   +   ++GNIHVLF
Sbjct  90    RLRLLEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKLVLGNIHVLF  133

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQIRLL+E A  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+
Sbjct  134   NPKRGDVKLGQIRLLLEKANALAEKWDEIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHD  193

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y   S         L ++W+DEE+R ATG  +V +  H LKL S+
Sbjct  194   RRKLSG-LDSSEFDLYELCS--------SLKYQWSDEEVRNATGYSNVMVAEHPLKLSSS  244

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G S  R    EPLATSFH KFLGTVDY+W+T  L   RVLD  P+ +LRRTRGLP
Sbjct  245   YANLKGNSSNRGLHAEPLATSFHKKFLGTVDYLWYTHGLECSRVLDTFPIGVLRRTRGLP  304

Query  571   SEEWGSDHLALVCELAFA  518
             + E GSDHL ++ E AF 
Sbjct  305   TREIGSDHLPIIAEFAFT  322


 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -2

Query  1694  VSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDN  1515
             +SYN+LA  +A+ HPDLY +V  + M WD R++++  EIR ++P ++C QEVDR+ D+  
Sbjct  1     MSYNILADYHARNHPDLYRDVPWDAMRWDSRRRLIIHEIRHWDPDLVCLQEVDRFQDIAA  60

Query  1514  LLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
              ++  G+ G+YQ RTGD+ DGCA+FWK++
Sbjct  61    GMKSRGYEGIYQRRTGDTRDGCAMFWKSK  89



>ref|XP_010909783.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X1 [Elaeis guineensis]
Length=432

 Score =   231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 171/257 (67%), Gaps = 24/257 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL ++ IEF  FGLR+NVAQ  VF+++              +   +  +VGNIHVLF
Sbjct  177   RFRLLEEDYIEFSAFGLRDNVAQLFVFEKR--------------EADPRRLVVGNIHVLF  222

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+RLL+     LS++W NIP+VLAGD NS P+SA+Y+FL++S+LDI  H+
Sbjct  223   NPKRGDIKLGQVRLLLSKVNALSEKWDNIPVVLAGDFNSTPESAIYEFLSTSELDIAAHD  282

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             R +I GQ     +  +    +P+      L   WTDEEL+ ATG +    L H LKL SA
Sbjct  283   RRYIFGQD----RCEFALYDLPSF-----LKFHWTDEELKNATGQSKCTKLEHPLKLHSA  333

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G ++TR   GEPLAT++HSKFLGTVDYIW++  L   RVLD + ++ILR+  GLP
Sbjct  334   YASVKGNARTRGRHGEPLATTYHSKFLGTVDYIWYSTGLACTRVLDTISIDILRKLGGLP  393

Query  571   SEEWGSDHLALVCELAF  521
             S+E GSDH+AL+ E  F
Sbjct  394   SKEMGSDHIALLSEFIF  410


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -2

Query  1709  DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRY  1530
             D FV VSYN+LA +NA  H DLY  +  ++M WD RK ++ +EI  +N  I+C QEVDRY
Sbjct  83    DRFVLVSYNILADKNASHHRDLYWKIPFDVMKWDSRKGLIFQEICRWNADIVCLQEVDRY  142

Query  1529  DDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +D+   ++K G+ G Y+ RTG + DGCAIFWK + + L
Sbjct  143   EDILMNMKKKGYAGSYKGRTGLAKDGCAIFWKVKRFRL  180



>ref|XP_006406597.1| hypothetical protein EUTSA_v10020715mg [Eutrema salsugineum]
 gb|ESQ48050.1| hypothetical protein EUTSA_v10020715mg [Eutrema salsugineum]
Length=452

 Score =   231 bits (590),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 177/264 (67%), Gaps = 18/264 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF RFG+R+NVAQ  V + ++ +              S+  LVGNIHVL+
Sbjct  203   RFRVLERENIEFSRFGMRDNVAQLSVLELRKSK--------------SRKLLVGNIHVLY  248

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL S++L+I  H+
Sbjct  249   NPSRGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNSTPQSPLYNFLASAELNIMKHD  308

Query  928   RIHISGQID---PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             +  +SGQ +     V  T R  S       + L   WT+EE+R+ATG  + +  +H LKL
Sbjct  309   KRELSGQRNCHSNQVLETGRKSSSTITSISRCLSSSWTNEEIRVATGQENSYWAVHPLKL  368

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  LVP RVLD +P ++L +TR
Sbjct  369   RSSYASVKGSTNTRDSVGEPLATSYHSKFLGTVDYLWYSDGLVPARVLDTIPTDVLCKTR  428

Query  580   GLPSEEWGSDHLALVCELAFAGEG  509
             GLP +E GSDHLALV E  F  +G
Sbjct  429   GLPCQELGSDHLALVSEFFFELDG  452


 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 75/118 (64%), Gaps = 1/118 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRD-VSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQ  1596
             P++    R+W+ S    VS   + F  VSYN+L   N+  H DLY NV    + W YRK+
Sbjct  87    PSSRTIVREWIDSDTSPVSEDSERFTVVSYNILGDRNSSYHRDLYSNVSFPHLKWGYRKR  146

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
             ++C+E+    P I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  147   LICEEMIRLKPDIICMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAMFWKADRF  204



>ref|XP_010663575.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 [Vitis 
vinifera]
 emb|CBI15424.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 180/268 (67%), Gaps = 22/268 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  E IEF+++GLR+NVAQ  +F+     C ++S  L          LVGNIHVL+
Sbjct  181   KFRLLEGECIEFKQYGLRDNVAQLSLFEM----CEDESRKL----------LVGNIHVLY  226

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++WGN+P+VLAGD NS P+SA+YQFL+SS+L+I +++
Sbjct  227   NPSRGDVKLGQIRFLSSRAHILSEKWGNVPVVLAGDFNSTPQSAMYQFLSSSELNIMLYD  286

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHR-----WTDEELRLATGTVSVH-LLHQL  767
             R  +SGQ +    P   F       +   LM R     WTDEE+++ATG    H ++H L
Sbjct  287   RRELSGQRN--CHPAQVFDVEREISSSFILMDRFLKGCWTDEEVKVATGNADCHVVVHPL  344

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KL S+YA V  +++TR   GEPLATS+HSKFLGTVDY+W++  +VP RVLD LPV+ILR 
Sbjct  345   KLKSSYATVKSSTRTRGFNGEPLATSYHSKFLGTVDYLWYSDGVVPTRVLDTLPVDILRG  404

Query  586   TRGLPSEEWGSDHLALVCELAFAGEGDE  503
               GLP  E GSDHLAL+ E AFA   +E
Sbjct  405   LGGLPCREVGSDHLALISEFAFAQGTEE  432


 Score =   114 bits (286),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = -2

Query  1712  KDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDR  1533
             ++ F  VSYN+L   NA KH DLY NV    M WD+R++++C EI G NP I+C QEVD+
Sbjct  86    QETFTVVSYNILGDRNAFKHRDLYSNVPFSYMKWDHRRRVICNEIIGRNPDIVCLQEVDK  145

Query  1532  YDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             Y DL ++++K+G+ G Y+ RTGD+ DGCA+FWK E + L
Sbjct  146   YFDLVSIMEKEGYAGSYKRRTGDTVDGCAMFWKAEKFRL  184



>ref|XP_006485766.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X2 [Citrus sinensis]
Length=464

 Score =   231 bits (589),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 177/261 (68%), Gaps = 18/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL + SIEF+ FGLR NVAQ   F+ +              +  S+  LVGNIHVL+
Sbjct  198   KFRLLEQTSIEFKEFGLRENVAQLSAFEMR--------------NTKSRRVLVGNIHVLY  243

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQI  L   A+ ++++WGNIP+VLAGD N  P+SA+Y+FL+SS+L+I+ ++
Sbjct  244   NPNRGEVKLGQICFLSSRARIVAEKWGNIPVVLAGDFNITPQSAIYKFLSSSELNIKSYD  303

Query  928   RIHISGQIDPSVKPTYRFKSV---PAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    +   +  K     P A   + L + WTDEE+++ATG    +L +H LKL
Sbjct  304   RRDLSGQRSCHLAQVFEVKKEIINPFAAMDRLLPNGWTDEEVKVATGNAQCYLAVHPLKL  363

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+ +TR   GEPLATS+HSKF GTVDY+W+T  LVP RVLD LPV+ILRRT 
Sbjct  364   NSSYASVKGSPRTRGINGEPLATSYHSKFFGTVDYLWYTKGLVPTRVLDTLPVDILRRTG  423

Query  580   GLPSEEWGSDHLALVCELAFA  518
             GLP ++ GSDHLALV E AFA
Sbjct  424   GLPCKKLGSDHLALVSEFAFA  444


 Score =   110 bits (274),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ +  +     + F  VSYN+L  +NA KH DLY NV  E M W+ RK+++C+E+ G
Sbjct  90    RHWIDADPNPISSDERFSVVSYNILGDKNAFKHRDLYQNVRYEYMKWNRRKRLICQELIG  149

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              NP I+C QEVDRY D+ N+++K G+ G Y+ RTG + DGCA+FWK + + L
Sbjct  150   LNPDIICMQEVDRYFDILNVMEKVGYAGCYKRRTGYNVDGCAMFWKADKFRL  201



>emb|CAN69164.1| hypothetical protein VITISV_015324 [Vitis vinifera]
Length=228

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 157/202 (78%), Gaps = 19/202 (9%)
 Frame = -3

Query  1147  SQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQ  968
             ++S +VGNIHVLFNP RGD KLGQ+RL +E A +LSQEWG IP+VLAGDLNSMP+     
Sbjct  9     TRSLIVGNIHVLFNPNRGDXKLGQMRLFLEKAHKLSQEWGCIPVVLAGDLNSMPQ-----  63

Query  967   FLTSSKLDIRMHERIHISGQID-PSVKPTYRFKSVPAA-----RARKPLMHRWTDEELRL  806
                   LD+R+H+R  ISGQ++  S    YR+++  A+     R+R PL+HRW++EELRL
Sbjct  64    ------LDVRLHDRRKISGQVEHQSQHRAYRYQNEDASSFCMSRSR-PLVHRWSNEELRL  116

Query  805   ATGTVSV-HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvp  629
             ATG+  V HL H LKLCSAY G+PG+ +TRD+ GEPLATS+HSKF+GTVDYIWHT ELVP
Sbjct  117   ATGSDGVTHLQHCLKLCSAYYGIPGSCRTRDNYGEPLATSYHSKFMGTVDYIWHTEELVP  176

Query  628   lrvldplpVNILRRTRGLPSEE  563
             +RVL+ LPV+ILR+T GLPSE+
Sbjct  177   VRVLETLPVDILRKTGGLPSEK  198



>emb|CDY24484.1| BnaC05g34700D [Brassica napus]
Length=450

 Score =   230 bits (586),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 176/269 (65%), Gaps = 28/269 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++                S+  LVGNIHVL+
Sbjct  201   RFRVLERENIEFSQFGMRDNVAQLSVLELRKS--------------MSRKILVGNIHVLY  246

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++WG+IPIVL GD NS+P+S +Y FL SS+L+I   +
Sbjct  247   NPSRGDVKLGQIRSLCTKAHLLSKKWGDIPIVLGGDYNSLPQSPLYNFLASSELNIMKQD  306

Query  928   RIHISGQ--------IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-L  776
             +  +SGQ        ++   KP     S P     + L   W++EE+RLATG  S +  +
Sbjct  307   KRELSGQRNRLPNQVLEAGGKP-----SNPITSINRCLSSSWSNEEIRLATGQESSYWAV  361

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             H LKL S+YA V G+  TRD +GEPLATS+HSKFLGTVDY+W++  + P+RVLD LP+++
Sbjct  362   HPLKLHSSYASVKGSKNTRDSVGEPLATSYHSKFLGTVDYLWYSDGVAPVRVLDTLPIDV  421

Query  595   LRRTRGLPSEEWGSDHLALVCELAFAGEG  509
             L RTRGLP +E GSDHLALV E  F   G
Sbjct  422   LCRTRGLPCQELGSDHLALVSEFFFEPNG  450


 Score =   106 bits (264),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   D F  VSYN+L   N+  H DLY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTSTVSEDSDRFTVVSYNILGDRNSSYHKDLYSNVSFPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                P I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCAIFWK + +
Sbjct  152   RLRPDIICMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAIFWKADRF  202



>ref|XP_009789801.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X2 [Nicotiana sylvestris]
Length=437

 Score =   228 bits (581),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 171/260 (66%), Gaps = 18/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESIE+ ++GLR+NVAQ  VFK                +  S   +VGNIHVL+
Sbjct  178   KFQLLEGESIEYRQYGLRDNVAQLSVFKM--------------HEAQSGRLVVGNIHVLY  223

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W   PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  224   NPSRGDVKLGQIRFLSSRAHILSEKWDTAPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  283

Query  928   RIHISG--QIDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SG  Q  PS V    R K +      + L   W++EE+ +ATG    H+ LH LKL
Sbjct  284   RRELSGQRQCHPSQVLGLGREKGILFVLMDRFLNSSWSEEEMNVATGAPKSHIALHPLKL  343

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+  TRDD GEPLATS+HSKFLGTVDY+W++  LV  +VLD LP+NIL++T 
Sbjct  344   NSSYAMVKGSQTTRDDNGEPLATSYHSKFLGTVDYLWYSDGLVATKVLDTLPINILKKTG  403

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP +  GSDHLALV E AF
Sbjct  404   GLPFKRMGSDHLALVSEFAF  423


 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 78/128 (61%), Gaps = 11/128 (9%)
 Frame = -2

Query  1766  NTVDRRKWVYSPRDVSHCKDG-----------FVFVSYNLLAVENAKKHPDLYPNVLPEL  1620
             N   RR+   +P  V H  +G           F  VSYN+L   N  KH DLY NV    
Sbjct  54    NPEHRRQLSSAPDIVRHWVEGDALSTVPPQERFTVVSYNILGDRNMSKHGDLYRNVPSNY  113

Query  1619  MDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIF  1440
             +DW++RK+++C+E+ G NP I+C QEVD+Y DL N+L+K G+ G ++ RTG S DGCA+F
Sbjct  114   LDWNHRKRVICEELLGLNPDIICLQEVDKYYDLLNVLEKAGYLGSHKRRTGGSVDGCAMF  173

Query  1439  WKNELYDL  1416
             WK + + L
Sbjct  174   WKADKFQL  181



>ref|XP_009789802.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X3 [Nicotiana sylvestris]
Length=433

 Score =   228 bits (581),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 171/260 (66%), Gaps = 23/260 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESIE+ ++GLR+NVAQ  VFK                +  S   +VGNIHVL+
Sbjct  179   KFQLLEGESIEYRQYGLRDNVAQLSVFKM--------------HEAQSGRLVVGNIHVLY  224

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W   PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  225   NPSRGDVKLGQIRFLSSRAHILSEKWDTAPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  284

Query  928   RIHISG--QIDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SG  Q  PS V    R K +        LM  W++EE+ +ATG    H+ LH LKL
Sbjct  285   RRELSGQRQCHPSQVLGLGREKGILFV-----LMDSWSEEEMNVATGAPKSHIALHPLKL  339

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+  TRDD GEPLATS+HSKFLGTVDY+W++  LV  +VLD LP+NIL++T 
Sbjct  340   NSSYAMVKGSQTTRDDNGEPLATSYHSKFLGTVDYLWYSDGLVATKVLDTLPINILKKTG  399

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP +  GSDHLALV E AF
Sbjct  400   GLPFKRMGSDHLALVSEFAF  419


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -2

Query  1766  NTVDRRKWVYSPRDVSHCKDG------------FVFVSYNLLAVENAKKHPDLYPNVLPE  1623
             N   RR+   +P  V H  +G            F  VSYN+L   N  KH DLY NV   
Sbjct  54    NPEHRRQLSSAPDIVRHWVEGDALSTVPPQAERFTVVSYNILGDRNMSKHGDLYRNVPSN  113

Query  1622  LMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAI  1443
              +DW++RK+++C+E+ G NP I+C QEVD+Y DL N+L+K G+ G ++ RTG S DGCA+
Sbjct  114   YLDWNHRKRVICEELLGLNPDIICLQEVDKYYDLLNVLEKAGYLGSHKRRTGGSVDGCAM  173

Query  1442  FWKNELYDL  1416
             FWK + + L
Sbjct  174   FWKADKFQL  182



>ref|XP_009789800.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X1 [Nicotiana sylvestris]
Length=438

 Score =   228 bits (581),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 171/260 (66%), Gaps = 18/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESIE+ ++GLR+NVAQ  VFK                +  S   +VGNIHVL+
Sbjct  179   KFQLLEGESIEYRQYGLRDNVAQLSVFKM--------------HEAQSGRLVVGNIHVLY  224

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W   PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  225   NPSRGDVKLGQIRFLSSRAHILSEKWDTAPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  284

Query  928   RIHISG--QIDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SG  Q  PS V    R K +      + L   W++EE+ +ATG    H+ LH LKL
Sbjct  285   RRELSGQRQCHPSQVLGLGREKGILFVLMDRFLNSSWSEEEMNVATGAPKSHIALHPLKL  344

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+  TRDD GEPLATS+HSKFLGTVDY+W++  LV  +VLD LP+NIL++T 
Sbjct  345   NSSYAMVKGSQTTRDDNGEPLATSYHSKFLGTVDYLWYSDGLVATKVLDTLPINILKKTG  404

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP +  GSDHLALV E AF
Sbjct  405   GLPFKRMGSDHLALVSEFAF  424


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -2

Query  1766  NTVDRRKWVYSPRDVSHCKDG------------FVFVSYNLLAVENAKKHPDLYPNVLPE  1623
             N   RR+   +P  V H  +G            F  VSYN+L   N  KH DLY NV   
Sbjct  54    NPEHRRQLSSAPDIVRHWVEGDALSTVPPQAERFTVVSYNILGDRNMSKHGDLYRNVPSN  113

Query  1622  LMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAI  1443
              +DW++RK+++C+E+ G NP I+C QEVD+Y DL N+L+K G+ G ++ RTG S DGCA+
Sbjct  114   YLDWNHRKRVICEELLGLNPDIICLQEVDKYYDLLNVLEKAGYLGSHKRRTGGSVDGCAM  173

Query  1442  FWKNELYDL  1416
             FWK + + L
Sbjct  174   FWKADKFQL  182



>ref|XP_004235743.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Solanum lycopersicum]
Length=443

 Score =   228 bits (581),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 174/260 (67%), Gaps = 18/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ES+EF + GLR+NVAQ  VF+ +              +  S+  +VGNIHVL+
Sbjct  180   KFQLLEGESVEFRQHGLRDNVAQLSVFEMR--------------EAKSRRLVVGNIHVLY  225

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W ++PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  226   NPNRGDVKLGQIRFLASRAHILSEKWDHVPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  285

Query  928   RIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    PS V    R K +      +    RW+DEE+ +A G +  H+ +H LKL
Sbjct  286   RKELSGQRLCHPSQVLGLRREKGILFVLMDRFFNSRWSDEEINVAIGALKSHIAMHPLKL  345

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G   TRD+ GEPLATSFHSKFLGTVDY+W++  L P +VLD LP+N+L++T 
Sbjct  346   NSSYAMVKGPLTTRDNSGEPLATSFHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKTG  405

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP ++ GSDHLALV E AF
Sbjct  406   GLPYKKLGSDHLALVSEFAF  425


 Score =   118 bits (295),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = -2

Query  1718  HCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEV  1539
             H ++ F   SYN+L   N   H DLY NV P  +DWD+R++++C+E+ G NP I+C QEV
Sbjct  83    HHEERFTVASYNILGDRNVSNHGDLYRNVPPAYLDWDHRRRVICEELLGLNPDIICLQEV  142

Query  1538  DRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             D+Y+DL N+L+K G+ G Y+ RTG S DGCA+FWK + + L
Sbjct  143   DKYNDLLNILEKAGYLGSYKRRTGGSVDGCAMFWKADKFQL  183



>ref|XP_010663594.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   226 bits (577),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 147/190 (77%), Gaps = 8/190 (4%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             FTLLH+E+IEF+ FGLR+NVAQ CV K  R + ++D +   S+   ++S +VGNIHVLFN
Sbjct  201   FTLLHQENIEFQNFGLRHNVAQLCVLKMNRNQSNSDVDTKASQIPPTRSLIVGNIHVLFN  260

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGDIKLGQ+RL +E A +LSQEWG IP+VLAGDLNSMP+SA+YQFL SS+LD+R+H+R
Sbjct  261   PNRGDIKLGQMRLFLEKAHKLSQEWGCIPVVLAGDLNSMPQSALYQFLASSELDVRLHDR  320

Query  925   IHISGQID-PSVKPTYRFKSVPA-----ARARKPLMHRWTDEELRLATGTVSV-HLLHQL  767
               ISGQ++  S    YR+++  A     +R+R PL+HRW++EELRLATG+  V HL H L
Sbjct  321   RKISGQVEHQSQHRAYRYQNEDASSFCMSRSR-PLVHRWSNEELRLATGSDGVTHLQHCL  379

Query  766   KLCSAYAGVP  737
             KLCSAY G+P
Sbjct  380   KLCSAYYGIP  389


 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A T   R+WV+S RD+S  KD  V VSYN+L VENA  HPDLY  V  +L+DW+ R++++
Sbjct  86    ATTEAHRRWVFSTRDLSDYKDKVVVVSYNILGVENASNHPDLYSKVPTKLLDWNRRRKLI  145

Query  1589  CKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              KEI  YNP I+CFQEVDR++DL+NLL+K GF+GVY+ RTG++ DGCA+FWK++L+ L
Sbjct  146   NKEINQYNPSILCFQEVDRFNDLNNLLKKGGFKGVYKARTGEAYDGCAMFWKDDLFTL  203



>ref|XP_009346877.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 [Pyrus 
x bretschneideri]
Length=456

 Score =   228 bits (580),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 179/265 (68%), Gaps = 18/265 (7%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL +ESIEF+ +GL +NVAQ  VF+ ++ E              S++ ++GNIHVL+N
Sbjct  189   FRLLEEESIEFKGYGLGDNVAQLSVFETQKAE--------------SRNVVIGNIHVLYN  234

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RG+ KLGQIR L+  A+ LS+ WGN P+VL GD N  PKSA+Y+FL+ S+L+I +++R
Sbjct  235   PTRGEAKLGQIRFLISRAKILSERWGNAPVVLCGDFNITPKSAIYKFLSKSELNIMLYDR  294

Query  925   IHISGQID---PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
               +SGQ D     V    +  S P       L H WTDEE+R+ATG  + HL LH +KL 
Sbjct  295   RELSGQRDCHPAQVLGAKQEISSPLTMIDGLLKHCWTDEEIRVATGDANSHLVLHPMKLN  354

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V G+++TRD  GEP+AT++HSKFLGTVDY+W++  LVP RV+D +PV++L++   
Sbjct  355   SSYATVQGSTRTRDPNGEPVATTYHSKFLGTVDYLWYSDGLVPTRVIDTVPVDVLQKIGS  414

Query  577   LPSEEWGSDHLALVCELAFAGEGDE  503
             LP ++ GSDHLALV E AF    +E
Sbjct  415   LPCKKVGSDHLALVTEFAFKPGTNE  439


 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+W+ +       +D F   SYN+L   NA  H D+Y NV  + + WD+R++++C E+  
Sbjct  80    RRWIQAENQPLASRDRFSVASYNILGDRNAFWHRDMYRNVPSKYLKWDHRRRVICDELAE  139

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +N  IMC QEVD+Y +L  +L K G+ G Y+ RTG S DGCAIFWK + + L
Sbjct  140   WNADIMCLQEVDKYFELSEILAKVGYVGSYKRRTGGSVDGCAIFWKPDNFRL  191



>dbj|BAB01117.1| unnamed protein product [Arabidopsis thaliana]
Length=445

 Score =   227 bits (578),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/261 (48%), Positives = 175/261 (67%), Gaps = 17/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  201   RFGVLERENIEFSQFGMRDNVAQLAVLELRKSN-------------KSRKILLGNIHVLY  247

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQ+R L   A  LS++WG+IPIVL GD NS PKS +Y FL SS+L++  H+
Sbjct  248   NPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKSPLYNFLASSELNVMEHD  307

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLCSA  752
             +  +SGQ +   +PT +     +  +       WT EE+R+ATG  + +   H LKL S+
Sbjct  308   KKELSGQKN--CRPT-KVLETGSKSSNTITFSSWTKEEIRVATGQENSYWAAHPLKLNSS  364

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  L+P RVLD LP+++L +T+GLP
Sbjct  365   YASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDGLLPARVLDTLPIDVLCKTKGLP  424

Query  571   SEEWGSDHLALVCELAFAGEG  509
              +E GSDHLALV E  F  +G
Sbjct  425   CQELGSDHLALVSEFVFEPDG  445


 Score =   100 bits (248),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   + F  VSYN+L   N+  H +LY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTTPVSQALERFTVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               NP I+  QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + + +
Sbjct  152   RLNPDIISMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAMFWKADRFGV  204



>ref|XP_006341629.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X2 [Solanum tuberosum]
Length=443

 Score =   227 bits (578),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 174/260 (67%), Gaps = 18/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ES+EF + GLR+NVAQ  VF+ +              +  S+  +VGNIHVL+
Sbjct  180   KFQLLEGESVEFRQHGLRDNVAQLSVFEMR--------------EAKSRRLVVGNIHVLY  225

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W ++PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  226   NPNRGDVKLGQIRFLSSRAHILSEKWDHVPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  285

Query  928   RIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    PS V    R K +      +    RW+DEE+ +A GT   H+ +H LKL
Sbjct  286   RKELSGQRRCHPSQVLGLRREKGILFVLMDRFFNSRWSDEEINVAIGTPKSHIAMHPLKL  345

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G   TRD+ GEPLATS+HSKFLGTVDY+W++  L P +VLD LP+N+L++T 
Sbjct  346   NSSYAMVKGPLTTRDNSGEPLATSYHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKTG  405

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP ++ GSDHLALV E AF
Sbjct  406   GLPYKKLGSDHLALVSEFAF  425


 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  1718  HCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEV  1539
             H ++ F  VSYN+L  +N   H DLY NVLP  +DWD+R++++C+E+ G NP I+C QEV
Sbjct  83    HQEERFTVVSYNILGDKNVSNHGDLYRNVLPTYLDWDHRRRVICEELLGLNPDIICLQEV  142

Query  1538  DRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             D+Y DL N+L+K G+ G Y+ RTG S DGCA+FWK + + L
Sbjct  143   DKYYDLLNILEKAGYLGSYKRRTGGSVDGCAMFWKVDKFQL  183



>gb|KHN21555.1| Carbon catabolite repressor protein 4 like 3 [Glycine soja]
Length=435

 Score =   226 bits (576),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 177/265 (67%), Gaps = 17/265 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESI+F+  GLR+NVAQ  VF+     C +DS  +          LVGNIHVL+
Sbjct  162   KFRLLEGESIQFKDIGLRDNVAQLSVFEM----CESDSRRM----------LVGNIHVLY  207

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQIR L   AQ LS++WGN P+VLAGD NS P+S +Y+FL+SS+L+I +++
Sbjct  208   NPNRGEVKLGQIRFLSSRAQYLSEKWGNTPVVLAGDFNSTPQSGIYKFLSSSELNIMLYD  267

Query  928   RIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
             R  +SGQ    P+       ++V    A   L   WTDEE++LATG    HL +H LKL 
Sbjct  268   RKELSGQKRCRPAQVLGENKETVGPIVALDGLFKCWTDEEVKLATGDSERHLAVHPLKLN  327

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA + G++ TR   GEPLATS+HSKFLGTVDY+W++  +VP RVLD + ++ L R  G
Sbjct  328   SSYATINGSTSTRGFNGEPLATSYHSKFLGTVDYLWYSDGIVPTRVLDTVSISDLLRAGG  387

Query  577   LPSEEWGSDHLALVCELAFAGEGDE  503
             LP ++ GSDHLALV E +F+   +E
Sbjct  388   LPCKKVGSDHLALVSEFSFSVTNNE  412


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             +R WV +       ++ F   SYN+L   NA +H DLY NV    ++W  RK+++C E+ 
Sbjct  53    KRHWVEASDQSLASQERFSVASYNILGDRNASQHSDLYVNVPSRYINWGRRKRVICDELF  112

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             G++P I+C QEVD+Y +L +++ K G+ G Y+ RTGD+ DGCA+FWK + + L
Sbjct  113   GWDPDIICLQEVDKYFELSDIMVKAGYAGSYKRRTGDAADGCAMFWKADKFRL  165



>ref|XP_003524384.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
[Glycine max]
Length=435

 Score =   226 bits (576),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 177/265 (67%), Gaps = 17/265 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESI+F+  GLR+NVAQ  VF+     C +DS  +          LVGNIHVL+
Sbjct  162   KFRLLEGESIQFKDIGLRDNVAQLSVFEM----CESDSRRM----------LVGNIHVLY  207

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQIR L   AQ LS++WGN P+VLAGD NS P+S +Y+FL+SS+L+I +++
Sbjct  208   NPNRGEVKLGQIRFLSSRAQYLSEKWGNTPVVLAGDFNSTPQSGIYKFLSSSELNIMLYD  267

Query  928   RIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
             R  +SGQ    P+       ++V    A   L   WTDEE++LATG    HL +H LKL 
Sbjct  268   RKELSGQKRCRPAQVLGENKETVGPIVALDGLFKCWTDEEVKLATGDSERHLAVHPLKLN  327

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA + G++ TR   GEPLATS+HSKFLGTVDY+W++  +VP RVLD + ++ L R  G
Sbjct  328   SSYATINGSTSTRGFNGEPLATSYHSKFLGTVDYLWYSDGIVPTRVLDTVSISDLLRAGG  387

Query  577   LPSEEWGSDHLALVCELAFAGEGDE  503
             LP ++ GSDHLALV E +F+   +E
Sbjct  388   LPCKKVGSDHLALVSEFSFSVTNNE  412


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             +R WV +       ++ F   SYN+L   NA +H DLY NV    ++W  RK+++C E+ 
Sbjct  53    KRHWVEASDQSLASQERFSVASYNILGDRNASQHSDLYVNVPSRYINWGRRKRVICDELF  112

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             G++P I+C QEVD+Y +L +++ K G+ G Y+ RTGD+ DGCA+FWK + + L
Sbjct  113   GWDPDIICLQEVDKYFELSDIMVKAGYAGSYKRRTGDAADGCAMFWKADKFRL  165



>ref|NP_001189925.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
 gb|AEE76107.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
Length=449

 Score =   226 bits (577),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 179/266 (67%), Gaps = 23/266 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  201   RFGVLERENIEFSQFGMRDNVAQLAVLELRKSN-------------KSRKILLGNIHVLY  247

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQ+R L   A  LS++WG+IPIVL GD NS PKS +Y FL SS+L++  H+
Sbjct  248   NPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKSPLYNFLASSELNVMEHD  307

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHR-----WTDEELRLATGTVSVHL-LHQL  767
             +  +SGQ +   +PT   ++   +++   +  R     WT EE+R+ATG  + +   H L
Sbjct  308   KKELSGQKN--CRPTKVLET--GSKSSNTITFRSFCSSWTKEEIRVATGQENSYWAAHPL  363

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KL S+YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  L+P RVLD LP+++L +
Sbjct  364   KLNSSYASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDGLLPARVLDTLPIDVLCK  423

Query  586   TRGLPSEEWGSDHLALVCELAFAGEG  509
             T+GLP +E GSDHLALV E  F  +G
Sbjct  424   TKGLPCQELGSDHLALVSEFVFEPDG  449


 Score =   100 bits (248),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   + F  VSYN+L   N+  H +LY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTTPVSQALERFTVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               NP I+  QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + + +
Sbjct  152   RLNPDIISMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAMFWKADRFGV  204



>ref|XP_010416212.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   224 bits (572),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 162/260 (62%), Gaps = 47/260 (18%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV                                   
Sbjct  186   FKLLDYQHIEFDRFDMRNNVAQLCVL----------------------------------  211

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
                      ++RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R
Sbjct  212   ---------EVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDR  262

Query  925   IHISGQIDPSVKPTYR-FKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
               ISGQ +  V+P  R F+   A  A   L + W+ EEL+ ATG   S H+ HQLKL SA
Sbjct  263   RQISGQSE--VEPKKRSFRKRAAVSASGSLPNAWSKEELQFATGGQASTHVQHQLKLHSA  320

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT  LP
Sbjct  321   YSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRTCRLP  380

Query  571   SEEWGSDHLALVCELAFAGE  512
             SE+WGSDHLA+ CEL F  +
Sbjct  381   SEKWGSDHLAIACELGFVND  400


 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++CKEI  
Sbjct  77    REWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLICKEISR  136

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD +L+  GF+GV++ RTG++ DGCAIFWK +L+ L
Sbjct  137   YNASILCLQEVDRFDDLDGILKNRGFQGVHKSRTGEASDGCAIFWKEKLFKL  188



>ref|NP_188479.3| DNAse I-like superfamily protein [Arabidopsis thaliana]
 gb|AEE76105.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
Length=426

 Score =   225 bits (573),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 171/261 (66%), Gaps = 14/261 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  179   RFGVLERENIEFSQFGMRDNVAQLAVLELRKSN-------------KSRKILLGNIHVLY  225

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQ+R L   A  LS++WG+IPIVL GD NS PKS +Y FL SS+L++  H+
Sbjct  226   NPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKSPLYNFLASSELNVMEHD  285

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLCSA  752
             +  +SGQ +          S  +          WT EE+R+ATG  + +   H LKL S+
Sbjct  286   KKELSGQKNCRPTKVLETGSKSSNTITFSFCSSWTKEEIRVATGQENSYWAAHPLKLNSS  345

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  L+P RVLD LP+++L +T+GLP
Sbjct  346   YASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDGLLPARVLDTLPIDVLCKTKGLP  405

Query  571   SEEWGSDHLALVCELAFAGEG  509
              +E GSDHLALV E  F  +G
Sbjct  406   CQELGSDHLALVSEFVFEPDG  426


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 23/113 (20%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   + F  VSYN+L   N+  H +LY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTTPVSQALERFTVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               NP I+  Q                       RTGD+ DGCA+FWK + + +
Sbjct  152   RLNPDIISMQR----------------------RTGDNVDGCAMFWKADRFGV  182



>ref|NP_001078178.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
 sp|Q9LS39.2|CCR4C_ARATH RecName: Full=Carbon catabolite repressor protein 4 homolog 3; 
Short=CCR4 homolog 3 [Arabidopsis thaliana]
 gb|AEE76106.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
Length=448

 Score =   226 bits (575),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 171/261 (66%), Gaps = 14/261 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  201   RFGVLERENIEFSQFGMRDNVAQLAVLELRKSN-------------KSRKILLGNIHVLY  247

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQ+R L   A  LS++WG+IPIVL GD NS PKS +Y FL SS+L++  H+
Sbjct  248   NPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKSPLYNFLASSELNVMEHD  307

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLCSA  752
             +  +SGQ +          S  +          WT EE+R+ATG  + +   H LKL S+
Sbjct  308   KKELSGQKNCRPTKVLETGSKSSNTITFSFCSSWTKEEIRVATGQENSYWAAHPLKLNSS  367

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  L+P RVLD LP+++L +T+GLP
Sbjct  368   YASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDGLLPARVLDTLPIDVLCKTKGLP  427

Query  571   SEEWGSDHLALVCELAFAGEG  509
              +E GSDHLALV E  F  +G
Sbjct  428   CQELGSDHLALVSEFVFEPDG  448


 Score =   100 bits (248),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   + F  VSYN+L   N+  H +LY NV    + W YRK+++C+E+ 
Sbjct  92    RDWIDSDTTPVSQALERFTVVSYNILGDGNSSYHRELYSNVSVPYLKWGYRKRLICEELI  151

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               NP I+  QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + + +
Sbjct  152   RLNPDIISMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAMFWKADRFGV  204



>ref|XP_008374735.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 [Malus 
domestica]
Length=455

 Score =   225 bits (574),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 174/259 (67%), Gaps = 18/259 (7%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL +ESIEF+ +GL +NVAQ  VF+ ++ E              S++ ++GNIHVL+N
Sbjct  188   FRLLEEESIEFKGYGLGDNVAQLSVFETQKAE--------------SRNVVIGNIHVLYN  233

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RG+ KLGQIR L+  A+ LS+ WGN P+VL GD N  PKSA+Y+FL+ S+L+I +++R
Sbjct  234   PTRGEAKLGQIRFLISRAKILSERWGNAPVVLCGDFNITPKSAIYKFLSKSELNIMLYDR  293

Query  925   IHISGQIDPSVKPTYRFK---SVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
               +SGQ D         K   S P       L H WTDEE+R+ATG    HL +H +KL 
Sbjct  294   RELSGQRDCHPAKVLGAKQEISSPLTMIDGLLKHCWTDEEIRVATGDADSHLVVHPMKLN  353

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V G+++TRD  GEP AT++HSKFLGTVDY+W++  LVP RV+D +PV++L++   
Sbjct  354   SSYATVQGSTRTRDPNGEPAATTYHSKFLGTVDYLWYSDGLVPTRVIDTVPVDVLQKIGS  413

Query  577   LPSEEWGSDHLALVCELAF  521
             LP ++ GSDHLALV E AF
Sbjct  414   LPCKKVGSDHLALVTEFAF  432


 Score =   106 bits (265),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ +       +D F   SYN+L   NA  H D+Y NV  + + WD+R++++C E+  
Sbjct  79    RHWIQAENQPLASRDRFSVASYNILGDRNAFWHRDMYRNVPSKYLKWDHRRRVICDELAE  138

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP IMC QEVD+Y +L  +L K G+ G Y+ RTG S DGCAIFWK + + L
Sbjct  139   WNPDIMCLQEVDKYFELSEILAKVGYVGSYKRRTGGSVDGCAIFWKPDNFRL  190



>ref|XP_010471468.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X2 [Camelina sativa]
Length=404

 Score =   223 bits (567),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 165/264 (63%), Gaps = 51/264 (19%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV                                   
Sbjct  186   FKLLDYQHIEFDRFDMRNNVAQLCVL----------------------------------  211

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
                      ++RL +E A +LSQEWGNIP+V+AGDLNS P+SA+Y F+ S+ LD ++H R
Sbjct  212   ---------EVRLFLEKAYQLSQEWGNIPVVIAGDLNSTPQSAIYDFIASADLDTQLHNR  262

Query  925   IHISGQIDPSVKPTYR-FKSVPAARA----RKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
               ISGQ +  ++P  R F++  A RA       L + W+ EEL+ ATG   S H+ HQLK
Sbjct  263   RQISGQSE--MEPKKRSFRNRYAVRAAVSTSGSLPNVWSKEELQFATGGQASTHVQHQLK  320

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT
Sbjct  321   LHSAYSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRT  380

Query  583   RGLPSEEWGSDHLALVCELAFAGE  512
              GLPSE+WGSDHLA+ CEL F  +
Sbjct  381   CGLPSEKWGSDHLAIACELGFVND  404


 Score =   141 bits (355),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++CKEI  
Sbjct  77    REWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLICKEISR  136

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD LL+  GF+GV++ RTG++ DGCAIFWK +L+ L
Sbjct  137   YNASILCLQEVDRFDDLDGLLKTRGFQGVHKSRTGEASDGCAIFWKEKLFKL  188



>ref|XP_003630828.1| Carbon catabolite repressor protein-like protein [Medicago truncatula]
 gb|AET05304.1| carbon catabolite repressor-like protein [Medicago truncatula]
Length=414

 Score =   223 bits (568),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 177/260 (68%), Gaps = 17/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESI+++  GLR+NVAQ  VF+            ++  D  S+  LVGNIHVL+
Sbjct  148   KFRLLDGESIQYKNIGLRDNVAQLLVFE------------MSGSD--SRRLLVGNIHVLY  193

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQIR L   AQ LS++WGN P++LAGD NS P+S +Y+FL++S+L+I++++
Sbjct  194   NPNRGEVKLGQIRFLSSKAQSLSEKWGNAPVILAGDFNSTPESGIYKFLSTSELNIKLYD  253

Query  928   RIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
             R  +SGQ    P+     + ++V    +   L+  WTDEE++ ATG    HL +H LKL 
Sbjct  254   RKQLSGQKRCRPAQVLGEKKETVGPFSSLDGLLDFWTDEEVKTATGDSECHLAVHPLKLN  313

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V G++ TR   GEPLATS+HSKFLGTVDY+W++  +VP RVLD + ++ L R  G
Sbjct  314   SSYATVNGSASTRGLNGEPLATSYHSKFLGTVDYLWYSEGIVPTRVLDTVSISDLLREGG  373

Query  577   LPSEEWGSDHLALVCELAFA  518
             LP ++ GSDHLAL+ E +F+
Sbjct  374   LPCKKVGSDHLALLSEFSFS  393


 Score =   108 bits (270),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             +R+WV +        + F   SYN+LA  NA +H DLY NV    ++W+ R++IL +E+ 
Sbjct  39    QRRWVEAFDQSLASPERFTVASYNILADRNASQHTDLYVNVPSRYINWNRRQKILSEELF  98

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +NP I+C QEVD Y +L N+L K G+ G Y+ RTGD+ DGCA+FWK + + L
Sbjct  99    EWNPDIICLQEVDMYVELSNILVKAGYAGSYKRRTGDTSDGCAMFWKADKFRL  151



>ref|XP_010318600.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Solanum lycopersicum]
Length=444

 Score =   224 bits (570),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 174/261 (67%), Gaps = 19/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ES+EF + GLR+NVAQ  VF+ +              +  S+  +VGNIHVL+
Sbjct  180   KFQLLEGESVEFRQHGLRDNVAQLSVFEMR--------------EAKSRRLVVGNIHVLY  225

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSS-KLDIRMH  932
             NP RGD+KLGQIR L   A  LS++W ++PIVLAGD NS P+S +Y+FL+SS +L++ +H
Sbjct  226   NPNRGDVKLGQIRFLASRAHILSEKWDHVPIVLAGDYNSTPQSPIYKFLSSSEQLNLMLH  285

Query  931   ERIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLK  764
              R  +SGQ    PS V    R K +      +    RW+DEE+ +A G +  H+ +H LK
Sbjct  286   NRKELSGQRLCHPSQVLGLRREKGILFVLMDRFFNSRWSDEEINVAIGALKSHIAMHPLK  345

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L S+YA V G   TRD+ GEPLATSFHSKFLGTVDY+W++  L P +VLD LP+N+L++T
Sbjct  346   LNSSYAMVKGPLTTRDNSGEPLATSFHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKT  405

Query  583   RGLPSEEWGSDHLALVCELAF  521
              GLP ++ GSDHLALV E AF
Sbjct  406   GGLPYKKLGSDHLALVSEFAF  426


 Score =   117 bits (294),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = -2

Query  1718  HCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEV  1539
             H ++ F   SYN+L   N   H DLY NV P  +DWD+R++++C+E+ G NP I+C QEV
Sbjct  83    HHEERFTVASYNILGDRNVSNHGDLYRNVPPAYLDWDHRRRVICEELLGLNPDIICLQEV  142

Query  1538  DRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             D+Y+DL N+L+K G+ G Y+ RTG S DGCA+FWK + + L
Sbjct  143   DKYNDLLNILEKAGYLGSYKRRTGGSVDGCAMFWKADKFQL  183



>emb|CDO98461.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   223 bits (568),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 184/273 (67%), Gaps = 29/273 (11%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+  ESIEF+++GLR+NVAQ  VF+ ++ +              S+  LVGNIHVL+
Sbjct  160   KFQLIEGESIEFKQYGLRDNVAQVSVFEMRKAK--------------SRRILVGNIHVLY  205

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RGD+KLGQIR L+  A  LS++WGN P+VLAGD NS P+SA+Y F +SS+LDI +H+
Sbjct  206   NPRRGDVKLGQIRFLLSRASILSKKWGNTPVVLAGDYNSTPQSAIYTFFSSSELDIMLHD  265

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPL---MHR-----WTDEELRLAT-GTVSVHLL  776
             R  +SGQ   + +PT   +++   R +  L   M R     WT+EE++ AT GT S  + 
Sbjct  266   RGDLSGQ--KNCRPT---QALGIRREQGSLFLWMDRFLHSSWTNEEIKSATGGTDSRVVR  320

Query  775   HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNI  596
             + LKL S+YA V G+++TR   GEPLATS+HSKFLGTVDY+W +  +VP +V+D LP+N+
Sbjct  321   NPLKLRSSYAMVKGSAETRSSNGEPLATSYHSKFLGTVDYLWFSDGIVPTKVMDTLPINV  380

Query  595   LRRTRGLPSEEWGSDHLALVCELAFA-GEGDET  500
             L+   GLP +++GSDHL L  E AF  G  DE 
Sbjct  381   LKNIGGLPCQKFGSDHLPLASEFAFIRGSKDEN  413


 Score =   117 bits (294),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -2

Query  1751  RKWVYSPRDVSHC--KDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             R+WV +  + +H   ++ F  VSYN+L   NA KH DLY NV    + WDYRK+++C+E+
Sbjct  50    RQWVTADNNRTHLLSEERFTVVSYNILGDRNAFKHWDLYRNVPSIYLKWDYRKRVICEEL  109

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              G NP I+C QEVD+Y D+ NL++K G+ G Y+ RTGD  DGCA+FWK + + L
Sbjct  110   IGLNPDIICLQEVDKYFDVLNLMEKAGYLGSYKRRTGDYADGCAMFWKADKFQL  163



>ref|XP_003563977.1| PREDICTED: LOW QUALITY PROTEIN: carbon catabolite repressor protein 
4 homolog 3-like [Brachypodium distachyon]
Length=457

 Score =   223 bits (569),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 165/257 (64%), Gaps = 26/257 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ  V                 E   +  F++GNIHVLF
Sbjct  183   RLRLLEEDSIDFSEFNLRNNVAQILVL----------------ELNGTHKFVLGNIHVLF  226

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQIR+L+E A  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+
Sbjct  227   NPKRGDVKLGQIRMLLEKANALAEKWDGIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHD  286

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y   S+        L ++WTDEE+R ATG  +V +  H L+L S+
Sbjct  287   RKQLSG-LDSSDFGLYELCSL--------LNYQWTDEEVRNATGYSNVTVARHPLRLSSS  337

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G S  R   GEPLATS+H KFLGTVDY+W+T  L   RVLD LP+  LR TRGLP
Sbjct  338   YAMLKGNSSNRGHQGEPLATSYHKKFLGTVDYLWYTPGLECSRVLDTLPMGALRGTRGLP  397

Query  571   SEEWGSDHLALVCELAF  521
             + E GSDHL +V E  F
Sbjct  398   TREMGSDHLPIVAEFVF  414


 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 73/115 (63%), Gaps = 0/115 (0%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQI  1593
             P   V  R+WV++    +   D    +SYN+LA  NA+ HPDLY +V  + M WD R+++
Sbjct  68    PQTPVPSRQWVFAEEASTSSGDACTIMSYNILADNNARNHPDLYLDVPWDAMRWDSRRRL  127

Query  1592  LCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             + +EIR ++  ++C QEVDR+ ++   ++  G+   ++ RTGD+ DGCA FWK+E
Sbjct  128   IIREIRHWDADLVCLQEVDRFREISAEMKNRGYECSFKGRTGDAKDGCATFWKSE  182



>ref|XP_004301074.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
[Fragaria vesca subsp. vesca]
Length=428

 Score =   222 bits (566),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/267 (48%), Positives = 175/267 (66%), Gaps = 21/267 (8%)
 Frame = -3

Query  1279  LLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFNPK  1100
             LL +ESIEF+ +GLR+NVAQ  VF+  + +              S+  ++GNIHVL++P 
Sbjct  171   LLDEESIEFKGYGLRDNVAQLSVFEMHKDK--------------SRKLVIGNIHVLYSPS  216

Query  1099  RGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIH  920
             RG+IKLGQIR L+  A  LS+ WGN P+VL GD NS P+SA+Y+FL++S+L+I  ++R  
Sbjct  217   RGEIKLGQIRFLLSRAHILSERWGNAPVVLCGDFNSTPQSAIYKFLSTSELNIMSYDRTE  276

Query  919   ISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVH-LLHQLKLCSA  752
             +SGQ    P+ V    +  S P       L H WTDEE+R+ATG    H ++H LKL S+
Sbjct  277   LSGQKSCHPAQVLGVKQRTSSPLNLIDGLLKHSWTDEEIRVATGNSGSHSVVHPLKLNSS  336

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G++ TR   GEPLATS+HSKFLGTVDY+W++  LVP  VLD + ++ L+R   LP
Sbjct  337   YAMVQGSTATRGSSGEPLATSYHSKFLGTVDYLWYSDGLVPTGVLDTVSLDTLQRIGSLP  396

Query  571   SEEWGSDHLALVCELAF---AGEGDET  500
              ++ GSDHLALV E AF     EG+ T
Sbjct  397   CKKVGSDHLALVSEFAFTPGTKEGNNT  423


 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+W+ S   ++  +D F   SYN+L   NA  H D+Y NV    + WD+RK+++C EI  
Sbjct  61    RRWIQSDHPLA-SQDRFTVASYNILGDRNAFAHRDMYGNVPSMYLKWDHRKRVICDEISA  119

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKN  1431
             +N  I+C QEVD+Y +L N L K G+ G Y+ RTGD+ DGCA FWK+
Sbjct  120   WNSHIVCLQEVDKYLELSNNLAKLGYAGSYKRRTGDTVDGCATFWKS  166



>ref|XP_010416210.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X1 [Camelina sativa]
 ref|XP_010416211.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   221 bits (564),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 163/262 (62%), Gaps = 47/262 (18%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  + IEF+RF +RNNVAQ CV                                   
Sbjct  186   FKLLDYQHIEFDRFDMRNNVAQLCVL----------------------------------  211

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
                      ++RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R
Sbjct  212   ---------EVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDR  262

Query  925   IHISGQ--IDPSVKPTYRFKSVPAA-RARKPLMHRWTDEELRLATG-TVSVHLLHQLKLC  758
               ISGQ  ++P  +   +  +V AA  A   L + W+ EEL+ ATG   S H+ HQLKL 
Sbjct  263   RQISGQSEVEPKKRSFRKRYAVSAAVSASGSLPNAWSKEELQFATGGQASTHVQHQLKLH  322

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             SAY+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT  
Sbjct  323   SAYSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRTCR  382

Query  577   LPSEEWGSDHLALVCELAFAGE  512
             LPSE+WGSDHLA+ CEL F  +
Sbjct  383   LPSEKWGSDHLAIACELGFVND  404


 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++CKEI  
Sbjct  77    REWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLICKEISR  136

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+C QEVDR+DDLD +L+  GF+GV++ RTG++ DGCAIFWK +L+ L
Sbjct  137   YNASILCLQEVDRFDDLDGILKNRGFQGVHKSRTGEASDGCAIFWKEKLFKL  188



>gb|KFK39180.1| hypothetical protein AALP_AA3G210600 [Arabis alpina]
Length=436

 Score =   222 bits (566),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/264 (48%), Positives = 172/264 (65%), Gaps = 18/264 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++ +              S+  ++GNIHVL+
Sbjct  187   RFRVLERENIEFSQFGMRDNVAQLSVLELRKSK--------------SRKLVLGNIHVLY  232

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++WG+IPIVL GD N+ P+S +Y FL SS+L++  H+
Sbjct  233   NPSRGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNTTPQSPLYNFLASSELNVMEHD  292

Query  928   RIHISGQID---PSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ +     V  T    S       +     WT+EE+R+ATG  + +  +H LKL
Sbjct  293   RRELSGQRNCHPTQVLETGNKYSNAITSVNRCFSSSWTNEEIRVATGQENSYWAVHPLKL  352

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+S TRD +GEPLATS+H KFLGTVDY+W++  LV  RVLD LP++ L +T+
Sbjct  353   QSSYASVKGSSNTRDSVGEPLATSYHMKFLGTVDYLWYSDGLVAARVLDTLPIDALCKTK  412

Query  580   GLPSEEWGSDHLALVCELAFAGEG  509
             GLP +E GSDHLALV E  F   G
Sbjct  413   GLPCKELGSDHLALVSEFFFEPNG  436


 Score =   103 bits (257),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 71/111 (64%), Gaps = 1/111 (1%)
 Frame = -2

Query  1751  RKWVYSPRD-VSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   + F  VSYN+L  +N+  H DLY NV    + W YRK+++C+E+ 
Sbjct  78    RDWIDSETSPVSEDSERFTLVSYNILGDKNSSYHRDLYSNVSFPYLKWGYRKRLICEELI  137

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                P I+C QEVD+Y DL ++++K G+ G Y  RTGD+ DGCA+FWK + +
Sbjct  138   RLKPDIICLQEVDKYFDLFSMMEKAGYAGSYMRRTGDNIDGCAMFWKADRF  188



>ref|XP_001763073.1| predicted protein [Physcomitrella patens]
 gb|EDQ71950.1| predicted protein, partial [Physcomitrella patens]
Length=347

 Score =   219 bits (559),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 166/258 (64%), Gaps = 31/258 (12%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL +E I+F  F LR+NVAQ CV                   + +   +VGN H+LF
Sbjct  96    RFELLEEECIKFNEFNLRDNVAQLCV-------------------LWNNCVVVGNTHLLF  136

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQ R+L+E A  +S++WGN P+ +AGD NS P SA+Y+F++ S+LD+  H+
Sbjct  137   NPKRGDVKLGQARVLLEKAHAISEKWGNAPVAIAGDFNSTPWSALYRFMSCSQLDLAGHD  196

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R +ISGQ + + +   RFK+   +        RW   EL  ATG   + ++ H+L L SA
Sbjct  197   RRNISGQEEGAKE---RFKTNAYS--------RWDQSELMAATGASDLSVVQHKLDLRSA  245

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y+ + G   +RD+ GEP  T+FH KF GTVDYIWHT +LV +RVLD LP ++L+  +GLP
Sbjct  246   YSEIEGKPGSRDERGEPFVTTFHKKFRGTVDYIWHTDDLVTVRVLDTLPTSVLQHCKGLP  305

Query  571   SEEWGSDHLALVCELAFA  518
             S++WGSDHLAL CE  FA
Sbjct  306   SKKWGSDHLALACEFCFA  323


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -2

Query  1703  FVFVSYNLLAVENAKKHPD-LYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYD  1527
             F+ VSYN+LA  NA+ H D LY ++ P +MDWD RK+ L +E+  ++P IMC QEVD Y+
Sbjct  3     FIIVSYNILADVNARAHWDELYWHIPPFIMDWDARKKKLLRELALWSPDIMCLQEVDHYE  62

Query  1526  DLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             DL+  L+  G+ GVY  RTG S DGCA+FW+   ++L
Sbjct  63    DLNEELESKGYVGVYTSRTGASTDGCAMFWRKNRFEL  99



>ref|XP_010549138.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Tarenaya hassleriana]
 ref|XP_010549139.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Tarenaya hassleriana]
 ref|XP_010549140.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Tarenaya hassleriana]
Length=275

 Score =   217 bits (552),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 176/263 (67%), Gaps = 21/263 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  E+IEF+ FGL +NVAQ  VF+  + +              S+  LVGN HVL+
Sbjct  20    RFQLLESENIEFKSFGLHDNVAQLSVFEMCKSK--------------SRKLLVGNTHVLY  65

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
              P RGD+KLGQIRLL   A  LS++WGNIP+VLAGD NS P+S VY FL +S+L++  H 
Sbjct  66    YPSRGDVKLGQIRLLCSRAHLLSKKWGNIPVVLAGDFNSTPESPVYNFLATSELNVMEHN  125

Query  928   RIHISGQID--PS-VKPTYRFKS-VPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
             R  +SGQ +  P+ V  T R +S +  +  R      WT+EE+R+ATG   S   +H LK
Sbjct  126   RRELSGQRNCHPTRVLGTSRKQSDMLVSIGRSLGGSSWTNEEIRIATGRDNSYWAVHPLK  185

Query  763   LCSAYAGVPGT-SKTRDDLGEPLATSFHSKFLGTVDYIWHT-AElvplrvldplpVNILR  590
             L S+YA V G+ ++TRD  GEPLATS+HSKFLGTVDY+W++   LVP RVLD LP+++L 
Sbjct  186   LRSSYASVKGSAARTRDSAGEPLATSYHSKFLGTVDYLWYSDGGLVPARVLDTLPIDVLC  245

Query  589   RTRGLPSEEWGSDHLALVCELAF  521
             +TRGLP E+ GSDHLALV E  F
Sbjct  246   KTRGLPCEKLGSDHLALVSEFMF  268



>ref|XP_006297580.1| hypothetical protein CARUB_v10013601mg [Capsella rubella]
 gb|EOA30478.1| hypothetical protein CARUB_v10013601mg [Capsella rubella]
Length=477

 Score =   223 bits (568),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 177/262 (68%), Gaps = 18/262 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+ +NVAQ  V + ++               +S+  L+GNIHV +
Sbjct  232   RFRVLERENIEFSQFGMGDNVAQLAVLELRKS--------------NSRKILLGNIHVRY  277

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL SS+L+I  H+
Sbjct  278   NPNKGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNSTPQSPLYNFLASSELNIMEHD  337

Query  928   RIHISGQIDPSVKPTYRFKS-VPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLCS  755
             +  +SGQ +   +PT   ++    + +   +   WT+EE+R+ATG  + +  +H LKL S
Sbjct  338   KRQLSGQKN--CRPTQVLETGSKTSNSITFISSSWTNEEIRVATGQENSYWAVHPLKLSS  395

Query  754   AYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGL  575
             +YA V G++ TRD +GEPLATS+HSKFLGTVDY+W++  LVP RVLD LP+++L +TRGL
Sbjct  396   SYASVKGSANTRDSVGEPLATSYHSKFLGTVDYLWYSDGLVPARVLDTLPIDVLCKTRGL  455

Query  574   PSEEWGSDHLALVCELAFAGEG  509
             P +E GSDHLALV E  F   G
Sbjct  456   PCQELGSDHLALVSEFFFEPNG  477


 Score =   111 bits (278),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = -2

Query  1751  RKWVYS--PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             R W+ S     VS   + F  VSYN+L V NA  H DLY NV    + W YRK+++C+E+
Sbjct  122   RDWIVSDTTTPVSQGSERFTVVSYNILGVRNASHHIDLYSNVSFPYLKWGYRKRLICEEL  181

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                NP I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  182   IRLNPDIICMQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAVFWKADRF  233



>ref|XP_007160361.1| hypothetical protein PHAVU_002G315100g [Phaseolus vulgaris]
 gb|ESW32355.1| hypothetical protein PHAVU_002G315100g [Phaseolus vulgaris]
Length=434

 Score =   222 bits (565),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 178/265 (67%), Gaps = 17/265 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  E+I+F+  GLR+NVAQ  VF+     C          +  S+  +VGNIHVL+
Sbjct  167   KFRLLEGENIQFKDIGLRDNVAQLSVFEM----C----------ESYSRRLIVGNIHVLY  212

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +G++KLGQIR L   AQ LS++WGNIP+VLAGD NS P+S +Y+FL+SS+L++++++
Sbjct  213   NPNKGEVKLGQIRFLSSRAQYLSEKWGNIPVVLAGDFNSTPQSGIYKFLSSSELNVKLYD  272

Query  928   RIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
             +  +SGQ    P+       ++V     +  L+  WTDEE+++ATG    HL +H LKL 
Sbjct  273   KKELSGQKRCRPAQVIWENKETVGPVVTQDSLLKCWTDEEIKIATGDSQRHLAVHPLKLN  332

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V G++ TR   GEPLATS+HSKFLGTVDY+W++  +VP RVLD + ++ L R  G
Sbjct  333   SSYATVNGSTSTRGFNGEPLATSYHSKFLGTVDYLWYSDGIVPTRVLDTVSISDLLREGG  392

Query  577   LPSEEWGSDHLALVCELAFAGEGDE  503
             LP ++ GSDHLALV E  F+   +E
Sbjct  393   LPCKKVGSDHLALVSEFTFSVTNNE  417


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             +R WV +        + F   SYN+L   NA +H DLY NV    + WD RK+++  E+ 
Sbjct  58    KRHWVEASDQSLESPETFSVASYNILGDRNASQHSDLYVNVPSRYIKWDRRKRVISDELL  117

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             G++P I+C QEVD+Y ++ +++ K G+ G YQ RTGDS DGCAIFWK + + L
Sbjct  118   GWDPDIICLQEVDKYLEVSDIMVKAGYAGSYQRRTGDSVDGCAIFWKTDKFRL  170



>ref|XP_006341628.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X1 [Solanum tuberosum]
Length=444

 Score =   222 bits (566),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 174/261 (67%), Gaps = 19/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ES+EF + GLR+NVAQ  VF+ +              +  S+  +VGNIHVL+
Sbjct  180   KFQLLEGESVEFRQHGLRDNVAQLSVFEMR--------------EAKSRRLVVGNIHVLY  225

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSS-KLDIRMH  932
             NP RGD+KLGQIR L   A  LS++W ++PIVLAGD NS P+S +Y+FL+SS +L++ +H
Sbjct  226   NPNRGDVKLGQIRFLSSRAHILSEKWDHVPIVLAGDYNSTPQSPIYKFLSSSEQLNLMLH  285

Query  931   ERIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLK  764
              R  +SGQ    PS V    R K +      +    RW+DEE+ +A GT   H+ +H LK
Sbjct  286   NRKELSGQRRCHPSQVLGLRREKGILFVLMDRFFNSRWSDEEINVAIGTPKSHIAMHPLK  345

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L S+YA V G   TRD+ GEPLATS+HSKFLGTVDY+W++  L P +VLD LP+N+L++T
Sbjct  346   LNSSYAMVKGPLTTRDNSGEPLATSYHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKT  405

Query  583   RGLPSEEWGSDHLALVCELAF  521
              GLP ++ GSDHLALV E AF
Sbjct  406   GGLPYKKLGSDHLALVSEFAF  426


 Score =   120 bits (302),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  1718  HCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEV  1539
             H ++ F  VSYN+L  +N   H DLY NVLP  +DWD+R++++C+E+ G NP I+C QEV
Sbjct  83    HQEERFTVVSYNILGDKNVSNHGDLYRNVLPTYLDWDHRRRVICEELLGLNPDIICLQEV  142

Query  1538  DRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             D+Y DL N+L+K G+ G Y+ RTG S DGCA+FWK + + L
Sbjct  143   DKYYDLLNILEKAGYLGSYKRRTGGSVDGCAMFWKVDKFQL  183



>ref|XP_004503421.1| PREDICTED: LOW QUALITY PROTEIN: carbon catabolite repressor protein 
4 homolog 3-like [Cicer arietinum]
Length=434

 Score =   221 bits (564),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 181/274 (66%), Gaps = 19/274 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESI+++  GLR+NVAQ  VF+     C + S  L          LVGNIHVL+
Sbjct  162   KFNLLDGESIQYKNIGLRDNVAQLLVFE----TCGSGSRRL----------LVGNIHVLY  207

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQIR L   AQ LS++WGN P++LAGD NS P+S +Y+FL+SS+L++++++
Sbjct  208   NPNRGEVKLGQIRFLSSKAQTLSEKWGNAPVILAGDFNSTPQSGIYKFLSSSELNVKLYD  267

Query  928   RIHISGQ--IDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLC  758
             R  +SGQ    P+     + ++V        L+  WTDEE++ ATG    HL +H LKL 
Sbjct  268   RKELSGQKRCRPAQVLGDKKETVGPFILPDRLLDCWTDEEVKTATGDAECHLAVHPLKLN  327

Query  757   SAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRG  578
             S+YA V G++ TR   GEPLATS+HSKFLGTVDY+W++  +VP RVLD + ++ L R  G
Sbjct  328   SSYATVDGSASTRGFNGEPLATSYHSKFLGTVDYLWYSDGIVPTRVLDTVSISDLLRAGG  387

Query  577   LPSEEWGSDHLALVCELAFAGEGDET*IAFVEAA  476
             LP ++ GSDHL LV E +F+   +++    VEAA
Sbjct  388   LPCKKVGSDHLGLVSEFSFSVAQNKS--TXVEAA  419


 Score =   108 bits (271),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -2

Query  1754  RRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             +R+W+ S  + ++     F   SYN+LA  NA +HPDLY N+    ++WD R +IL  E+
Sbjct  52    QRRWIQSFDQSLASPTHRFTVASYNILADRNASQHPDLYLNIPSRYINWDRRMRILSHEL  111

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               +NP I+C QEVD+Y +L  +L + G+ G Y+ RTGDS DGCA+FWK + ++L
Sbjct  112   FEWNPDIICLQEVDKYFELSKILVEAGYAGSYKRRTGDSADGCAMFWKADKFNL  165



>ref|XP_011072946.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X4 [Sesamum indicum]
Length=376

 Score =   219 bits (559),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +FTLLH+ESIEF+RFGLRNNVAQFCV K  +   S    A      +S++FLVGNIHVL+
Sbjct  194   QFTLLHEESIEFQRFGLRNNVAQFCVLKMNQDLPSTGVTARPPCPSTSRNFLVGNIHVLY  253

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+ +E A  LSQEWG IP+V+ GDLNS+P+SA+YQFL SSKL I+ ++
Sbjct  254   NPKRGDIKLGQMRIFLEKAYELSQEWGCIPVVITGDLNSLPQSAMYQFLASSKLHIQQYD  313

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAY  749
             R H+SGQI PS    Y        R  +PLM+RWT+EE+ LATG+    L H LKLCSAY
Sbjct  314   RRHVSGQIFPS---EYAESQSRRNRITRPLMNRWTNEEIMLATGSRLSVLRHHLKLCSAY  370

Query  748   AGVP  737
             AGVP
Sbjct  371   AGVP  374


 Score =   155 bits (392),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 16/181 (9%)
 Frame = -2

Query  1952  DRREKRKKRRVTAVQTEA--HSETLSLADNSNRTSTSHMHAYAHANYhrggehrgkrkrq  1779
             +R+  RKKR+V + +TE     +TL  +  ++R + S++    ++               
Sbjct  31    ERQRSRKKRKVISSETETRIQIQTLRPSSYTHRRTNSYVQKQGNSR--------------  76

Query  1778  RPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             + P     +RKW YS  DVS+  D FV VSYN+L VENA KHP+LY  V P+ +DW +RK
Sbjct  77    KKPRKPQCQRKWTYSTHDVSNYNDRFVIVSYNILGVENATKHPELYRGVSPKYLDWGHRK  136

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             ++LCKE++ Y   I+CFQEVD ++DL  +L  DGFRG+++ R+G++ DGCAIFWK E + 
Sbjct  137   KLLCKEVKDYQASILCFQEVDHFNDLKEILGSDGFRGLHKARSGETRDGCAIFWKTEQFT  196

Query  1418  L  1416
             L
Sbjct  197   L  197



>ref|XP_010549137.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Tarenaya hassleriana]
Length=323

 Score =   218 bits (554),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 176/263 (67%), Gaps = 21/263 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  E+IEF+ FGL +NVAQ  VF+  + +              S+  LVGN HVL+
Sbjct  68    RFQLLESENIEFKSFGLHDNVAQLSVFEMCKSK--------------SRKLLVGNTHVLY  113

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
              P RGD+KLGQIRLL   A  LS++WGNIP+VLAGD NS P+S VY FL +S+L++  H 
Sbjct  114   YPSRGDVKLGQIRLLCSRAHLLSKKWGNIPVVLAGDFNSTPESPVYNFLATSELNVMEHN  173

Query  928   RIHISGQID--PS-VKPTYRFKS-VPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
             R  +SGQ +  P+ V  T R +S +  +  R      WT+EE+R+ATG   S   +H LK
Sbjct  174   RRELSGQRNCHPTRVLGTSRKQSDMLVSIGRSLGGSSWTNEEIRIATGRDNSYWAVHPLK  233

Query  763   LCSAYAGVPGT-SKTRDDLGEPLATSFHSKFLGTVDYIWHT-AElvplrvldplpVNILR  590
             L S+YA V G+ ++TRD  GEPLATS+HSKFLGTVDY+W++   LVP RVLD LP+++L 
Sbjct  234   LRSSYASVKGSAARTRDSAGEPLATSYHSKFLGTVDYLWYSDGGLVPARVLDTLPIDVLC  293

Query  589   RTRGLPSEEWGSDHLALVCELAF  521
             +TRGLP E+ GSDHLALV E  F
Sbjct  294   KTRGLPCEKLGSDHLALVSEFMF  316


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  1547  QEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +EVD+Y DL + L+K G+ G Y+ RTGD+ DGCA+FWK + + L
Sbjct  28    KEVDKYFDLFSTLEKAGYAGSYKRRTGDNVDGCALFWKADRFQL  71



>ref|XP_010037355.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49061.1| hypothetical protein EUGRSUZ_K02664 [Eucalyptus grandis]
Length=460

 Score =   221 bits (564),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 170/266 (64%), Gaps = 22/266 (8%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LL +ESI+F+  GLR+NVAQ  VF+  + E              S+  LVGNIHVL+N
Sbjct  198   FSLLEEESIKFKELGLRDNVAQLSVFQACKAE--------------SKKLLVGNIHVLYN  243

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGD+KLGQIR L   A  LS++WG+IP++LAGD N+ P+SA+Y+FL+ SKLDI  ++R
Sbjct  244   PSRGDVKLGQIRHLSSRAHILSEKWGSIPVLLAGDFNTTPQSAIYKFLSMSKLDIMSYDR  303

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHR-----WTDEELRLATGTVSVHLL-HQLK  764
               +SGQ   S  P   F           L+ R     WTDEE++ A G     ++ H L 
Sbjct  304   RELSGQR--SCHPAQVFGEKQDLSNSLFLIDRFLTCGWTDEEIKTAGGNAKGEVVAHPLN  361

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             + S+YA   G+++TR   GEPLATS+HSKF GTVDYIW++  +VP RVLD   V +LRRT
Sbjct  362   IKSSYATTRGSARTRGSNGEPLATSYHSKFFGTVDYIWYSKGVVPTRVLDTPSVGVLRRT  421

Query  583   RGLPSEEWGSDHLALVCELAFAGEGD  506
              GLP ++ GSDHLALV E AF  + D
Sbjct  422   GGLPCKKVGSDHLALVSEFAFTQDSD  447


 Score =   117 bits (294),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + R ++  +  F  VSY +L  +NA KH DLY N+ P  M W+ RK+++C+E+ G
Sbjct  90    RSWIEADRPLAS-QAKFTMVSYYILGDKNASKHRDLYTNIPPLYMKWERRKRVICEELIG  148

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y +L  +L+K G+ G Y+ RTGD+ DGCAIFWK   + L
Sbjct  149   WNPDIICLQEVDKYFELSKILEKAGYIGSYKRRTGDAVDGCAIFWKANEFSL  200



>gb|KDP20095.1| hypothetical protein JCGZ_05864 [Jatropha curcas]
Length=457

 Score =   221 bits (562),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/246 (53%), Positives = 168/246 (68%), Gaps = 22/246 (9%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  ESIEF+  GLR+NVAQ  VF+  + E              S+  LVGNIHVL+N
Sbjct  179   FRLLEAESIEFKALGLRDNVAQLSVFEICKAE--------------SKRILVGNIHVLYN  224

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGD+KLGQIR L+  AQ L+++WGNIPIVLAGD NS P+SA+Y+FL SS+LDI ++++
Sbjct  225   PHRGDVKLGQIRFLLSRAQILAEKWGNIPIVLAGDFNSTPQSAIYKFLASSELDIMLYDK  284

Query  925   IHISGQIDPSVKPTYRFK-----SVPAARARKPLMHRWTDEELRLATGTVSVH-LLHQLK  764
               +SGQ +   KP   F        P +   + L + WT+EE++ ATG      LLH LK
Sbjct  285   KELSGQRN--CKPAQVFGVKKEMGNPFSLMDRYLKNCWTNEEIKAATGNSKCQLLLHPLK  342

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             L S+YA V G+++TRD  GEPLATS+HSKFLGTVDY+W++  +VP+RVLD LP +ILRRT
Sbjct  343   LSSSYATVKGSTRTRDLHGEPLATSYHSKFLGTVDYLWYSDGVVPIRVLDTLPFDILRRT  402

Query  583   RGLPSE  566
              GLP E
Sbjct  403   GGLPCE  408


 Score =   115 bits (288),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R WV   +  +  ++ F  VSYN+L   NA KH D+YPNV P  + W +RK+++CKE+ G
Sbjct  70    RHWVEDDQPQALQENRFTVVSYNILGDRNAYKHRDMYPNVDPLYLKWAHRKRVICKELAG  129

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVDRY DL   ++K G+ G Y+ RTGD  DGCA+FWK + + L
Sbjct  130   WNPDIICLQEVDRYFDLLKSVEKLGYAGSYKRRTGDYSDGCAVFWKADEFRL  181



>ref|XP_009595088.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Nicotiana tomentosiformis]
Length=438

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 172/260 (66%), Gaps = 18/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESIE+ ++GLR+NVAQ  VFK +  +              S+  +VGNIHVL+
Sbjct  179   KFQLLEGESIEYRQYGLRDNVAQLSVFKMREAQ--------------SRRLVVGNIHVLY  224

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W   PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  225   NPSRGDVKLGQIRFLSSRAHILSEKWDGAPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  284

Query  928   RIHISG--QIDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SG  Q  PS V    R + +      + L   W++EE+ +A G     + LH LKL
Sbjct  285   RRELSGQRQCHPSQVLGLRRERGILFVLMDRFLNSSWSEEEMNVAIGAPKSPIALHPLKL  344

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+  TRD+ GEPLATS+HSKFLGTVDY+W++  L P +VLD LP+N+L++T 
Sbjct  345   NSSYAMVKGSLTTRDNSGEPLATSYHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKTG  404

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP ++ GSDHLALV E AF
Sbjct  405   GLPFKKLGSDHLALVSEFAF  424


 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 77/125 (62%), Gaps = 12/125 (10%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDG------------FVFVSYNLLAVENAKKHPDLYPNVLPELMDW  1611
             RR+   +P  V H  +G            F  VSYN+L   N  KH DLY NV    +DW
Sbjct  58    RRQLSLAPDIVRHWVEGDASSTVPPQAERFTVVSYNILGDRNVSKHGDLYRNVPSNYLDW  117

Query  1610  DYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKN  1431
             D+RK+++C+E+ G NP I+C QEVD+Y DL N+L+K G+ G Y+ RTG S DGCA+FWK 
Sbjct  118   DHRKRVICEELLGLNPDIICLQEVDKYYDLLNVLEKAGYLGSYKRRTGGSVDGCAMFWKP  177

Query  1430  ELYDL  1416
             + + L
Sbjct  178   DKFQL  182



>dbj|BAJ85841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   221 bits (562),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 172/271 (63%), Gaps = 35/271 (13%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ  VF                E   +Q F++GNIHVLF
Sbjct  183   RLRLLEEDSIDFSEFNLRNNVAQVLVF----------------ELNGTQKFVLGNIHVLF  226

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+K+GQIR+L+E A  L+ +W  IPIVLAGD NS P+SA+Y+FL++ KL++ +H+
Sbjct  227   NPKRGDVKMGQIRMLLERANALAGKWDGIPIVLAGDFNSTPESAIYKFLSTMKLNVSLHD  286

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y             L   W+DEE+R ATG+ +V +  H LKL S+
Sbjct  287   RRQLSG-LDSSEFGLY----------CSLLNFEWSDEEVRNATGSSNVMVARHPLKLSSS  335

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G S  R   GEPLATS+H KFLGTVDY+W+T  L   RVLD LPV+ L+RTRGLP
Sbjct  336   YAMLKGNSSNRGHHGEPLATSYHKKFLGTVDYLWYTPGLECSRVLDTLPVDALKRTRGLP  395

Query  571   SEEWGSDHLALVCELAF-------AGEGDET  500
             + E GSDHL +V E  F       + +GDE+
Sbjct  396   TREMGSDHLPIVAEFIFSEQTRYSSEQGDES  426


 Score =   100 bits (250),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQI  1593
             P   V  R+WV++    +   D    +SYN+LA  NA+ HPDLY +V  + + WD R+++
Sbjct  68    PHTPVPSRQWVFADEASTSGSDACTIMSYNILADNNARNHPDLYLDVPWDALRWDSRRRL  127

Query  1592  LCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             +  EIR ++  ++C QEVDR+ ++   ++  G+   ++ RTGD+ DGCA FWK+E
Sbjct  128   IIHEIRHWDSDLVCLQEVDRFREIAAEMKSKGYECSFKGRTGDAKDGCATFWKSE  182



>ref|XP_009595089.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Nicotiana tomentosiformis]
Length=437

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 172/260 (66%), Gaps = 18/260 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESIE+ ++GLR+NVAQ  VFK +  +              S+  +VGNIHVL+
Sbjct  178   KFQLLEGESIEYRQYGLRDNVAQLSVFKMREAQ--------------SRRLVVGNIHVLY  223

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W   PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  224   NPSRGDVKLGQIRFLSSRAHILSEKWDGAPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  283

Query  928   RIHISG--QIDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SG  Q  PS V    R + +      + L   W++EE+ +A G     + LH LKL
Sbjct  284   RRELSGQRQCHPSQVLGLRRERGILFVLMDRFLNSSWSEEEMNVAIGAPKSPIALHPLKL  343

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+  TRD+ GEPLATS+HSKFLGTVDY+W++  L P +VLD LP+N+L++T 
Sbjct  344   NSSYAMVKGSLTTRDNSGEPLATSYHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKTG  403

Query  580   GLPSEEWGSDHLALVCELAF  521
             GLP ++ GSDHLALV E AF
Sbjct  404   GLPFKKLGSDHLALVSEFAF  423


 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 77/124 (62%), Gaps = 11/124 (9%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDG-----------FVFVSYNLLAVENAKKHPDLYPNVLPELMDWD  1608
             RR+   +P  V H  +G           F  VSYN+L   N  KH DLY NV    +DWD
Sbjct  58    RRQLSLAPDIVRHWVEGDASSTVPPQERFTVVSYNILGDRNVSKHGDLYRNVPSNYLDWD  117

Query  1607  YRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             +RK+++C+E+ G NP I+C QEVD+Y DL N+L+K G+ G Y+ RTG S DGCA+FWK +
Sbjct  118   HRKRVICEELLGLNPDIICLQEVDKYYDLLNVLEKAGYLGSYKRRTGGSVDGCAMFWKPD  177

Query  1427  LYDL  1416
              + L
Sbjct  178   KFQL  181



>ref|XP_010465953.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X3 [Camelina sativa]
Length=331

 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 177/261 (68%), Gaps = 23/261 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+ +NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  61    RFRVLERENIEFSQFGMCDNVAQLAVLELRK--------------CKSRKILLGNIHVLY  106

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL SS+L+I  H+
Sbjct  107   NPNKGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNSTPQSPLYSFLASSELNIIEHD  166

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHR---WTDEELRLATGTVSVHL-LHQLKL  761
             +  +SGQ     +PT   ++   +++   +M     WT+EE+R+ATG  + +  +H LKL
Sbjct  167   KKELSGQ--KKCRPTQVLET--GSKSSNTIMFNSSSWTNEEIRVATGQENSYWAVHPLKL  222

Query  760   CSAYAGVPGTS-KTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
              S+YA V G++  TRD +GEPLATS+HSKFLGTVDY+W++  LVP RVLD LP+++L +T
Sbjct  223   NSSYASVKGSANNTRDSVGEPLATSYHSKFLGTVDYLWYSDGLVPARVLDTLPIDVLCKT  282

Query  583   RGLPSEEWGSDHLALVCELAF  521
             + LP +E GSDHLALV EL F
Sbjct  283   KCLPCKELGSDHLALVSELRF  303



>ref|XP_001778811.1| predicted protein [Physcomitrella patens]
 gb|EDQ56397.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   217 bits (553),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 166/268 (62%), Gaps = 19/268 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  E I+F+   LR+NVAQ CV +            + S D  +   +VGNIHVLF
Sbjct  103   RFELLEVEHIKFKDHDLRDNVAQLCVLQ------------VLSCDSKNNRVIVGNIHVLF  150

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQ R+L+E A  + ++WGN P+ +AGD NS P SA+Y+F+TSS+LD+  H+
Sbjct  151   NPKRGDVKLGQARVLLEKAHAICEKWGNAPLAIAGDFNSTPWSALYEFITSSQLDLAFHD  210

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPL------MHRWTDEELRLATGTVSVHLL-HQ  770
             R +ISGQ +       R +  P              +  W + EL  +TG   + ++ H+
Sbjct  211   RRNISGQEEDQNDGFKRNEYNPYKYEGYGFSISWLKVQGWDESELMTSTGERHLSIVRHK  270

Query  769   LKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILR  590
             L L SAY+ + G   +RD+ GEP  TS+H +F GTVDYIWHT EL  +RVLD LP ++L+
Sbjct  271   LNLRSAYSEIKGKPGSRDERGEPFVTSYHKRFKGTVDYIWHTDELCTVRVLDTLPFSVLQ  330

Query  589   RTRGLPSEEWGSDHLALVCELAFAGEGD  506
             R  GLPS++WGSDHLAL CE +F    D
Sbjct  331   RCGGLPSKKWGSDHLALACEFSFVPSAD  358


 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 2/97 (2%)
 Frame = -2

Query  1703  FVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYD  1527
             FV VSYN+LA  N   H  +LY +V P L+DWD RK+ L +E+  ++P I+CFQEVD Y+
Sbjct  11    FVIVSYNILADRNVWNHRSELYWHVPPFLLDWDARKRKLVRELGLWSPDIICFQEVDYYE  70

Query  1526  DLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             DL+  LQK+ + GVY  RTG++ DGCAIFW+   ++L
Sbjct  71    DLNEELQKE-YIGVYTARTGEAHDGCAIFWRKNRFEL  106



>ref|XP_002883134.1| hypothetical protein ARALYDRAFT_898218 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59393.1| hypothetical protein ARALYDRAFT_898218 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   219 bits (557),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 171/261 (66%), Gaps = 17/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+R+NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  191   RFRVLERENIEFSQFGMRDNVAQLAVLELRKSN-------------KSRKILLGNIHVLY  237

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL SS+L++  H+
Sbjct  238   NPNKGDVKLGQIRSLCSKAHLLSKKWGDIPIVLCGDFNSTPQSPLYNFLASSELNVMEHD  297

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKLCSA  752
             +  +SGQ +    P  +     +  +       WT+EE+R+ATG  + +  +H LKL S+
Sbjct  298   KRELSGQKN--CHPA-KVLETGSKSSSTITFSSWTNEEIRVATGQENSYWAVHPLKLNSS  354

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G+  TRD +GEPLATS+H KFLGTVDY+W++  LVP  VLD LP+++L +T+GLP
Sbjct  355   YASVRGSPNTRDSVGEPLATSYHLKFLGTVDYLWYSDGLVPAGVLDTLPIDVLCKTKGLP  414

Query  571   SEEWGSDHLALVCELAFAGEG  509
              +E GSDHLALV E  F   G
Sbjct  415   CQELGSDHLALVSEFFFEPNG  435


 Score =   103 bits (258),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = -2

Query  1751  RKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             R W+ S    VS   + F  VSYN+L   N+  H DLY NV    + W YRK+++C+E+ 
Sbjct  82    RDWIDSDTTPVSQASERFTVVSYNILGDRNSSYHRDLYSNVSFPYLKWGYRKRLICEELI  141

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
               NP I+C QEVD+Y DL +  +K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  142   RLNPDIICMQEVDKYFDLFSTTEKAGYAGSYKRRTGDNIDGCAMFWKADRF  192



>ref|XP_010506947.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
[Camelina sativa]
Length=455

 Score =   218 bits (555),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 179/265 (68%), Gaps = 23/265 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+ +NVAQ  V + ++              + S+  L+GNIHVL+
Sbjct  209   RFRVLERENIEFSQFGMCDNVAQLAVLELRK--------------LKSRKILLGNIHVLY  254

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL SS+L+I  H+
Sbjct  255   NPNKGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNSTPQSPLYSFLASSELNIMEHD  314

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHR---WTDEELRLATGTVSVHL-LHQLKL  761
             +  +SGQ   S +PT   ++   +++   +  +   WT+EE+R+ATG  + +  +H LKL
Sbjct  315   KKELSGQ--KSCRPTQVLET--GSKSSNTVTFKSSSWTNEEIRVATGQENSYWAVHPLKL  370

Query  760   CSAYAGVPGTS-KTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
              SAYA V G++  TRD +GEPLATS+HSKFLGTVDY+W++  LVP RVLD LP+++L +T
Sbjct  371   NSAYASVKGSANNTRDSVGEPLATSYHSKFLGTVDYLWYSDGLVPARVLDTLPIDVLCKT  430

Query  583   RGLPSEEWGSDHLALVCELAFAGEG  509
             + LP +E GSDHLALV E  F   G
Sbjct  431   KCLPCKELGSDHLALVSEFFFDPNG  455


 Score =   105 bits (263),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDG--FVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             R W+ S       +D   F  VSYN+L   NA  H DLY NV    + W YRK+++C+E+
Sbjct  99    RDWIDSDSTTPLSQDSERFTVVSYNILGDRNASHHKDLYTNVSFPYLKWGYRKRLICEEL  158

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                NP I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  159   IRLNPDIICLQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAMFWKADRF  210



>ref|XP_008801143.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Phoenix dactylifera]
Length=394

 Score =   214 bits (546),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 161/242 (67%), Gaps = 24/242 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  + IEF  FGLR+NVAQ  VF+++              +   +  +VGNIHVLF
Sbjct  174   RFRLLEGDYIEFSAFGLRDNVAQLFVFEKR--------------EAVPRRLVVGNIHVLF  219

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+RLL+  A  LS++WGNIP+VLAGD NS P+SA+Y+FL++S+L+I  H+
Sbjct  220   NPKRGDIKLGQVRLLLSKANTLSEKWGNIPVVLAGDFNSTPESAIYEFLSTSELNIATHD  279

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             R HISGQ D      Y   S+        +  +WTD+EL+ ATG +    L H L L SA
Sbjct  280   RRHISGQ-DRCELALYDLPSL--------MTFQWTDKELKNATGQSKCTKLEHPLMLHSA  330

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G ++TR   GEPLAT++HSKF GTVDYIW++  L   RVLD LP++ILR+  GLP
Sbjct  331   YASVKGNARTRGPHGEPLATTYHSKFFGTVDYIWYSTGLACTRVLDTLPIDILRKLGGLP  390

Query  571   SE  566
             S+
Sbjct  391   SK  392


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSHC---KDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+W+ +  D+S      D FV VSYN+LA +NA  H DLY  +  ++M WD RK ++ +E
Sbjct  64    RRWIKA-EDLSLSDSRNDRFVLVSYNILADKNASYHRDLYWKIPFDVMKWDSRKGLILQE  122

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             I  +N  I+C QEVDRY+D+   + K G+ G Y+ RTG++ DGCAIFWK + + L
Sbjct  123   ICRWNADIVCLQEVDRYEDILINMNKKGYAGSYKGRTGEAKDGCAIFWKVKRFRL  177



>ref|XP_010549136.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Tarenaya hassleriana]
Length=455

 Score =   216 bits (550),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 176/263 (67%), Gaps = 21/263 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  E+IEF+ FGL +NVAQ  VF+  + +              S+  LVGN HVL+
Sbjct  200   RFQLLESENIEFKSFGLHDNVAQLSVFEMCKSK--------------SRKLLVGNTHVLY  245

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
              P RGD+KLGQIRLL   A  LS++WGNIP+VLAGD NS P+S VY FL +S+L++  H 
Sbjct  246   YPSRGDVKLGQIRLLCSRAHLLSKKWGNIPVVLAGDFNSTPESPVYNFLATSELNVMEHN  305

Query  928   RIHISGQID--PS-VKPTYRFKS-VPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLK  764
             R  +SGQ +  P+ V  T R +S +  +  R      WT+EE+R+ATG   S   +H LK
Sbjct  306   RRELSGQRNCHPTRVLGTSRKQSDMLVSIGRSLGGSSWTNEEIRIATGRDNSYWAVHPLK  365

Query  763   LCSAYAGVPGT-SKTRDDLGEPLATSFHSKFLGTVDYIWHT-AElvplrvldplpVNILR  590
             L S+YA V G+ ++TRD  GEPLATS+HSKFLGTVDY+W++   LVP RVLD LP+++L 
Sbjct  366   LRSSYASVKGSAARTRDSAGEPLATSYHSKFLGTVDYLWYSDGGLVPARVLDTLPIDVLC  425

Query  589   RTRGLPSEEWGSDHLALVCELAF  521
             +TRGLP E+ GSDHLALV E  F
Sbjct  426   KTRGLPCEKLGSDHLALVSEFMF  448


 Score =   109 bits (272),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -2

Query  1694  VSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDN  1515
             VSYN+LA  N+ KH DLYPNV    + W YRK+++C E+ G  P I+C QEVD+Y DL +
Sbjct  111   VSYNILADRNSSKHRDLYPNVPNPYLKWGYRKRLICDELIGLGPDIICMQEVDKYFDLFS  170

Query  1514  LLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              L+K G+ G Y+ RTGD+ DGCA+FWK + + L
Sbjct  171   TLEKAGYAGSYKRRTGDNVDGCALFWKADRFQL  203



>ref|XP_010465951.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X1 [Camelina sativa]
Length=480

 Score =   216 bits (550),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 177/261 (68%), Gaps = 23/261 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+ +NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  210   RFRVLERENIEFSQFGMCDNVAQLAVLELRK--------------CKSRKILLGNIHVLY  255

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL SS+L+I  H+
Sbjct  256   NPNKGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNSTPQSPLYSFLASSELNIIEHD  315

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHR---WTDEELRLATGTVSVHL-LHQLKL  761
             +  +SGQ     +PT   ++   +++   +M     WT+EE+R+ATG  + +  +H LKL
Sbjct  316   KKELSGQ--KKCRPTQVLET--GSKSSNTIMFNSSSWTNEEIRVATGQENSYWAVHPLKL  371

Query  760   CSAYAGVPGTS-KTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
              S+YA V G++  TRD +GEPLATS+HSKFLGTVDY+W++  LVP RVLD LP+++L +T
Sbjct  372   NSSYASVKGSANNTRDSVGEPLATSYHSKFLGTVDYLWYSDGLVPARVLDTLPIDVLCKT  431

Query  583   RGLPSEEWGSDHLALVCELAF  521
             + LP +E GSDHLALV EL F
Sbjct  432   KCLPCKELGSDHLALVSELRF  452


 Score =   106 bits (265),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 2/112 (2%)
 Frame = -2

Query  1751  RKWVYS--PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             R W+ S     +S   + F  VSYN+L   NA  H DLY NV    + W YRK+++C+E+
Sbjct  100   RDWIDSDSTTPLSQVSERFTVVSYNILGDRNASHHKDLYTNVSFPYLKWGYRKRLICEEL  159

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
                NP I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  160   IRLNPDIICLQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAMFWKADRF  211



>ref|XP_010465952.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X2 [Camelina sativa]
Length=478

 Score =   216 bits (549),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 177/261 (68%), Gaps = 23/261 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF +L +E+IEF +FG+ +NVAQ  V + ++                S+  L+GNIHVL+
Sbjct  208   RFRVLERENIEFSQFGMCDNVAQLAVLELRK--------------CKSRKILLGNIHVLY  253

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP +GD+KLGQIR L   A  LS++WG+IPIVL GD NS P+S +Y FL SS+L+I  H+
Sbjct  254   NPNKGDVKLGQIRSLCSKAHLLSKKWGDIPIVLGGDFNSTPQSPLYSFLASSELNIIEHD  313

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHR---WTDEELRLATGTVSVHL-LHQLKL  761
             +  +SGQ     +PT   ++   +++   +M     WT+EE+R+ATG  + +  +H LKL
Sbjct  314   KKELSGQ--KKCRPTQVLET--GSKSSNTIMFNSSSWTNEEIRVATGQENSYWAVHPLKL  369

Query  760   CSAYAGVPGTS-KTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
              S+YA V G++  TRD +GEPLATS+HSKFLGTVDY+W++  LVP RVLD LP+++L +T
Sbjct  370   NSSYASVKGSANNTRDSVGEPLATSYHSKFLGTVDYLWYSDGLVPARVLDTLPIDVLCKT  429

Query  583   RGLPSEEWGSDHLALVCELAF  521
             + LP +E GSDHLALV EL F
Sbjct  430   KCLPCKELGSDHLALVSELRF  450


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ S       ++ F  VSYN+L   NA  H DLY NV    + W YRK+++C+E+  
Sbjct  100   RDWIDSDSTTPLSQERFTVVSYNILGDRNASHHKDLYTNVSFPYLKWGYRKRLICEELIR  159

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
              NP I+C QEVD+Y DL ++++K G+ G Y+ RTGD+ DGCA+FWK + +
Sbjct  160   LNPDIICLQEVDKYFDLFSMMEKAGYAGSYKRRTGDNIDGCAMFWKADRF  209



>gb|KDO64533.1| hypothetical protein CISIN_1g021001mg [Citrus sinensis]
Length=318

 Score =   209 bits (533),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 164/245 (67%), Gaps = 18/245 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL + SIEF+ FGLR NVAQ   F+ +              +  S+  LVGNIHVL+
Sbjct  41    KFRLLEQTSIEFKEFGLRENVAQLSAFEMR--------------NTKSRRVLVGNIHVLY  86

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQI  L   AQ ++++WGNIP+VLAGD N  P+SA+Y+FL+SS+L+I+ ++
Sbjct  87    NPNRGEVKLGQICFLSSRAQIVAEKWGNIPVVLAGDFNITPQSAIYKFLSSSELNIKSYD  146

Query  928   RIHISGQIDPSVKPTYRFKSV---PAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    +   +  K     P A   + L + WTDEE+++ATG    +L +H LKL
Sbjct  147   RRDLSGQRSCHLVQVFEVKKEIINPFAVMDRLLPNGWTDEEVKVATGNAQCYLAVHPLKL  206

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+ +TR   GEPLATS+HSKF GTVDY+W+T  LVP RVLD LPV+ILRRT 
Sbjct  207   NSSYASVKGSPRTRGINGEPLATSYHSKFFGTVDYLWYTKGLVPTRVLDTLPVDILRRTG  266

Query  580   GLPSE  566
             GLP +
Sbjct  267   GLPCK  271



>ref|XP_008658270.1| PREDICTED: uncharacterized protein LOC100273611 isoform X2 [Zea 
mays]
Length=424

 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 153/210 (73%), Gaps = 11/210 (5%)
 Frame = -3

Query  1147  SQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQ  968
             +  F++GNIHVLFNPKRGD+KLGQIR+L+ENA  L+++W  IPIVLAGD NS P SA+Y+
Sbjct  204   THKFVLGNIHVLFNPKRGDVKLGQIRMLLENANALAEKWDKIPIVLAGDFNSTPDSAIYK  263

Query  967   FLTSSKLDIRMHERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVS  788
             FL++ KL+I +H+R H+SG +D S +  Y   S+        L ++WTDEE+R ATG  +
Sbjct  264   FLSTMKLNISLHDRRHLSG-LD-STEFGYELCSL--------LKYQWTDEEVRNATGYSN  313

Query  787   VHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldp  611
             V +  H LKL S+YA + G S  R   GEPLATS+H KFLGTVDY+WHT  +   RVLD 
Sbjct  314   VMVAEHPLKLSSSYAMLKGNSNNRGLHGEPLATSYHRKFLGTVDYLWHTHGIECSRVLDT  373

Query  610   lpVNILRRTRGLPSEEWGSDHLALVCELAF  521
             LP+++L+RTRGLP+ E GSDHL +V E AF
Sbjct  374   LPISVLKRTRGLPTREIGSDHLPIVAEFAF  403


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSP-RDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             P    +  R W+ S     S   D    +SYN+LA  NA+ HPDLY +   + M WD R+
Sbjct  101   PQPALLSSRLWICSEDASTSSSGDACTIMSYNILADYNARNHPDLYLDAPWDAMRWDSRR  160

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQ  1479
             +++ +EIR ++P ++C QEVDR+ D+   ++  G+ G++Q
Sbjct  161   RLIIREIRHWDPDVVCLQEVDRFQDIAAGMKSRGYEGIFQ  200



>ref|XP_009773807.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X1 [Nicotiana sylvestris]
Length=154

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 130/164 (79%), Gaps = 10/164 (6%)
 Frame = -3

Query  991  MPKSAVYQFLTSSKLDIRMHERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL  812
            MP+SA+YQFLTSSKLDI+MHER  ISGQI P    +++             ++RW+DEEL
Sbjct  1    MPQSAMYQFLTSSKLDIQMHERKQISGQIYPLQNRSFK----------SSFIYRWSDEEL  50

Query  811  RLATGTVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElv  632
            RLATGT + HL+HQL+L SAYAGVPG+S TRD+ GEPL TS+HSKF+GTVDYIWHT + V
Sbjct  51   RLATGTGASHLIHQLQLRSAYAGVPGSSGTRDNSGEPLVTSYHSKFMGTVDYIWHTTDFV  110

Query  631  plrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            P+RVLD LP+++L RTRGLPS++WGSDHLALVCELAF   G ET
Sbjct  111  PVRVLDTLPIDVLSRTRGLPSKKWGSDHLALVCELAFTDGGSET  154



>ref|XP_006485765.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X1 [Citrus sinensis]
Length=501

 Score =   213 bits (542),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 177/298 (59%), Gaps = 55/298 (18%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL + SIEF+ FGLR NVAQ   F+ +              +  S+  LVGNIHVL+
Sbjct  198   KFRLLEQTSIEFKEFGLRENVAQLSAFEMR--------------NTKSRRVLVGNIHVLY  243

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG++KLGQI  L   A+ ++++WGNIP+VLAGD N  P+SA+Y+FL+SS+L+I+ ++
Sbjct  244   NPNRGEVKLGQICFLSSRARIVAEKWGNIPVVLAGDFNITPQSAIYKFLSSSELNIKSYD  303

Query  928   RIHISGQIDPSVKPTYRFKSV---PAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SGQ    +   +  K     P A   + L + WTDEE+++ATG    +L +H LKL
Sbjct  304   RRDLSGQRSCHLAQVFEVKKEIINPFAAMDRLLPNGWTDEEVKVATGNAQCYLAVHPLKL  363

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+ +TR   GEPLATS+HSKF GTVDY+W+T  LVP RVLD LPV+ILRRT 
Sbjct  364   NSSYASVKGSPRTRGINGEPLATSYHSKFFGTVDYLWYTKGLVPTRVLDTLPVDILRRTG  423

Query  580   GLPSE------------------------EW-------------GSDHLALVCELAFA  518
             GLP +                         W             GSDHLALV E AFA
Sbjct  424   GLPCKVRTVERVGFAISCCMTQKLHESVSAWDDIVHFQGFLKKLGSDHLALVSEFAFA  481


 Score =   110 bits (274),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ +  +     + F  VSYN+L  +NA KH DLY NV  E M W+ RK+++C+E+ G
Sbjct  90    RHWIDADPNPISSDERFSVVSYNILGDKNAFKHRDLYQNVRYEYMKWNRRKRLICQELIG  149

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              NP I+C QEVDRY D+ N+++K G+ G Y+ RTG + DGCA+FWK + + L
Sbjct  150   LNPDIICMQEVDRYFDILNVMEKVGYAGCYKRRTGYNVDGCAMFWKADKFRL  201



>ref|XP_010909784.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X2 [Elaeis guineensis]
Length=432

 Score =   211 bits (537),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 159/242 (66%), Gaps = 24/242 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL ++ IEF  FGLR+NVAQ  VF+++              +   +  +VGNIHVLF
Sbjct  177   RFRLLEEDYIEFSAFGLRDNVAQLFVFEKR--------------EADPRRLVVGNIHVLF  222

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+RLL+     LS++W NIP+VLAGD NS P+SA+Y+FL++S+LDI  H+
Sbjct  223   NPKRGDIKLGQVRLLLSKVNALSEKWDNIPVVLAGDFNSTPESAIYEFLSTSELDIAAHD  282

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             R +I GQ     +  +    +P+      L   WTDEEL+ ATG +    L H LKL SA
Sbjct  283   RRYIFGQD----RCEFALYDLPSF-----LKFHWTDEELKNATGQSKCTKLEHPLKLHSA  333

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G ++TR   GEPLAT++HSKFLGTVDYIW++  L   RVLD + ++ILR+  GLP
Sbjct  334   YASVKGNARTRGRHGEPLATTYHSKFLGTVDYIWYSTGLACTRVLDTISIDILRKLGGLP  393

Query  571   SE  566
              +
Sbjct  394   RD  395


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -2

Query  1709  DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRY  1530
             D FV VSYN+LA +NA  H DLY  +  ++M WD RK ++ +EI  +N  I+C QEVDRY
Sbjct  83    DRFVLVSYNILADKNASHHRDLYWKIPFDVMKWDSRKGLIFQEICRWNADIVCLQEVDRY  142

Query  1529  DDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +D+   ++K G+ G Y+ RTG + DGCAIFWK + + L
Sbjct  143   EDILMNMKKKGYAGSYKGRTGLAKDGCAIFWKVKRFRL  180



>ref|XP_010416213.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X3 [Camelina sativa]
Length=359

 Score =   208 bits (530),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = -3

Query  1099  RGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIH  920
             RG   + ++RL +E A +LSQEWGNIP+ +AGDLNS P+SA+Y F+ S+ LD ++H+R  
Sbjct  160   RGFQGVHKVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIYDFIASADLDTQLHDRRQ  219

Query  919   ISGQ--IDPSVKPTYRFKSVPAA-RARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             ISGQ  ++P  +   +  +V AA  A   L + W+ EEL+ ATG   S H+ HQLKL SA
Sbjct  220   ISGQSEVEPKKRSFRKRYAVSAAVSASGSLPNAWSKEELQFATGGQASTHVQHQLKLHSA  279

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             Y+GVPGT +TRD  GEPLAT++HS+FLGTVDYIWHT ELVP+RVL+ LP ++L RT  LP
Sbjct  280   YSGVPGTHRTRDQRGEPLATTYHSRFLGTVDYIWHTKELVPVRVLETLPTDVLTRTCRLP  339

Query  571   SEEWGSDHLALVCELAFAGE  512
             SE+WGSDHLA+ CEL F  +
Sbjct  340   SEKWGSDHLAIACELGFVND  359


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+WV+S  +  + +D  V VSYNLL V+NA  H DLY NV P+ ++W  RK ++CKEI  
Sbjct  77    REWVFSATNFENLQDKVVLVSYNLLGVDNASNHMDLYYNVPPKHLEWSRRKHLICKEISR  136

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPR  1473
             YN  I+C QEVDR+DDLD +L+  GF+GV++ R
Sbjct  137   YNASILCLQEVDRFDDLDGILKNRGFQGVHKVR  169



>ref|XP_007036462.1| DNAse I-like superfamily protein, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY20963.1| DNAse I-like superfamily protein, putative isoform 2, partial 
[Theobroma cacao]
Length=335

 Score =   207 bits (527),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 146/219 (67%), Gaps = 19/219 (9%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL +ESIEF+ FGLR+NVAQ  VF+  R E              S+  ++GNIHVL+
Sbjct  123   KFRLLERESIEFKGFGLRDNVAQLSVFEICRVE--------------SRRLVIGNIHVLY  168

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMP-KSAVYQFLTSSKLDIRMH  932
             NP RG++KLGQIR L   AQ LS  WGN+P+VL GD NS P +SA+Y+FL++S+LDI+++
Sbjct  169   NPSRGEVKLGQIRFLSTRAQMLSNRWGNVPVVLGGDFNSTPQQSAIYKFLSTSELDIKLY  228

Query  931   ERIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLK  764
              R  +SGQ    PS V    R    P       L   WTDEE+R+ATG+   HL +H LK
Sbjct  229   NRKELSGQRSCHPSQVLGVNRESRSPFTIMDGFLNDCWTDEEVRVATGSADSHLVVHPLK  288

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWH  647
             L S+YA V G++ TRD  GEPLATS+HSKFLGTVDY+W+
Sbjct  289   LSSSYATVKGSTNTRDFNGEPLATSYHSKFLGTVDYLWY  327


 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R WV   + ++  +D F   SYN+L   NA KH DLY  V  + + W YRK++LC+E+ G
Sbjct  16    RHWVEVQQPLA-SQDRFTVASYNILGDRNASKHKDLYITVPSDYLRWGYRKRVLCEELMG  74

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y DL N ++K G+ G Y+ RTG + DGCA FWK + + L
Sbjct  75    WNPDIICMQEVDKYFDLRNTMKKAGYVGSYKRRTGGNVDGCATFWKPDKFRL  126



>ref|XP_004965189.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X2 [Setaria italica]
Length=414

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 155/241 (64%), Gaps = 26/241 (11%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ CVF                E   +   ++GNIHVLF
Sbjct  187   RLRLLEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKLVLGNIHVLF  230

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQIRLL+E A  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+
Sbjct  231   NPKRGDVKLGQIRLLLEKANALAEKWDEIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHD  290

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y   S         L ++W+DEE+R ATG  +V +  H LKL S+
Sbjct  291   RRKLSG-LDSSEFDLYELCS--------SLKYQWSDEEVRNATGYSNVMVAEHPLKLSSS  341

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G S  R    EPLATSFH KFLGTVDY+W+T  L   RVLD  P+ +LRRTRGLP
Sbjct  342   YANLKGNSSNRGLHAEPLATSFHKKFLGTVDYLWYTHGLECSRVLDTFPIGVLRRTRGLP  401

Query  571   S  569
             +
Sbjct  402   T  402


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -2

Query  1775  PPANTV-DRRKWVYSPRDVSHCK-DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYR  1602
             PP + +   R+WV S    +    D    +SYN+LA  +A+ HPDLY +V  + M WD R
Sbjct  69    PPQSALPTSRRWVSSEGASTSSSGDACTIMSYNILADYHARNHPDLYRDVPWDAMRWDSR  128

Query  1601  KQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             ++++  EIR ++P ++C QEVDR+ D+   ++  G+ G+YQ RTGD+ DGCA+FWK++
Sbjct  129   RRLIIHEIRHWDPDLVCLQEVDRFQDIAAGMKSRGYEGIYQRRTGDTRDGCAMFWKSK  186



>ref|XP_009773815.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
isoform X2 [Nicotiana sylvestris]
Length=150

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 129/164 (79%), Gaps = 14/164 (9%)
 Frame = -3

Query  991  MPKSAVYQFLTSSKLDIRMHERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL  812
            MP+SA+YQFLTSSKLDI+MHER  ISGQI P    +  FKS            RW+DEEL
Sbjct  1    MPQSAMYQFLTSSKLDIQMHERKQISGQIYPLQNRS--FKS------------RWSDEEL  46

Query  811  RLATGTVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElv  632
            RLATGT + HL+HQL+L SAYAGVPG+S TRD+ GEPL TS+HSKF+GTVDYIWHT + V
Sbjct  47   RLATGTGASHLIHQLQLRSAYAGVPGSSGTRDNSGEPLVTSYHSKFMGTVDYIWHTTDFV  106

Query  631  plrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            P+RVLD LP+++L RTRGLPS++WGSDHLALVCELAF   G ET
Sbjct  107  PVRVLDTLPIDVLSRTRGLPSKKWGSDHLALVCELAFTDGGSET  150



>ref|XP_008453378.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Cucumis melo]
 ref|XP_008453379.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Cucumis melo]
Length=430

 Score =   206 bits (525),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 175/267 (66%), Gaps = 18/267 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+ +ESI+F+ F LR+NVAQ  V +  +               +S+  L+GNIHVL+
Sbjct  175   KFRLIDEESIKFKMFNLRDNVAQLSVLEMFK--------------ANSRRLLIGNIHVLY  220

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L+  A+ LS++W N+P VLAGD NS P+SA+Y+FL+SS+L+   ++
Sbjct  221   NPSRGDVKLGQIRYLLSRAEILSKKWSNLPFVLAGDFNSTPESAIYKFLSSSELNFMSYD  280

Query  928   RIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKL  761
             R  +SGQ    P+ V    +    P           WT+EE+++ATG+    ++ +  +L
Sbjct  281   RRELSGQSGCHPAKVLGVKKEVCTPFFCLGSQTKGLWTEEEVKVATGSADCKVVTNPFRL  340

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA + G + TR    EPLATS+HSKFLGTVDYIW++ +L+P+RV+D +P++IL +T 
Sbjct  341   TSSYATIKGPTTTRGSTDEPLATSYHSKFLGTVDYIWYSDDLIPIRVVDTVPIDILLKTG  400

Query  580   GLPSEEWGSDHLALVCELAFAGEGDET  500
             GLP E+ GSDHL LV E+AF    +E+
Sbjct  401   GLPCEKVGSDHLPLVSEIAFIRTSEES  427


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + +  S  ++ F  VSYN+LA  N  KH  LYPNV    + W++RK+++C+E+  
Sbjct  68    RHWIEADQP-SASEEKFSVVSYNILAERNTWKHRGLYPNVPSPYLKWNHRKRVICEELLM  126

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y D+  +++K G+ G Y  RTGD+ DGCAIFWK + + L
Sbjct  127   WNPDIICLQEVDKYFDVSEIMEKAGYVGSYTRRTGDAIDGCAIFWKADKFRL  178



>ref|XP_004965188.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X1 [Setaria italica]
Length=446

 Score =   206 bits (523),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 156/257 (61%), Gaps = 37/257 (14%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ CVF                E   +   ++GNIHVLF
Sbjct  187   RLRLLEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKLVLGNIHVLF  230

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQIRLL+E A  L+++W  IPIVLAGD NS P            L+I +H+
Sbjct  231   NPKRGDVKLGQIRLLLEKANALAEKWDEIPIVLAGDFNSTP-----------DLNISLHD  279

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y   S         L ++W+DEE+R ATG  +V +  H LKL S+
Sbjct  280   RRKLSG-LDSSEFDLYELCS--------SLKYQWSDEEVRNATGYSNVMVAEHPLKLSSS  330

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G S  R    EPLATSFH KFLGTVDY+W+T  L   RVLD  P+ +LRRTRGLP
Sbjct  331   YANLKGNSSNRGLHAEPLATSFHKKFLGTVDYLWYTHGLECSRVLDTFPIGVLRRTRGLP  390

Query  571   SEEWGSDHLALVCELAF  521
             + E GSDHL ++ E AF
Sbjct  391   TREIGSDHLPIIAEFAF  407


 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -2

Query  1775  PPANTV-DRRKWVYSPRDVSHCK-DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYR  1602
             PP + +   R+WV S    +    D    +SYN+LA  +A+ HPDLY +V  + M WD R
Sbjct  69    PPQSALPTSRRWVSSEGASTSSSGDACTIMSYNILADYHARNHPDLYRDVPWDAMRWDSR  128

Query  1601  KQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             ++++  EIR ++P ++C QEVDR+ D+   ++  G+ G+YQ RTGD+ DGCA+FWK++
Sbjct  129   RRLIIHEIRHWDPDLVCLQEVDRFQDIAAGMKSRGYEGIYQRRTGDTRDGCAMFWKSK  186



>ref|XP_004155032.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
[Cucumis sativus]
Length=421

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 166/258 (64%), Gaps = 17/258 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+ +ESI+F+ F LR+NVAQ  V +  + +              S+  L+GNIHVL+
Sbjct  176   KFRLIDEESIKFKMFNLRDNVAQLSVLEMSKAK--------------SRRLLIGNIHVLY  221

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQ+R L+  A+ LS++W N+P VLAGD NS P+SA+Y FL+SS+L+   ++
Sbjct  222   NPSRGDVKLGQLRYLLSRAEILSKKWRNLPFVLAGDFNSTPESAIYNFLSSSELNFMSYD  281

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SGQ      P           A       WT+EE+++ATG+    ++ +  +L S+
Sbjct  282   RRELSGQ--SGCHPDKVLGVKTEVCAPFSFGSLWTEEEVKVATGSADCKVVRNPFRLTSS  339

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA + G   TR    EPLATS+HSKFLGTVDYIW++  L+P+RV+D +P++IL +T GLP
Sbjct  340   YATIKGPPTTRGSTDEPLATSYHSKFLGTVDYIWYSDGLIPIRVVDTVPIDILLKTGGLP  399

Query  571   SEEWGSDHLALVCELAFA  518
              E+ GSDHL LV E+AF 
Sbjct  400   CEKVGSDHLPLVSEIAFT  417


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + +  S  ++ F  VSYN+LA  N  KH  LYPNV    + W++RK+++C+E+  
Sbjct  69    RHWIETDQP-SASEEKFSVVSYNILAERNTWKHRGLYPNVPSPYLKWNHRKRVICEELLM  127

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y D+  +++K G+ G Y  RTGD+ DGCAIFWK + + L
Sbjct  128   WNPDIICLQEVDKYFDVSEIMEKAGYVGSYTRRTGDAIDGCAIFWKADKFRL  179



>ref|XP_004138235.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
[Cucumis sativus]
 gb|KGN63806.1| hypothetical protein Csa_1G021960 [Cucumis sativus]
Length=426

 Score =   202 bits (513),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 167/261 (64%), Gaps = 18/261 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+ +ESI+F+ F LR+NVAQ  V +  + +              S+  L+GNIHVL+
Sbjct  176   KFRLIDEESIKFKMFNLRDNVAQLSVLEMSKAK--------------SRRLLIGNIHVLY  221

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQ+R L+  A+ LS++W N+P VLAGD NS P+SA+Y FL+SS+L+   ++
Sbjct  222   NPSRGDVKLGQLRYLLSRAEILSKKWRNLPFVLAGDFNSTPESAIYNFLSSSELNFMSYD  281

Query  928   RIHISGQIDPSVKPTYRFKS---VPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKL  761
             R  +SGQ           K+    P           WT+EE+++ATG+    ++ +  +L
Sbjct  282   RRELSGQSGCHPDKVLGVKTEVCAPFFFLGSQTKGLWTEEEVKVATGSADCKVVRNPFRL  341

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA + G   TR    EPLATS+HSKFLGTVDYIW++  L+P+RV+D +P++IL +T 
Sbjct  342   TSSYATIKGPPTTRGSTDEPLATSYHSKFLGTVDYIWYSDGLIPIRVVDTVPIDILLKTG  401

Query  580   GLPSEEWGSDHLALVCELAFA  518
             GLP E+ GSDHL LV E+AF 
Sbjct  402   GLPCEKVGSDHLPLVSEIAFT  422


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + +  S  ++ F  VSYN+LA  N  KH  LYPNV    + W++RK+++C+E+  
Sbjct  69    RHWIETDQP-SASEEKFSVVSYNILAERNTWKHRGLYPNVPSPYLKWNHRKRVICEELLM  127

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y D+  +++K G+ G Y  RTGD+ DGCAIFWK + + L
Sbjct  128   WNPDIICLQEVDKYFDVSEIMEKAGYVGSYTRRTGDAIDGCAIFWKADKFRL  179



>ref|XP_009409259.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   200 bits (509),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 162/263 (62%), Gaps = 26/263 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  ++IEF  FGL NNVAQ  V +              SED   +  +VGNIHVLF
Sbjct  181   RFKLLEVDNIEFRSFGLHNNVAQLFVLE-------------LSED-DQRRVVVGNIHVLF  226

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+K GQ+  L+  A  LS++WG IP+VLAGD NS P+SA+Y+FL++SKL+I +H 
Sbjct  227   NPKRGDVKFGQVHRLLLKANALSEKWGGIPVVLAGDFNSTPESAIYEFLSTSKLNIALHG  286

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL-RLATGTVSVHLLHQLKLCSA  752
             R  +  Q     K  +    +P       L++ WT E L R    +    + H L+L S+
Sbjct  287   RKKVFRQD----KCQFVLDDLPC------LINDWTGENLTRAIVNSHDSLITHPLQLKSS  336

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V   + TR+  GEPLATS HSKFLGTVDYIW++  L   RVLD LP++ LR+  GLP
Sbjct  337   YASVQRNASTRNSQGEPLATSCHSKFLGTVDYIWYSTGLACTRVLDTLPLDTLRKLGGLP  396

Query  571   SEEWGSDHLALVCELAFAGEGDE  503
              ++ GSDHLALV E  F G G+E
Sbjct  397   CKDIGSDHLALVAEFKFTG-GNE  418


 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSH---CKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+WV +     H    KD FV +SYN+L   NA KH +LY N+  + M+W  RK+++C E
Sbjct  70    RRWVQAEHTTLHDCPSKDSFVLLSYNILGEYNASKHHELYWNIPSDFMNWSSRKRLICHE  129

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             IR +N  ++C QEVDRY+D+   ++  G+ G Y+ RTG + DGCA+FWK E + L
Sbjct  130   IRRWNADLLCLQEVDRYEDISICIRGKGYVGGYKGRTGGAKDGCALFWKKERFKL  184



>ref|XP_009595090.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Nicotiana tomentosiformis]
Length=427

 Score =   199 bits (507),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 159/243 (65%), Gaps = 18/243 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ESIE+ ++GLR+NVAQ  VFK +  +              S+  +VGNIHVL+
Sbjct  179   KFQLLEGESIEYRQYGLRDNVAQLSVFKMREAQ--------------SRRLVVGNIHVLY  224

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L   A  LS++W   PIVLAGD NS P+S +Y+FL+SS+L++ +H 
Sbjct  225   NPSRGDVKLGQIRFLSSRAHILSEKWDGAPIVLAGDYNSTPQSPIYKFLSSSELNLMLHN  284

Query  928   RIHISG--QIDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLKL  761
             R  +SG  Q  PS V    R + +      + L   W++EE+ +A G     + LH LKL
Sbjct  285   RRELSGQRQCHPSQVLGLRRERGILFVLMDRFLNSSWSEEEMNVAIGAPKSPIALHPLKL  344

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA V G+  TRD+ GEPLATS+HSKFLGTVDY+W++  L P +VLD LP+N+L++T 
Sbjct  345   NSSYAMVKGSLTTRDNSGEPLATSYHSKFLGTVDYLWYSDGLAPTKVLDTLPINVLKKTG  404

Query  580   GLP  572
             GLP
Sbjct  405   GLP  407


 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 77/125 (62%), Gaps = 12/125 (10%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDG------------FVFVSYNLLAVENAKKHPDLYPNVLPELMDW  1611
             RR+   +P  V H  +G            F  VSYN+L   N  KH DLY NV    +DW
Sbjct  58    RRQLSLAPDIVRHWVEGDASSTVPPQAERFTVVSYNILGDRNVSKHGDLYRNVPSNYLDW  117

Query  1610  DYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKN  1431
             D+RK+++C+E+ G NP I+C QEVD+Y DL N+L+K G+ G Y+ RTG S DGCA+FWK 
Sbjct  118   DHRKRVICEELLGLNPDIICLQEVDKYYDLLNVLEKAGYLGSYKRRTGGSVDGCAMFWKP  177

Query  1430  ELYDL  1416
             + + L
Sbjct  178   DKFQL  182



>ref|XP_010037356.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Eucalyptus grandis]
Length=449

 Score =   198 bits (504),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 160/266 (60%), Gaps = 33/266 (12%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F+LL +ESI+F+  GLR+NVAQ  VF+  + E              S+  LVGNIHVL+N
Sbjct  198   FSLLEEESIKFKELGLRDNVAQLSVFQACKAE--------------SKKLLVGNIHVLYN  243

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
             P RGD+KLGQIR L   A  LS++WG+IP++LAGD N+ P+           LDI  ++R
Sbjct  244   PSRGDVKLGQIRHLSSRAHILSEKWGSIPVLLAGDFNTTPQ-----------LDIMSYDR  292

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHR-----WTDEELRLATGTVSVHLL-HQLK  764
               +SGQ   S  P   F           L+ R     WTDEE++ A G     ++ H L 
Sbjct  293   RELSGQR--SCHPAQVFGEKQDLSNSLFLIDRFLTCGWTDEEIKTAGGNAKGEVVAHPLN  350

Query  763   LCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRT  584
             + S+YA   G+++TR   GEPLATS+HSKF GTVDYIW++  +VP RVLD   V +LRRT
Sbjct  351   IKSSYATTRGSARTRGSNGEPLATSYHSKFFGTVDYIWYSKGVVPTRVLDTPSVGVLRRT  410

Query  583   RGLPSEEWGSDHLALVCELAFAGEGD  506
              GLP ++ GSDHLALV E AF  + D
Sbjct  411   GGLPCKKVGSDHLALVSEFAFTQDSD  436


 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + R ++  +  F  VSY +L  +NA KH DLY N+ P  M W+ RK+++C+E+ G
Sbjct  90    RSWIEADRPLAS-QAKFTMVSYYILGDKNASKHRDLYTNIPPLYMKWERRKRVICEELIG  148

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y +L  +L+K G+ G Y+ RTGD+ DGCAIFWK   + L
Sbjct  149   WNPDIICLQEVDKYFELSKILEKAGYIGSYKRRTGDAVDGCAIFWKANEFSL  200



>ref|XP_009771291.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5-like 
[Nicotiana sylvestris]
Length=309

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 141/211 (67%), Gaps = 5/211 (2%)
 Frame = -2

Query  2045  MGRFTGGEMPPAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNS  1866
             MGR   G  PPA++ ++   S + +T +++  +   +KK+RVT  QTE  +ETL+     
Sbjct  29    MGRIGDGRYPPAEQPSRSSASKRSRTSQFDVGQHRSKKKQRVTIRQTETETETLT----L  84

Query  1865  NRTSTSHMHAYA-HANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVS  1689
             N TSTS+   YA  + Y        + K +    +  D+RKWVYS  DVS   D  VF+S
Sbjct  85    NHTSTSYTRTYATSSTYSYNRRKEKRHKGKSKRTSAEDKRKWVYSTHDVSPYLDRVVFMS  144

Query  1688  YNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLL  1509
             YN+L V+NA  H DLY NV P+ +DWDYRK+++ KEIR YNPGIMCFQEVD YDDLD LL
Sbjct  145   YNILGVKNAANHEDLYHNVAPKYLDWDYRKRLIRKEIREYNPGIMCFQEVDCYDDLDYLL  204

Query  1508  QKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             QK+GF+GVYQ RTGD+CDGCAIFW  EL+DL
Sbjct  205   QKEGFKGVYQARTGDACDGCAIFWNRELFDL  235


 Score = 93.2 bits (230),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LLH+ESIEF++F LRNNV Q CVFK   K  S D  A  SE +SS+SF+VGNIHVLFN
Sbjct  233   FDLLHEESIEFQKFDLRNNVCQLCVFKMNVKNSSKDMGASNSESISSRSFVVGNIHVLFN  292

Query  1105  PKRGDIKLGQIRLLVEN  1055
             P RGDIKLGQ+ +   N
Sbjct  293   PNRGDIKLGQVYIFSNN  309



>ref|NP_001141416.1| hypothetical protein [Zea mays]
 gb|ACF78952.1| unknown [Zea mays]
 gb|ACF84292.1| unknown [Zea mays]
 gb|ACF86344.1| unknown [Zea mays]
 tpg|DAA58933.1| TPA: hypothetical protein ZEAMMB73_981822 [Zea mays]
Length=538

 Score =   197 bits (501),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 158/262 (60%), Gaps = 16/262 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR-KRKECSNDSNALTSEDMSSQS---FLVGNI  1121
             RF L ++E IEF + GLR+NVAQ CV +    +    DS +L++     Q     ++ NI
Sbjct  285   RFQLRYEEDIEFTKLGLRDNVAQLCVLESVGLQYVQTDSVSLSTSSNHPQQAKQVIICNI  344

Query  1120  HVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDI  941
             HVL+NPKRGDIKLGQ+R L++ A  LS+ W + P+++ GD NS PKS +Y F+   KL++
Sbjct  345   HVLYNPKRGDIKLGQVRTLLDKANALSKMWNDAPVIVCGDFNSTPKSPLYNFMLGQKLNL  404

Query  940   RMHERIHISG-QIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQL  767
                 R  ISG QI  S +  Y            P +  WT EE++ ATG      + H L
Sbjct  405   SGLARNTISGQQIGGSSQGLY----------TGPNISGWTPEEIKAATGKDECTFMKHSL  454

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KL S Y  V     T+D   EPL TS++ KF+GTVDYIW +  L  ++VLD  P+ IL++
Sbjct  455   KLRSVYTDVEDFEGTKDASKEPLVTSYNRKFMGTVDYIWASEGLHTVKVLDTFPIEILKK  514

Query  586   TRGLPSEEWGSDHLALVCELAF  521
             T G P+++WGSDH+AL CELAF
Sbjct  515   TTGFPTKKWGSDHIALACELAF  536


 Score =   100 bits (249),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+W ++ +   H    F+ +SYN+LA   A++H  LY  + P ++DW++RK  L  E   
Sbjct  177   RRWRFAKQRPPHQAGRFIILSYNILADYLAQEHRFLYEKISPFILDWNWRKDKLLFEFGL  236

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             ++P I+C QEVD++ DL+  +   G+ G ++ RTGD+ DGCAIFW+   + L
Sbjct  237   WSPDILCLQEVDKFTDLEQEMASQGYNGTWKIRTGDAADGCAIFWRTTRFQL  288



>ref|XP_004965190.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X3 [Setaria italica]
Length=374

 Score =   192 bits (489),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 135/213 (63%), Gaps = 26/213 (12%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ CVF                E   +   ++GNIHVLF
Sbjct  187   RLRLLEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKLVLGNIHVLF  230

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+KLGQIRLL+E A  L+++W  IPIVLAGD NS P SA+Y+FL++ KL+I +H+
Sbjct  231   NPKRGDVKLGQIRLLLEKANALAEKWDEIPIVLAGDFNSTPDSAIYKFLSTMKLNISLHD  290

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y   S         L ++W+DEE+R ATG  +V +  H LKL S+
Sbjct  291   RRKLSG-LDSSEFDLYELCS--------SLKYQWSDEEVRNATGYSNVMVAEHPLKLSSS  341

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
             YA + G S  R    EPLATSFH KFLGTVDY+
Sbjct  342   YANLKGNSSNRGLHAEPLATSFHKKFLGTVDYL  374


 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -2

Query  1775  PPANTV-DRRKWVYSPRDVSHCK-DGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYR  1602
             PP + +   R+WV S    +    D    +SYN+LA  +A+ HPDLY +V  + M WD R
Sbjct  69    PPQSALPTSRRWVSSEGASTSSSGDACTIMSYNILADYHARNHPDLYRDVPWDAMRWDSR  128

Query  1601  KQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             ++++  EIR ++P ++C QEVDR+ D+   ++  G+ G+YQ RTGD+ DGCA+FWK++
Sbjct  129   RRLIIHEIRHWDPDLVCLQEVDRFQDIAAGMKSRGYEGIYQRRTGDTRDGCAMFWKSK  186



>gb|EMS55006.1| hypothetical protein TRIUR3_35285 [Triticum urartu]
Length=633

 Score =   191 bits (485),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 138/217 (64%), Gaps = 28/217 (13%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ  VF                E   +Q F++GNIHVLF
Sbjct  178   RLRLLEEDSIDFSEFNLRNNVAQVLVF----------------ELNGTQKFVLGNIHVLF  221

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+K+GQIR+L+E A  L+ +W  IPIVLAGD NS P+SA+Y+FL++ KL++ +H+
Sbjct  222   NPKRGDVKMGQIRMLLERANALAGKWDGIPIVLAGDFNSTPESAIYKFLSTMKLNVSLHD  281

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y             L + W+DEE+R ATG+ +V +  H LKL S+
Sbjct  282   RRQLSG-LDSSEFGLY----------CSLLNYGWSDEEVRNATGSSNVMVASHPLKLSSS  330

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTA  641
             YA + G S  R   GEPLATS+H KFLGTVDY+W  A
Sbjct  331   YAMLKGNSSNRGYHGEPLATSYHKKFLGTVDYLWRWA  367


 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 69/115 (60%), Gaps = 4/115 (3%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQI  1593
             P   V  R+WV++    +   D    +SYN+LA  NA+ HPDLY +V  + + WD R+++
Sbjct  67    PHAPVPYRRWVFADEASTSGSDACTIMSYNILADNNARNHPDLYLDVPWDALRWDSRRRL  126

Query  1592  LCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             +  EIR ++  +    EVDR+ ++   ++  G+   ++ RTGD+ DGCA FWK+E
Sbjct  127   IIHEIRHWDSDL----EVDRFREIAAEMKNRGYECSFKGRTGDAKDGCATFWKSE  177



>ref|XP_008453380.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Cucumis melo]
Length=424

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 160/245 (65%), Gaps = 18/245 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+ +ESI+F+ F LR+NVAQ  V +  +               +S+  L+GNIHVL+
Sbjct  175   KFRLIDEESIKFKMFNLRDNVAQLSVLEMFK--------------ANSRRLLIGNIHVLY  220

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L+  A+ LS++W N+P VLAGD NS P+SA+Y+FL+SS+L+   ++
Sbjct  221   NPSRGDVKLGQIRYLLSRAEILSKKWSNLPFVLAGDFNSTPESAIYKFLSSSELNFMSYD  280

Query  928   RIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKL  761
             R  +SGQ    P+ V    +    P           WT+EE+++ATG+    ++ +  +L
Sbjct  281   RRELSGQSGCHPAKVLGVKKEVCTPFFCLGSQTKGLWTEEEVKVATGSADCKVVTNPFRL  340

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTR  581
              S+YA + G + TR    EPLATS+HSKFLGTVDYIW++ +L+P+RV+D +P++IL +T 
Sbjct  341   TSSYATIKGPTTTRGSTDEPLATSYHSKFLGTVDYIWYSDDLIPIRVVDTVPIDILLKTG  400

Query  580   GLPSE  566
             GLP E
Sbjct  401   GLPCE  405


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + +  S  ++ F  VSYN+LA  N  KH  LYPNV    + W++RK+++C+E+  
Sbjct  68    RHWIEADQP-SASEEKFSVVSYNILAERNTWKHRGLYPNVPSPYLKWNHRKRVICEELLM  126

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y D+  +++K G+ G Y  RTGD+ DGCAIFWK + + L
Sbjct  127   WNPDIICLQEVDKYFDVSEIMEKAGYVGSYTRRTGDAIDGCAIFWKADKFRL  178



>ref|XP_010265225.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Nelumbo nucifera]
Length=367

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 154/256 (60%), Gaps = 53/256 (21%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFN  1106
             F LL  ESIEF  FGLR+NVAQ  VF                                  
Sbjct  141   FRLLEGESIEFRMFGLRDNVAQLSVF----------------------------------  166

Query  1105  PKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHER  926
                      +IRLL++ A  LS++WGNIP+VL GD NS P+SAVY+FL+SS+L++ +++R
Sbjct  167   ---------EIRLLLQRAHALSEKWGNIPVVLVGDFNSTPQSAVYKFLSSSELNVTLYDR  217

Query  925   IHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAY  749
              ++SGQI P  +P               L + W+ E++ +ATG+ +  ++ H LKL S+Y
Sbjct  218   RYLSGQI-PMRRPFVLIDGC--------LNYSWSGEQVNIATGSPNRTIVEHPLKLNSSY  268

Query  748   AGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPS  569
               V G+++TR   GEPLAT++HS+FLGTVDY+W++  L P RVLD  PV++LR+T GLPS
Sbjct  269   LTVKGSARTRGSHGEPLATTYHSRFLGTVDYLWYSDGLFPTRVLDTPPVDMLRKTGGLPS  328

Query  568   EEWGSDHLALVCELAF  521
             ++ GSDHLALV E AF
Sbjct  329   KKLGSDHLALVSEFAF  344


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  1619  MDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIF  1440
             + W+ RK+++C+E+ G+ P I+C QEVDRY DL ++++K+G+ G Y+ RTG + DGCA+F
Sbjct  76    LKWERRKRLICQELIGWKPDIICLQEVDRYYDLLSIMEKNGYAGSYKRRTGHATDGCALF  135

Query  1439  WKNELYDL  1416
             W+   + L
Sbjct  136   WRATTFRL  143



>ref|XP_009409260.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=398

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 143/221 (65%), Gaps = 13/221 (6%)
 Frame = -3

Query  1162  SEDMSSQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPK  983
             SED   +  +VGNIHVLFNPKRGD+K GQ+  L+  A  LS++WG IP+VLAGD NS P+
Sbjct  184   SED-DQRRVVVGNIHVLFNPKRGDVKFGQVHRLLLKANALSEKWGGIPVVLAGDFNSTPE  242

Query  982   SAVYQFLTSSKLDIRMHERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL-RL  806
             SA+Y+FL++SKL+I +H R  +  Q     K  +    +P       L++ WT E L R 
Sbjct  243   SAIYEFLSTSKLNIALHGRKKVFRQD----KCQFVLDDLPC------LINDWTGENLTRA  292

Query  805   ATGTVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvpl  626
                +    + H L+L S+YA V   + TR+  GEPLATS HSKFLGTVDYIW++  L   
Sbjct  293   IVNSHDSLITHPLQLKSSYASVQRNASTRNSQGEPLATSCHSKFLGTVDYIWYSTGLACT  352

Query  625   rvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDE  503
             RVLD LP++ LR+  GLP ++ GSDHLALV E  F G G+E
Sbjct  353   RVLDTLPLDTLRKLGGLPCKDIGSDHLALVAEFKFTG-GNE  392


 Score =   100 bits (248),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (65%), Gaps = 3/111 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSH---CKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+WV +     H    KD FV +SYN+L   NA KH +LY N+  + M+W  RK+++C E
Sbjct  70    RRWVQAEHTTLHDCPSKDSFVLLSYNILGEYNASKHHELYWNIPSDFMNWSSRKRLICHE  129

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             IR +N  ++C QEVDRY+D+   ++  G+ G Y+ RTG + DGCA+FWK E
Sbjct  130   IRRWNADLLCLQEVDRYEDISICIRGKGYVGGYKGRTGGAKDGCALFWKKE  180



>ref|XP_008801142.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X2 [Phoenix dactylifera]
Length=400

 Score =   179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 147/257 (57%), Gaps = 53/257 (21%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  + IEF  FGLR+NVAQ  VF                                 
Sbjct  174   RFRLLEGDYIEFSAFGLRDNVAQLFVF---------------------------------  200

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
                       ++RLL+  A  LS++WGNIP+VLAGD NS P+SA+Y+FL++S+L+I  H+
Sbjct  201   ----------EVRLLLSKANTLSEKWGNIPVVLAGDFNSTPESAIYEFLSTSELNIATHD  250

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATG-TVSVHLLHQLKLCSA  752
             R HISGQ D      Y   S+        +  +WTD+EL+ ATG +    L H L L SA
Sbjct  251   RRHISGQ-DRCELALYDLPSL--------MTFQWTDKELKNATGQSKCTKLEHPLMLHSA  301

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V G ++TR   GEPLAT++HSKF GTVDYIW++  L   RVLD LP++ILR+  GLP
Sbjct  302   YASVKGNARTRGPHGEPLATTYHSKFFGTVDYIWYSTGLACTRVLDTLPIDILRKLGGLP  361

Query  571   SEEWGSDHLALVCELAF  521
             S+E GSDH+ LV E  F
Sbjct  362   SKEIGSDHVGLVSEFIF  378


 Score = 99.8 bits (247),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 4/115 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSHC---KDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+W+ +  D+S      D FV VSYN+LA +NA  H DLY  +  ++M WD RK ++ +E
Sbjct  64    RRWIKA-EDLSLSDSRNDRFVLVSYNILADKNASYHRDLYWKIPFDVMKWDSRKGLILQE  122

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             I  +N  I+C QEVDRY+D+   + K G+ G Y+ RTG++ DGCAIFWK + + L
Sbjct  123   ICRWNADIVCLQEVDRYEDILINMNKKGYAGSYKGRTGEAKDGCAIFWKVKRFRL  177



>gb|EYU45447.1| hypothetical protein MIMGU_mgv1a022739mg, partial [Erythranthe 
guttata]
Length=272

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 134/206 (65%), Gaps = 7/206 (3%)
 Frame = -2

Query  2030  GGEMPPAKELAKHPTSSKRKTPRYNGDRREKRKKRRVTAVQTEAHSETLSLADNSNRTST  1851
              G+ P A      P S  ++  R+  D+R ++K++ + + +TE      ++  +S RT  
Sbjct  4     SGDSPSATAEHSSPNSLGKRPHRH--DKRSRKKRKLLLSSETETCIRIQTIKPDSTRTFC  61

Query  1850  SHMHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRD-VSHCKDGFVFVSYNLLA  1674
             S+   +  +++ R    R K +R     ++  +RKW YS +  +S+ KD  V VSYN+L 
Sbjct  62    SYTRKHTDSHFQRQDRIRTKSRRN----HSWQQRKWTYSQQHHLSNYKDRVVIVSYNILG  117

Query  1673  VENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGF  1494
             VEN+ KHP+LY +V P+ +DW+YRK+ILCKE++GY P I+CFQEVD +DDL+ +L KDGF
Sbjct  118   VENSTKHPELYRDVSPKYLDWEYRKKILCKEVKGYQPSILCFQEVDHFDDLNEILAKDGF  177

Query  1493  RGVYQPRTGDSCDGCAIFWKNELYDL  1416
             RGVY+ R G++CDGCAIFWK EL+ L
Sbjct  178   RGVYKARGGETCDGCAIFWKTELFTL  203


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSND--SNALTSEDMSSQSFLVGNIHVL  1112
             FTLLH+E+IEF+RFGLRNNVAQFCV K  +        S  +  E  +S+S LVGN HVL
Sbjct  201   FTLLHEENIEFQRFGLRNNVAQFCVLKVIQIFVITYFFSCFILVEATTSRSLLVGNTHVL  260

Query  1111  FNPKRGDIKLGQ  1076
             +NPKRGDIKLGQ
Sbjct  261   YNPKRGDIKLGQ  272



>gb|KEH27039.1| carbon catabolite repressor-like protein [Medicago truncatula]
Length=301

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 115/138 (83%), Gaps = 4/138 (3%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHVL  1112
             F+LLH+E IEF++FG+R+NVAQ CV +       +D+  LT+E+ S+++  F++GNIHVL
Sbjct  153   FSLLHQEDIEFQKFGMRHNVAQLCVLEVNNNNPESDTCKLTAEEQSTKNKRFVIGNIHVL  212

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNP RGDIKLGQ+RLL++ A +LSQEWG+IP++LAGDLNS+P+SA+Y+FL+SSKLDI+ H
Sbjct  213   FNPNRGDIKLGQVRLLIDKAYKLSQEWGDIPVILAGDLNSVPQSAIYKFLSSSKLDIQSH  272

Query  931   ERIHISGQIDPSVKPTYR  878
             +R ++SGQ++  ++P +R
Sbjct  273   DRRNMSGQLE--IRPNHR  288


 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             RKWV+S  D S C D  V VSYN+L VENA  H DLY N+    +DW  RK+++ +EI  
Sbjct  44    RKWVFSSEDYSDCADTIVVVSYNILGVENASNHLDLYSNIPRRFLDWGRRKRLILEEIDS  103

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             YN  I+CFQEVD +DDLD+L Q +GF+ VY+ RTG++ DGCAIFWK++L+ L
Sbjct  104   YNASILCFQEVDHFDDLDDLFQNNGFKSVYKGRTGEANDGCAIFWKDKLFSL  155



>ref|XP_008658269.1| PREDICTED: uncharacterized protein LOC100273611 isoform X1 [Zea 
mays]
Length=438

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 114/254 (45%), Positives = 149/254 (59%), Gaps = 58/254 (23%)
 Frame = -3

Query  1279  LLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLFNPK  1100
             L+ ++SI+F  F LRNNVAQ CVF                E   +  F++GNIHVLFNPK
Sbjct  221   LVEEDSIDFSEFNLRNNVAQICVF----------------ELNGTHKFVLGNIHVLFNPK  264

Query  1099  RGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHERIH  920
             RGD+KLGQ                               SA+Y+FL++ KL+I +H+R H
Sbjct  265   RGDVKLGQ-------------------------------SAIYKFLSTMKLNISLHDRRH  293

Query  919   ISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAYAG  743
             +SG +D S +  Y   S+        L ++WTDEE+R ATG  +V +  H LKL S+YA 
Sbjct  294   LSG-LD-STEFGYELCSL--------LKYQWTDEEVRNATGYSNVMVAEHPLKLSSSYAM  343

Query  742   VPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEE  563
             + G S  R   GEPLATS+H KFLGTVDY+WHT  +   RVLD LP+++L+RTRGLP+ E
Sbjct  344   LKGNSNNRGLHGEPLATSYHRKFLGTVDYLWHTHGIECSRVLDTLPISVLKRTRGLPTRE  403

Query  562   WGSDHLALVCELAF  521
              GSDHL +V E AF
Sbjct  404   IGSDHLPIVAEFAF  417


 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSP-RDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRK  1599
             P    +  R W+ S     S   D    +SYN+LA  NA+ HPDLY +   + M WD R+
Sbjct  101   PQPALLSSRLWICSEDASTSSSGDACTIMSYNILADYNARNHPDLYLDAPWDAMRWDSRR  160

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             +++ +EIR ++P ++C QEVDR+ D+   ++  G+ G++Q RTGD+ DGCAIFWK++   
Sbjct  161   RLIIREIRHWDPDVVCLQEVDRFQDIAAGMKSRGYEGIFQRRTGDTRDGCAIFWKSK--Q  218

Query  1418  LHLI  1407
             LHL+
Sbjct  219   LHLV  222



>gb|KHN16588.1| Carbon catabolite repressor protein 4 like 3 [Glycine soja]
Length=314

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 161/268 (60%), Gaps = 33/268 (12%)
 Frame = -3

Query  1285  FTLLHKESIEFERFGLRNNVAQFCV--FKRKRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             F LL  ESI+++  G  +     C+  F   R+ C +DS  L          LVGNIHVL
Sbjct  50    FQLLEGESIQYKDIG--STFIFLCISNFILYRQMCKSDSRRL----------LVGNIHVL  97

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NP RG++KLGQIR L+  AQ LS++WGN P+VLAGD NS P+S +Y+FL+SS+L++ ++
Sbjct  98    YNPNRGEVKLGQIRFLLSRAQYLSEKWGNTPVVLAGDFNSTPQSGIYKFLSSSELNVLLY  157

Query  931   ERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-----HQL  767
              R  +SGQ           +  PA    +   ++ T   +    G  S  LL     H+L
Sbjct  158   YRKELSGQK----------RCRPAQVLGE---NKQTVGPIVTLYGLYSRELLFDISHHKL  204

Query  766   KLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRR  587
             KL + Y    G++ T+   GE LATS+HSKFLGTVDY+W++  +VP RVLD + ++ L R
Sbjct  205   KL-TGYMSFQGSNCTQGFNGELLATSYHSKFLGTVDYLWYSDGIVPSRVLDTVSISDLLR  263

Query  586   TRGLPSEEWGSDHLALVCELAFAGEGDE  503
             T GLP ++ GSDHLALV E +F+   +E
Sbjct  264   TGGLPCKKVGSDHLALVSEFSFSVTNNE  291



>ref|XP_008453381.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Cucumis melo]
Length=376

 Score =   172 bits (437),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 136/216 (63%), Gaps = 18/216 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+ +ESI+F+ F LR+NVAQ  V +  +               +S+  L+GNIHVL+
Sbjct  175   KFRLIDEESIKFKMFNLRDNVAQLSVLEMFK--------------ANSRRLLIGNIHVLY  220

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGD+KLGQIR L+  A+ LS++W N+P VLAGD NS P+SA+Y+FL+SS+L+   ++
Sbjct  221   NPSRGDVKLGQIRYLLSRAEILSKKWSNLPFVLAGDFNSTPESAIYKFLSSSELNFMSYD  280

Query  928   RIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKL  761
             R  +SGQ    P+ V    +    P           WT+EE+++ATG+    ++ +  +L
Sbjct  281   RRELSGQSGCHPAKVLGVKKEVCTPFFCLGSQTKGLWTEEEVKVATGSADCKVVTNPFRL  340

Query  760   CSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
              S+YA + G + TR    EPLATS+HSKFLGTVDYI
Sbjct  341   TSSYATIKGPTTTRGSTDEPLATSYHSKFLGTVDYI  376


 Score =   111 bits (278),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R W+ + +  S  ++ F  VSYN+LA  N  KH  LYPNV    + W++RK+++C+E+  
Sbjct  68    RHWIEADQP-SASEEKFSVVSYNILAERNTWKHRGLYPNVPSPYLKWNHRKRVICEELLM  126

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             +NP I+C QEVD+Y D+  +++K G+ G Y  RTGD+ DGCAIFWK + + L
Sbjct  127   WNPDIICLQEVDKYFDVSEIMEKAGYVGSYTRRTGDAIDGCAIFWKADKFRL  178



>ref|XP_002324275.2| hypothetical protein POPTR_0018s01290g [Populus trichocarpa]
 gb|EEF02840.2| hypothetical protein POPTR_0018s01290g [Populus trichocarpa]
Length=507

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 155/268 (58%), Gaps = 13/268 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESIEF + GLR+NVAQ CV +          ++  S   + S   ++ NIHVL
Sbjct  237   RFRLVHEESIEFNKHGLRDNVAQICVLEVSCLHILETFSSSLSLLSTISNKVVICNIHVL  296

Query  1111  FNPKRGDIKLGQ-IRLLVENAQRLSQEWGNIPIVLAGDLNSMPK-SAVYQFLTSSKL-DI  941
             +NPKRGDIKLGQ +R+L++ A  +S+ W + P++L GD N  PK ++   FL S  L D 
Sbjct  297   YNPKRGDIKLGQQVRMLLDRAHAVSKTWNDAPVILCGDFNCTPKVTSSSAFLKSPDLLDF  356

Query  940   RMHERIHISGQIDPSV---KPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-H  773
                +R  +SGQ    +   +P Y F   P   A  P +  WT  E+  ATG V    + H
Sbjct  357   SGIDRGKVSGQASAEICNSRP-YNFGRNP--NANDPSL--WTPMEIVTATGNVDCMFVEH  411

Query  772   QLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNIL  593
              LKL S Y  V     TRD  GEPL TS++  F GTVDYIW++  L  +RVL P+  + +
Sbjct  412   PLKLKSTYTQVEDCYGTRDPNGEPLVTSYNRCFFGTVDYIWYSEGLQTVRVLAPMAKHAM  471

Query  592   RRTRGLPSEEWGSDHLALVCELAFAGEG  509
             + T G P+++WGSDH+AL  E AF  + 
Sbjct  472   QWTAGFPTKKWGSDHIALASEFAFTKDA  499


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 78/124 (63%), Gaps = 9/124 (7%)
 Frame = -2

Query  1772  PANTVDRRKWVYS----PRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWD  1608
             PA  +D R W Y+    PRD     + F+ +SYN+LA   A  H   LY ++   ++DW+
Sbjct  121   PAKPLDYRNWEYAKTAPPRD----SERFIVLSYNILADYLAINHRSKLYYHIPRHMLDWE  176

Query  1607  YRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             +RK+ +  E+  ++  IMCFQEVDR+ DL+ +L+  G+ G+++ RTG++ DGCA+FW+  
Sbjct  177   WRKRSIIFELGLWSADIMCFQEVDRFGDLEEVLKVRGYSGIWKMRTGNAIDGCAVFWRTS  236

Query  1427  LYDL  1416
              + L
Sbjct  237   RFRL  240



>ref|XP_002968603.1| hypothetical protein SELMODRAFT_89183, partial [Selaginella moellendorffii]
 gb|EFJ30857.1| hypothetical protein SELMODRAFT_89183, partial [Selaginella moellendorffii]
Length=224

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 129/207 (62%), Gaps = 13/207 (6%)
 Frame = -3

Query  1153  MSSQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAV  974
             + +Q  +V N H+LFNPKRGDIKLGQ R   + AQ LS  WG   +++AGD NS P S +
Sbjct  4     IENQVLVVANTHILFNPKRGDIKLGQARF--DFAQELSSSWGGAQVIVAGDFNSTPSSPL  61

Query  973   YQFLTSSKLDIRMHERIHISGQIDPSVKPTYRFK-SVPAARARKP---------LMHRWT  824
             Y+++++++LD+   +R  ISGQI       YR   S P  R   P         L   WT
Sbjct  62    YRYISTAELDVSSLDRRSISGQIADGEGGYYRNPFSKPWIRGHNPSSAGFSRINLPSGWT  121

Query  823   DEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWH  647
              EEL  ATGT S   ++H LKL SAY+ + G + +RD  GEPL T++H KF GTVDYIWH
Sbjct  122   VEELVNATGTSSSTKVVHDLKLSSAYSEIEGKAGSRDSQGEPLVTTYHKKFKGTVDYIWH  181

Query  646   TAElvplrvldplpVNILRRTRGLPSE  566
             T  L PLRV+D L V++LR T GLPS+
Sbjct  182   TERLRPLRVVDMLSVDVLRHTGGLPSQ  208



>ref|XP_009409262.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=390

 Score =   169 bits (428),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 128/213 (60%), Gaps = 25/213 (12%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  ++IEF  FGL NNVAQ  V +              SED   +  +VGNIHVLF
Sbjct  181   RFKLLEVDNIEFRSFGLHNNVAQLFVLE-------------LSED-DQRRVVVGNIHVLF  226

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+K GQ+  L+  A  LS++WG IP+VLAGD NS P+SA+Y+FL++SKL+I +H 
Sbjct  227   NPKRGDVKFGQVHRLLLKANALSEKWGGIPVVLAGDFNSTPESAIYEFLSTSKLNIALHG  286

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL-RLATGTVSVHLLHQLKLCSA  752
             R  +  Q     K  +    +P       L++ WT E L R    +    + H L+L S+
Sbjct  287   RKKVFRQD----KCQFVLDDLPC------LINDWTGENLTRAIVNSHDSLITHPLQLKSS  336

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
             YA V   + TR+  GEPLATS HSKFLGTVDYI
Sbjct  337   YASVQRNASTRNSQGEPLATSCHSKFLGTVDYI  369


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSH---CKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+WV +     H    KD FV +SYN+L   NA KH +LY N+  + M+W  RK+++C E
Sbjct  70    RRWVQAEHTTLHDCPSKDSFVLLSYNILGEYNASKHHELYWNIPSDFMNWSSRKRLICHE  129

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             IR +N  ++C QEVDRY+D+   ++  G+ G Y+ RTG + DGCA+FWK E + L
Sbjct  130   IRRWNADLLCLQEVDRYEDISICIRGKGYVGGYKGRTGGAKDGCALFWKKERFKL  184



>ref|XP_003588706.1| Carbon catabolite repressor protein-like protein [Medicago truncatula]
Length=848

 Score =   122 bits (305),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 87/138 (63%), Gaps = 11/138 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F L+++E IEF + GLR+NVAQ CV +  +       N+ T     S+  +V NIHVL+
Sbjct  287   QFNLVYEECIEFNKLGLRDNVAQICVLEVHK-------NSYTG----SRKVVVCNIHVLY  335

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG+IKLGQ+R+L++ AQ +SQ W N P++L GD N  PKS +Y F+   KLD+   +
Sbjct  336   NPNRGEIKLGQVRVLLDKAQAVSQLWNNAPVILCGDFNCTPKSPLYNFIAEQKLDLSGID  395

Query  928   RIHISGQIDPSVKPTYRF  875
             R  +SGQ    ++  + +
Sbjct  396   RNKVSGQASAVIRAPWTY  413


 Score = 79.0 bits (193),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  1703  FVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYD  1527
             F  +SYN+LA   A  H   LY ++   +++W +RK  +  E+  ++  IMC QEVDR+ 
Sbjct  167   FKVLSYNILADYLAMDHWRKLYYHIPSYMLNWQWRKSKIVLELGLWSADIMCLQEVDRFH  226

Query  1526  DLDNLLQKDGFRGVYQPRTGDSCDGCAIFWK-NELYDL-HLIYRIWCFIIDHCAIGPRII  1353
             +L+  L+  G+RG+++ RTG+  DGCAIFW+ + ++ L HL+  +    ++  +   RII
Sbjct  227   ELEEDLKFKGYRGIWKMRTGNPVDGCAIFWRTSSIWTLYHLLELLQVSQLNRMSYTLRII  286


 Score = 89.0 bits (219),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 3/108 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      L H L L S Y     +S TRD  GEPL TS++  FLGTVDYI
Sbjct  735  WTPAEIETATGNAECTFLGHPLSLRSTYTE--DSSGTRDPNGEPLVTSYNKCFLGTVDYI  792

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W +  L   RVL P+P  ++  T+G P+++WGSDH+ALV ELAF  +G
Sbjct  793  WRSEGLQTTRVLAPIPKRVMESTQGYPTKKWGSDHIALVSELAFMEDG  840



>emb|CBI15445.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A T   R+WV+S RD+S  KD  V VSYN+L VENA  HPDLY  V  +L+DW+ R++++
Sbjct  86    ATTEAHRRWVFSTRDLSDYKDKVVVVSYNILGVENASNHPDLYSKVPTKLLDWNRRRKLI  145

Query  1589  CKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              KEI  YNP I+CFQEVDR++DL+NLL+K GF+GVY+ RTG++ DGCA+FWK++L+ L
Sbjct  146   NKEINQYNPSILCFQEVDRFNDLNNLLKKGGFKGVYKARTGEAYDGCAMFWKDDLFTL  203



>ref|XP_002318554.2| hypothetical protein POPTR_0012s05370g [Populus trichocarpa]
 gb|EEE96774.2| hypothetical protein POPTR_0012s05370g [Populus trichocarpa]
Length=241

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 128/203 (63%), Gaps = 16/203 (8%)
 Frame = -2

Query  2018  PPAKELAKHPTSSKRKTPRYNGDRREKRKKRR-VTAVQTEAHSETLSLA-DNSNRTSTSH  1845
              PA EL    +  KRK P +   +   RKK++ V+ ++     +TL+L   NSN+ S S 
Sbjct  8     APATELTSATSKYKRKHPFHKKRQYHHRKKQKSVSKIE-----KTLTLKPHNSNQNSVSL  62

Query  1844  MHAYAHANYhrggehrgkrkrqRPPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVEN  1665
              + +         +   ++K     +N    RKW +S  D    +D  VFVSYN+L VEN
Sbjct  63    SNRF---------QSIQRKKSHNYDSNFEYNRKWTFSCHDSPAYEDRVVFVSYNILGVEN  113

Query  1664  AKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGV  1485
             A KHPDLY  +  E M+W+ RK+++CKE+  YN GI+CFQ VDR+DDLD+LLQKDG+RGV
Sbjct  114   ASKHPDLYFKIPSEFMEWERRKELICKEMHHYNAGILCFQAVDRFDDLDDLLQKDGYRGV  173

Query  1484  YQPRTGDSCDGCAIFWKNELYDL  1416
             Y+ RTG++CDGCA+FWK++L+ L
Sbjct  174   YKARTGEACDGCAVFWKDKLFTL  196



>gb|KHN20726.1| Carbon catabolite repressor protein 4 like 5 [Glycine soja]
Length=120

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -3

Query  838  MHRWTDEELRLATGTVSV-HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTV  662
            ++RW+ EELRLA+G   V  L HQLKLC AY+GVPG  +TRDD+ EPLATS+HSKF+GTV
Sbjct  7    LYRWSVEELRLASGEEGVTRLQHQLKLCGAYSGVPGNHRTRDDIEEPLATSYHSKFMGTV  66

Query  661  DYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGD  506
            DYIWH+ +L+P+RVL+ LP++ LRR+RGLPSE+WGSDHLA+VCE+AFA  G+
Sbjct  67   DYIWHSEDLIPVRVLETLPIDTLRRSRGLPSEKWGSDHLAVVCEVAFANNGN  118



>ref|XP_002318553.2| hypothetical protein POPTR_0012s053602g, partial [Populus trichocarpa]
 gb|EEE96773.2| hypothetical protein POPTR_0012s053602g, partial [Populus trichocarpa]
Length=134

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -3

Query  841  LMHRWTDEELRLATGTVSV-HLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGT  665
            L++RW+DEELRLATG+  +  L H+LKL SAY GVPG+   RD+ GEPLATS+HSKF+GT
Sbjct  20   LIYRWSDEELRLATGSEELTRLQHELKLYSAYLGVPGSHGLRDNRGEPLATSYHSKFMGT  79

Query  664  VDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            VDYIWHT  L+P+RVL+ LP+NILRR+ GLP+E+WGSDHLALVCELAFA +G
Sbjct  80   VDYIWHTKGLIPVRVLETLPINILRRSAGLPNEKWGSDHLALVCELAFANDG  131



>ref|XP_009409261.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=395

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 143/263 (54%), Gaps = 55/263 (21%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL  ++IEF  FGL NNVAQ  V +                           +H   
Sbjct  181   RFKLLEVDNIEFRSFGLHNNVAQLFVLE---------------------------VH---  210

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
                         RLL++ A  LS++WG IP+VLAGD NS P+SA+Y+FL++SKL+I +H 
Sbjct  211   ------------RLLLK-ANALSEKWGGIPVVLAGDFNSTPESAIYEFLSTSKLNIALHG  257

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL-RLATGTVSVHLLHQLKLCSA  752
             R  +  Q     K  +    +P       L++ WT E L R    +    + H L+L S+
Sbjct  258   RKKVFRQD----KCQFVLDDLPC------LINDWTGENLTRAIVNSHDSLITHPLQLKSS  307

Query  751   YAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLP  572
             YA V   + TR+  GEPLATS HSKFLGTVDYIW++  L   RVLD LP++ LR+  GLP
Sbjct  308   YASVQRNASTRNSQGEPLATSCHSKFLGTVDYIWYSTGLACTRVLDTLPLDTLRKLGGLP  367

Query  571   SEEWGSDHLALVCELAFAGEGDE  503
              ++ GSDHLALV E  F G G+E
Sbjct  368   CKDIGSDHLALVAEFKFTG-GNE  389


 Score =   101 bits (252),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -2

Query  1751  RKWVYSPRDVSH---CKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKE  1581
             R+WV +     H    KD FV +SYN+L   NA KH +LY N+  + M+W  RK+++C E
Sbjct  70    RRWVQAEHTTLHDCPSKDSFVLLSYNILGEYNASKHHELYWNIPSDFMNWSSRKRLICHE  129

Query  1580  IRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             IR +N  ++C QEVDRY+D+   ++  G+ G Y+ RTG + DGCA+FWK E + L
Sbjct  130   IRRWNADLLCLQEVDRYEDISICIRGKGYVGGYKGRTGGAKDGCALFWKKERFKL  184



>dbj|BAJ91292.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 112/182 (62%), Gaps = 28/182 (15%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             R  LL ++SI+F  F LRNNVAQ  VF                E   +Q F++GNIHVLF
Sbjct  183   RLRLLEEDSIDFSEFNLRNNVAQVLVF----------------ELNGTQKFVLGNIHVLF  226

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD+K+GQIR+L+E A  L+ +W  IPIVLAGD NS P+SA+Y+ L++ KL++ +H+
Sbjct  227   NPKRGDVKMGQIRMLLERANALAGKWDGIPIVLAGDFNSTPESAIYKLLSTMKLNVSLHD  286

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSA  752
             R  +SG +D S    Y             L   W+DEE+R ATG+ +V +  H LKL S+
Sbjct  287   RRQLSG-LDSSEFGLY----------CSLLNFEWSDEEVRNATGSSNVMVARHPLKLSSS  335

Query  751   YA  746
             YA
Sbjct  336   YA  337


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 72/115 (63%), Gaps = 0/115 (0%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQI  1593
             P   V  R+WV++    +   D    +SYN+LA  NA+ HPDLY +V  + + WD R+++
Sbjct  68    PHTPVPSRQWVFADEASTSGSDACTIMSYNILADNNARNHPDLYLDVPWDALRWDSRRRL  127

Query  1592  LCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNE  1428
             +  EIR ++  ++C QEVDR+ ++   ++  G+   ++ RTGD+ DGCA FWK+E
Sbjct  128   IIHEIRHWDSDLVCLQEVDRFREIAAEMKSKGYECSFKGRTGDAKDGCATFWKSE  182



>emb|CAN77912.1| hypothetical protein VITISV_014763 [Vitis vinifera]
Length=263

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 10/128 (8%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQIL  1590
             A T   R WV+S RD+S  KD  V VSYN+L VENA  HPDLY  V  +L+DW+ R++++
Sbjct  86    ATTEAHRXWVFSTRDLSGYKDKVVVVSYNILGVENASNHPDLYSKVPTKLLDWNRRRKLI  145

Query  1589  CKEIRGYNPGIMCFQ----------EVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIF  1440
              KEI  YNP I+CFQ          EVD ++DL+NLL+K GF+GVY+ RTG++ DGCA+F
Sbjct  146   NKEINQYNPSILCFQASVRMFYKHLEVDXFNDLNNLLKKGGFKGVYKARTGEAYDGCAMF  205

Query  1439  WKNELYDL  1416
             WK++L+ L
Sbjct  206   WKDDLFTL  213



>ref|XP_006341630.1| PREDICTED: carbon catabolite repressor protein 4 homolog 3-like 
isoform X3 [Solanum tuberosum]
Length=356

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 116/188 (62%), Gaps = 19/188 (10%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             +F LL  ES+EF + GLR+NVAQ  VF+ +              +  S+  +VGNIHVL+
Sbjct  180   KFQLLEGESVEFRQHGLRDNVAQLSVFEMR--------------EAKSRRLVVGNIHVLY  225

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSS-KLDIRMH  932
             NP RGD+KLGQIR L   A  LS++W ++PIVLAGD NS P+S +Y+FL+SS +L++ +H
Sbjct  226   NPNRGDVKLGQIRFLSSRAHILSEKWDHVPIVLAGDYNSTPQSPIYKFLSSSEQLNLMLH  285

Query  931   ERIHISGQ--IDPS-VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHL-LHQLK  764
              R  +SGQ    PS V    R K +      +    RW+DEE+ +A GT   H+ +H LK
Sbjct  286   NRKELSGQRRCHPSQVLGLRREKGILFVLMDRFFNSRWSDEEINVAIGTPKSHIAMHPLK  345

Query  763   LCSAYAGV  740
             L S+YA V
Sbjct  346   LNSSYAMV  353


 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -2

Query  1718  HCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEV  1539
             H ++ F  VSYN+L  +N   H DLY NVLP  +DWD+R++++C+E+ G NP I+C QEV
Sbjct  83    HQEERFTVVSYNILGDKNVSNHGDLYRNVLPTYLDWDHRRRVICEELLGLNPDIICLQEV  142

Query  1538  DRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             D+Y DL N+L+K G+ G Y+ RTG S DGCA+FWK + + L
Sbjct  143   DKYYDLLNILEKAGYLGSYKRRTGGSVDGCAMFWKVDKFQL  183



>gb|EYU21940.1| hypothetical protein MIMGU_mgv1a002905mg [Erythranthe guttata]
Length=627

 Score =   137 bits (346),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 12/148 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR-KRKECSND-SNALTSEDM---------SSQ  1142
             RF LLH+ESIE+ + GLR+NVAQ CVF+  KR   SN+ S   T +D          SS 
Sbjct  125   RFKLLHEESIEYNKLGLRDNVAQICVFETLKRPNKSNEASTPSTRQDAFLPFECCSSSSD  184

Query  1141  SFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFL  962
               ++ NIHVLFNPKRGDIKLGQIR+L++ A  +S+ W + P+V+ GD N  PKS++Y F+
Sbjct  185   RVVICNIHVLFNPKRGDIKLGQIRVLLDRAHAVSKLWDDAPVVICGDFNCTPKSSMYNFI  244

Query  961   TSSKLDIRMHERIHISGQIDPSV-KPTY  881
             T  KLD+    R  ISGQ+   + +P Y
Sbjct  245   TEQKLDLSTLARDKISGQVSAKIGRPAY  272


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E++ ATG+     + H L L SAY  +  +   RD +GEPL TS H  F GTVDYI
Sbjct  513  WTPAEIQTATGSADCRTMEHPLNLTSAYPEIVNSPWLRDPIGEPLVTSHHRLFSGTVDYI  572

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L  ++VL P+P +++++T G P+++WGSDH+ALV E AF  +
Sbjct  573  WRSEGLQTVKVLAPIPKHVMQQTPGFPTKKWGSDHIALVSEFAFTKD  619


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = -2

Query  1757  DRRKWVY-SPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             D R W Y  P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK+ +C 
Sbjct  14    DYRDWEYRKPGLPPHC-ERFTVLSYNILAEYLAIDHFQKLYFHIPRYMLDWNWRKRNICF  72

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  I+CFQEVDR+ +++  L+  G+ G+++ RTGD  DGCAIFW+   + L
Sbjct  73    ELGLWSADILCFQEVDRFQEMEAELKPRGYSGIWKMRTGDPADGCAIFWRVSRFKL  128



>ref|XP_004293013.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Fragaria vesca subsp. vesca]
Length=804

 Score =   137 bits (345),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 2/148 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E +EF + GLR+NVAQ CV +  RK    ++ AL +    S   ++ NIHVL+
Sbjct  235   RFKLLHEECVEFNKLGLRDNVAQICVLESLRKTSKENNAALPTSSPGSHKVVICNIHVLY  294

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A+ +S+ W + PIVL GD N  PKS +Y F++  KLD+   +
Sbjct  295   NPRRGEIKLGQVRVLLDKARAVSKFWNDAPIVLCGDYNCTPKSPMYNFISEQKLDLAEVD  354

Query  928   RIHISGQIDPSVKPTYRFKSVPAARARK  845
             R  +SGQ    + P   F   P+ R ++
Sbjct  355   RDKVSGQASAEIGPPRSFN--PSYRGQQ  380


 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W Y+   +    + F  +SYN+LA   A  H   LY ++   ++DW +RK+ L  
Sbjct  123   LDYRNWEYAKTTLPPNSEKFTVLSYNILADYLANDHRGKLYYHIPRHMLDWQWRKKNLVF  182

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVDR+ +L + L+  G+ GVY+ RTG+  DGCA+FW++  + L
Sbjct  183   ELGLWSADIMCFQEVDRFQELQDELKPRGYSGVYKMRTGNPLDGCAVFWRSSRFKL  238


 Score = 86.3 bits (212),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 67/111 (60%), Gaps = 1/111 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+ +ATG     LL H LKL S Y  V   + TRD  GEPL TS++  F GTVDYI
Sbjct  694  WTPMEIEVATGNRECTLLEHPLKLKSTYTEVEDCTGTRDSNGEPLVTSYNRCFFGTVDYI  753

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            W +  L  +RVL P+P + ++ T G P+  WGSDH+AL  EL F    D++
Sbjct  754  WRSEGLQTVRVLAPIPKHAMQWTSGFPTRRWGSDHIALATELVFTKCSDQS  804



>ref|XP_010102811.1| hypothetical protein L484_004664 [Morus notabilis]
 gb|EXB94139.1| hypothetical protein L484_004664 [Morus notabilis]
Length=760

 Score =   137 bits (345),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 0/146 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+ESIEF+ FGLR+NVAQ CV +   + C  ++ AL +    S   +V NIHVL+
Sbjct  259   RFKLLHEESIEFKNFGLRDNVAQICVLELISQNCEGNAAALETSSTGSNKVVVCNIHVLY  318

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RGDIKLGQ+R L+  A  +S+ W + PIVL GD N +PKS +Y +++  KLDI    
Sbjct  319   NPSRGDIKLGQVRTLLFRAHAVSKLWNDAPIVLCGDFNCVPKSPIYNYISEQKLDISGLH  378

Query  928   RIHISGQIDPSVKPTYRFKSVPAARA  851
             R  +SGQ    +     +   P  R+
Sbjct  379   RDKLSGQASAVIGAQRTYNPNPGLRS  404


 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = -2

Query  1757  DRRKWVYSPRDVSHCKDGFVFVSYNLLA--VENAKKH-PDLYPNVLPELMDWDYRKQILC  1587
             D R W Y+        + F  +SYNLLA  V    +H  +L+ ++   ++DW +RK  + 
Sbjct  146   DYRIWEYAKSAPPSTSERFTILSYNLLADYVALGYRHRMELFSHIPRRILDWGWRKGNII  205

Query  1586  KEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              E+  ++  IMCFQEVDR+ DL+  L+  G+ G+++ RTG   DGCAIFW+   + L
Sbjct  206   FELGLWSTDIMCFQEVDRFQDLEEELKLRGYNGIWKRRTGKPLDGCAIFWRASRFKL  262


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  ++  ATG      L H LKL S Y  V  T   RD  GEPL TS++  F+GTVDYI
Sbjct  671  WTPGDIETATGNADCTSLEHPLKLRSTYTEVEDTLGIRDSNGEPLVTSYNKCFMGTVDYI  730

Query  652  WHTAElvplrvldplpVNILRRTRGLPSE  566
            W +  L  ++VL P+P  +++   G P++
Sbjct  731  WRSERLQTVKVLAPIPKQVMQTIEGFPTK  759



>ref|XP_011026500.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X3 [Populus euphratica]
Length=784

 Score =   137 bits (345),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 95/147 (65%), Gaps = 4/147 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESIEF + GLR+NVAQ CV +  R++ + D++ L +    S   L+ NIHVL+
Sbjct  238   RFRLVHEESIEFNKHGLRDNVAQICVLELIRQDNTADTSTLPTSSTISNKVLICNIHVLY  297

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+L++ A  +S+ W + P++L GD N  PKS +Y F++  KLD    +
Sbjct  298   NPKRGDIKLGQVRMLLDRAHAVSKAWNDAPVILCGDFNCTPKSPLYNFISEQKLDFSGID  357

Query  928   RIHISGQIDPSV---KPTYRFKSVPAA  857
             R  +SGQ    +   +P Y F   P A
Sbjct  358   RGKVSGQASAEICSSRP-YNFGHNPNA  383


 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQ  1596
             PA  +D R W Y+        + F+ +SYN+LA   A  H   LY ++   ++DW++RK+
Sbjct  122   PAKPLDYRNWEYAKTAPPRDSERFIVLSYNILADYLAINHRSKLYYHIPRHMLDWEWRKR  181

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+ +L+  G+ G+++ RTG++ DGCA+FW+   + L
Sbjct  182   NIIFELGLWSADIMCFQEVDRFGDLEEMLKVRGYSGIWKMRTGNAIDGCAVFWRTSRFRL  241


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATGTV    + H LKL S Y  V     TRD  GEPL TS++  F GTVDYI
Sbjct  669  WTPMEIVTATGTVDCMFVEHPLKLKSTYTQVEDCYGTRDPNGEPLVTSYNRCFFGTVDYI  728

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W++  L  +RVL P+  + ++ T G P+++WGSDH+AL  E AF  + 
Sbjct  729  WYSEGLQTVRVLAPMAKHAMQWTAGFPTKKWGSDHIALASEFAFTKDA  776



>ref|XP_009759627.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X4 [Nicotiana sylvestris]
Length=648

 Score =   133 bits (335),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  48    RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVTPALSARPGHSNKVVICNTHVLF  107

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  108   NPRRGEIKLGQVRVLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEERLDLSEVP  167

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++    R    P+AR
Sbjct  168   RDKVSGQESATINTVKRSSLNPSAR  192


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVP--GTSKTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V     S TRD  GEP  TS+H  F+GTVD
Sbjct  529  WTPMDLETATGNADCTIMEHNLKLASSYREVEFQDFSGTRDSTGEPEVTSYHRLFMGTVD  588

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            YIW +  L  +RVL P+P N ++  RG P+++WGSDH+ALV ELAF  + 
Sbjct  589  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTKKWGSDHIALVSELAFTNDA  638



>ref|XP_006450508.1| hypothetical protein CICLE_v10007580mg [Citrus clementina]
 gb|ESR63748.1| hypothetical protein CICLE_v10007580mg [Citrus clementina]
Length=533

 Score =   132 bits (331),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL++E IEF + GLR+NVAQ CV +   +  + +S AL +    S+   + NIHVLF
Sbjct  44    RFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTENSAALPTSSAHSKKVAICNIHVLF  103

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F+   KLD+   +
Sbjct  104   NPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVD  163

Query  928   RIHISGQIDPSVK  890
             R  +SGQ    ++
Sbjct  164   RDKVSGQASAEIR  176


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     +L H L+L S YA V   + TRD  GEPL TS++ +F GTVDYI
Sbjct  425  WTPMEIATATGNADCAYLEHPLQLRSTYAEVEDCTGTRDSHGEPLVTSYNRRFKGTVDYI  484

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
              +  L  +RVL P+P + ++ T G P+++WGSDH+AL  E+AF
Sbjct  485  LRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAF  528


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  1556  MCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             MCFQEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  1     MCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKL  47



>ref|XP_011026499.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Populus euphratica]
Length=784

 Score =   134 bits (336),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 5/148 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRK-RKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF L+H+ESIEF + GLR+NVAQ CV ++  R++ + D++ L +    S   L+ NIHVL
Sbjct  237   RFRLVHEESIEFNKHGLRDNVAQICVLEQLIRQDNTADTSTLPTSSTISNKVLICNIHVL  296

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRGDIKLGQ+R+L++ A  +S+ W + P++L GD N  PKS +Y F++  KLD    
Sbjct  297   YNPKRGDIKLGQVRMLLDRAHAVSKAWNDAPVILCGDFNCTPKSPLYNFISEQKLDFSGI  356

Query  931   ERIHISGQIDPSV---KPTYRFKSVPAA  857
             +R  +SGQ    +   +P Y F   P A
Sbjct  357   DRGKVSGQASAEICSSRP-YNFGHNPNA  383


 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQ  1596
             PA  +D R W Y+        + F+ +SYN+LA   A  H   LY ++   ++DW++RK+
Sbjct  121   PAKPLDYRNWEYAKTAPPRDSERFIVLSYNILADYLAINHRSKLYYHIPRHMLDWEWRKR  180

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+ +L+  G+ G+++ RTG++ DGCA+FW+   + L
Sbjct  181   NIIFELGLWSADIMCFQEVDRFGDLEEMLKVRGYSGIWKMRTGNAIDGCAVFWRTSRFRL  240


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATGTV    + H LKL S Y  V     TRD  GEPL TS++  F GTVDYI
Sbjct  669  WTPMEIVTATGTVDCMFVEHPLKLKSTYTQVEDCYGTRDPNGEPLVTSYNRCFFGTVDYI  728

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W++  L  +RVL P+  + ++ T G P+++WGSDH+AL  E AF  + 
Sbjct  729  WYSEGLQTVRVLAPMAKHAMQWTAGFPTKKWGSDHIALASEFAFTKDA  776



>ref|XP_011026497.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Populus euphratica]
 ref|XP_011026498.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Populus euphratica]
Length=785

 Score =   134 bits (336),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 5/148 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRK-RKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF L+H+ESIEF + GLR+NVAQ CV ++  R++ + D++ L +    S   L+ NIHVL
Sbjct  238   RFRLVHEESIEFNKHGLRDNVAQICVLEQLIRQDNTADTSTLPTSSTISNKVLICNIHVL  297

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRGDIKLGQ+R+L++ A  +S+ W + P++L GD N  PKS +Y F++  KLD    
Sbjct  298   YNPKRGDIKLGQVRMLLDRAHAVSKAWNDAPVILCGDFNCTPKSPLYNFISEQKLDFSGI  357

Query  931   ERIHISGQIDPSV---KPTYRFKSVPAA  857
             +R  +SGQ    +   +P Y F   P A
Sbjct  358   DRGKVSGQASAEICSSRP-YNFGHNPNA  384


 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQ  1596
             PA  +D R W Y+        + F+ +SYN+LA   A  H   LY ++   ++DW++RK+
Sbjct  122   PAKPLDYRNWEYAKTAPPRDSERFIVLSYNILADYLAINHRSKLYYHIPRHMLDWEWRKR  181

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+ +L+  G+ G+++ RTG++ DGCA+FW+   + L
Sbjct  182   NIIFELGLWSADIMCFQEVDRFGDLEEMLKVRGYSGIWKMRTGNAIDGCAVFWRTSRFRL  241


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATGTV    + H LKL S Y  V     TRD  GEPL TS++  F GTVDYI
Sbjct  670  WTPMEIVTATGTVDCMFVEHPLKLKSTYTQVEDCYGTRDPNGEPLVTSYNRCFFGTVDYI  729

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W++  L  +RVL P+  + ++ T G P+++WGSDH+AL  E AF  + 
Sbjct  730  WYSEGLQTVRVLAPMAKHAMQWTAGFPTKKWGSDHIALASEFAFTKDA  777



>ref|XP_008394028.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 [Malus 
domestica]
Length=819

 Score =   134 bits (337),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESIEF + GLR+NVAQ CV +  R+  + +  AL +    +   ++ NIHVL+
Sbjct  268   RFKLVHEESIEFNKLGLRDNVAQICVLESMRQNSTKNVAALPTSSTGTNKVVICNIHVLY  327

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   +
Sbjct  328   NPRRGEIKLGQVRVLLDRAHSVSKIWNDAPIVLCGDFNCTPKSPLYNFISEQKLDLSGVD  387

Query  928   RIHISGQ  908
             R  +SGQ
Sbjct  388   RDKVSGQ  394


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 74/133 (56%), Gaps = 1/133 (1%)
 Frame = -3

Query  895  VKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTR  719
              P   F + P A         WT  E+  ATG     LL H LKL S Y  V   S TR
Sbjct  686  TPPNSAFSASPNAERTYYDPSLWTPMEIETATGNAEHTLLEHPLKLKSTYTEVEDCSGTR  745

Query  718  DDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLAL  539
            D  GEPL TS++  FLGTVDYIW +  L  +RVL P+P   ++ T G P+++WGSDH+AL
Sbjct  746  DSSGEPLVTSYNKLFLGTVDYIWCSEGLQTVRVLAPIPKQAMQWTSGFPTKKWGSDHIAL  805

Query  538  VCELAFAGEGDET  500
              ELAF    D++
Sbjct  806  ASELAFINNSDQS  818


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P    +D R W ++    S   + F  +SYN+LA   A  H   LY ++   +MDW +RK
Sbjct  151   PRPKPLDYRNWEFAKATPSPTCERFTVLSYNILADYLANDHRSKLYYHIPHHMMDWQWRK  210

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + L  E+  ++P IMC QEVD+++DL+   +  G+ G+++ RTG+  DGCAIFW++  + 
Sbjct  211   RNLIFELGLWSPDIMCLQEVDKFEDLEEEFKLKGYIGIWKMRTGNPVDGCAIFWRSSRFK  270

Query  1418  L  1416
             L
Sbjct  271   L  271



>ref|XP_009334790.1| PREDICTED: LOW QUALITY PROTEIN: carbon catabolite repressor protein 
4 homolog 6 [Pyrus x bretschneideri]
Length=823

 Score =   134 bits (337),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESIEF + GLR+NVAQ CV +  R+  S +  AL +    +   ++ NIHVL+
Sbjct  274   RFKLVHEESIEFNKLGLRDNVAQICVLESIRQNSSKNIAALPTSSTGTNKVVICNIHVLY  333

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   +
Sbjct  334   NPRRGEIKLGQVRVLLDRAHAVSKIWNDAPIVLCGDFNCTPKSPLYNFISEQKLDLSGVD  393

Query  928   RIHISGQ  908
             R  +SGQ
Sbjct  394   RDKVSGQ  400


 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 75/134 (56%), Gaps = 1/134 (1%)
 Frame = -3

Query  898  SVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKT  722
            SV P   F + P A         WT  E+  ATG     LL H LKL S Y  V   S T
Sbjct  689  SVTPNSAFLASPNAERTYYDPSLWTPMEIETATGNAEHTLLEHPLKLKSTYTEVEDCSGT  748

Query  721  RDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLA  542
            RD  GEP  TS++  FLGTVDYIW +  L  +RVL P+P   ++ T G P+++WGSDH+A
Sbjct  749  RDSSGEPQVTSYNKLFLGTVDYIWRSEGLQTVRVLAPIPKQAMQWTSGFPTKKWGSDHIA  808

Query  541  LVCELAFAGEGDET  500
            L  EL+F    D++
Sbjct  809  LASELSFINNSDQS  822


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W ++    S   + F  +SYN+LA   A  H   LY ++   +MDW +RK+ L  
Sbjct  162   LDYRNWEFAKTTPSPTCERFTVLSYNILADYLANDHRSKLYYHIPHHMMDWLWRKRNLIF  221

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++P IMC QEVD+++DL+  L+  G+ G+++ RTG+  DGCAIFW++  + L
Sbjct  222   ELGLWSPDIMCLQEVDKFEDLEEELKLKGYIGIWKMRTGNPVDGCAIFWRSSRFKL  277



>ref|XP_009759626.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X3 [Nicotiana sylvestris]
Length=686

 Score =   133 bits (335),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  86    RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVTPALSARPGHSNKVVICNTHVLF  145

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  146   NPRRGEIKLGQVRVLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEERLDLSEVP  205

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++    R    P+AR
Sbjct  206   RDKVSGQESATINTVKRSSLNPSAR  230


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVP--GTSKTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V     S TRD  GEP  TS+H  F+GTVD
Sbjct  567  WTPMDLETATGNADCTIMEHNLKLASSYREVEFQDFSGTRDSTGEPEVTSYHRLFMGTVD  626

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            YIW +  L  +RVL P+P N ++  RG P+++WGSDH+ALV ELAF  + 
Sbjct  627  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTKKWGSDHIALVSELAFTNDA  676


 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  1646  LYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTG  1467
             LY ++   ++DW++RK+ +  E+  ++  I+CFQEVDR+ +L+  L+  G+ G+++ RTG
Sbjct  13    LYYHIPQHILDWEWRKRSILSELGWWSADILCFQEVDRFQELEAELKLRGYNGIWKRRTG  72

Query  1466  DSCDGCAIFWKNELYDL  1416
             D  DGCAIFW    + L
Sbjct  73    DPADGCAIFWNASRFKL  89



>ref|XP_002514362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48316.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   133 bits (335),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR-KRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF LLH+ESIEF + GLR+NVAQ CV ++     C+++++AL +    S   ++ NIHVL
Sbjct  226   RFKLLHEESIEFNKLGLRDNVAQICVLEQLMSNNCTSNTSALPTSSAGSDKVIMCNIHVL  285

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG+IKLGQ+R+L++ A  +S+ W N PIVL GD N  PKS +Y F++  KLD+   
Sbjct  286   YNPKRGEIKLGQVRMLLDRAYAVSKMW-NAPIVLCGDFNCTPKSPLYNFISEQKLDLSGI  344

Query  931   ERIHISGQIDPSVK  890
             +R  +SGQ    ++
Sbjct  345   DRDKVSGQASSEIR  358


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQ  1596
             P    D R W YS        + F+ +SYN+LA   A  H   LY ++   ++DW++R +
Sbjct  110   PPKASDYRDWQYSKTAPRPNSENFIVLSYNILADYLAINHWRKLYFHIPRHMLDWEWRMR  169

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+R ++  IMCFQEVDR+ DL + L+  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  170   SILFELRLWSADIMCFQEVDRFQDLADQLKPRGYSGIWKMRTGNAVDGCAIFWRTSRFKL  229


 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      L H LKL SAYA V   S TRD  GEPL TS++  FLGTVDYI
Sbjct  690  WTPMEVATATGNADCTFLEHPLKLKSAYAEVEDCSGTRDPNGEPLVTSYNRCFLGTVDYI  749

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            W +  L  +RVL P+P + ++ T G P+++WGSDH+AL  ELAF  +  + 
Sbjct  750  WKSEGLQTIRVLAPIPKHAMQWTPGFPTKKWGSDHIALASELAFTKDATDN  800



>ref|XP_002282223.2| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Vitis vinifera]
 ref|XP_010648599.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Vitis vinifera]
 emb|CBI20971.3| unnamed protein product [Vitis vinifera]
Length=786

 Score =   132 bits (333),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 90/142 (63%), Gaps = 0/142 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E IEF + GLR+NVAQ CV +   +  S  ++AL +    S   ++ NIHVL+
Sbjct  257   RFKLLHEECIEFNKLGLRDNVAQICVLESINQNYSWSTSALPASSTGSNKVVICNIHVLY  316

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R L++ A  +S+ W + PIV+ GD N  PKS +Y F++  KLD+   +
Sbjct  317   NPRRGEIKLGQVRALLDKAHAVSKIWNDAPIVICGDFNCTPKSPLYNFISEQKLDLSGLD  376

Query  928   RIHISGQIDPSVKPTYRFKSVP  863
             R  +SGQ    ++   +F   P
Sbjct  377   RDKVSGQASAEIRAPRQFSPNP  398


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     HL H LKL S Y  V   S T+D  GEPL TS++  FLGTVDYI
Sbjct  680  WTPMEIETATGNADCTHLEHPLKLKSTYTEVEDRSGTKDSNGEPLVTSYNRCFLGTVDYI  739

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L  +R L P+P   ++ T G P+++WGSDH+AL  ELAF  +
Sbjct  740  WRSEGLKTIRALAPIPKQAMQWTPGFPTKKWGSDHIALATELAFTKD  786


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = -2

Query  1760  VDRRKWVYSPRD-VSHCKDGFVFVSYNLLAVENA-KKHPDLYPNVLPELMDWDYRKQILC  1587
             +D R W YS     SHC + F  +SYN+LA   A  +   LY ++   ++DW++RK+ + 
Sbjct  145   LDYRNWEYSEAGPSSHC-ERFTVLSYNILADYLAVNQRSRLYFHIPRHMLDWEWRKRNII  203

Query  1586  KEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              E+  ++  +MCFQEVDR+ DL+  L+  G+ G+++ RTGD  DGCAIFW+   + L
Sbjct  204   FELGLWSADVMCFQEVDRFGDLEEELKLRGYTGIWKMRTGDPVDGCAIFWRASRFKL  260



>ref|XP_008466384.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Cucumis melo]
Length=869

 Score =   132 bits (333),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E IEF + GLR+NVAQ CV +++ ++  ++S        +    +V NIHVL+
Sbjct  270   RFKLLHEEFIEFNQLGLRDNVAQICVLEQRSQDNGDNSVTPPVSTSNPNRVVVCNIHVLY  329

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L+E A  +S+ W N P+VL GD N  PKSA+Y F++  KLD+   +
Sbjct  330   NPRRGEIKLGQVRVLLEKAHTISKIWNNAPVVLCGDFNCTPKSALYNFISEQKLDLSGLD  389

Query  928   RIHISGQIDPSV-KPT--YRFKSVPAARARKPLMHR  830
             R  +SGQ    + +P+  YR      A    PL  R
Sbjct  390   RDKVSGQSSAEIFQPSSLYRNPRFQNANGSVPLQRR  425


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +E+  ATG     L+ H L+L S Y      S TRD  GEPLATS++  FLGTVDYI
Sbjct  759  WTPKEIETATGNADSTLVEHSLRLRSTYTEAEDLSGTRDLNGEPLATSYNRCFLGTVDYI  818

Query  652  WHTAElvplrvldplpVNILRR-TRGLPSEEWGSDHLALVCELAFAGEGDE  503
            W +  L  +RVL P+   ++++ T+G P+++WGSDH+AL  ELAF G  +E
Sbjct  819  WRSEGLQTVRVLSPIRKQVMQQLTQGFPTKKWGSDHIALATELAFVGSREE  869


 Score = 88.6 bits (218),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQ  1596
             P   +D R W Y+        + F  +SYN+LA   A  H   LY ++   ++DW++RK 
Sbjct  154   PPKPLDFRHWDYAKTQPPSTCERFSILSYNILADYLAMDHKHKLYHHIPHYMLDWEWRKN  213

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+  L+  GF G+++ RTG   DGCAIFW+   + L
Sbjct  214   HILFELGLWSTDIMCFQEVDRFRDLEEALKDRGFNGIWKMRTGIPVDGCAIFWRVSRFKL  273



>ref|XP_009614089.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X6 [Nicotiana tomentosiformis]
Length=702

 Score =   132 bits (332),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  91    RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  150

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  151   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  210

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  211   RDKVSGQESATINTVKHSSLNPSAR  235


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTS--KTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V       TRD  GEP  TS+H  F+GTVD
Sbjct  572  WTPMDLETATGNADCTIVEHNLKLASSYREVEFQDFIGTRDSTGEPEVTSYHRLFMGTVD  631

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSE  566
            YIW +  L  +RVL P+P N ++  RG P++
Sbjct  632  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTK  662



>ref|XP_009614091.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X7 [Nicotiana tomentosiformis]
Length=697

 Score =   132 bits (332),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  86    RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  145

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  146   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  205

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  206   RDKVSGQESATINTVKHSSLNPSAR  230


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  1646  LYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTG  1467
             LY ++   ++DW++RK+ +  E+  ++  I+CFQEVDR+ +L+  L+   + G+++ RTG
Sbjct  13    LYYHIPQHILDWEWRKRSILSELGWWSADILCFQEVDRFQELEAELKLHEYNGIWKRRTG  72

Query  1466  DSCDGCAIFWKNELYDL  1416
             D  DGCAIFW    + L
Sbjct  73    DPADGCAIFWNASRFKL  89


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTS--KTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V       TRD  GEP  TS+H  F+GTVD
Sbjct  567  WTPMDLETATGNADCTIVEHNLKLASSYREVEFQDFIGTRDSTGEPEVTSYHRLFMGTVD  626

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSE  566
            YIW +  L  +RVL P+P N ++  RG P++
Sbjct  627  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTK  657



>ref|XP_008672447.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=471

 Score =   129 bits (325),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 106/189 (56%), Gaps = 16/189 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR-KRKECSNDSNALTSEDMSSQS---FLVGNI  1121
             RF L ++E IEF + GLR+NVAQ CV +    +    DS +L++     Q     ++ NI
Sbjct  285   RFQLRYEEDIEFTKLGLRDNVAQLCVLESVGLQYVQTDSVSLSTSSNHPQQAKQVIICNI  344

Query  1120  HVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDI  941
             HVL+NPKRGDIKLGQ+R L++ A  LS+ W + P+++ GD NS PKS +Y F+   KL++
Sbjct  345   HVLYNPKRGDIKLGQVRTLLDKANALSKMWNDAPVIVCGDFNSTPKSPLYNFMLGQKLNL  404

Query  940   RMHERIHISG-QIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQL  767
                 R  ISG QI  S +  Y            P +  WT EE++ ATG      + H L
Sbjct  405   SGLARNTISGQQIGGSSQGLY----------TGPNISGWTPEEIKAATGKDECTFMKHSL  454

Query  766   KLCSAYAGV  740
             KL S Y  V
Sbjct  455   KLRSVYTDV  463


 Score =   100 bits (249),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+W ++ +   H    F+ +SYN+LA   A++H  LY  + P ++DW++RK  L  E   
Sbjct  177   RRWRFAKQRPPHQAGRFIILSYNILADYLAQEHRFLYEKISPFILDWNWRKDKLLFEFGL  236

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             ++P I+C QEVD++ DL+  +   G+ G ++ RTGD+ DGCAIFW+   + L
Sbjct  237   WSPDILCLQEVDKFTDLEQEMASQGYNGTWKIRTGDAADGCAIFWRTTRFQL  288



>ref|XP_008672445.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=483

 Score =   129 bits (325),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 106/189 (56%), Gaps = 16/189 (8%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR-KRKECSNDSNALTSEDMSSQS---FLVGNI  1121
             RF L ++E IEF + GLR+NVAQ CV +    +    DS +L++     Q     ++ NI
Sbjct  285   RFQLRYEEDIEFTKLGLRDNVAQLCVLESVGLQYVQTDSVSLSTSSNHPQQAKQVIICNI  344

Query  1120  HVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDI  941
             HVL+NPKRGDIKLGQ+R L++ A  LS+ W + P+++ GD NS PKS +Y F+   KL++
Sbjct  345   HVLYNPKRGDIKLGQVRTLLDKANALSKMWNDAPVIVCGDFNSTPKSPLYNFMLGQKLNL  404

Query  940   RMHERIHISG-QIDPSVKPTYRFKSVPAARARKPLMHRWTDEELRLATGTVSVHLL-HQL  767
                 R  ISG QI  S +  Y            P +  WT EE++ ATG      + H L
Sbjct  405   SGLARNTISGQQIGGSSQGLY----------TGPNISGWTPEEIKAATGKDECTFMKHSL  454

Query  766   KLCSAYAGV  740
             KL S Y  V
Sbjct  455   KLRSVYTDV  463


 Score =   100 bits (249),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = -2

Query  1751  RKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIRG  1572
             R+W ++ +   H    F+ +SYN+LA   A++H  LY  + P ++DW++RK  L  E   
Sbjct  177   RRWRFAKQRPPHQAGRFIILSYNILADYLAQEHRFLYEKISPFILDWNWRKDKLLFEFGL  236

Query  1571  YNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             ++P I+C QEVD++ DL+  +   G+ G ++ RTGD+ DGCAIFW+   + L
Sbjct  237   WSPDILCLQEVDKFTDLEQEMASQGYNGTWKIRTGDAADGCAIFWRTTRFQL  288



>ref|XP_008466385.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Cucumis melo]
Length=868

 Score =   132 bits (332),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 98/158 (62%), Gaps = 8/158 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHV  1115
             RF LLH+E IEF + GLR+NVAQ CV +R +    N  N++T    +S     +V NIHV
Sbjct  270   RFKLLHEEFIEFNQLGLRDNVAQICVLERSQ---DNGDNSVTPPVSTSNPNRVVVCNIHV  326

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             L+NP+RG+IKLGQ+R+L+E A  +S+ W N P+VL GD N  PKSA+Y F++  KLD+  
Sbjct  327   LYNPRRGEIKLGQVRVLLEKAHTISKIWNNAPVVLCGDFNCTPKSALYNFISEQKLDLSG  386

Query  934   HERIHISGQIDPSV-KPT--YRFKSVPAARARKPLMHR  830
              +R  +SGQ    + +P+  YR      A    PL  R
Sbjct  387   LDRDKVSGQSSAEIFQPSSLYRNPRFQNANGSVPLQRR  424


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +E+  ATG     L+ H L+L S Y      S TRD  GEPLATS++  FLGTVDYI
Sbjct  758  WTPKEIETATGNADSTLVEHSLRLRSTYTEAEDLSGTRDLNGEPLATSYNRCFLGTVDYI  817

Query  652  WHTAElvplrvldplpVNILRR-TRGLPSEEWGSDHLALVCELAFAGEGDE  503
            W +  L  +RVL P+   ++++ T+G P+++WGSDH+AL  ELAF G  +E
Sbjct  818  WRSEGLQTVRVLSPIRKQVMQQLTQGFPTKKWGSDHIALATELAFVGSREE  868


 Score = 88.6 bits (218),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQ  1596
             P   +D R W Y+        + F  +SYN+LA   A  H   LY ++   ++DW++RK 
Sbjct  154   PPKPLDFRHWDYAKTQPPSTCERFSILSYNILADYLAMDHKHKLYHHIPHYMLDWEWRKN  213

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+  L+  GF G+++ RTG   DGCAIFW+   + L
Sbjct  214   HILFELGLWSTDIMCFQEVDRFRDLEEALKDRGFNGIWKMRTGIPVDGCAIFWRVSRFKL  273



>ref|XP_009759623.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009759624.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Nicotiana sylvestris]
Length=906

 Score =   132 bits (332),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  306   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVTPALSARPGHSNKVVICNTHVLF  365

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  366   NPRRGEIKLGQVRVLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEERLDLSEVP  425

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++    R    P+AR
Sbjct  426   RDKVSGQESATINTVKRSSLNPSAR  450


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVP--GTSKTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V     S TRD  GEP  TS+H  F+GTVD
Sbjct  787  WTPMDLETATGNADCTIMEHNLKLASSYREVEFQDFSGTRDSTGEPEVTSYHRLFMGTVD  846

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            YIW +  L  +RVL P+P N ++  RG P+++WGSDH+ALV ELAF  + 
Sbjct  847  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTKKWGSDHIALVSELAFTNDA  896


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+      HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  190   PPKALNFRNWEYARTGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  248

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQEVDR+ +L+  L+  G+ G+++ RTGD  DGCAIFW    + 
Sbjct  249   RSILSELGWWSADILCFQEVDRFQELEAELKLRGYNGIWKRRTGDPADGCAIFWNASRFK  308

Query  1418  L  1416
             L
Sbjct  309   L  309



>ref|XP_009759625.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Nicotiana sylvestris]
Length=904

 Score =   132 bits (332),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  306   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVTPALSARPGHSNKVVICNTHVLF  365

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  366   NPRRGEIKLGQVRVLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEERLDLSEVP  425

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++    R    P+AR
Sbjct  426   RDKVSGQESATINTVKRSSLNPSAR  450


 Score = 95.1 bits (235),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  +L  ATG     ++ H LKL S+Y  V   S TRD  GEP  TS+H  F+GTVDYI
Sbjct  787  WTPMDLETATGNADCTIMEHNLKLASSYREVEDFSGTRDSTGEPEVTSYHRLFMGTVDYI  846

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W +  L  +RVL P+P N ++  RG P+++WGSDH+ALV ELAF  + 
Sbjct  847  WRSEGLQTVRVLAPIPKNAMQFVRGFPTKKWGSDHIALVSELAFTNDA  894


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+      HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  190   PPKALNFRNWEYARTGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  248

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQEVDR+ +L+  L+  G+ G+++ RTGD  DGCAIFW    + 
Sbjct  249   RSILSELGWWSADILCFQEVDRFQELEAELKLRGYNGIWKRRTGDPADGCAIFWNASRFK  308

Query  1418  L  1416
             L
Sbjct  309   L  309



>gb|AES58957.2| carbon catabolite repressor-like protein [Medicago truncatula]
Length=837

 Score =   132 bits (331),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 5/138 (4%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+++E IEF + GLR+NVAQ CV      EC N + +L      S+  +V NIHVL+
Sbjct  268   RFNLVYEECIEFNKLGLRDNVAQICVL-----ECINQNGSLPPSLTGSRKVVVCNIHVLY  322

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG+IKLGQ+R+L++ AQ +SQ W N P++L GD N  PKS +Y F+   KLD+   +
Sbjct  323   NPNRGEIKLGQVRVLLDKAQAVSQLWNNAPVILCGDFNCTPKSPLYNFIAEQKLDLSGID  382

Query  928   RIHISGQIDPSVKPTYRF  875
             R  +SGQ    ++  + +
Sbjct  383   RNKVSGQASAVIRAPWTY  400


 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      L H L L S Y     +S TRD  GEPL TS++  FLGTVDYI
Sbjct  722  WTPAEIETATGNAECTFLGHPLSLRSTYTEAMDSSGTRDPNGEPLVTSYNKCFLGTVDYI  781

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W +  L   RVL P+P  ++  T+G P+++WGSDH+ALV ELAF  +G
Sbjct  782  WRSEGLQTTRVLAPIPKRVMESTQGYPTKKWGSDHIALVSELAFMEDG  829


 Score = 79.3 bits (194),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 83/154 (54%), Gaps = 10/154 (6%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQI  1593
             A   D R+W  +        + F  +SYN+LA   A  H   LY ++   +++W +RK  
Sbjct  153   AKPADYREWENALTPPPPRCERFKVLSYNILADYLAMDHWRKLYYHIPSYMLNWQWRKSK  212

Query  1592  LCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDLH  1413
             +  E+  ++  IMC QEVDR+ +L+  L+  G+RG+++ RTG+  DGCAIFW+   ++L 
Sbjct  213   IVLELGLWSADIMCLQEVDRFHELEEDLKFKGYRGIWKMRTGNPVDGCAIFWRTSRFNL-  271

Query  1412  LIYRIWCFIIDHCAIGPRIISNINL*QKAVLFCI  1311
                 ++   I+   +G R     N+ Q  VL CI
Sbjct  272   ----VYEECIEFNKLGLR----DNVAQICVLECI  297



>gb|KEH39822.1| carbon catabolite repressor-like protein [Medicago truncatula]
Length=769

 Score =   131 bits (330),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 5/138 (4%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+++E IEF + GLR+NVAQ CV      EC N + +L      S+  +V NIHVL+
Sbjct  268   RFNLVYEECIEFNKLGLRDNVAQICVL-----ECINQNGSLPPSLTGSRKVVVCNIHVLY  322

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG+IKLGQ+R+L++ AQ +SQ W N P++L GD N  PKS +Y F+   KLD+   +
Sbjct  323   NPNRGEIKLGQVRVLLDKAQAVSQLWNNAPVILCGDFNCTPKSPLYNFIAEQKLDLSGID  382

Query  928   RIHISGQIDPSVKPTYRF  875
             R  +SGQ    ++  + +
Sbjct  383   RNKVSGQASAVIRAPWTY  400


 Score = 79.3 bits (194),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 83/154 (54%), Gaps = 10/154 (6%)
 Frame = -2

Query  1769  ANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQI  1593
             A   D R+W  +        + F  +SYN+LA   A  H   LY ++   +++W +RK  
Sbjct  153   AKPADYREWENALTPPPPRCERFKVLSYNILADYLAMDHWRKLYYHIPSYMLNWQWRKSK  212

Query  1592  LCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDLH  1413
             +  E+  ++  IMC QEVDR+ +L+  L+  G+RG+++ RTG+  DGCAIFW+   ++L 
Sbjct  213   IVLELGLWSADIMCLQEVDRFHELEEDLKFKGYRGIWKMRTGNPVDGCAIFWRTSRFNL-  271

Query  1412  LIYRIWCFIIDHCAIGPRIISNINL*QKAVLFCI  1311
                 ++   I+   +G R     N+ Q  VL CI
Sbjct  272   ----VYEECIEFNKLGLR----DNVAQICVLECI  297



>ref|XP_006483303.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Citrus sinensis]
Length=732

 Score =   131 bits (329),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL++E IEF + GLR+NVAQ CV +   +  + +S AL +    S+   + NIHVLF
Sbjct  243   RFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTENSAALPTSSAHSKKVAICNIHVLF  302

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F+   KLD+   +
Sbjct  303   NPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVD  362

Query  928   RIHISGQIDPSVK  890
             R  +SGQ    ++
Sbjct  363   RDKVSGQASAEIR  375


 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W +S   +    + FV +SYN+LA   A  H   LY ++   L+DW++RK+ +  
Sbjct  131   LDYRNWEHSKASLPPYSERFVVLSYNILADYLALSHRSKLYFHIPRHLLDWEWRKRSILF  190

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  191   ELGLWSADIMCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKL  246


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     +L H L+L S YA V   + TRD  GEPL TS++ +F GTVDYI
Sbjct  624  WTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSQGEPLVTSYNRRFKGTVDYI  683

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
              +  L  +RVL P+P + ++ T G P+++WGSDH+AL  E+AF
Sbjct  684  LRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAF  727



>ref|XP_006450507.1| hypothetical protein CICLE_v10007580mg [Citrus clementina]
 gb|ESR63747.1| hypothetical protein CICLE_v10007580mg [Citrus clementina]
Length=732

 Score =   131 bits (329),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL++E IEF + GLR+NVAQ CV +   +  + +S AL +    S+   + NIHVLF
Sbjct  243   RFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTENSAALPTSSAHSKKVAICNIHVLF  302

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F+   KLD+   +
Sbjct  303   NPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVD  362

Query  928   RIHISGQIDPSVK  890
             R  +SGQ    ++
Sbjct  363   RDKVSGQASAEIR  375


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W +S   +    + FV +SYN+LA   A  H   LY ++   L+DW++RK+ +  
Sbjct  131   LDYRNWEHSKASLPPYSERFVVLSYNILADYLALSHRSKLYFHIPRHLLDWEWRKRSILF  190

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  191   ELGLWSADIMCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKL  246


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     +L H L+L S YA V   + TRD  GEPL TS++ +F GTVDYI
Sbjct  624  WTPMEIATATGNADCAYLEHPLQLRSTYAEVEDCTGTRDSHGEPLVTSYNRRFKGTVDYI  683

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
              +  L  +RVL P+P + ++ T G P+++WGSDH+AL  E+AF
Sbjct  684  LRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAF  727



>gb|KDO61648.1| hypothetical protein CISIN_1g047201mg [Citrus sinensis]
Length=772

 Score =   131 bits (329),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL++E IEF + GLR+NVAQ CV +   +  + +S AL +    S+   + NIHVLF
Sbjct  283   RFKLLYEEGIEFNKLGLRDNVAQICVLELLSQNFTENSAALPTSSAHSKKVAICNIHVLF  342

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F+   KLD+   +
Sbjct  343   NPKRGEIKLGQVRTLLEKAHAVSKTWNDAPVVLCGDFNCTPKSPLYNFILEQKLDLSGVD  402

Query  928   RIHISGQIDPSVK  890
             R  +SGQ    ++
Sbjct  403   RDKVSGQASAEIR  415


 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W +S   +    + FV +SYN+LA   A  H   LY ++   L+DW++RK+ +  
Sbjct  171   LDYRNWEHSKASLPPYSERFVVLSYNILADYLALSHRSKLYFHIPRHLLDWEWRKRSILF  230

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  231   ELGLWSADIMCFQEVDRFQDLEVELKFRGYTGIWKMRTGNAIDGCAIFWRASRFKL  286


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     +L H L+L S YA V   + TRD  GEPL TS++ +F GTVDYI
Sbjct  664  WTPMEIATATGNADCTYLEHPLQLRSTYAEVEDCTGTRDSHGEPLVTSYNRRFKGTVDYI  723

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
              +  L  +RVL P+P + ++ T G P+++WGSDH+AL  E+AF
Sbjct  724  LRSEGLQTVRVLAPIPKHAMQWTPGYPTKKWGSDHIALASEVAF  767



>gb|EPS58822.1| hypothetical protein M569_15991, partial [Genlisea aurea]
Length=272

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 2/129 (2%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFK--RKRKECSNDSNALTSEDMSSQSFLVGNIHV  1115
             RF LLH+ESIE+ + GLR+NVAQ CV +  + R   ++ ++ L      S   +V N+HV
Sbjct  135   RFKLLHEESIEYNKQGLRDNVAQICVLESLKGRGTVTSGASPLPPSSERSNRVVVCNVHV  194

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             LFNP RGDIKLGQIR+L+  A  +S+ W + P+V+ GD NS P S +Y F+   KLD+  
Sbjct  195   LFNPNRGDIKLGQIRVLLARAHSVSKLWDDAPVVVCGDFNSTPMSPIYDFVAKRKLDLSA  254

Query  934   HERIHISGQ  908
               R  +SGQ
Sbjct  255   LARDEVSGQ  263


 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQ  1596
             P+   D R+W Y+ PR  S  ++ F  +SYN+LA   A  H  LY +V   +MDW++RK+
Sbjct  20    PSKPPDYREWEYAKPRPPSD-RELFTVLSYNILADYLAIGHGHLYFHVPHYIMDWNWRKK  78

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             ++  E+  ++  I+C QEVDR+ ++   L+  G+ G+++ RTG + DGCA+FW+   + L
Sbjct  79    VIIFELGLWSSDILCLQEVDRFQEILEELKPRGYDGIWKMRTGQAADGCAVFWRVSRFKL  138



>ref|XP_009614088.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X5 [Nicotiana tomentosiformis]
Length=892

 Score =   131 bits (329),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  281   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  340

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  341   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  400

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  401   RDKVSGQESATINTVKHSSLNPSAR  425


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 25/121 (21%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  187   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  245

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQ                       RTGD  DGCAIFW    + 
Sbjct  246   RSILSELGWWSADILCFQR----------------------RTGDPADGCAIFWNASRFK  283

Query  1418  L  1416
             L
Sbjct  284   L  284


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTS--KTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V       TRD  GEP  TS+H  F+GTVD
Sbjct  762  WTPMDLETATGNADCTIVEHNLKLASSYREVEFQDFIGTRDSTGEPEVTSYHRLFMGTVD  821

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSE  566
            YIW +  L  +RVL P+P N ++  RG P++
Sbjct  822  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTK  852



>ref|XP_009614085.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Nicotiana tomentosiformis]
Length=912

 Score =   131 bits (329),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  303   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  362

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  363   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  422

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  423   RDKVSGQESATINTVKHSSLNPSAR  447


 Score = 88.6 bits (218),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  187   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  245

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQEVDR+ +L+  L+   + G+++ RTGD  DGCAIFW    + 
Sbjct  246   RSILSELGWWSADILCFQEVDRFQELEAELKLHEYNGIWKRRTGDPADGCAIFWNASRFK  305

Query  1418  L  1416
             L
Sbjct  306   L  306


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  +L  ATG     ++ H LKL S+Y  V     TRD  GEP  TS+H  F+GTVDYI
Sbjct  784  WTPMDLETATGNADCTIVEHNLKLASSYREVEDFIGTRDSTGEPEVTSYHRLFMGTVDYI  843

Query  652  WHTAElvplrvldplpVNILRRTRGLPSE  566
            W +  L  +RVL P+P N ++  RG P++
Sbjct  844  WRSEGLQTVRVLAPIPKNAMQFVRGFPTK  872



>ref|XP_009614084.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Nicotiana tomentosiformis]
Length=914

 Score =   131 bits (329),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  303   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  362

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  363   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  422

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  423   RDKVSGQESATINTVKHSSLNPSAR  447


 Score = 88.6 bits (218),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  187   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  245

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQEVDR+ +L+  L+   + G+++ RTGD  DGCAIFW    + 
Sbjct  246   RSILSELGWWSADILCFQEVDRFQELEAELKLHEYNGIWKRRTGDPADGCAIFWNASRFK  305

Query  1418  L  1416
             L
Sbjct  306   L  306


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTS--KTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V       TRD  GEP  TS+H  F+GTVD
Sbjct  784  WTPMDLETATGNADCTIVEHNLKLASSYREVEFQDFIGTRDSTGEPEVTSYHRLFMGTVD  843

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSE  566
            YIW +  L  +RVL P+P N ++  RG P++
Sbjct  844  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTK  874



>gb|KGN60117.1| hypothetical protein Csa_3G878860 [Cucumis sativus]
Length=865

 Score =   130 bits (328),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHV  1115
             RF LL +E IEF + GLR+NVAQ CV +R +    N  N++T    +S     +V NIHV
Sbjct  269   RFKLLQEEFIEFNKLGLRDNVAQICVLERTQ---DNGDNSVTQPISTSNPNRVVVCNIHV  325

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             L+NP+RG+IKLGQ+R+L+E A  +S+ W N PIVL GD N  PKSA+Y F++  KLD+  
Sbjct  326   LYNPRRGEIKLGQVRVLLEKAHAISKIWNNAPIVLCGDFNCTPKSALYNFISEQKLDLSG  385

Query  934   HERIHISGQIDPSV-KPT--YRFKSVPAARARKPLMHR  830
              +R  +SGQ    + +P+  YR      A    PL  R
Sbjct  386   LDRDKVSGQSSAEIFQPSSLYRNPRFQNANGSVPLQQR  423


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPD-LYPNVLPELMDWDYRKQ  1596
             P   +D R W Y+     +  + F  +SYN+LA   A  H   LY ++   ++DW++RK 
Sbjct  153   PPKPLDFRHWDYAKTQPPYTCERFSILSYNILADYLAMDHKQKLYHHIPHYMLDWEWRKN  212

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+  L+  GF G+++ RTG   DGCAIFW+   + L
Sbjct  213   HILFELGLWSTDIMCFQEVDRFHDLEEALKDRGFSGIWKMRTGIPVDGCAIFWRVSRFKL  272


 Score = 89.7 bits (221),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +++  ATG     L+ H L+L S Y      S TRD  GEPLATS++  FLGTVDYI
Sbjct  755  WTPKDIETATGNADSTLIEHSLRLRSTYTEAEDLSGTRDLNGEPLATSYNRCFLGTVDYI  814

Query  652  WHTAElvplrvldplpVNILRR-TRGLPSEEWGSDHLALVCELAFAGEGDE  503
            W +  L  ++VL P+   ++++ T+G P+++WGSDH+AL  ELAF G  +E
Sbjct  815  WRSEGLQTVKVLAPIRKQVMQQLTQGFPTKKWGSDHIALATELAFVGSREE  865



>ref|XP_004136470.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Cucumis sativus]
Length=871

 Score =   130 bits (328),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHV  1115
             RF LL +E IEF + GLR+NVAQ CV +R +    N  N++T    +S     +V NIHV
Sbjct  269   RFKLLQEEFIEFNKLGLRDNVAQICVLERTQ---DNGDNSVTQPISTSNPNRVVVCNIHV  325

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             L+NP+RG+IKLGQ+R+L+E A  +S+ W N PIVL GD N  PKSA+Y F++  KLD+  
Sbjct  326   LYNPRRGEIKLGQVRVLLEKAHAISKIWNNAPIVLCGDFNCTPKSALYNFISEQKLDLSG  385

Query  934   HERIHISGQIDPSV-KPT--YRFKSVPAARARKPLMHR  830
              +R  +SGQ    + +P+  YR      A    PL  R
Sbjct  386   LDRDKVSGQSSAEIFQPSSLYRNPRFQNANGSVPLQQR  423


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPD-LYPNVLPELMDWDYRKQ  1596
             P   +D R W Y+     +  + F  +SYN+LA   A  H   LY ++   ++DW++RK 
Sbjct  153   PPKPLDFRHWDYAKTQPPYTCERFSILSYNILADYLAMDHKQKLYHHIPHYMLDWEWRKN  212

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+  L+  GF G+++ RTG   DGCAIFW+   + L
Sbjct  213   HILFELGLWSTDIMCFQEVDRFHDLEEALKDRGFSGIWKMRTGIPVDGCAIFWRVSRFKL  272


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 71/117 (61%), Gaps = 8/117 (7%)
 Frame = -3

Query  829  WTDEELRLATGT----VSVHLLHQLKLCSAYAGVP---GTSKTRDDLGEPLATSFHSKFL  671
            WT +++  ATG     +S  L+  + +       P     S TRD  GEPLATS++  FL
Sbjct  755  WTPKDIETATGNFYEYISFPLMQMMTITPYDLFFPLFSDLSGTRDLNGEPLATSYNRCFL  814

Query  670  GTVDYIWHTAElvplrvldplpVNILRR-TRGLPSEEWGSDHLALVCELAFAGEGDE  503
            GTVDYIW +  L  ++VL P+   ++++ T+G P+++WGSDH+AL  ELAF G  +E
Sbjct  815  GTVDYIWRSEGLQTVKVLAPIRKQVMQQLTQGFPTKKWGSDHIALATELAFVGSREE  871



>ref|XP_009614087.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X4 [Nicotiana tomentosiformis]
Length=901

 Score =   130 bits (328),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  303   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  362

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  363   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  422

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  423   RDKVSGQESATINTVKHSSLNPSAR  447


 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  +L  ATG     ++ H LKL S+Y  V     TRD  GEP  TS+H  F+GTVDYI
Sbjct  784  WTPMDLETATGNADCTIVEHNLKLASSYREVEDFIGTRDSTGEPEVTSYHRLFMGTVDYI  843

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L  +RVL P+P N ++  RG P+++WGSDH+ALV ELAF  +
Sbjct  844  WRSEGLQTVRVLAPIPKNAMQFVRGFPTKKWGSDHIALVSELAFTND  890


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  187   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  245

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQEVDR+ +L+  L+   + G+++ RTGD  DGCAIFW    + 
Sbjct  246   RSILSELGWWSADILCFQEVDRFQELEAELKLHEYNGIWKRRTGDPADGCAIFWNASRFK  305

Query  1418  L  1416
             L
Sbjct  306   L  306



>ref|XP_009614086.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X3 [Nicotiana tomentosiformis]
Length=903

 Score =   130 bits (328),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 0/145 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E IEF++FGLR+NVAQ CVF+   ++  + + AL++    S   ++ N HVLF
Sbjct  303   RFKLVHEEFIEFKKFGLRDNVAQICVFESLGQQNKSVAPALSARPGHSNKVVICNTHVLF  362

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+RLL++ A  +S+ W N P+V+ GD NS PKS +Y ++   +LD+    
Sbjct  363   NPRRGEIKLGQVRLLLDKADGVSKLWDNAPVVICGDFNSTPKSPLYNYIVEKRLDLSEVP  422

Query  928   RIHISGQIDPSVKPTYRFKSVPAAR  854
             R  +SGQ   ++         P+AR
Sbjct  423   RDKVSGQESATINTVKHSSLNPSAR  447


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  187   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLAIDHQRKLYYHIPQHILDWEWRK  245

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+CFQEVDR+ +L+  L+   + G+++ RTGD  DGCAIFW    + 
Sbjct  246   RSILSELGWWSADILCFQEVDRFQELEAELKLHEYNGIWKRRTGDPADGCAIFWNASRFK  305

Query  1418  L  1416
             L
Sbjct  306   L  306


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTS--KTRDDLGEPLATSFHSKFLGTVD  659
            WT  +L  ATG     ++ H LKL S+Y  V       TRD  GEP  TS+H  F+GTVD
Sbjct  784  WTPMDLETATGNADCTIVEHNLKLASSYREVEFQDFIGTRDSTGEPEVTSYHRLFMGTVD  843

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            YIW +  L  +RVL P+P N ++  RG P+++WGSDH+ALV ELAF  +
Sbjct  844  YIWRSEGLQTVRVLAPIPKNAMQFVRGFPTKKWGSDHIALVSELAFTND  892



>ref|XP_004162062.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Cucumis sativus]
Length=837

 Score =   130 bits (327),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 8/158 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS--FLVGNIHV  1115
             RF LL +E IEF + GLR+NVAQ CV +R +    N  N++T    +S     +V NIHV
Sbjct  269   RFKLLQEEFIEFNKLGLRDNVAQICVLERTQ---DNGDNSVTQPISTSNPNRVVVCNIHV  325

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             L+NP+RG+IKLGQ+R+L+E A  +S+ W N PIVL GD N  PKSA+Y F++  KLD+  
Sbjct  326   LYNPRRGEIKLGQVRVLLEKAHAISKIWNNAPIVLCGDFNCTPKSALYNFISEQKLDLSG  385

Query  934   HERIHISGQIDPSV-KPT--YRFKSVPAARARKPLMHR  830
              +R  +SGQ    + +P+  YR      A    PL  R
Sbjct  386   LDRDKVSGQSSAEIFQPSSLYRNPRFQNANGSVPLQQR  423


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPD-LYPNVLPELMDWDYRKQ  1596
             P   +D R W Y+     +  + F  +SYN+LA   A  H   LY ++   ++DW++RK 
Sbjct  153   PPKPLDFRHWDYAKTQPPYTCERFSILSYNILADYLAMDHKQKLYHHIPHYMLDWEWRKN  212

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVDR+ DL+  L+  GF G+++ RTG   DGCAIFW+   + L
Sbjct  213   HILFELGLWSTDIMCFQEVDRFHDLEEALKDRGFSGIWKMRTGIPVDGCAIFWRVSRFKL  272


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +++  ATG     L+ H L+L S Y      S TRD  GEPLATS++  FLGTVDYI
Sbjct  727  WTPKDIETATGNADSTLIEHSLRLRSTYTEAEDLSGTRDLNGEPLATSYNRCFLGTVDYI  786

Query  652  WHTAElvplrvldplpVNILRR-TRGLPSEEWGSDHLALVCELAFAGEGDE  503
            W +  L  ++VL P+   ++++ T+G P+++WGSDH+AL  ELAF G  +E
Sbjct  787  WRSEGLQTVKVLAPIRKQVMQQLTQGFPTKKWGSDHIALATELAFVGSREE  837



>ref|XP_010325138.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X4 [Solanum lycopersicum]
Length=662

 Score =   130 bits (326),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 92/140 (66%), Gaps = 8/140 (6%)
 Frame = -3

Query  1327  LFYFASEISILECRFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS  1148
             +F+ AS       RF L+H+E +EF++FGLR+NVAQ CVF+   ++  +    L S   S
Sbjct  80    IFWHAS-------RFKLVHEEFVEFKKFGLRDNVAQICVFESLGQQNKSSPAPLASTGHS  132

Query  1147  SQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQ  968
             S+  ++ N HVLFNPKRGDIKLGQ+R+L++ A  +S+ W N PIV+ GD NS PKS +Y 
Sbjct  133   SK-VVICNTHVLFNPKRGDIKLGQVRVLLDKAGGVSKLWDNAPIVICGDFNSTPKSPLYN  191

Query  967   FLTSSKLDIRMHERIHISGQ  908
             +L   +LD+    R  +SGQ
Sbjct  192   YLAEERLDLSEVPRDKVSGQ  211


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 109/223 (49%), Gaps = 34/223 (15%)
 Frame = -3

Query  1117  VLFNPKRGDIKLGQI-------RLLVENAQ----RLSQEWGNIPIVLAGDLNSMPKSAVY  971
             VL + K  ++ L  +        LLVEN +    +L  E G+ P     D + +  +++ 
Sbjct  442   VLLDEKMANLSLSVVSEGTKEDELLVENREAFLSQLHDEAGSFP----SDSDQLQTTSLE  497

Query  970   QFLTSSK-----LDIRM--HERIHISGQIDPSVKPTYRFKSVPAARARKPLMHRWTDEEL  812
             +   S K     L++R    E  H +  +D  V         P+A         WT  ++
Sbjct  498   ELDESVKKCDGSLELRSLSDEIAHDAPNLDSEVVDRENSIYDPSA---------WTPIDI  548

Query  811   RLATGTVSVHLL-HQLKLCSAYAGVP--GTSKTRDDLGEPLATSFHSKFLGTVDYIWHTA  641
               ATG     LL H LKL SAY  V     S TRD  GEP  TS+H  F+GTVDYIW + 
Sbjct  549   ETATGNADCKLLEHNLKLTSAYREVELQDFSGTRDSTGEPEVTSYHRLFMGTVDYIWRSE  608

Query  640   ElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
              L   RVL P+P N ++  RG P+++WGSDH+ALV E AF  +
Sbjct  609   GLQTARVLAPIPKNAMQFVRGFPTKKWGSDHIALVSEFAFTSD  651


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  1646  LYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTG  1467
             LY ++   ++DW++RK+ +  E+  ++  I+C QEVDR+ +L+  L+  G+ G+++ RTG
Sbjct  13    LYFHIPQHILDWEWRKRSILSELGWWSADILCLQEVDRFQELEAELKLRGYSGIWKRRTG  72

Query  1466  DSCDGCAIFWKNELYDL  1416
             D  DGCAIFW    + L
Sbjct  73    DPADGCAIFWHASRFKL  89



>gb|KCW81438.1| hypothetical protein EUGRSUZ_C02819 [Eucalyptus grandis]
Length=625

 Score =   129 bits (324),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL +E IEF + GLR+NVAQ CV +   +  + ++   ++    S+  +V NIHVL+
Sbjct  66    RFKLLQEECIEFNKLGLRDNVAQICVLELLSENGTGNTAHQSASSACSRKIVVCNIHVLY  125

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQIR+L++ A  +S+ W + P+VL GD N  PKS +Y F++  KL +   +
Sbjct  126   NPKRGEIKLGQIRVLLDRAYAVSRAWADAPVVLCGDFNCTPKSPLYNFISEQKLSLSGLD  185

Query  928   RIHISGQIDPSVKPT  884
             R  +SGQ    ++PT
Sbjct  186   RDKVSGQASAEIRPT  200


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  1622  LMDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAI  1443
             ++DW +RK+ +  E+  ++  IMCFQEVD++ DL+  L+  G+ G+++ RTG+  DGCAI
Sbjct  1     MLDWQWRKRSILFELGLWSADIMCFQEVDKFHDLEEELKPRGYCGIWKMRTGNPVDGCAI  60

Query  1442  FWKNELYDL  1416
             FW+   + L
Sbjct  61    FWRASRFKL  69



>ref|XP_010325136.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Solanum lycopersicum]
Length=871

 Score =   129 bits (324),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E +EF++FGLR+NVAQ CVF+   ++  +    L S   SS+  ++ N HVLF
Sbjct  297   RFKLVHEEFVEFKKFGLRDNVAQICVFESLGQQNKSSPAPLASTGHSSK-VVICNTHVLF  355

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+L++ A  +S+ W N PIV+ GD NS PKS +Y +L   +LD+    
Sbjct  356   NPKRGDIKLGQVRVLLDKAGGVSKLWDNAPIVICGDFNSTPKSPLYNYLAEERLDLSEVP  415

Query  928   RIHISGQ  908
             R  +SGQ
Sbjct  416   RDKVSGQ  422


 Score = 95.5 bits (236),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  ++  ATG     LL H LKL SAY  V   S TRD  GEP  TS+H  F+GTVDYI
Sbjct  754  WTPIDIETATGNADCKLLEHNLKLTSAYREVEDFSGTRDSTGEPEVTSYHRLFMGTVDYI  813

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L   RVL P+P N ++  RG P+++WGSDH+ALV E AF  +
Sbjct  814  WRSEGLQTARVLAPIPKNAMQFVRGFPTKKWGSDHIALVSEFAFTSD  860


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  181   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLANDHQRKLYFHIPQHILDWEWRK  239

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+C QEVDR+ +L+  L+  G+ G+++ RTGD  DGCAIFW    + 
Sbjct  240   RSILSELGWWSADILCLQEVDRFQELEAELKLRGYSGIWKRRTGDPADGCAIFWHASRFK  299

Query  1418  L  1416
             L
Sbjct  300   L  300



>ref|XP_010325135.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Solanum lycopersicum]
Length=873

 Score =   129 bits (324),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E +EF++FGLR+NVAQ CVF+   ++  +    L S   SS+  ++ N HVLF
Sbjct  297   RFKLVHEEFVEFKKFGLRDNVAQICVFESLGQQNKSSPAPLASTGHSSK-VVICNTHVLF  355

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+L++ A  +S+ W N PIV+ GD NS PKS +Y +L   +LD+    
Sbjct  356   NPKRGDIKLGQVRVLLDKAGGVSKLWDNAPIVICGDFNSTPKSPLYNYLAEERLDLSEVP  415

Query  928   RIHISGQ  908
             R  +SGQ
Sbjct  416   RDKVSGQ  422


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 3/109 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVP--GTSKTRDDLGEPLATSFHSKFLGTVD  659
            WT  ++  ATG     LL H LKL SAY  V     S TRD  GEP  TS+H  F+GTVD
Sbjct  754  WTPIDIETATGNADCKLLEHNLKLTSAYREVELQDFSGTRDSTGEPEVTSYHRLFMGTVD  813

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            YIW +  L   RVL P+P N ++  RG P+++WGSDH+ALV E AF  +
Sbjct  814  YIWRSEGLQTARVLAPIPKNAMQFVRGFPTKKWGSDHIALVSEFAFTSD  862


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  181   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLANDHQRKLYFHIPQHILDWEWRK  239

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+C QEVDR+ +L+  L+  G+ G+++ RTGD  DGCAIFW    + 
Sbjct  240   RSILSELGWWSADILCLQEVDRFQELEAELKLRGYSGIWKRRTGDPADGCAIFWHASRFK  299

Query  1418  L  1416
             L
Sbjct  300   L  300



>ref|XP_010325137.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X3 [Solanum lycopersicum]
Length=871

 Score =   129 bits (324),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+E +EF++FGLR+NVAQ CVF+   ++  +    L S   SS+  ++ N HVLF
Sbjct  297   RFKLVHEEFVEFKKFGLRDNVAQICVFESLGQQNKSSPAPLASTGHSSK-VVICNTHVLF  355

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGDIKLGQ+R+L++ A  +S+ W N PIV+ GD NS PKS +Y +L   +LD+    
Sbjct  356   NPKRGDIKLGQVRVLLDKAGGVSKLWDNAPIVICGDFNSTPKSPLYNYLAEERLDLSEVP  415

Query  928   RIHISGQ  908
             R  +SGQ
Sbjct  416   RDKVSGQ  422


 Score = 90.5 bits (223),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 3/109 (3%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVP--GTSKTRDDLGEPLATSFHSKFLGTVD  659
            WT  ++  ATG     LL H LKL SAY  V     S TRD  GEP  TS+H  F+GTVD
Sbjct  752  WTPIDIETATGNADCKLLEHNLKLTSAYREVELQDFSGTRDSTGEPEVTSYHRLFMGTVD  811

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            YIW +  L   RVL P+P N ++  RG P+++WGSDH+ALV E AF  +
Sbjct  812  YIWRSEGLQTARVLAPIPKNAMQFVRGFPTKKWGSDHIALVSEFAFTSD  860


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -2

Query  1772  PANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRK  1599
             P   ++ R W Y+ P    HC + F  +SYN+LA   A  H   LY ++   ++DW++RK
Sbjct  181   PPKALNFRNWEYARPGPPPHC-ERFTVLSYNILADYLANDHQRKLYFHIPQHILDWEWRK  239

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  I+C QEVDR+ +L+  L+  G+ G+++ RTGD  DGCAIFW    + 
Sbjct  240   RSILSELGWWSADILCLQEVDRFQELEAELKLRGYSGIWKRRTGDPADGCAIFWHASRFK  299

Query  1418  L  1416
             L
Sbjct  300   L  300



>ref|XP_010051192.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 [Eucalyptus 
grandis]
Length=849

 Score =   128 bits (322),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 88/135 (65%), Gaps = 0/135 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL +E IEF + GLR+NVAQ CV +   +  + ++   ++    S+  +V NIHVL+
Sbjct  317   RFKLLQEECIEFNKLGLRDNVAQICVLELLSENGTGNTAHQSASSACSRKIVVCNIHVLY  376

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQIR+L++ A  +S+ W + P+VL GD N  PKS +Y F++  KL +   +
Sbjct  377   NPKRGEIKLGQIRVLLDRAYAVSRAWADAPVVLCGDFNCTPKSPLYNFISEQKLSLSGLD  436

Query  928   RIHISGQIDPSVKPT  884
             R  +SGQ    ++PT
Sbjct  437   RDKVSGQASAEIRPT  451


 Score = 89.0 bits (219),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 72/120 (60%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQ  1596
             P    D R W Y+ R+     + FV +SYN+LA   A  H   LY ++   ++DW +RK+
Sbjct  201   PQRPPDFRIWEYAKREPPSDCERFVILSYNILADYLAINHRSKLYYHIPRHMLDWQWRKR  260

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+  ++  IMCFQEVD++ DL+  L+  G+ G+++ RTG+  DGCAIFW+   + L
Sbjct  261   SILFELGLWSADIMCFQEVDKFHDLEEELKPRGYCGIWKMRTGNPVDGCAIFWRASRFKL  320


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG+     L H LKL S YA V  +S TRD  GEP+ TS++  FLGTVDYI
Sbjct  761  WTPMEIATATGSADCLFLEHPLKLKSTYAEVEDSSGTRDTNGEPIVTSYNRCFLGTVDYI  820

Query  652  WHT  644
            WH+
Sbjct  821  WHS  823



>ref|XP_010541622.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Tarenaya hassleriana]
Length=658

 Score =   127 bits (319),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESI+F + GLR+NVAQ CV +      S +    +     S   +V NIHVL+
Sbjct  190   RFKLVHEESIQFNKLGLRDNVAQICVLELLNSRTSKNGVTASESSAGSHRVVVCNIHVLY  249

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQ+R L+E A  +S+ W N  +VL GD N  PKS +Y F+   KLD+    
Sbjct  250   NPKRGEIKLGQVRTLLERAHAVSKLWDNASVVLCGDFNCTPKSPLYNFILEQKLDLSALA  309

Query  928   RIHISGQIDPSVKPT  884
             R  +SGQ    ++P+
Sbjct  310   RDKVSGQDSAIIRPS  324


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L L S Y  V G + TRD  GEP  TS++  F+GTVDYI
Sbjct  550  WTPMEIAAATGDQERTAIEHPLHLTSTYTEVEGKTNTRDKNGEPEVTSYNRCFMGTVDYI  609

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF  E
Sbjct  610  WRSQGLETVRVLAPMPKQAMQWTPGFPTPKWGSDHVALVSELAFTEE  656


 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -2

Query  1703  FVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQEVDRYD  1527
             FV +SYN+LA   A  H   LY ++   ++ W+ RK+ +  E+  ++  IMC QEVDR+ 
Sbjct  97    FVVLSYNILADYLANDHRGKLYFHIPRNMLGWESRKRRIIFELGLWSADIMCLQEVDRFQ  156

Query  1526  DLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             DL+  ++  G+  +++ RTG++ DGCA+FW++  + L
Sbjct  157   DLEEEMKLRGYSSIWKMRTGNAIDGCAMFWRSNRFKL  193



>ref|XP_006854929.1| hypothetical protein AMTR_s00052p00118920, partial [Amborella 
trichopoda]
 gb|ERN16396.1| hypothetical protein AMTR_s00052p00118920, partial [Amborella 
trichopoda]
Length=887

 Score =   127 bits (319),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 92/158 (58%), Gaps = 11/158 (7%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS----SQSFLVGNI  1121
             +F LLH+E IEF +  LR+NVAQ CV + + ++C    N   S  +S    +   +V NI
Sbjct  191   KFNLLHEEYIEFNKLSLRDNVAQICVLESRSRDCVEGGNRAPSTSLSKPKGANKVVVCNI  250

Query  1120  HVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDI  941
             HVL+NP RGDIKLGQ+R+L+  AQ +S  W + P+++ GD N  PKS +Y+F++  KL +
Sbjct  251   HVLYNPNRGDIKLGQVRVLLNRAQEVSNLWDDAPVIICGDFNCTPKSPLYKFISEQKLSL  310

Query  940   RMHERIHISGQI-----DPSVKPTYRFKSVPAARARKP  842
                 +  +SGQ      DP   P +   S P   +R P
Sbjct  311   SGLAKNQVSGQFSARLYDP--MPNFNRGSAPNFSSRSP  346


 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     LL H LKL SAY  V   S T+D   EP  TS++ +F+GTVDYI
Sbjct  774  WTSTEIEAATGNAECTLLEHNLKLKSAYTEVEDYSGTKDTSREPQVTSYNRRFMGTVDYI  833

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  ++VL  LP ++L+RTRG P+++WGSDHLAL C+LAF
Sbjct  834  WCSEGLQTVKVLGTLPKHVLQRTRGFPTQKWGSDHLALACQLAF  877


 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 77/122 (63%), Gaps = 3/122 (2%)
 Frame = -2

Query  1775  PPANTVDRRKWVYS-PRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYR  1602
             P   + + R W ++  +  SHC+  FV +S+N+LA   A+ H   LY ++ P ++DW++R
Sbjct  74    PSPQSDNYRHWEHALSQPPSHCEK-FVVLSFNILADYLARDHRHKLYFHIPPHILDWEWR  132

Query  1601  KQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELY  1422
             K+ +  E+  ++P IMC QEVD++ DL   LQ  GF G+++ RTG   DGCAIFW+   +
Sbjct  133   KRRILLELGLWSPDIMCLQEVDKFQDLAEELQLRGFAGIWKERTGLPIDGCAIFWRLTKF  192

Query  1421  DL  1416
             +L
Sbjct  193   NL  194



>gb|KFK25402.1| hypothetical protein AALP_AA8G109900 [Arabis alpina]
Length=673

 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESI+F +  LR+NVAQ CV +      + +     SE  S +  ++ NIHVLF
Sbjct  241   RFKLVHEESIQFNQLSLRDNVAQICVLETLLNSQTKEDEVSPSESCSRR-VVICNIHVLF  299

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A+ +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  300   NPKRGDFKLGQVRTLLERARAVSKLWDDAPVVLCGDFNCTPKSHLYNFISERKLDLSGLA  359

Query  928   RIHISGQIDPSVKP------TYRFKSV---PAARARKP  842
             R  +SGQ   +++P      T RF++V   P  + + P
Sbjct  360   RDKVSGQESATIRPPRPEIYTTRFQTVNKSPQGQVQPP  397


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H   LY ++   ++ W +RK
Sbjct  124   PRSKPSDYREWEYAKSPPSPRSEKFVVLSYNILADYLANDHWRTLYFHIPRNMLSWGWRK  183

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               +  E+  ++  IMC QEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  184   SKIVFELGLWSADIMCLQEVDRFQDLEEELKPRGYSGIWKMRTGNAVDGCAIFWRSNRFK  243

Query  1418  L  1416
             L
Sbjct  244   L  244


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H ++L S Y+ + G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  561  WTPMEIATATGDPERTAVEHSMELRSTYSEIEGQANTRDENGEPVVTSYHRCFMGTVDYI  620

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  621  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  664



>ref|XP_007013800.1| DNAse I-like superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY31419.1| DNAse I-like superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=897

 Score =   126 bits (317),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 2/139 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E IEF + GLR+NVAQ CV +   +    +++A      S+   +V NIHVL+
Sbjct  285   RFKLLHEEYIEFNKHGLRDNVAQICVLELLSQHTPENTSAPLKS--SANKVVVCNIHVLY  342

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+   +
Sbjct  343   NPRRGEIKLGQVRRLLEGAHSVSKSWDDAPVVLCGDFNCTPKSPLYNFISEQKLDLSGVD  402

Query  928   RIHISGQIDPSVKPTYRFK  872
             R  +SGQ    + P   + 
Sbjct  403   RDKVSGQASAEIPPPMPYN  421


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -2

Query  1757  DRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             D R+W Y+        + F+ +SYN+LA   A  H +LY ++   +M+W++RK+ L  E+
Sbjct  175   DYREWEYAKTPPPSHSERFIVLSYNILADYLASTHRNLYFHIPLHMMNWEWRKRNLMFEL  234

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               ++  IMCFQEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  235   GLWSADIMCFQEVDKFHDLEEQMKYRGYSGIWKMRTGNAMDGCAIFWRTSRFKL  288


 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 1/89 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            W+  E+  ATG+   + L H L+L S Y  V   S TRD  GEPL TS++ +F GTVDYI
Sbjct  767  WSPMEIATATGSEDCNFLEHPLQLKSTYTEVKDFSGTRDLDGEPLVTSYNRRFFGTVDYI  826

Query  652  WHTAElvplrvldplpVNILRRTRGLPSE  566
            W +  L  +RVL P+P + ++ T G P++
Sbjct  827  WRSEGLQTVRVLAPIPKHAMQWTPGFPTK  855



>ref|XP_002871471.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47730.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=753

 Score =   126 bits (316),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 94/159 (59%), Gaps = 10/159 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F + GLR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  275   RFKLVHEESIQFNQLGLRDNVAQICVLETLLTSHTKENETPPPESSAGSHQVVICNIHVL  334

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   
Sbjct  335   FNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSHLYNFISDRKLDLSGL  394

Query  931   ERIHISGQIDPSVKP------TYRFKSV---PAARARKP  842
              R  +SGQ+    +P      T RF+S    P  + + P
Sbjct  395   ARDKVSGQVSAEFRPPRPENYTTRFQSANKSPQGQVQPP  433


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  641  WTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYI  700

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  701  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  744


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H   LY ++   ++ W +RK
Sbjct  158   PRSKPSDYREWEYAKTPPSPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGWRK  217

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+  +++ RTG++ DGCAIFW++  + 
Sbjct  218   SKLVFELGLWSADIMCLQEVDKFQDLEEEMKHRGYSAIWKMRTGNAVDGCAIFWRSNRFK  277

Query  1418  L  1416
             L
Sbjct  278   L  278



>gb|KFK25403.1| hypothetical protein AALP_AA8G109900 [Arabis alpina]
Length=698

 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESI+F +  LR+NVAQ CV +      + +     SE  S +  ++ NIHVLF
Sbjct  241   RFKLVHEESIQFNQLSLRDNVAQICVLETLLNSQTKEDEVSPSESCSRR-VVICNIHVLF  299

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A+ +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  300   NPKRGDFKLGQVRTLLERARAVSKLWDDAPVVLCGDFNCTPKSHLYNFISERKLDLSGLA  359

Query  928   RIHISGQIDPSVKP------TYRFKSV---PAARARKP  842
             R  +SGQ   +++P      T RF++V   P  + + P
Sbjct  360   RDKVSGQESATIRPPRPEIYTTRFQTVNKSPQGQVQPP  397


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H   LY ++   ++ W +RK
Sbjct  124   PRSKPSDYREWEYAKSPPSPRSEKFVVLSYNILADYLANDHWRTLYFHIPRNMLSWGWRK  183

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               +  E+  ++  IMC QEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  184   SKIVFELGLWSADIMCLQEVDRFQDLEEELKPRGYSGIWKMRTGNAVDGCAIFWRSNRFK  243

Query  1418  L  1416
             L
Sbjct  244   L  244


 Score = 88.6 bits (218),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H ++L S Y+ + G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  586  WTPMEIATATGDPERTAVEHSMELRSTYSEIEGQANTRDENGEPVVTSYHRCFMGTVDYI  645

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  646  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  689



>ref|XP_007013799.1| DNAse I-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31418.1| DNAse I-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=975

 Score =   126 bits (316),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 2/139 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LLH+E IEF + GLR+NVAQ CV +   +    +++A      S+   +V NIHVL+
Sbjct  285   RFKLLHEEYIEFNKHGLRDNVAQICVLELLSQHTPENTSAPLKS--SANKVVVCNIHVLY  342

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+   +
Sbjct  343   NPRRGEIKLGQVRRLLEGAHSVSKSWDDAPVVLCGDFNCTPKSPLYNFISEQKLDLSGVD  402

Query  928   RIHISGQIDPSVKPTYRFK  872
             R  +SGQ    + P   + 
Sbjct  403   RDKVSGQASAEIPPPMPYN  421


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -2

Query  1757  DRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             D R+W Y+        + F+ +SYN+LA   A  H +LY ++   +M+W++RK+ L  E+
Sbjct  175   DYREWEYAKTPPPSHSERFIVLSYNILADYLASTHRNLYFHIPLHMMNWEWRKRNLMFEL  234

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
               ++  IMCFQEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  235   GLWSADIMCFQEVDKFHDLEEQMKYRGYSGIWKMRTGNAMDGCAIFWRTSRFKL  288


 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            W+  E+  ATG+   + L H L+L S Y  V   S TRD  GEPL TS++ +F GTVDYI
Sbjct  767  WSPMEIATATGSEDCNFLEHPLQLKSTYTEVKDFSGTRDLDGEPLVTSYNRRFFGTVDYI  826

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L  +RVL P+P + ++ T G P+++WGSDH AL  ELAF  +
Sbjct  827  WRSEGLQTVRVLAPIPKHAMQWTPGFPTKKWGSDHFALASELAFTKD  873



>ref|XP_010541621.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Tarenaya hassleriana]
Length=764

 Score =   125 bits (315),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESI+F + GLR+NVAQ CV +      S +    +     S   +V NIHVL+
Sbjct  296   RFKLVHEESIQFNKLGLRDNVAQICVLELLNSRTSKNGVTASESSAGSHRVVVCNIHVLY  355

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRG+IKLGQ+R L+E A  +S+ W N  +VL GD N  PKS +Y F+   KLD+    
Sbjct  356   NPKRGEIKLGQVRTLLERAHAVSKLWDNASVVLCGDFNCTPKSPLYNFILEQKLDLSALA  415

Query  928   RIHISGQIDPSVKPT  884
             R  +SGQ    ++P+
Sbjct  416   RDKVSGQDSAIIRPS  430


 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 65/107 (61%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L L S Y  V G + TRD  GEP  TS++  F+GTVDYI
Sbjct  656  WTPMEIAAATGDQERTAIEHPLHLTSTYTEVEGKTNTRDKNGEPEVTSYNRCFMGTVDYI  715

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF  E
Sbjct  716  WRSQGLETVRVLAPMPKQAMQWTPGFPTPKWGSDHVALVSELAFTEE  762


 Score = 84.0 bits (206),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W ++   +    + FV +SYN+LA   A  H   LY ++   ++ W+ RK
Sbjct  179   PRSKPSDYREWEFAKTALPSGSEKFVVLSYNILADYLANDHRGKLYFHIPRNMLGWESRK  238

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + +  E+  ++  IMC QEVDR+ DL+  ++  G+  +++ RTG++ DGCA+FW++  + 
Sbjct  239   RRIIFELGLWSADIMCLQEVDRFQDLEEEMKLRGYSSIWKMRTGNAIDGCAMFWRSNRFK  298

Query  1418  L  1416
             L
Sbjct  299   L  299



>ref|NP_196696.2| DNAse I-like superfamily protein [Arabidopsis thaliana]
 sp|Q8VYU4.2|CCR4F_ARATH RecName: Full=Carbon catabolite repressor protein 4 homolog 6; 
Short=CCR4 homolog 6 [Arabidopsis thaliana]
 gb|AED91664.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
Length=754

 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 94/159 (59%), Gaps = 10/159 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F + GLR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  276   RFKLVHEESIQFNQLGLRDNVAQICVLETLLTSHTKENETPPPESSAGSHRVVICNIHVL  335

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   
Sbjct  336   FNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSPLYNFISDRKLDLSGL  395

Query  931   ERIHISGQIDPSVKP------TYRFKSV---PAARARKP  842
              R  +SGQ+    +P      T R++S    P  + + P
Sbjct  396   ARDKVSGQVSAEFRPPRPENYTTRYQSANKSPQGQVQPP  434


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  642  WTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYI  701

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  702  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  745


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H   LY ++   ++ W +RK
Sbjct  159   PRSKPSDYREWEYAKTPPSPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGWRK  218

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+  +++ RTG++ DGCAIFW++  + 
Sbjct  219   SKLVFELSLWSADIMCLQEVDKFQDLEEEMKHRGYSAIWKMRTGNAVDGCAIFWRSNRFK  278

Query  1418  L  1416
             L
Sbjct  279   L  279



>ref|XP_009824634.1| hypothetical protein H257_02618 [Aphanomyces astaci]
 gb|ETV86162.1| hypothetical protein H257_02618 [Aphanomyces astaci]
Length=455

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 121/241 (50%), Gaps = 49/241 (20%)
 Frame = -3

Query  1150  SSQSFLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIP-IVLAGDLNSMPKSAV  974
             +  + +V   H+LFNP+RGD+KL Q++LL+     L     NIP ++L GD N  PKSA+
Sbjct  235   TKDTVVVATTHILFNPRRGDVKLAQMQLLLSTLHAL-----NIPHVILCGDFNVTPKSAL  289

Query  973   YQFLTSSKLDIRMHERIHISGQI----------------DPSVK------------PTYR  878
             Y FL+  +LD         SGQ                 D  V               YR
Sbjct  290   YAFLSKGRLDGTTVYTGDASGQFAHRNSYFHNDVHDEEGDQGVDGGCVTRHQGNGTAAYR  349

Query  877   FKSVPAARARKPLMHRWTDEELRLATGTVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPL  698
             F +  + R+R+P                + VH +H+L L SAYA  P    T +  GEP 
Sbjct  350   FDAPSSRRSRRP----------HPPHECLGVHAVHELPLASAYAQHP----TAETSGEPF  395

Query  697   ATSFHSKFLGTVDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFA  518
             ATS+H +FLGTVDYIW+ A +V + V++  PV+  R  R LP+ + GSDH++LV + AF 
Sbjct  396   ATSYHDRFLGTVDYIWY-ANVVCVGVVELPPVSFFRNIRSLPTRDLGSDHVSLVADFAFG  454

Query  517   G  515
              
Sbjct  455   A  455


 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 62/122 (51%), Gaps = 13/122 (11%)
 Frame = -2

Query  1742  VYSPRDVSHCKDG--------FVFVSYNLLAVENAKKHPDLYPNVLPEL---MDWDYRKQ  1596
             VY+  DV+    G        F  VS+N+LA   A        +  P       W +R  
Sbjct  82    VYTAYDVASVDGGAAAATTSPFRVVSFNVLADYLATSRDGNLGHSHPSQAFKFQWAFRCT  141

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDD-LDNLLQKDGFRGVYQPRTG-DSCDGCAIFWKNELY  1422
              L +EI  +N  ++C QEVD ++D  +  L+K G+ G ++ RTG ++ DGC+IF K +L+
Sbjct  142   RLLREILTWNAAVICLQEVDHFEDFFEPELRKYGYVGKHKQRTGAETHDGCSIFVKEDLF  201

Query  1421  DL  1416
              +
Sbjct  202   QI  203



>ref|XP_008863800.1| hypothetical protein H310_02156 [Aphanomyces invadans]
 gb|ETW07707.1| hypothetical protein H310_02156 [Aphanomyces invadans]
Length=445

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 138/289 (48%), Gaps = 61/289 (21%)
 Frame = -3

Query  1306  ISILECRFTLLHKESIEFERFGL----RNNVAQFCVFKRKRKECSNDSNALTSEDMSSQS  1139
             I I E  F ++ +  ++F + G     R+NVA   V   K                +   
Sbjct  189   IFIKEDLFEIVDEIEVDFHKPGHAILDRHNVALVLVLAFKP---------------TKDV  233

Query  1138  FLVGNIHVLFNPKRGDIKLGQIRLLVENAQRLSQEWGNIP-IVLAGDLNSMPKSAVYQFL  962
              +V   H+LFNP+RGD+KL Q++LL+   Q L     N P ++L GD N  PKSA+Y+FL
Sbjct  234   VVVATTHILFNPRRGDVKLAQLQLLLSTIQAL-----NTPHVILCGDFNLTPKSALYEFL  288

Query  961   TSSKLDIRMHERIHISGQ-------IDPSVKP---------------TYRFKSVPAARAR  848
             +   LD         SGQ           V P                YRF + P+ + R
Sbjct  289   SKGALDGTTVSSCDASGQYAHRNSYFHNDVHPEEGNGIERHQGAGTAAYRFGATPSLQLR  348

Query  847   KPLMHRWTDEELRLATGTVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLG  668
             +             A   + +  +H+L L SAYA  P  + +    GEP ATS+H +FLG
Sbjct  349   R---------RPSRAHECLGIRAVHELNLASAYAQHPTDATS----GEPFATSYHDRFLG  395

Query  667   TVDYIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
             TVDYIW+ A +V + V++  PV+  R  R LP+ + GSDHL+LV + AF
Sbjct  396   TVDYIWY-ANMVCVGVMELPPVSFFRGIRALPTRDLGSDHLSLVADFAF  443


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 59/109 (54%), Gaps = 5/109 (5%)
 Frame = -2

Query  1727  DVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPEL---MDWDYRKQILCKEIRGYNPGI  1557
             DVS     F  VS+N+LA   A        +  P       W +R   L +E+  +N  +
Sbjct  90    DVSATTSPFRVVSFNVLADYLATSPDGNLGHSHPSQKWKFQWSFRCTRLLREMLAWNAAV  149

Query  1556  MCFQEVDRYDD-LDNLLQKDGFRGVYQPRTG-DSCDGCAIFWKNELYDL  1416
             +C QEVD +DD  +  L+K G+ G ++ RTG D+ DGC+IF K +L+++
Sbjct  150   ICLQEVDHFDDFFEPELRKYGYIGKHKKRTGADTHDGCSIFIKEDLFEI  198



>ref|XP_010254301.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X5 [Nelumbo nucifera]
Length=649

 Score =   124 bits (312),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFK-RKRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF LL++E IEF + GLR+NVAQ CV + R +    N+S A  S        ++ N HVL
Sbjct  222   RFKLLYEEFIEFNKLGLRDNVAQICVLESRSQNAAENESEASCSSSKLVNQVVICNTHVL  281

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG++KLGQ+R+L++ A  +S+ W N P+VL GD N  PKS +Y ++   KLD+   
Sbjct  282   YNPKRGEVKLGQVRVLLDRAHAVSRSWNNAPVVLCGDFNCTPKSPLYNYILEQKLDLSGL  341

Query  931   ERIHISGQ  908
              R  ISGQ
Sbjct  342   ARDQISGQ  349


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +E+  ATG     LL H LKL S YA V   S TRD   EP  TS++ +FLGTVDYI
Sbjct  539  WTPKEIETATGNAECTLLEHPLKLRSTYAEVEDYSGTRDSSREPQVTSYNRRFLGTVDYI  598

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            WH+  L  ++VLD +P +I++ T G P+ +WGSDH+AL C+LAF  +  ++
Sbjct  599  WHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAFVRDAAQS  649


 Score = 94.7 bits (234),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQILCK  1584
             +D R W Y+        + F+ +SYN+LA   A  H  +LY ++   ++DW++RK+ +  
Sbjct  110   LDYRNWEYALSQPPGQCERFIVLSYNILADYLATNHRRELYFHIPRYMLDWEWRKKRMVF  169

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+R ++P IMC QEVDR+ DL+  L+  G+ G+++ RTG + DGCAIFW+   + L
Sbjct  170   ELRLWSPDIMCLQEVDRFHDLEEELKLQGYEGIWKMRTGTAVDGCAIFWRTSRFKL  225



>emb|CDP04807.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   125 bits (313),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESIEF   GLR+NVAQ CVF+   +  S  + A +     ++  +V NIHVLF
Sbjct  290   RFKLVHEESIEFSALGLRDNVAQICVFESLSQCNSTTAPAPSKSSKQAKKVVVCNIHVLF  349

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQIR+L+  A  +S+ W +  +++ GD NS PKS +Y F+   KLD+    
Sbjct  350   NPRRGEIKLGQIRVLLARAHAVSKLWDDASVIICGDFNSTPKSPLYNFVAEQKLDLSELP  409

Query  928   RIHISGQIDPSVKPT  884
             R  +SGQ      P+
Sbjct  410   RDQVSGQTSAEFYPS  424


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  EL  ATG+    ++ H LKL S Y  V  +S TRD  GEP  TS+H +FLGTVDYI
Sbjct  627  WTPVELETATGSSDCLVMEHPLKLRSVYGEVEDSSGTRDSTGEPAVTSYHRRFLGTVDYI  686

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L   RVL P+P + ++ TRG P+++WGSDH+ALV ELAF
Sbjct  687  WRSEGLQTSRVLAPIPKHAMQWTRGFPTKKWGSDHIALVSELAF  730


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = -2

Query  1772  PANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQ  1596
             P   ++ R W ++        + F  +SYN+LA   A  H   LY +V   ++DW +RK+
Sbjct  174   PPKDLEYRNWEHAKPGPPPEWERFTVLSYNILADYLATDHQHKLYFHVPRHMLDWKWRKR  233

Query  1595  ILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              +  E+R ++  I+CFQEVDR+ DL   L+  G+ GV++ RTGD  DGCAIFW+N  + L
Sbjct  234   SILFELRLWSADILCFQEVDRFQDLKEELELRGYNGVWKMRTGDRVDGCAIFWRNSRFKL  293



>ref|XP_006399637.1| hypothetical protein EUTSA_v10012752mg [Eutrema salsugineum]
 gb|ESQ41090.1| hypothetical protein EUTSA_v10012752mg [Eutrema salsugineum]
Length=764

 Score =   125 bits (313),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+H+ESI+F + GLR+NVAQ CV +      + +     SE  S +  ++ NIHVLF
Sbjct  291   RFKLVHEESIQFNQLGLRDNVAQICVLETLLNSHTKEIEVSPSESCSRR-VVICNIHVLF  349

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  350   NPKRGDFKLGQVRTLLERAHAVSKLWDDAPVVLCGDFNCTPKSHLYNFISERKLDLSGLA  409

Query  928   RIHISGQIDPSVKP  887
             R  +SGQ   +++P
Sbjct  410   RDKVSGQDSAAIRP  423


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H ++L S Y+ + G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  652  WTPMEIATATGDPEKSTVEHAMELKSTYSEIEGQANTRDENGEPVVTSYHRCFMGTVDYI  711

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  712  WRSEGLQTVRVLAPIPKQAMQWTLGFPTPKWGSDHIALVSELAF  755


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+        + FV +SYN+LA   A  H  +LY ++   ++ W +RK
Sbjct  174   PRSKPSDYREWEYAKTAPPPGSEKFVVLSYNILADYLANDHWRNLYFHIPRNMLSWGWRK  233

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  234   NKLVFELGLWSADIMCLQEVDKFQDLEEEMKIRGYSGIWKMRTGNAVDGCAIFWRSNRFK  293

Query  1418  L  1416
             L
Sbjct  294   L  294



>ref|XP_010254300.1| PREDICTED: carbon catabolite repressor protein 4 homolog 5 isoform 
X4 [Nelumbo nucifera]
Length=729

 Score =   124 bits (312),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFK-RKRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF LL++E IEF + GLR+NVAQ CV + R +    N+S A  S        ++ N HVL
Sbjct  222   RFKLLYEEFIEFNKLGLRDNVAQICVLESRSQNAAENESEASCSSSKLVNQVVICNTHVL  281

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG++KLGQ+R+L++ A  +S+ W N P+VL GD N  PKS +Y ++   KLD+   
Sbjct  282   YNPKRGEVKLGQVRVLLDRAHAVSRSWNNAPVVLCGDFNCTPKSPLYNYILEQKLDLSGL  341

Query  931   ERIHISGQ  908
              R  ISGQ
Sbjct  342   ARDQISGQ  349


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +E+  ATG     LL H LKL S YA V   S TRD   EP  TS++ +FLGTVDYI
Sbjct  619  WTPKEIETATGNAECTLLEHPLKLRSTYAEVEDYSGTRDSSREPQVTSYNRRFLGTVDYI  678

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            WH+  L  ++VLD +P +I++ T G P+ +WGSDH+AL C+LAF
Sbjct  679  WHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAF  722


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQILCK  1584
             +D R W Y+        + F+ +SYN+LA   A  H  +LY ++   ++DW++RK+ +  
Sbjct  110   LDYRNWEYALSQPPGQCERFIVLSYNILADYLATNHRRELYFHIPRYMLDWEWRKKRMVF  169

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+R ++P IMC QEVDR+ DL+  L+  G+ G+++ RTG + DGCAIFW+   + L
Sbjct  170   ELRLWSPDIMCLQEVDRFHDLEEELKLQGYEGIWKMRTGTAVDGCAIFWRTSRFKL  225



>ref|XP_010254297.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Nelumbo nucifera]
Length=843

 Score =   124 bits (312),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFK-RKRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF LL++E IEF + GLR+NVAQ CV + R +    N+S A  S        ++ N HVL
Sbjct  222   RFKLLYEEFIEFNKLGLRDNVAQICVLESRSQNAAENESEASCSSSKLVNQVVICNTHVL  281

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG++KLGQ+R+L++ A  +S+ W N P+VL GD N  PKS +Y ++   KLD+   
Sbjct  282   YNPKRGEVKLGQVRVLLDRAHAVSRSWNNAPVVLCGDFNCTPKSPLYNYILEQKLDLSGL  341

Query  931   ERIHISGQ  908
              R  ISGQ
Sbjct  342   ARDQISGQ  349


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQILCK  1584
             +D R W Y+        + F+ +SYN+LA   A  H  +LY ++   ++DW++RK+ +  
Sbjct  110   LDYRNWEYALSQPPGQCERFIVLSYNILADYLATNHRRELYFHIPRYMLDWEWRKKRMVF  169

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+R ++P IMC QEVDR+ DL+  L+  G+ G+++ RTG + DGCAIFW+   + L
Sbjct  170   ELRLWSPDIMCLQEVDRFHDLEEELKLQGYEGIWKMRTGTAVDGCAIFWRTSRFKL  225


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +E+  ATG     LL H LKL S YA V   S TRD   EP  TS++ +FLGTVDYI
Sbjct  734  WTPKEIETATGNAECTLLEHPLKLRSTYAEVEDYSGTRDSSREPQVTSYNRRFLGTVDYI  793

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEE  563
            WH+  L  ++VLD +P +I++ T G P+ +
Sbjct  794  WHSEGLQTVKVLDTIPKHIMQFTPGFPTHD  823



>ref|XP_010254296.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Nelumbo nucifera]
Length=844

 Score =   124 bits (312),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFK-RKRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF LL++E IEF + GLR+NVAQ CV + R +    N+S A  S        ++ N HVL
Sbjct  222   RFKLLYEEFIEFNKLGLRDNVAQICVLESRSQNAAENESEASCSSSKLVNQVVICNTHVL  281

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG++KLGQ+R+L++ A  +S+ W N P+VL GD N  PKS +Y ++   KLD+   
Sbjct  282   YNPKRGEVKLGQVRVLLDRAHAVSRSWNNAPVVLCGDFNCTPKSPLYNYILEQKLDLSGL  341

Query  931   ERIHISGQ  908
              R  ISGQ
Sbjct  342   ARDQISGQ  349


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT +E+  ATG     LL H LKL S YA V   S TRD   EP  TS++ +FLGTVDYI
Sbjct  734  WTPKEIETATGNAECTLLEHPLKLRSTYAEVEDYSGTRDSSREPQVTSYNRRFLGTVDYI  793

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            WH+  L  ++VLD +P +I++ T G P+ +WGSDH+AL C+LAF
Sbjct  794  WHSEGLQTVKVLDTIPKHIMQFTPGFPTHKWGSDHIALACQLAF  837


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHP-DLYPNVLPELMDWDYRKQILCK  1584
             +D R W Y+        + F+ +SYN+LA   A  H  +LY ++   ++DW++RK+ +  
Sbjct  110   LDYRNWEYALSQPPGQCERFIVLSYNILADYLATNHRRELYFHIPRYMLDWEWRKKRMVF  169

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+R ++P IMC QEVDR+ DL+  L+  G+ G+++ RTG + DGCAIFW+   + L
Sbjct  170   ELRLWSPDIMCLQEVDRFHDLEEELKLQGYEGIWKMRTGTAVDGCAIFWRTSRFKL  225



>ref|XP_010670716.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=589

 Score =   123 bits (309),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+++E IEF + G+R+NVAQ CV +      S    A +S        ++ N HVL+
Sbjct  65    RFRLMYEECIEFNKHGMRDNVAQICVLESLVPNQSEKELASSSSSKGPNRVVICNTHVLY  124

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L+E AQ +S+ W + P VL GD N  P S +Y F++  KLDI   E
Sbjct  125   NPRRGEIKLGQVRILLERAQAVSKTWDDAPAVLCGDFNCTPMSPLYNFISEQKLDISEVE  184

Query  928   RIHISGQIDPSVKPTYR  878
             R  +SGQ    + P  R
Sbjct  185   RDKVSGQASAVIYPPPR  201


 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG  S   L H LKL S Y+ V  +S TRD  GEPL TS+++ F+GTVDYI
Sbjct  483  WTPMEIATATGDASSSALEHSLKLKSTYSEVVDSSGTRDSNGEPLVTSYNTCFMGTVDYI  542

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  ++VL P+  + ++ + G P+++WGSDH+AL  ELAF
Sbjct  543  WRSEGLCTIKVLAPITKDAMQPSGGFPTKKWGSDHIALASELAF  586


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -2

Query  1619  MDWDYRKQILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIF  1440
             M WD+RK  +  E+R ++P IMC QEVD++ +L+   +  G+ G+++ RTGD  DGCAIF
Sbjct  1     MSWDWRKGNILFELRLWSPDIMCLQEVDKFHELEEDFRVRGYSGIWKMRTGDPIDGCAIF  60

Query  1439  WKNELYDL  1416
             W+   + L
Sbjct  61    WRTSRFRL  68



>ref|XP_007161236.1| hypothetical protein PHAVU_001G053400g [Phaseolus vulgaris]
 gb|ESW33230.1| hypothetical protein PHAVU_001G053400g [Phaseolus vulgaris]
Length=827

 Score =   124 bits (312),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 84/127 (66%), Gaps = 5/127 (4%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL++E IEF + GLR+NVAQ CV      E  N + +L S    S   +V NIHVL+
Sbjct  251   RFNLLYEECIEFNKLGLRDNVAQLCVL-----EIINRNGSLPSSLTGSSKVVVCNIHVLY  305

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG+IKLGQ+R+L++ A+ +S+ W + P+V+ GD N  PKS +Y F++  KLD+   +
Sbjct  306   NPNRGEIKLGQVRVLLDKAKSVSKLWNDAPVVICGDFNCTPKSPLYNFISEQKLDLSGID  365

Query  928   RIHISGQ  908
             R  +SGQ
Sbjct  366   RNKVSGQ  372


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      L H L L S Y      S TRD  GEPL TS++ +F GTVDYI
Sbjct  712  WTPTEIETATGNEDCTFLEHPLLLRSTYTEAMDRSGTRDPYGEPLVTSYNRRFSGTVDYI  771

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEG  509
            W +  L    VL P+    L  T G P+++WGSDH+ALV ELAF  +G
Sbjct  772  WRSEGLQTTGVLAPMAKYALEHTPGFPTKKWGSDHIALVTELAFMKDG  819


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -2

Query  1718  HCKDGFVFVSYNLLAVENAKKHPD-LYPNVLPELMDWDYRKQILCKEIRGYNPGIMCFQE  1542
             HC + F  +SYN+LA   A  H + LY ++   ++DW +RK+ +  E+  ++  I+C QE
Sbjct  154   HC-ERFKVLSYNILADYLALDHRNKLYFHIPSYILDWQWRKRSILFELGLWSADILCLQE  212

Query  1541  VDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             VDR+ +L   L+  G+ G+++ RTG+  DGCAIFW+   ++L
Sbjct  213   VDRFHELAEELKPRGYCGIWKMRTGNPVDGCAIFWRKSRFNL  254



>ref|XP_009121962.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Brassica rapa]
Length=691

 Score =   124 bits (310),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+ +ESI+F + GLR+NVAQ CV +      + ++ A  SE  S +  +V NIHVL+
Sbjct  280   RFKLVQEESIQFNQLGLRDNVAQICVLEALLNSHAKENEASPSESCSHR-VVVCNIHVLY  338

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  339   NPKRGDFKLGQVRTLLERAHAVSKLWDDAPVVLCGDFNCTPKSHLYNFISEGKLDLSGVA  398

Query  928   RIHISGQIDPSVKP  887
             R  +SGQ    ++P
Sbjct  399   RNKVSGQESAEIRP  412


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H  +LY ++   ++ W +RK
Sbjct  163   PRSKPSDYREWEYAKTAPSPGTEKFVVLSYNILADYLANDHWRNLYFHIPRNMLSWGWRK  222

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               +  E+  ++  IMC QEVD++ DL+  L+  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  223   NKIVFELGLWSADIMCLQEVDKFQDLEEELKLRGYSGIWKMRTGNAVDGCAIFWRSNRFK  282

Query  1418  L  1416
             L
Sbjct  283   L  283



>ref|XP_006287178.1| hypothetical protein CARUB_v10000347mg [Capsella rubella]
 ref|XP_006287179.1| hypothetical protein CARUB_v10000347mg [Capsella rubella]
 gb|EOA20076.1| hypothetical protein CARUB_v10000347mg [Capsella rubella]
 gb|EOA20077.1| hypothetical protein CARUB_v10000347mg [Capsella rubella]
Length=705

 Score =   124 bits (310),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F + GLR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  252   RFKLVHEESIQFNQLGLRDNVAQICVLETLVISRTKENETPPPESSAGSHRVVICNIHVL  311

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   
Sbjct  312   FNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSHLYNFISDRKLDLSGL  371

Query  931   ERIHISGQIDPSVKP------TYRFKSV  866
              R  +SGQ+    +P      T RF+S 
Sbjct  372   ARDKVSGQVSAEFRPPRPENYTTRFQSA  399


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     ++ H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  593  WTPMEIATATGDPERTMVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRLFMGTVDYI  652

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  653  WRSEGLQTVRVLAPIPKEAMQWTPGFPTPKWGSDHIALVSELAF  696


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+   +    + FV +SYN+LA   A  H   LY ++   ++ W +RK
Sbjct  135   PRSKPSDYREWEYAKPPLPPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGWRK  194

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + L  E+  ++  IMC QEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  195   RKLVFELGLWSADIMCLQEVDKFQDLEEEMKHRGYCGIWKMRTGNAVDGCAIFWRSNRFK  254

Query  1418  L  1416
             L
Sbjct  255   L  255



>emb|CDX97099.1| BnaC09g45260D [Brassica napus]
Length=752

 Score =   124 bits (311),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+ +ESI+F + GLR+NVAQ CV +      + ++ A  SE  S +  +V NIHVL+
Sbjct  277   RFKLVQEESIQFNQLGLRDNVAQICVLEALLNSHTKENEASPSESCSRR-VVVCNIHVLY  335

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  336   NPKRGDFKLGQVRTLLERAHAVSKLWDDAPVVLCGDFNCTPKSHLYNFISEGKLDLSGVA  395

Query  928   RIHISGQIDPSVKP  887
             R  +SGQ    ++P
Sbjct  396   RNKVSGQESAEIRP  409


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H  +LY ++   ++ W +RK
Sbjct  160   PRSKPSDFREWEYAKTAPSPGSEKFVVLSYNILADYLANDHWRNLYFHIPRNVLSWGWRK  219

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               +  E+  ++  IMC QEVD++ DL+  L+  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  220   NKIVFELGLWSADIMCLQEVDKFQDLEEELKHRGYSGIWKMRTGNAVDGCAIFWRSNRFK  279

Query  1418  L  1416
             L
Sbjct  280   L  280


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ + G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  640  WTPMEIAAATGDPGRSTVEHALELKSTYSEIEGKANTRDENGEPVVTSYHRCFMGTVDYI  699

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  700  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  743



>ref|XP_009121961.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Brassica rapa]
Length=757

 Score =   124 bits (310),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 1/134 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+ +ESI+F + GLR+NVAQ CV +      + ++ A  SE  S +  +V NIHVL+
Sbjct  280   RFKLVQEESIQFNQLGLRDNVAQICVLEALLNSHAKENEASPSESCSHR-VVVCNIHVLY  338

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  339   NPKRGDFKLGQVRTLLERAHAVSKLWDDAPVVLCGDFNCTPKSHLYNFISEGKLDLSGVA  398

Query  928   RIHISGQIDPSVKP  887
             R  +SGQ    ++P
Sbjct  399   RNKVSGQESAEIRP  412


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H  +LY ++   ++ W +RK
Sbjct  163   PRSKPSDYREWEYAKTAPSPGTEKFVVLSYNILADYLANDHWRNLYFHIPRNMLSWGWRK  222

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               +  E+  ++  IMC QEVD++ DL+  L+  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  223   NKIVFELGLWSADIMCLQEVDKFQDLEEELKLRGYSGIWKMRTGNAVDGCAIFWRSNRFK  282

Query  1418  L  1416
             L
Sbjct  283   L  283


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ + G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  645  WTPMEIAAATGDPERSTVEHALELKSTYSEIEGKANTRDENGEPVVTSYHRCFMGTVDYI  704

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  705  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  748



>ref|XP_010670715.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=749

 Score =   123 bits (309),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+++E IEF + G+R+NVAQ CV +      S    A +S        ++ N HVL+
Sbjct  225   RFRLMYEECIEFNKHGMRDNVAQICVLESLVPNQSEKELASSSSSKGPNRVVICNTHVLY  284

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP+RG+IKLGQ+R+L+E AQ +S+ W + P VL GD N  P S +Y F++  KLDI   E
Sbjct  285   NPRRGEIKLGQVRILLERAQAVSKTWDDAPAVLCGDFNCTPMSPLYNFISEQKLDISEVE  344

Query  928   RIHISGQIDPSVKPTYR  878
             R  +SGQ    + P  R
Sbjct  345   RDKVSGQASAVIYPPPR  361


 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 67/114 (59%), Gaps = 0/114 (0%)
 Frame = -2

Query  1757  DRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEI  1578
             D R W ++        + FV +SYN+LA   A  H  LY ++    M WD+RK  +  E+
Sbjct  115   DFRSWEFAKLPPPPHDERFVLLSYNILADYLANSHRKLYFHIPRRFMSWDWRKGNILFEL  174

Query  1577  RGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             R ++P IMC QEVD++ +L+   +  G+ G+++ RTGD  DGCAIFW+   + L
Sbjct  175   RLWSPDIMCLQEVDKFHELEEDFRVRGYSGIWKMRTGDPIDGCAIFWRTSRFRL  228


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG  S   L H LKL S Y+ V  +S TRD  GEPL TS+++ F+GTVDYI
Sbjct  643  WTPMEIATATGDASSSALEHSLKLKSTYSEVVDSSGTRDSNGEPLVTSYNTCFMGTVDYI  702

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  ++VL P+  + ++ + G P+++WGSDH+AL  ELAF
Sbjct  703  WRSEGLCTIKVLAPITKDAMQPSGGFPTKKWGSDHIALASELAF  746



>ref|XP_010453180.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Camelina sativa]
Length=747

 Score =   123 bits (308),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 94/159 (59%), Gaps = 10/159 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F + GLR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  272   RFKLVHEESIQFNQLGLRDNVAQICVLETLLTSRTKENETFPPESSAGSHRVVICNIHVL  331

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ A  +S+ W + P+VL GD N  PKS +Y F++  KLD+   
Sbjct  332   FNPKRGDFKLGQVRTLLDKAHTVSKLWDDAPVVLCGDFNCTPKSHLYNFISDRKLDLSGL  391

Query  931   ERIHISGQIDPSVKP------TYRFKSV---PAARARKP  842
              R  +SGQ     +P      T RF+S    P ++ + P
Sbjct  392   ARDKVSGQGSGEFRPPRPENYTTRFQSTNKSPQSQVQPP  430


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  635  WTPMEIATATGDPEKTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYI  694

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  695  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  738


 Score = 85.9 bits (211),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W ++   +    + FV +SYN+LA   A  H   LY ++   ++ W  RK
Sbjct  155   PRSKPSDYREWEHAKTPLPPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGSRK  214

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  215   SKLVFELGLWSADIMCLQEVDKFQDLEEEMKPRGYSGIWKMRTGNAVDGCAIFWRSNRFK  274

Query  1418  L  1416
             L
Sbjct  275   L  275



>ref|XP_008219887.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X2 [Prunus mume]
Length=843

 Score =   123 bits (308),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNA-LTSEDMSSQSFLVGNIHVL  1112
             RF L+H+E IEF + GLR+NVAQ CV +     C   + A + +    S   ++ NIHVL
Sbjct  250   RFKLIHEECIEFSKLGLRDNVAQICVLESI---CQTKNLAVIPTSSTGSNKVVICNIHVL  306

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG+IKLGQ+R+L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   
Sbjct  307   YNPKRGEIKLGQVRVLLDRAHAISKIWNDAPIVLCGDFNCTPKSPLYNFISEQKLDLSGV  366

Query  931   ERIHISGQ  908
             +R  +SGQ
Sbjct  367   DRDKVSGQ  374


 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W ++    S   D F  +SYN+LA   A +H   LY ++   +MDW +RK  L  
Sbjct  138   LDYRNWEFAKTTPSPTCDRFTVLSYNILADSLAHEHRSKLYFHIPYHMMDWQWRKNNLIF  197

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVD++ D++  L+  G+ G+++ RTG+  DGCAIFW++  + L
Sbjct  198   ELGLWSADIMCFQEVDKFQDIEEELKLKGYNGIWKMRTGNPVDGCAIFWRSSRFKL  253


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = -3

Query  829  WTDEELRLATG-TVSVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG + S  L H LKL S Y  V   +  RD  GEPL TS++  FLGTVDYI
Sbjct  733  WTPMEIEAATGNSESTVLEHPLKLRSTYTEVEDCAGARDSNGEPLVTSYNRCFLGTVDYI  792

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            W +  L  +RVL P+P + ++ T G P+++WGSDH+AL  ELAF    D++
Sbjct  793  WRSEGLQTVRVLAPIPKHAMQWTSGFPTKKWGSDHIALASELAFVNSFDQS  843



>ref|XP_008219886.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 isoform 
X1 [Prunus mume]
Length=844

 Score =   123 bits (308),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNA-LTSEDMSSQSFLVGNIHVL  1112
             RF L+H+E IEF + GLR+NVAQ CV +     C   + A + +    S   ++ NIHVL
Sbjct  250   RFKLIHEECIEFSKLGLRDNVAQICVLESI---CQTKNLAVIPTSSTGSNKVVICNIHVL  306

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NPKRG+IKLGQ+R+L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   
Sbjct  307   YNPKRGEIKLGQVRVLLDRAHAISKIWNDAPIVLCGDFNCTPKSPLYNFISEQKLDLSGV  366

Query  931   ERIHISGQ  908
             +R  +SGQ
Sbjct  367   DRDKVSGQ  374


 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W ++    S   D F  +SYN+LA   A +H   LY ++   +MDW +RK  L  
Sbjct  138   LDYRNWEFAKTTPSPTCDRFTVLSYNILADSLAHEHRSKLYFHIPYHMMDWQWRKNNLIF  197

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVD++ D++  L+  G+ G+++ RTG+  DGCAIFW++  + L
Sbjct  198   ELGLWSADIMCFQEVDKFQDIEEELKLKGYNGIWKMRTGNPVDGCAIFWRSSRFKL  253


 Score = 82.8 bits (203),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -3

Query  829  WTDEELRLATG-TVSVHLLHQLKLCSAYAGVP-GTSKTRDDLGEPLATSFHSKFLGTVDY  656
            WT  E+  ATG + S  L H LKL S Y  V    +  RD  GEPL TS++  FLGTVDY
Sbjct  733  WTPMEIEAATGNSESTVLEHPLKLRSTYTEVEVDCAGARDSNGEPLVTSYNRCFLGTVDY  792

Query  655  IWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            IW +  L  +RVL P+P + ++ T G P+++WGSDH+AL  ELAF    D++
Sbjct  793  IWRSEGLQTVRVLAPIPKHAMQWTSGFPTKKWGSDHIALASELAFVNSFDQS  844



>ref|XP_010419693.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6 [Camelina 
sativa]
Length=753

 Score =   122 bits (307),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F + GLR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  276   RFKLVHEESIQFNQLGLRDNVAQICVLETLLTSRTKENETPPPESSAGSHRVVICNIHVL  335

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ AQ +S+ W + P+VL GD N  PKS +Y F++  KLD+   
Sbjct  336   FNPKRGDFKLGQVRTLLDKAQTVSKLWDDAPVVLCGDFNCTPKSHLYNFISDRKLDLSGL  395

Query  931   ERIHISGQ  908
              R  +SGQ
Sbjct  396   ARDKVSGQ  403


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  641  WTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYI  700

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  701  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  744


 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W ++   +    + FV +SYN+LA   A  H   LY ++   ++ W  RK
Sbjct  159   PRSKPSDYREWEHAKTPLPPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGCRK  218

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW+   + 
Sbjct  219   SKLVFELGLWSADIMCLQEVDKFQDLEEEMKPRGYSGIWKMRTGNAVDGCAIFWRLNRFK  278

Query  1418  L  1416
             L
Sbjct  279   L  279



>gb|KDP33634.1| hypothetical protein JCGZ_07205 [Jatropha curcas]
Length=830

 Score =   122 bits (307),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 94/141 (67%), Gaps = 2/141 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR-KRKECSNDSNALTSEDMSSQSFLVGNIHVL  1112
             RF LL++ESIEF + GLR+NVAQ CV ++   K C+ +S++L++    S   ++ NIHVL
Sbjct  246   RFKLLYEESIEFNKLGLRDNVAQICVLEKLTSKNCTENSSSLSTSSAGSDKVVMCNIHVL  305

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             +NP+RG+IKLGQ+R L++ A  +S+ W N P+V+ GD N  PKS +Y F++  KLD+   
Sbjct  306   YNPRRGEIKLGQVRTLLDRAYAVSKMW-NAPVVICGDFNCTPKSPLYNFISEQKLDLTGI  364

Query  931   ERIHISGQIDPSVKPTYRFKS  869
             +R  +SGQ    ++    F S
Sbjct  365   DRDKVSGQASAEIRAPRPFNS  385


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = -2

Query  1760  VDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILCK  1584
             +D R W Y+        + F+ +SYN+LA   A  H   LY ++   ++DW++RK+ +  
Sbjct  134   LDYRDWEYAKTAPPSDSEKFIVLSYNILADYLAINHRSKLYFHIPRRMLDWEWRKRSILF  193

Query  1583  EIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
             E+  ++  IMCFQEVDR+ DL+  L+  G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  194   ELGLWSADIMCFQEVDRFQDLEEELKLRGYCGIWKMRTGNAVDGCAIFWRTSRFKL  249


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -3

Query  829  WTDEELRLATGTV-SVHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG++ ++ L H LKL SAY  V   S TRD  GEPL TS++  F GTVDYI
Sbjct  715  WTPVEIATATGSIDNICLEHPLKLKSAYTEVQDCSGTRDPNGEPLVTSYNRCFFGTVDYI  774

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGE  512
            W +  L   RVL P+P + ++ T G P+++WGSDH+AL  ELAF  +
Sbjct  775  WFSEGLQTNRVLAPIPKHAMQWTPGFPTKKWGSDHIALASELAFTKD  821



>ref|XP_004969137.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Setaria italica]
Length=862

 Score =   122 bits (306),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKR--KRKECSNDSNALTSEDMSSQSFLVGNIHV  1115
             RF L ++E IEF + GLR+NVAQ CV +    +   ++ +N  TS    ++  +V NIHV
Sbjct  272   RFQLRYEEDIEFNKLGLRDNVAQLCVLESVVPQNVQTDSTNLSTSHPQQAKQVVVCNIHV  331

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             L+NPKRGDIKLGQ+R L++ A  +S+ W + P++L GD NS PKS +Y F++  KL++  
Sbjct  332   LYNPKRGDIKLGQVRTLLDRAYTVSKMWNDAPVILCGDFNSTPKSPLYNFVSEQKLNLSG  391

Query  934   HERIHISGQ  908
               +  ISGQ
Sbjct  392   LAKNTISGQ  400


 Score = 99.8 bits (247),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = -3

Query  835  HRWTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVD  659
            +RWT EE++ ATG V    + H LKL S Y  V     T+D   EPL TS++SKF+GTVD
Sbjct  755  YRWTPEEIKAATGNVECTSVEHSLKLRSVYTDVEDFDGTKDANKEPLVTSYNSKFMGTVD  814

Query  658  YIWHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            YIW + +L  ++VLD  P  IL++T G P+++WGSDH+A+ CEL+F
Sbjct  815  YIWASEDLQTVQVLDTFPKQILKQTIGFPTKKWGSDHIAIACELSF  860


 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 70/113 (62%), Gaps = 0/113 (0%)
 Frame = -2

Query  1754  RRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKHPDLYPNVLPELMDWDYRKQILCKEIR  1575
             RR+W ++ +      + F  +SYN+LA   A++H  LY  +   ++DW++RK  L  E  
Sbjct  163   RRRWRFAKQRPPRQAERFKVLSYNILADYLAQEHRFLYERIPSFILDWNWRKDKLVFEFG  222

Query  1574  GYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              ++P I+C QEVDR+ DL+  +   G+ G+++ RTG++ DGCAIFW+   + L
Sbjct  223   LWSPDILCLQEVDRFTDLEQEMASRGYNGIWKMRTGNAADGCAIFWRTTRFQL  275



>gb|AAL47464.1| At5g11350/F2I11_240 [Arabidopsis thaliana]
 gb|AAN28916.1| At5g11350/F2I11_240 [Arabidopsis thaliana]
Length=754

 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 93/159 (58%), Gaps = 10/159 (6%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F +  LR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  276   RFKLVHEESIQFNQLRLRDNVAQICVLETLLTSHTKENETPPPESSAGSHRVVICNIHVL  335

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+   
Sbjct  336   FNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSPLYNFISDRKLDLSGL  395

Query  931   ERIHISGQIDPSVKP------TYRFKSV---PAARARKP  842
              R  +SGQ+    +P      T R++S    P  + + P
Sbjct  396   ARDKVSGQVSAEFRPPRPENYTTRYQSANKSPQGQVQPP  434


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  642  WTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYI  701

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  702  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  745


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H   LY ++   ++ W +RK
Sbjct  159   PRSKPSDYREWEYAKTPPSPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGWRK  218

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+  +++ RTG++ DGCAIFW++  + 
Sbjct  219   SKLVFELSLWSADIMCLQEVDKFQDLEEEMKHRGYSAIWKMRTGNAVDGCAIFWRSNRFK  278

Query  1418  L  1416
             L
Sbjct  279   L  279



>ref|XP_010491857.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Camelina sativa]
Length=754

 Score =   122 bits (305),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 7/148 (5%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMS-SQSFLVGNIHVL  1112
             RF L+H+ESI+F + GLR+NVAQ CV +      + ++     E  + S   ++ NIHVL
Sbjct  279   RFKLVHEESIQFNQLGLRDNVAQICVLETLLTSRTKENETPPPESSAGSHRVVICNIHVL  338

Query  1111  FNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMH  932
             FNPKRGD KLGQ+R L++ A  +S+ W + P+VL GD N  PKS +Y F++  KLD+   
Sbjct  339   FNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPVVLCGDFNCTPKSHLYNFISDRKLDLSGL  398

Query  931   ERIHISGQIDPSVKP------TYRFKSV  866
              R  +SGQ     +P      T RF+S 
Sbjct  399   ARDKVSGQGSGEFRPPRPENYTTRFQSA  426


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVS-VHLLHQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  642  WTPMEIATATGDPERTTVEHALELKSTYSEVEGQANTRDENGEPVVTSYHRCFMGTVDYI  701

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAF  521
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF
Sbjct  702  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAF  745


 Score = 85.9 bits (211),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W ++   +    + FV +SYN+LA   A  H   LY ++   ++ W  RK
Sbjct  162   PRSKPSDYREWEHAKTPLPPGSEKFVVLSYNILADYLANDHWRSLYFHIPRNMLSWGSRK  221

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               L  E+  ++  IMC QEVD++ DL+  ++  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  222   SKLVFELGLWSADIMCLQEVDKFQDLEEEMKPRGYSGIWKMRTGNAVDGCAIFWRSNRFK  281

Query  1418  L  1416
             L
Sbjct  282   L  282



>ref|XP_003545500.1| PREDICTED: carbon catabolite repressor protein 4 homolog 6-like 
[Glycine max]
Length=852

 Score =   122 bits (305),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF LL++E IEF + GLR+NVAQ CV      E  N + +L S    S   +V NIHVL+
Sbjct  252   RFKLLYEECIEFNKLGLRDNVAQLCVL-----EFINQNGSLPSSLTGSSKVVVCNIHVLY  306

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NP RG+IKLGQ+R+L++ A+ +S+ W + P+ + GD N  PKS +Y F++  KLD+   +
Sbjct  307   NPNRGEIKLGQVRVLLDKAKAVSKLWNDAPVAICGDFNCTPKSPLYNFISEQKLDLSGID  366

Query  928   RIHISGQIDPSV  893
             R  +SGQ   ++
Sbjct  367   RNKVSGQASATI  378


 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 132/274 (48%), Gaps = 26/274 (9%)
 Frame = -3

Query  1267  ESIEFERFGLRNNVAQFCVFKRK----RKECSNDSNALTSEDMSSQSFLVGNIH----VL  1112
             ++IE       +  +  CVF+ +     +E  ND N     + SS S+LV  +H    + 
Sbjct  582   DNIEISSTKPSSQTSVSCVFEDEDSPSHEEIDNDQN-----NSSSTSYLVDKLHHLSNIT  636

Query  1111  FNPKR------GDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSK  950
             F P         ++    I    E+  R      N   V A DL S  KS + +   S +
Sbjct  637   FPPDMKEKSFFDEMDKTIIGGESEDGSRFVSSLHNAGEV-AFDLGSSMKSDLEKPYQSEE  695

Query  949   LDIRMHERIHI--SGQIDPSVKPTYRFKSVPAARAR-KPLMHRWTDEELRLATGTVSVHL  779
             LD   +  +    S +++  + P    +S+ + +A   P +  WT  E+  ATG      
Sbjct  696   LDSASNNLLLPVESIEMEDYLSPRQISESINSEQATYTPAL--WTPMEIETATGNADCTF  753

Query  778   L-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYIWHTAElvplrvldplpV  602
             L H L+L S Y      S TRD  GEPL TS++ +FLGTVDYIW +  L   RVL P+  
Sbjct  754   LEHPLQLRSTYTEAMDCSGTRDPHGEPLVTSYNRRFLGTVDYIWRSEGLQTTRVLAPISK  813

Query  601   NILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
             + ++ T G P+++WGSDH+ALV ELAF  +  +T
Sbjct  814   HAMQWTPGFPTKKWGSDHIALVTELAFLKDSTDT  847


 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = -2

Query  1757  DRRKW--VYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRKQILC  1587
             D R W   ++P    HC + F  +SYN+LA   A  H   LY ++   ++DW +RK+ + 
Sbjct  140   DYRDWELAWTPPPPPHC-ERFKVLSYNILADYLALDHRTKLYFHIPRHILDWQWRKRSII  198

Query  1586  KEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYDL  1416
              E+  ++  I+C QEVDR+ +L+  L+  G+ G+++ RTG+  DGCAIFW+N  + L
Sbjct  199   FELGLWSADILCLQEVDRFHELEEELKPKGYSGIWKMRTGNPVDGCAIFWRNSRFKL  255



>emb|CDX69764.1| BnaA10g21130D [Brassica napus]
Length=756

 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 1/134 (1%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCVFKRKRKECSNDSNALTSEDMSSQSFLVGNIHVLF  1109
             RF L+ +ESI+F +  LR+NVAQ CV +      + ++ A  SE  S +  +V NIHVL+
Sbjct  279   RFKLVQEESIQFNQLSLRDNVAQICVLEALLNSHAKENEASPSESCSHR-VVVCNIHVLY  337

Query  1108  NPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRMHE  929
             NPKRGD KLGQ+R L+E A  +S+ W + P+VL GD N  PKS +Y F++  KLD+    
Sbjct  338   NPKRGDFKLGQVRTLLERAHAVSKLWDDAPVVLCGDFNCTPKSHLYNFISEGKLDLSGVA  397

Query  928   RIHISGQIDPSVKP  887
             R  +SGQ    ++P
Sbjct  398   RNKVSGQESAEIRP  411


 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG      + H L+L S Y+ V G + TRD+ GEP+ TS+H  F+GTVDYI
Sbjct  644  WTPMEIAAATGDPERSTVEHALELKSTYSEVEGKANTRDENGEPVVTSYHRCFMGTVDYI  703

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAG  515
            W +  L  +RVL P+P   ++ T G P+ +WGSDH+ALV ELAF G
Sbjct  704  WRSEGLQTVRVLAPIPKQAMQWTPGFPTPKWGSDHIALVSELAFCG  749


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +   D R+W Y+    S   + FV +SYN+LA   A  H  +LY ++   ++ W +RK
Sbjct  162   PRSKPSDYREWEYAKTAPSPGTEKFVVLSYNILADYLANDHWRNLYFHIPRNMLSWGWRK  221

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
               +  E+  ++  IMC QEVD++ DL+  L+  G+ G+++ RTG++ DGCAIFW++  + 
Sbjct  222   NKIVFELGLWSADIMCLQEVDKFQDLEEELKLRGYSGIWKMRTGNAVDGCAIFWRSNRFK  281

Query  1418  L  1416
             L
Sbjct  282   L  282



>ref|XP_007225253.1| hypothetical protein PRUPE_ppa001585mg [Prunus persica]
 gb|EMJ26452.1| hypothetical protein PRUPE_ppa001585mg [Prunus persica]
Length=797

 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  1288  RFTLLHKESIEFERFGLRNNVAQFCV--FKRKRKECSNDSNALTSEDMSSQSFLVGNIHV  1115
             RF L+H+E IEF + GLR+NVAQ CV  F     +C+     L      S   ++ NIHV
Sbjct  202   RFKLIHEECIEFSKLGLRDNVAQICVLEFFLLNSQCAR-PKILQFYQEGSNKVVICNIHV  260

Query  1114  LFNPKRGDIKLGQIRLLVENAQRLSQEWGNIPIVLAGDLNSMPKSAVYQFLTSSKLDIRM  935
             L+NPKRG+IKLGQ+R+L++ A  +S+ W + PIVL GD N  PKS +Y F++  KLD+  
Sbjct  261   LYNPKRGEIKLGQVRVLLDRAHAISKIWNDAPIVLCGDFNCTPKSPLYNFISEQKLDLSG  320

Query  934   HERIHISGQ  908
              +R  +SGQ
Sbjct  321   VDRDKVSGQ  329


 Score = 95.5 bits (236),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = -2

Query  1775  PPANTVDRRKWVYSPRDVSHCKDGFVFVSYNLLAVENAKKH-PDLYPNVLPELMDWDYRK  1599
             P +  +D R W ++    S   D F  +SYN+LA   A +H   LY ++   +MDW +RK
Sbjct  85    PSSAPLDYRNWEFAKTTPSSTCDRFTVLSYNILADSLAHEHRSKLYFHIPHHMMDWQWRK  144

Query  1598  QILCKEIRGYNPGIMCFQEVDRYDDLDNLLQKDGFRGVYQPRTGDSCDGCAIFWKNELYD  1419
             + L  E+  ++  IMCFQEVD++ D++  L+  G+ G+++ RTG+  DGCAIFW++  + 
Sbjct  145   KNLIFELGLWSADIMCFQEVDKFQDIEEELKLKGYNGIWKMRTGNPVDGCAIFWRSSRFK  204

Query  1418  L  1416
             L
Sbjct  205   L  205


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 1/111 (1%)
 Frame = -3

Query  829  WTDEELRLATGTVSVHLL-HQLKLCSAYAGVPGTSKTRDDLGEPLATSFHSKFLGTVDYI  653
            WT  E+  ATG     LL H LKL S Y  V   +  RD  GEPL TS++  FLGTVDYI
Sbjct  687  WTPMEIEAATGNSECTLLEHPLKLRSTYTEVEDCAGARDSNGEPLVTSYNRCFLGTVDYI  746

Query  652  WHTAElvplrvldplpVNILRRTRGLPSEEWGSDHLALVCELAFAGEGDET  500
            W +  L  +RVL P+P + ++ T G P+++WGSDH+AL  ELAF    D++
Sbjct  747  WRSQGLQTVRVLAPIPKHAMQWTSGFPTKKWGSDHIALASELAFVNSFDQS  797



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6341621592896