BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23097_g2_i1 len=245 path=[665:0-244]

Length=245
                                                                      Score     E

ref|XP_009789793.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    147   9e-40   
ref|XP_009631058.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    145   3e-39   
ref|XP_009781717.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    145   5e-39   
ref|XP_004251043.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    144   7e-39   
ref|XP_006349115.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    144   7e-39   
gb|EPS58786.1|  hypothetical protein M569_16027                         143   9e-39   
ref|XP_011090359.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    144   1e-38   
ref|XP_009611540.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    143   3e-38   
gb|EYU36959.1|  hypothetical protein MIMGU_mgv1a0177801mg               142   4e-38   
gb|EYU36081.1|  hypothetical protein MIMGU_mgv1a0090081mg               140   4e-38   
gb|EYU36080.1|  hypothetical protein MIMGU_mgv1a0090081mg               140   4e-38   
ref|XP_010031500.1|  PREDICTED: fatty acyl-CoA reductase 3              142   5e-38   
ref|XP_011088872.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    140   2e-37   
ref|XP_011088871.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    139   4e-37   
emb|CDP06945.1|  unnamed protein product                                139   8e-37   
gb|KDP42371.1|  hypothetical protein JCGZ_01947                         138   1e-36   
gb|ADK66305.1|  gland-specific fatty acyl-CoA reductase 1               138   1e-36   
ref|XP_008458592.1|  PREDICTED: fatty acyl-CoA reductase 3-like         138   1e-36   
ref|XP_006387898.1|  hypothetical protein POPTR_0490s00200g             134   2e-36   
ref|XP_004166245.1|  PREDICTED: fatty acyl-CoA reductase 3-like         138   2e-36   
ref|XP_004145801.1|  PREDICTED: fatty acyl-CoA reductase 3-like         137   3e-36   
ref|XP_002523778.1|  oxidoreductase, putative                           135   7e-36   Ricinus communis
ref|XP_008462137.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    135   1e-35   
ref|XP_008462145.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    135   1e-35   
ref|XP_008458693.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    135   1e-35   
ref|XP_004139568.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    135   1e-35   
ref|XP_002313668.2|  hypothetical protein POPTR_0009s14720g             135   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010271727.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    135   1e-35   
ref|XP_002263127.1|  PREDICTED: fatty acyl-CoA reductase 3              135   2e-35   Vitis vinifera
ref|XP_010244271.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    135   2e-35   
ref|XP_007015865.1|  Jojoba acyl CoA reductase-related male steri...    134   4e-35   
ref|XP_004161427.1|  PREDICTED: fatty acyl-CoA reductase 3-like         134   4e-35   
ref|XP_006290474.1|  hypothetical protein CARUB_v100190921mg            132   4e-35   
ref|XP_010089855.1|  Fatty acyl-CoA reductase 3                         134   4e-35   
ref|XP_006347238.1|  PREDICTED: fatty acyl-CoA reductase 3-like         134   5e-35   
emb|CDY48435.1|  BnaA08g11440D                                          133   6e-35   
ref|XP_010271729.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    133   6e-35   
ref|XP_010271730.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    133   7e-35   
ref|XP_010271728.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    133   8e-35   
emb|CDY28321.1|  BnaC03g66380D                                          133   1e-34   
ref|XP_009108773.1|  PREDICTED: fatty acyl-CoA reductase 3-like         132   1e-34   
ref|XP_007015863.1|  Jojoba acyl CoA reductase-related male steri...    132   1e-34   
ref|XP_010045241.1|  PREDICTED: fatty acyl-CoA reductase 3-like         132   2e-34   
ref|XP_008378269.1|  PREDICTED: fatty acyl-CoA reductase 3-like         129   2e-34   
gb|AFK47309.1|  unknown                                                 131   3e-34   
ref|XP_006279378.1|  hypothetical protein CARUB_v10007996mg             131   3e-34   
ref|XP_009405296.1|  PREDICTED: probable fatty acyl-CoA reductase 4     131   4e-34   
ref|XP_002305561.2|  hypothetical protein POPTR_0004s19580g             131   5e-34   Populus trichocarpa [western balsam poplar]
emb|CDY35688.1|  BnaC02g09540D                                          131   5e-34   
ref|XP_007205116.1|  hypothetical protein PRUPE_ppa004817mg             130   6e-34   
ref|XP_010425870.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    130   6e-34   
ref|XP_010514781.1|  PREDICTED: fatty acyl-CoA reductase 3-like         130   7e-34   
ref|XP_010503101.1|  PREDICTED: fatty acyl-CoA reductase 3-like         130   7e-34   
ref|XP_011044886.1|  PREDICTED: fatty acyl-CoA reductase 3-like         129   8e-34   
ref|XP_011044880.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    130   8e-34   
ref|XP_011046268.1|  PREDICTED: fatty acyl-CoA reductase 3-like         130   8e-34   
ref|XP_011090360.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    130   9e-34   
ref|XP_009364297.1|  PREDICTED: fatty acyl-CoA reductase 3-like         130   1e-33   
ref|XP_010425869.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    130   1e-33   
ref|XP_008801227.1|  PREDICTED: probable fatty acyl-CoA reductase 4     129   1e-33   
ref|XP_003606153.1|  Fatty acyl-CoA reductase                           128   2e-33   
emb|CAN81280.1|  hypothetical protein VITISV_041831                     129   2e-33   Vitis vinifera
gb|AFK38315.1|  unknown                                                 129   2e-33   
ref|XP_004241314.1|  PREDICTED: fatty acyl-CoA reductase 3              129   2e-33   
ref|XP_008228911.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    129   2e-33   
ref|XP_007206366.1|  hypothetical protein PRUPE_ppa017843mg             129   2e-33   
emb|CDY09144.1|  BnaA02g05700D                                          129   3e-33   
ref|XP_003606163.1|  Fatty acyl-CoA reductase                           129   3e-33   
ref|XP_009126546.1|  PREDICTED: fatty acyl-CoA reductase 1-like         129   3e-33   
ref|XP_010651912.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    128   3e-33   
gb|KGN46944.1|  hypothetical protein Csa_6G151810                       128   4e-33   
ref|XP_008357549.1|  PREDICTED: fatty acyl-CoA reductase 3-like         125   4e-33   
ref|XP_007020558.1|  Fatty acid reductase 4                             128   4e-33   
gb|KEH29873.1|  gland-specific fatty acyl-CoA reductase                 128   4e-33   
ref|XP_002263184.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    128   4e-33   Vitis vinifera
ref|XP_004515386.1|  PREDICTED: fatty acyl-CoA reductase 3-like         128   5e-33   
ref|XP_002313667.2|  acyl CoA reductase family protein                  128   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007132412.1|  hypothetical protein PHAVU_011G092500g             127   8e-33   
ref|XP_009119230.1|  PREDICTED: fatty acyl-CoA reductase 3              127   9e-33   
ref|XP_004291620.1|  PREDICTED: fatty acyl-CoA reductase 3-like         127   1e-32   
ref|XP_006412311.1|  hypothetical protein EUTSA_v10025005mg             127   1e-32   
gb|AID60102.1|  alcohol-forming fatty acyl-CoA reductase                127   1e-32   
ref|NP_001030809.1|  fatty acyl-CoA reductase 4                         127   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432512.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    127   1e-32   
ref|XP_004506277.1|  PREDICTED: fatty acyl-CoA reductase 3-like         127   1e-32   
gb|KDP42364.1|  hypothetical protein JCGZ_01940                         127   1e-32   
ref|XP_010447195.1|  PREDICTED: fatty acyl-CoA reductase 3-like         127   1e-32   
ref|XP_009376588.1|  PREDICTED: fatty acyl-CoA reductase 3-like         127   1e-32   
gb|AIE57506.1|  CER4                                                    127   2e-32   
ref|XP_009338685.1|  PREDICTED: fatty acyl-CoA reductase 3-like         127   2e-32   
ref|XP_010535678.1|  PREDICTED: fatty acyl-CoA reductase 3-like         127   2e-32   
ref|XP_010686043.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    127   2e-32   
ref|XP_010943712.1|  PREDICTED: probable fatty acyl-CoA reductase 4     126   2e-32   
gb|KFK30008.1|  hypothetical protein AALP_AA7G205800                    126   2e-32   
ref|XP_006283617.1|  hypothetical protein CARUB_v10004673mg             126   3e-32   
gb|AEV53412.1|  fatty acyl-CoA reductase 3                              126   3e-32   
ref|XP_002867157.1|  predicted protein                                  126   3e-32   
ref|XP_003539173.1|  PREDICTED: fatty acyl-CoA reductase 3-like         125   4e-32   
ref|XP_003539817.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    125   4e-32   
ref|XP_006487974.1|  PREDICTED: fatty acyl-CoA reductase 3-like         125   4e-32   
ref|XP_006400757.1|  hypothetical protein EUTSA_v10013355mg             125   6e-32   
emb|CDX69007.1|  BnaC01g04460D                                          125   6e-32   
ref|XP_004487511.1|  PREDICTED: fatty acyl-CoA reductase 3-like         125   7e-32   
ref|XP_011088867.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    124   8e-32   
ref|XP_004145802.1|  PREDICTED: fatty acyl-CoA reductase 3-like         124   9e-32   
ref|NP_190040.3|  fatty acyl-CoA reductase 4                            124   9e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KHN38645.1|  Fatty acyl-CoA reductase 3                              124   1e-31   
ref|XP_006591085.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    124   1e-31   
ref|NP_567936.5|  fatty acyl-CoA reductase CER4                         124   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AES88411.2|  gland-specific fatty acyl-CoA reductase                 124   1e-31   
emb|CAA20592.1|  male sterility 2-like protein                          124   1e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CAB80096.1|  male sterility 2-like protein                          124   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875671.1|  oxidoreductase, acting on the CH-CH group of...    124   1e-31   
ref|XP_004171145.1|  PREDICTED: fatty acyl-CoA reductase 3-like         124   1e-31   
ref|XP_002529056.1|  Male sterility protein, putative                   124   1e-31   Ricinus communis
ref|XP_011088866.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    124   1e-31   
ref|XP_008229411.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    126   2e-31   
ref|XP_002872001.1|  hypothetical protein ARALYDRAFT_489098             122   2e-31   
ref|XP_002875662.1|  predicted protein                                  124   2e-31   
gb|KDO58051.1|  hypothetical protein CISIN_1g037479mg                   124   2e-31   
gb|KFK39898.1|  hypothetical protein AALP_AA3G303100                    124   2e-31   
ref|XP_006291287.1|  hypothetical protein CARUB_v10017423mg             122   2e-31   
ref|XP_006349114.1|  PREDICTED: fatty acyl-CoA reductase 1-like         123   3e-31   
ref|XP_008352400.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    122   3e-31   
ref|XP_007150088.1|  hypothetical protein PHAVU_005G125500g             123   3e-31   
ref|XP_011044902.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    123   3e-31   
ref|XP_008458594.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    122   4e-31   
ref|XP_010514784.1|  PREDICTED: probable fatty acyl-CoA reductase...    122   4e-31   
emb|CDY26934.1|  BnaC09g36490D                                          123   4e-31   
ref|XP_006419126.1|  hypothetical protein EUTSA_v10002497mg             123   4e-31   
emb|CDY30935.1|  BnaA06g19780D                                          122   4e-31   
ref|NP_197642.1|  fatty acyl-CoA reductase 1                            122   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872004.1|  hypothetical protein ARALYDRAFT_910242             122   4e-31   
ref|XP_009364295.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    122   5e-31   
ref|XP_008458595.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    122   5e-31   
ref|XP_009150272.1|  PREDICTED: probable fatty acyl-CoA reductase 4     122   5e-31   
ref|XP_004291621.1|  PREDICTED: fatty acyl-CoA reductase 1-like         122   5e-31   
ref|XP_009762890.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    120   6e-31   
emb|CDX92346.1|  BnaA10g13850D                                          122   8e-31   
ref|XP_009120651.1|  PREDICTED: fatty acyl-CoA reductase 1              122   8e-31   
ref|XP_007205112.1|  hypothetical protein PRUPE_ppa004772mg             122   9e-31   
gb|KFK39899.1|  hypothetical protein AALP_AA3G303200                    122   9e-31   
ref|XP_007150087.1|  hypothetical protein PHAVU_005G125400g             122   9e-31   
ref|XP_006279379.1|  hypothetical protein CARUB_v10007997mg             121   9e-31   
emb|CDY21232.1|  BnaC03g53920D                                          122   9e-31   
gb|AAR88762.1|  acyl CoA reductase                                      121   9e-31   Hevea brasiliensis [jebe]
ref|XP_007208215.1|  hypothetical protein PRUPE_ppa018909mg             122   1e-30   
ref|XP_009364296.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    121   1e-30   
ref|XP_010248281.1|  PREDICTED: fatty acyl-CoA reductase 2-like         120   1e-30   
gb|KFK33883.1|  hypothetical protein AALP_AA5G072700                    121   1e-30   
ref|XP_008378258.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    120   1e-30   
ref|XP_010514783.1|  PREDICTED: probable fatty acyl-CoA reductase...    121   1e-30   
ref|XP_008353939.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    121   1e-30   
ref|XP_002523777.1|  Male sterility protein, putative                   121   2e-30   Ricinus communis
emb|CDP06949.1|  unnamed protein product                                120   2e-30   
ref|XP_010535677.1|  PREDICTED: fatty acyl-CoA reductase 1-like         121   2e-30   
ref|XP_010493325.1|  PREDICTED: putative fatty acyl-CoA reductase 7     121   2e-30   
ref|XP_008245932.1|  PREDICTED: fatty acyl-CoA reductase 3-like         119   2e-30   
ref|XP_002305562.1|  hypothetical protein POPTR_0004s19600g             120   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006419124.1|  hypothetical protein EUTSA_v10002499mg             120   3e-30   
ref|NP_197634.1|  putative fatty acyl-CoA reductase 7                   119   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020559.1|  Fatty acid reductase 4                             120   4e-30   
ref|XP_006279365.1|  hypothetical protein CARUB_v10007993mg             120   4e-30   
sp|Q9XGY7.1|FAR_SIMCH  RecName: Full=Alcohol-forming fatty acyl-C...    120   4e-30   Simmondsia chinensis [goatnut]
ref|XP_010454504.1|  PREDICTED: putative fatty acyl-CoA reductase 7     119   5e-30   
ref|XP_003596783.1|  Fatty acyl-CoA reductase                           119   6e-30   
ref|XP_009419426.1|  PREDICTED: probable fatty acyl-CoA reductase 4     119   6e-30   
ref|XP_009373003.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    119   7e-30   
ref|XP_004506152.1|  PREDICTED: fatty acyl-CoA reductase 3-like         119   7e-30   
ref|XP_006290972.1|  hypothetical protein CARUB_v10017087mg             119   7e-30   
ref|XP_010421031.1|  PREDICTED: putative fatty acyl-CoA reductase 7     119   7e-30   
gb|AES98766.2|  gland-specific fatty acyl-CoA reductase                 119   8e-30   
ref|XP_006851509.1|  hypothetical protein AMTR_s00040p00158690          119   8e-30   
ref|XP_011005173.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    119   9e-30   
ref|XP_006349112.1|  PREDICTED: probable fatty acyl-CoA reductase...    118   9e-30   
ref|XP_003615808.1|  Fatty acyl-CoA reductase                           119   9e-30   
gb|AES88362.2|  gland-specific fatty acyl-CoA reductase                 119   9e-30   
ref|XP_009610474.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    119   1e-29   
ref|XP_010255716.1|  PREDICTED: fatty acyl-CoA reductase 3-like         119   1e-29   
ref|XP_006349136.1|  PREDICTED: fatty acyl-CoA reductase 3-like         119   1e-29   
ref|XP_009610473.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    119   1e-29   
ref|XP_006419122.1|  hypothetical protein EUTSA_v10002495mg             119   1e-29   
gb|EMT08796.1|  Fatty acyl-CoA reductase 1                              118   1e-29   
ref|XP_008228906.1|  PREDICTED: fatty acyl-CoA reductase 3-like         118   1e-29   
ref|XP_003538130.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    118   2e-29   
gb|KHN38647.1|  Fatty acyl-CoA reductase 3                              118   2e-29   
ref|XP_006371441.1|  hypothetical protein POPTR_0019s10400g             117   2e-29   
ref|XP_010503104.1|  PREDICTED: probable fatty acyl-CoA reductase...    118   2e-29   
ref|XP_006287458.1|  hypothetical protein CARUB_v10000664mg             119   2e-29   
ref|XP_007020562.1|  Fatty acid reductase 4                             118   2e-29   
ref|XP_010425873.1|  PREDICTED: probable fatty acyl-CoA reductase...    118   2e-29   
ref|XP_009785725.1|  PREDICTED: fatty acyl-CoA reductase 3-like         118   2e-29   
ref|XP_006591086.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    118   2e-29   
ref|XP_006419123.1|  hypothetical protein EUTSA_v10002495mg             117   2e-29   
gb|AIZ97193.1|  fatty acyl-coenzyme A reductase                         118   3e-29   
ref|XP_011005175.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    117   3e-29   
ref|XP_011005176.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    117   3e-29   
ref|XP_009419498.1|  PREDICTED: probable fatty acyl-CoA reductase 4     116   3e-29   
ref|XP_010520424.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    117   3e-29   
ref|XP_010520425.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    117   3e-29   
ref|XP_006349134.1|  PREDICTED: fatty acyl-CoA reductase 1-like         117   3e-29   
ref|XP_007132408.1|  hypothetical protein PHAVU_011G092300g             117   3e-29   
ref|XP_011005174.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    117   3e-29   
ref|XP_010520422.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    117   3e-29   
ref|XP_010520423.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    117   3e-29   
ref|XP_007132410.1|  hypothetical protein PHAVU_011G092400g             117   4e-29   
gb|AFK38475.1|  unknown                                                 115   4e-29   
ref|XP_010454514.1|  PREDICTED: fatty acyl-CoA reductase 1-like         117   4e-29   
ref|XP_007132411.1|  hypothetical protein PHAVU_011G092400g             117   4e-29   
ref|XP_010493337.1|  PREDICTED: fatty acyl-CoA reductase 1              117   4e-29   
ref|XP_002875673.1|  oxidoreductase, acting on the CH-CH group of...    117   4e-29   
ref|XP_010326151.1|  PREDICTED: fatty acyl-CoA reductase 2-like         117   5e-29   
ref|XP_010503102.1|  PREDICTED: probable fatty acyl-CoA reductase...    117   5e-29   
emb|CAB88538.1|  acyl CoA reductase-like protein                        117   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543433.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    117   5e-29   
ref|XP_003615809.1|  Fatty acyl-CoA reductase                           115   5e-29   
ref|XP_011015001.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    114   6e-29   
ref|XP_010503103.1|  PREDICTED: probable fatty acyl-CoA reductase...    117   7e-29   
ref|XP_010425872.1|  PREDICTED: probable fatty acyl-CoA reductase...    116   8e-29   
emb|CAB88537.1|  acyl CoA reductase-like protein                        115   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786820.1|  PREDICTED: probable fatty acyl-CoA reductase 4     112   8e-29   
ref|XP_003540237.1|  PREDICTED: fatty acyl-CoA reductase 3-like         116   9e-29   
ref|XP_006371440.1|  hypothetical protein POPTR_0019s10390g             116   9e-29   
ref|XP_009610475.1|  PREDICTED: fatty acyl-CoA reductase 3-like         116   9e-29   
ref|NP_190041.2|  fatty acyl-CoA reductase 5                            116   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111080.1|  Fatty acyl-CoA reductase 1                         118   1e-28   
ref|XP_010313341.1|  PREDICTED: fatty acyl-CoA reductase 3-like i...    115   1e-28   
gb|ABK23559.1|  unknown                                                 114   1e-28   Picea sitchensis
gb|AFK33782.1|  unknown                                                 115   2e-28   
ref|XP_010314793.1|  PREDICTED: fatty acyl-CoA reductase 3-like         115   2e-28   
gb|KHN21439.1|  Fatty acyl-CoA reductase 3                              115   2e-28   
ref|XP_011090362.1|  PREDICTED: fatty acyl-CoA reductase 3-like         115   2e-28   
ref|XP_006586435.1|  PREDICTED: probable fatty acyl-CoA reductase...    115   2e-28   
gb|KHN27659.1|  Fatty acyl-CoA reductase 3                              112   2e-28   
ref|XP_010687363.1|  PREDICTED: fatty acyl-CoA reductase 3-like         115   2e-28   
ref|XP_006851510.1|  hypothetical protein AMTR_s00040p00161230          114   3e-28   
ref|NP_190042.2|  fatty acyl-CoA reductase 8                            115   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28586.1|  unknown                                                 115   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540238.1|  PREDICTED: fatty acyl-CoA reductase 3-like         115   3e-28   
ref|XP_010109930.1|  Fatty acyl-CoA reductase 1                         115   3e-28   
ref|XP_010430959.1|  PREDICTED: probable fatty acyl-CoA reductase 5     114   3e-28   
gb|KCW58563.1|  hypothetical protein EUGRSUZ_H01219                     114   3e-28   
emb|CDP14283.1|  unnamed protein product                                114   3e-28   
ref|XP_004487512.1|  PREDICTED: fatty acyl-CoA reductase 3-like         114   4e-28   
gb|AEQ33639.1|  male sterility protein 2                                112   4e-28   
ref|XP_010503105.1|  PREDICTED: probable fatty acyl-CoA reductase 5     114   4e-28   
ref|XP_010514782.1|  PREDICTED: probable fatty acyl-CoA reductase 5     114   4e-28   
ref|XP_003573673.1|  PREDICTED: fatty acyl-CoA reductase 1-like         114   4e-28   
ref|XP_004241312.1|  PREDICTED: probable fatty acyl-CoA reductase...    114   5e-28   
ref|XP_010070011.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    112   5e-28   
gb|KHN38171.1|  Putative fatty acyl-CoA reductase 5                     114   5e-28   
emb|CDX99193.1|  BnaA06g18840D                                          114   5e-28   
ref|XP_010070012.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    112   5e-28   
ref|XP_009150309.1|  PREDICTED: probable fatty acyl-CoA reductase 5     114   5e-28   
ref|XP_003543435.1|  PREDICTED: fatty acyl-CoA reductase 3-like         114   5e-28   
ref|XP_007048737.1|  Jojoba acyl CoA reductase-related male steri...    115   6e-28   
emb|CDY08707.1|  BnaC03g54750D                                          114   6e-28   
ref|XP_002449116.1|  hypothetical protein SORBIDRAFT_05g005340          114   7e-28   Sorghum bicolor [broomcorn]
gb|AHA15849.1|  male sterility protein 2                                115   8e-28   
ref|XP_008241158.1|  PREDICTED: fatty acyl-CoA reductase 2              115   8e-28   
ref|XP_007132904.1|  hypothetical protein PHAVU_011G134800g             114   9e-28   
ref|XP_009131879.1|  PREDICTED: putative fatty acyl-CoA reductase...    113   9e-28   
ref|XP_009769707.1|  PREDICTED: fatty acyl-CoA reductase 2              114   1e-27   
gb|AES67032.2|  gland-specific fatty acyl-CoA reductase                 113   1e-27   
ref|XP_009590583.1|  PREDICTED: fatty acyl-CoA reductase 2              114   1e-27   
ref|XP_003619032.1|  Fatty acyl-CoA reductase                           112   1e-27   
ref|XP_009131878.1|  PREDICTED: putative fatty acyl-CoA reductase...    113   1e-27   
gb|KFK23136.1|  hypothetical protein AALP_AAs65178U000500               113   1e-27   
gb|AFB77197.1|  male sterility protein 2                                114   1e-27   
ref|XP_010687495.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    113   1e-27   
ref|XP_002875672.1|  oxidoreductase, acting on the CH-CH group of...    113   1e-27   
ref|XP_002534422.1|  Male sterility protein, putative                   112   1e-27   Ricinus communis
dbj|BAH56968.1|  AT3G44540                                              110   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228881.1|  PREDICTED: fatty acyl-CoA reductase 3-like         113   1e-27   
emb|CDY35684.1|  BnaC02g09500D                                          112   1e-27   
ref|XP_008228895.1|  PREDICTED: fatty acyl-CoA reductase 3-like         113   1e-27   
ref|XP_004234754.1|  PREDICTED: fatty acyl-CoA reductase 2              114   1e-27   
ref|XP_006349384.1|  PREDICTED: fatty acyl-CoA reductase 3-like         113   2e-27   
ref|XP_006347258.1|  PREDICTED: fatty acyl-CoA reductase 3-like         113   2e-27   
ref|XP_006279387.1|  hypothetical protein CARUB_v10008006mg             113   2e-27   
ref|XP_010498380.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    113   2e-27   
ref|XP_004291622.1|  PREDICTED: fatty acyl-CoA reductase 3-like         113   2e-27   
ref|XP_004251041.1|  PREDICTED: probable fatty acyl-CoA reductase 4     113   2e-27   
ref|XP_004974193.1|  PREDICTED: fatty acyl-CoA reductase 1-like         113   2e-27   
ref|XP_006360607.1|  PREDICTED: fatty acyl-CoA reductase 2-like         114   2e-27   
gb|AFW65446.1|  hypothetical protein ZEAMMB73_799465                    112   2e-27   
ref|XP_003535102.1|  PREDICTED: fatty acyl-CoA reductase 2-like         113   2e-27   
ref|XP_004974195.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    112   2e-27   
ref|XP_010498364.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    114   2e-27   
gb|KHN43996.1|  Fatty acyl-CoA reductase 2                              113   3e-27   
ref|XP_003606214.1|  Fatty acyl-CoA reductase                           111   3e-27   
ref|XP_009120662.1|  PREDICTED: putative fatty acyl-CoA reductase 7     112   3e-27   
ref|XP_007145718.1|  hypothetical protein PHAVU_007G262300g             113   3e-27   
gb|KFK33885.1|  hypothetical protein AALP_AA5G072900                    112   3e-27   
ref|XP_004974194.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    112   3e-27   
gb|EMT11633.1|  Fatty acyl-CoA reductase 1                              112   3e-27   
ref|XP_009620478.1|  PREDICTED: fatty acyl-CoA reductase 3-like         111   3e-27   
emb|CDX92353.1|  BnaA10g13920D                                          112   3e-27   
gb|EYU36082.1|  hypothetical protein MIMGU_mgv1a004946mg                112   3e-27   
gb|AES75250.2|  fatty acyl-CoA reductase                                110   4e-27   
ref|XP_003520320.1|  PREDICTED: fatty acyl-CoA reductase 2-like         113   4e-27   
ref|XP_010041357.1|  PREDICTED: probable fatty acyl-CoA reductase 4     111   4e-27   
gb|EEC83314.1|  hypothetical protein OsI_28691                          112   4e-27   
dbj|BAH01371.1|  unnamed protein product                                112   4e-27   
gb|KHN00025.1|  Fatty acyl-CoA reductase 2                              113   4e-27   
ref|XP_009419621.1|  PREDICTED: fatty acyl-CoA reductase 3-like         112   4e-27   
gb|EYU39978.1|  hypothetical protein MIMGU_mgv1a020686mg                111   5e-27   
gb|KCW58570.1|  hypothetical protein EUGRSUZ_H01227                     111   5e-27   
ref|XP_006299443.1|  hypothetical protein CARUB_v10015607mg             113   5e-27   
ref|XP_010520001.1|  PREDICTED: fatty acyl-CoA reductase 2-like         113   5e-27   
gb|KCW44418.1|  hypothetical protein EUGRSUZ_L02093                     111   5e-27   
gb|KCW58994.1|  hypothetical protein EUGRSUZ_H01618                     111   5e-27   
ref|XP_004514155.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    112   5e-27   
dbj|BAD31814.1|  putative fatty acyl coA reductase                      112   5e-27   
ref|XP_009146656.1|  PREDICTED: fatty acyl-CoA reductase 2-like         112   5e-27   
ref|XP_004514156.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    112   5e-27   
ref|NP_187805.1|  fatty acyl-CoA reductase 2                            112   6e-27   
gb|AFW65447.1|  male sterility protein 2                                111   6e-27   
ref|XP_002445692.1|  hypothetical protein SORBIDRAFT_07g024290          111   6e-27   
emb|CAA52019.1|  male sterility 2 (MS2) protein                         112   6e-27   
ref|XP_002882759.1|  hypothetical protein ARALYDRAFT_478549             112   6e-27   
ref|XP_006407385.1|  hypothetical protein EUTSA_v10020305mg             112   6e-27   
gb|EYU20678.1|  hypothetical protein MIMGU_mgv1a003493mg                112   6e-27   
ref|XP_007204810.1|  hypothetical protein PRUPE_ppa026306mg             112   6e-27   
emb|CDY08472.1|  BnaA05g27080D                                          112   6e-27   
ref|NP_001151388.1|  male sterility protein 2                           111   7e-27   
emb|CDY01079.1|  BnaC05g41210D                                          112   7e-27   
gb|KCW58991.1|  hypothetical protein EUGRSUZ_H01615                     110   7e-27   
ref|XP_010464945.1|  PREDICTED: fatty acyl-CoA reductase 2-like         112   7e-27   
ref|XP_009121004.1|  PREDICTED: fatty acyl-CoA reductase 2              112   8e-27   
ref|XP_003578640.1|  PREDICTED: fatty acyl-CoA reductase 1-like         111   8e-27   
gb|AAZ06658.1|  male sterility protein 2-2                              112   9e-27   
emb|CAA68190.1|  male sterility protein 2                               112   9e-27   
gb|ACA28679.1|  male sterility-related protein                          111   1e-26   
gb|AAQ81302.2|  male sterility protein 2-1 mutant                       112   1e-26   
gb|EYU36638.1|  hypothetical protein MIMGU_mgv1a004191mg                111   1e-26   
ref|XP_011078802.1|  PREDICTED: fatty acyl-CoA reductase 2              111   1e-26   
gb|ABR18362.1|  unknown                                                 110   2e-26   
gb|KEH41771.1|  fatty acyl-CoA reductase-like protein                   111   2e-26   
ref|XP_006361195.1|  PREDICTED: fatty acyl-CoA reductase 2-like         108   2e-26   
emb|CDX98566.1|  BnaC05g38090D                                          110   2e-26   
ref|XP_009391351.1|  PREDICTED: fatty acyl-CoA reductase 2              110   2e-26   
ref|XP_001771307.1|  predicted protein                                  110   2e-26   
ref|XP_011089202.1|  PREDICTED: fatty acyl-CoA reductase 3-like         110   2e-26   
gb|EMT24985.1|  Fatty acyl-CoA reductase 1                              110   2e-26   
emb|CDY65611.1|  BnaCnng47950D                                          110   2e-26   
ref|XP_011089201.1|  PREDICTED: fatty acyl-CoA reductase 3-like         110   2e-26   
ref|XP_004172368.1|  PREDICTED: fatty acyl-CoA reductase 2-like         108   3e-26   
emb|CDY65772.1|  BnaCnng48640D                                          108   3e-26   
ref|XP_006481697.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    110   3e-26   
ref|XP_006492917.1|  PREDICTED: fatty acyl-CoA reductase 2-like         109   3e-26   
ref|XP_006429946.1|  hypothetical protein CICLE_v10011332mg             110   3e-26   
gb|KCW58995.1|  hypothetical protein EUGRSUZ_H01619                     109   4e-26   
ref|XP_006481696.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    110   4e-26   
ref|XP_006400746.1|  hypothetical protein EUTSA_v10015841mg             109   4e-26   
ref|XP_004295749.1|  PREDICTED: probable fatty acyl-CoA reductase...    109   4e-26   
ref|XP_003578641.1|  PREDICTED: putative fatty acyl-CoA reductase 7     108   5e-26   
ref|XP_002443047.1|  hypothetical protein SORBIDRAFT_08g006870          108   5e-26   
gb|EMS63229.1|  Fatty acyl-CoA reductase 1                              110   5e-26   
ref|XP_002323348.2|  Male sterility protein 2                           110   5e-26   
ref|XP_008458694.1|  PREDICTED: fatty acyl-CoA reductase 3-like         107   5e-26   
ref|XP_010520426.1|  PREDICTED: fatty acyl-CoA reductase 3-like         108   6e-26   
ref|XP_011039510.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    109   6e-26   
ref|XP_002308347.2|  Male sterility protein 2                           109   7e-26   
ref|XP_010557956.1|  PREDICTED: fatty acyl-CoA reductase 2-like         109   7e-26   
gb|KHG30561.1|  Fatty acyl-CoA reductase 2                              109   7e-26   
ref|XP_009104015.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    109   7e-26   
gb|EMT11621.1|  Fatty acyl-CoA reductase 1                              108   7e-26   
ref|XP_008382348.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    107   8e-26   
gb|KHG30562.1|  Fatty acyl-CoA reductase 2                              109   8e-26   
ref|XP_002449115.1|  hypothetical protein SORBIDRAFT_05g005330          108   8e-26   
ref|XP_011039509.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    109   9e-26   
gb|EMS54669.1|  Fatty acyl-CoA reductase 1                              108   9e-26   
ref|XP_010101094.1|  Fatty acyl-CoA reductase 2                         109   9e-26   
ref|XP_009104016.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    108   9e-26   
ref|XP_006341241.1|  PREDICTED: fatty acyl-CoA reductase 2-like         107   9e-26   
ref|XP_010673235.1|  PREDICTED: fatty acyl-CoA reductase 2              109   9e-26   
ref|XP_009335888.1|  PREDICTED: fatty acyl-CoA reductase 2              109   9e-26   
ref|XP_008371142.1|  PREDICTED: fatty acyl-CoA reductase 2              109   9e-26   
emb|CDX67654.1|  BnaA07g16940D                                          108   1e-25   
ref|XP_007029101.1|  Jojoba acyl CoA reductase-related male steri...    109   1e-25   
gb|KCW58564.1|  hypothetical protein EUGRSUZ_H01220                     107   1e-25   
gb|EMS57501.1|  putative fatty acyl-CoA reductase 5                     108   1e-25   
gb|EEE58391.1|  hypothetical protein OsJ_09553                          107   1e-25   
gb|KGN46942.1|  hypothetical protein Csa_6G151790                       107   1e-25   
gb|EMS62412.1|  putative fatty acyl-CoA reductase 5                     107   1e-25   
ref|XP_006487981.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    108   1e-25   
ref|XP_006341246.1|  PREDICTED: fatty acyl-CoA reductase 2-like         106   1e-25   
gb|EYU36076.1|  hypothetical protein MIMGU_mgv1a004914mg                107   2e-25   
gb|AHJ37516.1|  fatty acyl-CoA reductase 2-like protein                 108   2e-25   
dbj|BAK04658.1|  predicted protein                                      107   2e-25   
gb|KDO39574.1|  hypothetical protein CISIN_1g0083242mg                  104   2e-25   
gb|EMS46840.1|  putative fatty acyl-CoA reductase 4                     107   2e-25   
ref|XP_003606165.1|  Fatty acyl-CoA reductase                           106   2e-25   
ref|XP_007029099.1|  Jojoba acyl CoA reductase-related male steri...    108   2e-25   
ref|XP_002276588.1|  PREDICTED: fatty acyl-CoA reductase 2              108   2e-25   
gb|EMT00454.1|  Fatty acyl-CoA reductase 1                              107   2e-25   
ref|XP_004305541.1|  PREDICTED: fatty acyl-CoA reductase 2-like         108   2e-25   
ref|XP_006429860.1|  hypothetical protein CICLE_v10011477mg             106   2e-25   
gb|EMS67879.1|  putative fatty acyl-CoA reductase 4                     107   3e-25   
gb|AIZ97195.1|  fatty acyl-coenzyme A reductase 4                       107   3e-25   
gb|EEC74588.1|  hypothetical protein OsI_10168                          108   3e-25   
gb|AIZ97194.1|  fatty acyl-coenzyme A reductase 3                       107   3e-25   
ref|NP_001049083.1|  Os03g0167600                                       107   3e-25   
ref|XP_006341242.1|  PREDICTED: fatty acyl-CoA reductase 2-like         105   3e-25   
ref|XP_004973114.1|  PREDICTED: fatty acyl-CoA reductase 1-like         107   3e-25   
ref|XP_006429861.1|  hypothetical protein CICLE_v10011477mg             107   3e-25   
ref|XP_010676595.1|  PREDICTED: fatty acyl-CoA reductase 3-like         106   3e-25   
ref|XP_010024331.1|  PREDICTED: fatty acyl-CoA reductase 2              107   3e-25   
ref|XP_006659274.1|  PREDICTED: fatty acyl-CoA reductase 1-like         106   4e-25   
gb|AJA71622.1|  Male sterility factor protein                           107   4e-25   
ref|XP_008442196.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    107   4e-25   
gb|KDO44391.1|  hypothetical protein CISIN_1g0083151mg                  105   4e-25   
gb|KCW90352.1|  hypothetical protein EUGRSUZ_A02497                     107   4e-25   
ref|XP_004144700.1|  PREDICTED: fatty acyl-CoA reductase 2-like         107   4e-25   
ref|XP_008442197.1|  PREDICTED: fatty acyl-CoA reductase 2 isofor...    106   4e-25   
emb|CBI29968.3|  unnamed protein product                                107   4e-25   
ref|XP_001758118.1|  predicted protein                                  106   5e-25   
ref|XP_006651074.1|  PREDICTED: fatty acyl-CoA reductase 2-like         107   5e-25   
gb|EMS49520.1|  Fatty acyl-CoA reductase 1                              107   5e-25   
gb|KCW58566.1|  hypothetical protein EUGRSUZ_H01222                     105   7e-25   
ref|XP_006664917.1|  PREDICTED: fatty acyl-CoA reductase 1-like         105   7e-25   
gb|EPS67970.1|  hypothetical protein M569_06803                         104   7e-25   
ref|XP_006659273.1|  PREDICTED: fatty acyl-CoA reductase 1-like         105   8e-25   
ref|XP_007132409.1|  hypothetical protein PHAVU_011G092400g             104   9e-25   
ref|XP_006478011.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    106   1e-24   
gb|KDP34802.1|  hypothetical protein JCGZ_10582                         104   1e-24   
gb|KDO39571.1|  hypothetical protein CISIN_1g0083242mg                  104   1e-24   
gb|EMS50907.1|  Fatty acyl-CoA reductase 1                              105   1e-24   
gb|KDO39573.1|  hypothetical protein CISIN_1g0083242mg                  103   1e-24   
ref|XP_006492869.1|  PREDICTED: fatty acyl-CoA reductase 2-like         105   1e-24   
ref|XP_010313342.1|  PREDICTED: fatty acyl-CoA reductase 1-like i...    104   1e-24   
ref|XP_006424272.1|  hypothetical protein CICLE_v10028415mg             104   1e-24   
ref|XP_004987158.1|  PREDICTED: fatty acyl-CoA reductase 2-like         105   1e-24   
ref|XP_002963359.1|  hypothetical protein SELMODRAFT_80322              105   1e-24   
ref|XP_002974648.1|  hypothetical protein SELMODRAFT_101717             105   2e-24   
ref|XP_010070015.1|  PREDICTED: probable fatty acyl-CoA reductase 4     105   2e-24   
gb|KDO39572.1|  hypothetical protein CISIN_1g0083242mg                  103   2e-24   
gb|KDP34806.1|  hypothetical protein JCGZ_10586                         103   2e-24   
ref|XP_010559061.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    105   2e-24   
gb|EMT31062.1|  Fatty acyl-CoA reductase 2                              105   2e-24   
gb|AFW89578.1|  hypothetical protein ZEAMMB73_884169                    105   2e-24   
emb|CAD30692.1|  fatty acyl coA reductase                               104   2e-24   
ref|XP_008660506.1|  PREDICTED: fatty acyl-CoA reductase 2-like         105   2e-24   
gb|AJA71626.1|  male sterility protein                                  106   2e-24   
ref|XP_006424273.1|  hypothetical protein CICLE_v10028415mg             103   2e-24   
ref|XP_009104026.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    105   2e-24   
ref|XP_009104027.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    105   2e-24   
tpg|DAA60732.1|  TPA: hypothetical protein ZEAMMB73_285942              103   3e-24   
ref|XP_003562031.1|  PREDICTED: fatty acyl-CoA reductase 2-like         105   3e-24   
ref|XP_006349135.1|  PREDICTED: probable fatty acyl-CoA reductase...    103   3e-24   
dbj|BAK05128.1|  predicted protein                                      105   3e-24   
ref|XP_006653297.1|  PREDICTED: fatty acyl-CoA reductase 1-like         104   3e-24   
ref|XP_006424274.1|  hypothetical protein CICLE_v10028415mg             103   3e-24   
ref|XP_002468445.1|  hypothetical protein SORBIDRAFT_01g046030          105   3e-24   
emb|CAD30696.1|  fatty acyl coA reductase                               104   3e-24   
ref|XP_011085075.1|  PREDICTED: fatty acyl-CoA reductase 2-like         105   3e-24   
ref|XP_010504577.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    104   4e-24   
ref|XP_010427505.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    103   5e-24   
ref|XP_003538131.1|  PREDICTED: alcohol-forming fatty acyl-CoA re...    103   5e-24   
ref|XP_004308636.1|  PREDICTED: fatty acyl-CoA reductase 3-like         103   6e-24   
ref|XP_006347255.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    103   6e-24   
gb|EMT02038.1|  Fatty acyl-CoA reductase 1                              101   6e-24   
dbj|BAM71700.1|  hypothetical protein                                   104   7e-24   
ref|XP_009116368.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    103   7e-24   
emb|CDY56772.1|  BnaAnng14390D                                          103   7e-24   
gb|KDP42365.1|  hypothetical protein JCGZ_01941                         102   7e-24   
ref|XP_006347257.1|  PREDICTED: fatty acyl-CoA reductase 3-like         102   7e-24   
gb|KCW45311.1|  hypothetical protein EUGRSUZ_L01016                     102   8e-24   
emb|CBI75514.1|  male sterility protein, putative, expressed            103   8e-24   
ref|XP_006478064.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    102   8e-24   
ref|XP_006429858.1|  hypothetical protein CICLE_v10011476mg             103   1e-23   
dbj|BAK05531.1|  predicted protein                                      101   1e-23   
gb|EMT30212.1|  Fatty acyl-CoA reductase 1                              102   1e-23   
ref|XP_004490345.1|  PREDICTED: fatty acyl-CoA reductase 8-like         102   1e-23   
gb|EYU36637.1|  hypothetical protein MIMGU_mgv1a003539mg                103   1e-23   
emb|CBI75517.1|  male sterility protein, putative, expressed            102   1e-23   
ref|XP_010544518.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    102   1e-23   
gb|KDP46041.1|  hypothetical protein JCGZ_13487                         101   2e-23   
ref|NP_001140715.1|  male sterile protein homolog1                      101   2e-23   
gb|EEE60803.1|  hypothetical protein OsJ_14399                          100   2e-23   
ref|XP_010040307.1|  PREDICTED: LOW QUALITY PROTEIN: fatty acyl-C...    102   2e-23   
gb|EEE67188.1|  hypothetical protein OsJ_24284                          101   2e-23   
dbj|BAD46254.1|  putative fatty acyl coA reductase                      102   2e-23   
ref|NP_001052540.1|  Os04g0354400                                       100   2e-23   
ref|XP_010325916.1|  PREDICTED: fatty acyl-CoA reductase 2-like i...    102   2e-23   
ref|XP_011076814.1|  PREDICTED: fatty acyl-CoA reductase 2-like         102   2e-23   
gb|AES98767.2|  fatty acyl-CoA reductase-like protein                 99.8    2e-23   
ref|NP_001063962.1|  Os09g0567500                                       102   2e-23   
gb|ACF85730.1|  unknown                                                 102   2e-23   
ref|XP_008776229.1|  PREDICTED: uncharacterized protein LOC103696395    103   2e-23   
gb|KCW45312.1|  hypothetical protein EUGRSUZ_L01017                     101   3e-23   
ref|XP_007048736.1|  Jojoba acyl CoA reductase-related male steri...    102   3e-23   
gb|ACG42983.1|  male sterility protein 2                                101   3e-23   
gb|KCW65405.1|  hypothetical protein EUGRSUZ_G02830                     101   3e-23   
gb|EYU17613.1|  hypothetical protein MIMGU_mgv1a0210532mg               100   3e-23   
ref|XP_010412804.1|  PREDICTED: fatty acyl-CoA reductase 6, chlor...    102   3e-23   
ref|XP_006341245.1|  PREDICTED: fatty acyl-CoA reductase 2-like         101   3e-23   
emb|CDX72117.1|  BnaC08g27570D                                          101   4e-23   
ref|XP_010040308.1|  PREDICTED: fatty acyl-CoA reductase 2-like         101   4e-23   



>ref|XP_009789793.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana sylvestris]
Length=490

 Score =   147 bits (370),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG L++DIPL+ILRPTI+TST++EPF GWVEG+RTIDSLA+GY KGR
Sbjct  234  NTYVFTKAMGEMLLGNLKEDIPLVILRPTIITSTFQEPFPGWVEGIRTIDSLAVGYGKGR  293

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDPK + D+IPADMVV
Sbjct  294  LTCFLGDPKAVIDVIPADMVV  314



>ref|XP_009631058.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=491

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG L++DIPL+ILRPTI+TST++EPF GWVEG+RTIDSLA+GY KG+
Sbjct  235  NTYVFTKAMGEMLLGNLKEDIPLVILRPTIITSTFQEPFPGWVEGIRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDPK + D+IPADMVV
Sbjct  295  LTCFLGDPKAVIDVIPADMVV  315



>ref|XP_009781717.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nicotiana 
sylvestris]
Length=492

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK MGEMLLGKL++D+PL+I+RPTI+TST+KEPF GWVEG+RTIDSLA+GY KGR
Sbjct  235  NTYVFTKTMGEMLLGKLKEDVPLVIVRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PKTI D+IPADMVV
Sbjct  295  ITCFLGNPKTILDVIPADMVV  315



>ref|XP_004251043.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Solanum 
lycopersicum]
Length=492

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLGKL++++PL+I RPTI+TST+KEPF GWVEG+RTIDSLA+GY KGR
Sbjct  235  NTYVFTKAMGEMLLGKLKEEVPLVINRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PKTI D+IPADMVV
Sbjct  295  ITCFLGNPKTILDVIPADMVV  315



>ref|XP_006349115.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Solanum 
tuberosum]
Length=492

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLGKL++++PL+I RPTI+TST+KEPF GWVEG+RTIDSLA+GY KGR
Sbjct  235  NTYVFTKAMGEMLLGKLKEEVPLVINRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PKTI D+IPADMVV
Sbjct  295  ITCFLGNPKTILDVIPADMVV  315



>gb|EPS58786.1| hypothetical protein M569_16027, partial [Genlisea aurea]
Length=428

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L++++P++ILRP+IVTSTYKEPF GW EG+RTIDSLA+GYAKGR
Sbjct  171  NTYVFTKAMGEMLIEELKENLPIVILRPSIVTSTYKEPFPGWAEGIRTIDSLAVGYAKGR  230

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLGDPKTI DLIPADMVV
Sbjct  231  ITCFLGDPKTILDLIPADMVV  251



>ref|XP_011090359.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Sesamum indicum]
Length=491

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVF+KAMGEMLLG L+++IPL+I+RPTIVTSTYKEPF GW EGVRTIDSLA+GY KGR
Sbjct  236  NTYVFSKAMGEMLLGHLKENIPLVIVRPTIVTSTYKEPFPGWAEGVRTIDSLAVGYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PKT+ D IPADMVV
Sbjct  296  ITCFLGNPKTVIDAIPADMVV  316



>ref|XP_009611540.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nicotiana 
tomentosiformis]
Length=492

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK MGEMLLG L++D+PL+I+RPTI+TST+KEPF GWVEG+RTIDSLA+GY KGR
Sbjct  235  NTYVFTKTMGEMLLGNLKEDVPLVIVRPTIITSTFKEPFPGWVEGIRTIDSLAVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PKTI D+IPADMVV
Sbjct  295  ITCFLGNPKTILDVIPADMVV  315



>gb|EYU36959.1| hypothetical protein MIMGU_mgv1a0177801mg, partial [Erythranthe 
guttata]
Length=467

 Score =   142 bits (358),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 65/84 (77%), Positives = 78/84 (93%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDD--IPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYA  172
            NTYVFTKAMGEMLLG+L ++D  +PL+I+RPTIVTSTY+EPF GWVEG+RTIDSLA+GY 
Sbjct  201  NTYVFTKAMGEMLLGQLVKEDQTVPLVIIRPTIVTSTYREPFPGWVEGLRTIDSLAVGYG  260

Query  173  KGRLTCFLGDPKTITDLIPADMVV  244
            KG++TCFLGDPK+I D+IPADMVV
Sbjct  261  KGKITCFLGDPKSIVDVIPADMVV  284



>gb|EYU36081.1| hypothetical protein MIMGU_mgv1a0090081mg, partial [Erythranthe 
guttata]
Length=339

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG+L+D I ++I+RP+IVTSTYK+PF GW EGVRTIDS+A+GY KGR
Sbjct  94   NTYVFTKAMGEMLLGQLKDKIAVVIIRPSIVTSTYKQPFSGWAEGVRTIDSIAVGYGKGR  153

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDPKT+ D +PADMVV
Sbjct  154  LTCFLGDPKTVIDAVPADMVV  174



>gb|EYU36080.1| hypothetical protein MIMGU_mgv1a0090081mg, partial [Erythranthe 
guttata]
Length=350

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG+L+D I ++I+RP+IVTSTYK+PF GW EGVRTIDS+A+GY KGR
Sbjct  94   NTYVFTKAMGEMLLGQLKDKIAVVIIRPSIVTSTYKQPFSGWAEGVRTIDSIAVGYGKGR  153

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDPKT+ D +PADMVV
Sbjct  154  LTCFLGDPKTVIDAVPADMVV  174



>ref|XP_010031500.1| PREDICTED: fatty acyl-CoA reductase 3 [Eucalyptus grandis]
 gb|KCW50818.1| hypothetical protein EUGRSUZ_J00479 [Eucalyptus grandis]
Length=490

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEML+G+L++D+PL++LRPTIVTSTYKEPF GWVEGVRTIDSLA+GY KG+
Sbjct  235  NTYVFTKSMGEMLVGQLKEDLPLVVLRPTIVTSTYKEPFPGWVEGVRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD K I D+IPADMVV
Sbjct  295  LTCFLGDVKGIVDVIPADMVV  315



>ref|XP_011088872.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Sesamum indicum]
Length=441

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVF+KAMGEMLLG L+ +IPL+I+RPTIVTST+K+PF GWVEGVRTIDSLA+GY KG+
Sbjct  236  NTYVFSKAMGEMLLGHLKQNIPLVIIRPTIVTSTFKDPFPGWVEGVRTIDSLAVGYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+P++I D+IPADMVV
Sbjct  296  ITCFLGNPQSIIDVIPADMVV  316



>ref|XP_011088871.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Sesamum indicum]
Length=493

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVF+KAMGEMLLG L+ +IPL+I+RPTIVTST+K+PF GWVEGVRTIDSLA+GY KG+
Sbjct  236  NTYVFSKAMGEMLLGHLKQNIPLVIIRPTIVTSTFKDPFPGWVEGVRTIDSLAVGYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+P++I D+IPADMVV
Sbjct  296  ITCFLGNPQSIIDVIPADMVV  316



>emb|CDP06945.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG L+ + PL+I+RPTI+TST+KEPF GWVEGVRTIDSLA+GYAKGR
Sbjct  235  NTYVFTKAMGEMLLGHLKGNTPLVIVRPTIITSTFKEPFPGWVEGVRTIDSLAVGYAKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            +TCFLGDP+TI D IPAD
Sbjct  295  ITCFLGDPRTIVDAIPAD  312



>gb|KDP42371.1| hypothetical protein JCGZ_01947 [Jatropha curcas]
Length=492

 Score =   138 bits (348),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L+ ++ ++I+RPTIVTSTYKEPF GWVEGVRTIDSLA+GYAKGR
Sbjct  236  NTYVFTKAMGEMLVGHLKGNLSVVIVRPTIVTSTYKEPFPGWVEGVRTIDSLAVGYAKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IP DMVV
Sbjct  296  LTCFLGDINGIVDVIPGDMVV  316



>gb|ADK66305.1| gland-specific fatty acyl-CoA reductase 1 [Artemisia annua]
Length=493

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEM++G L+ D+P++I+RPTIVTSTYKEPF GWVEG+RTIDSL LGY KG+
Sbjct  237  NTYVFTKALGEMIIGHLKGDMPVVIIRPTIVTSTYKEPFPGWVEGIRTIDSLVLGYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDP+ + D++PADMVV
Sbjct  297  LTCFLGDPEAVYDVVPADMVV  317



>ref|XP_008458592.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis melo]
Length=487

 Score =   138 bits (347),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G L+DD+PL+++RPTIVTSTYKEPF GW+EGVRTIDSL +GYAKG+
Sbjct  230  NTYVFTKAMGEMIIGDLKDDVPLIVIRPTIVTSTYKEPFPGWIEGVRTIDSLIVGYAKGK  289

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF+    ++ DLIPADMVV
Sbjct  290  LTCFVAGINSVIDLIPADMVV  310



>ref|XP_006387898.1| hypothetical protein POPTR_0490s00200g [Populus trichocarpa]
 gb|ERP46812.1| hypothetical protein POPTR_0490s00200g [Populus trichocarpa]
Length=268

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++D+ ++I+RPTIVTSTY+EPF GWVEGVRTIDSLA+GY KGR
Sbjct  12   NTYVFTKAMGEMLVGHLKEDLSVVIIRPTIVTSTYEEPFPGWVEGVRTIDSLAVGYGKGR  71

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  72   LTCFLGDITGIVDVIPADMVV  92



>ref|XP_004166245.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
Length=487

 Score =   138 bits (347),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G L+D+IPL+++RPTIVTSTYKEPF GW+EGVRTIDSL +GYAKG+
Sbjct  230  NTYVFTKAMGEMIIGDLKDEIPLIVIRPTIVTSTYKEPFPGWIEGVRTIDSLIVGYAKGK  289

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF+    +I DLIPADMVV
Sbjct  290  LTCFVAGINSIIDLIPADMVV  310



>ref|XP_004145801.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
Length=487

 Score =   137 bits (345),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G L+D++PL+++RPTIVTSTYKEPF GW+EGVRTIDSL +GYAKG+
Sbjct  230  NTYVFTKAMGEMIIGDLKDEVPLIVIRPTIVTSTYKEPFPGWIEGVRTIDSLIVGYAKGK  289

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF+    +I DLIPADMVV
Sbjct  290  LTCFVAGINSIIDLIPADMVV  310



>ref|XP_002523778.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF38504.1| oxidoreductase, putative [Ricinus communis]
Length=414

 Score =   135 bits (340),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G L++++ ++ILRPTI+TSTYKEPF GWVEGVRTIDSLA+GY KGR
Sbjct  158  NTYVFTKAMGEMIVGHLKENLSVVILRPTIITSTYKEPFPGWVEGVRTIDSLAVGYGKGR  217

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  218  LTCFLGDINGIVDVIPADMVV  238



>ref|XP_008462137.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Cucumis 
melo]
Length=492

 Score =   135 bits (341),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+++IP++I+RPTIV+STYKEPF GWVEGVRTIDSLA+ Y KG+
Sbjct  236  NTYVFTKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLGD   + D+IPADMVV
Sbjct  296  ITCFLGDVNALVDVIPADMVV  316



>ref|XP_008462145.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Cucumis 
melo]
Length=488

 Score =   135 bits (341),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+++IP++I+RPTIV+STYKEPF GWVEGVRTIDSLA+ Y KG+
Sbjct  236  NTYVFTKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLGD   + D+IPADMVV
Sbjct  296  ITCFLGDVNALVDVIPADMVV  316



>ref|XP_008458693.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 3-like 
[Cucumis melo]
Length=520

 Score =   135 bits (341),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++   ++++PL+I+RPTIVTSTYKEPF GW+EGVRTIDSL LGYAKG+
Sbjct  264  NTYVFTKAMGEMVVSDPKNNLPLIIIRPTIVTSTYKEPFPGWIEGVRTIDSLILGYAKGK  323

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLG   +I DL+PADMVV
Sbjct  324  LTCFLGGINSIVDLVPADMVV  344



>ref|XP_004139568.1| PREDICTED: LOW QUALITY PROTEIN: fatty acyl-CoA reductase 3-like 
[Cucumis sativus]
Length=492

 Score =   135 bits (341),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+++IP++I+RPTIV+STYKEPF GWVEGVRTIDSLA+ Y KG+
Sbjct  236  NTYVFTKAMGEMLISELKENIPVVIIRPTIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLGD   + D+IPADMVV
Sbjct  296  ITCFLGDVNALVDVIPADMVV  316



>ref|XP_002313668.2| hypothetical protein POPTR_0009s14720g [Populus trichocarpa]
 gb|EEE87623.2| hypothetical protein POPTR_0009s14720g [Populus trichocarpa]
Length=492

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++D+ ++I+RPTIVTSTY+EPF GWVEGVRTIDSLA+GY KGR
Sbjct  236  NTYVFTKAMGEMLVGHLKEDLSVVIIRPTIVTSTYEEPFPGWVEGVRTIDSLAVGYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  296  LTCFLGDITGIVDVIPADMVV  316



>ref|XP_010271727.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nelumbo 
nucifera]
Length=490

 Score =   135 bits (340),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG  R++IPL+I+RPTI+TSTY EPF GW+EGVRTIDSL LGY KGR
Sbjct  235  NTYAFTKAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT F GDPK I D+IP DMVV
Sbjct  295  LTGFPGDPKLIMDVIPGDMVV  315



>ref|XP_002263127.1| PREDICTED: fatty acyl-CoA reductase 3 [Vitis vinifera]
 emb|CBI28353.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG L++++PL ILRPTIV+STYKEPF GWVEG+RTIDS A+GY KGR
Sbjct  235  NTYVFTKAMGEMLLGHLKENLPLAILRPTIVSSTYKEPFPGWVEGIRTIDSFAVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FLGD + I D+IPADMVV
Sbjct  295  LTFFLGDIEAIVDVIPADMVV  315



>ref|XP_010244271.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nelumbo 
nucifera]
Length=492

 Score =   135 bits (339),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEML+G LR+++P++I+RPT++TSTY EPF GW+EG+RTIDSLALGY KG+
Sbjct  235  NTYTFTKAMGEMLIGNLRENMPVVIIRPTMITSTYYEPFPGWIEGLRTIDSLALGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FLG+PK I DLIP DMVV
Sbjct  295  LTFFLGNPKMIIDLIPGDMVV  315



>ref|XP_007015865.1| Jojoba acyl CoA reductase-related male sterility protein, putative 
[Theobroma cacao]
 gb|EOY33484.1| Jojoba acyl CoA reductase-related male sterility protein, putative 
[Theobroma cacao]
Length=534

 Score =   134 bits (337),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  + D+PL+I+RPTIVTST+KEPF GW+EG+RTIDS+ +G  KG+
Sbjct  277  NTYVFTKAMGEMLVGNFKGDLPLVIVRPTIVTSTFKEPFPGWIEGLRTIDSVIVGLGKGK  336

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PK   DLIPADMV+
Sbjct  337  MTCFLGNPKVTIDLIPADMVI  357



>ref|XP_004161427.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
Length=584

 Score =   134 bits (338),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+++IP++I+RP IV+STYKEPF GWVEGVRTIDSLA+ Y KG+
Sbjct  236  NTYVFTKAMGEMLISELKENIPVVIIRPAIVSSTYKEPFPGWVEGVRTIDSLAVAYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLGD   + D+IPADMVV
Sbjct  296  ITCFLGDVNALVDVIPADMVV  316



>ref|XP_006290474.1| hypothetical protein CARUB_v100190921mg, partial [Capsella rubella]
 gb|EOA23372.1| hypothetical protein CARUB_v100190921mg, partial [Capsella rubella]
Length=340

 Score =   132 bits (332),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+D+ L+I+RP+IVTSTYKEPF GW EG+RTIDSLA+GY  G+
Sbjct  240  NTYVFTKAMGEMIVGANREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSLAVGYGTGK  299

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   ++D+IPADMVV
Sbjct  300  LTCFLGDLNAVSDVIPADMVV  320



>ref|XP_010089855.1| Fatty acyl-CoA reductase 3 [Morus notabilis]
 gb|EXB38471.1| Fatty acyl-CoA reductase 3 [Morus notabilis]
Length=492

 Score =   134 bits (336),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM+LG L++++ ++I+RPTI+TSTYKEPF GWVEG+RTIDSLA+GY KG+
Sbjct  235  NTYVFTKAMGEMVLGHLKENVNVVIIRPTIITSTYKEPFPGWVEGLRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD + + D+IPAD+VV
Sbjct  295  LTCFLGDLEAVVDVIPADLVV  315



>ref|XP_006347238.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=491

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            N YVFTKA+ EM+LG L++D+PL+I RPTIVTST ++PF GWVEG+RTIDSLA+GY KG+
Sbjct  235  NPYVFTKALAEMILGDLKEDVPLVIFRPTIVTSTLQDPFPGWVEGIRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDP+ I DLIPADMVV
Sbjct  295  LTCFLGDPEAIIDLIPADMVV  315



>emb|CDY48435.1| BnaA08g11440D [Brassica napus]
Length=480

 Score =   133 bits (335),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G+ RD+I L+++RP+I+TST+KEPF GW EG+RTIDSLA+GY KGR
Sbjct  226  NTYVFTKAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGR  285

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I+D++PADMVV
Sbjct  286  LTCFLGDLNAISDVMPADMVV  306



>ref|XP_010271729.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Nelumbo nucifera]
Length=452

 Score =   133 bits (334),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R++IPL+I+RPTI+TSTY EPF GW+EGVRTIDSL LGY+KG 
Sbjct  197  NTYVFTKAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYSKGG  256

Query  182  LTCFLGDPKTITDLIPADMV  241
            LT F GDPK I D+IP DMV
Sbjct  257  LTGFPGDPKLIMDVIPGDMV  276



>ref|XP_010271730.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X3 [Nelumbo nucifera]
Length=435

 Score =   133 bits (334),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R++IPL+I+RPTI+TSTY EPF GW+EGVRTIDSL LGY+KG 
Sbjct  180  NTYVFTKAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYSKGG  239

Query  182  LTCFLGDPKTITDLIPADMV  241
            LT F GDPK I D+IP DMV
Sbjct  240  LTGFPGDPKLIMDVIPGDMV  259



>ref|XP_010271728.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nelumbo nucifera]
Length=490

 Score =   133 bits (334),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R++IPL+I+RPTI+TSTY EPF GW+EGVRTIDSL LGY+KG 
Sbjct  235  NTYVFTKAMGEMLLGHYRENIPLVIIRPTIITSTYNEPFPGWIEGVRTIDSLILGYSKGG  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            LT F GDPK I D+IP DMV
Sbjct  295  LTGFPGDPKLIMDVIPGDMV  314



>emb|CDY28321.1| BnaC03g66380D [Brassica napus]
Length=492

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G+ RD+I L+++RP+I+TST+KEPF GW EG+RTIDSLA+GY KGR
Sbjct  238  NTYVFTKAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGR  297

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I+D++PADMVV
Sbjct  298  LTCFLGDLNAISDVMPADMVV  318



>ref|XP_009108773.1| PREDICTED: fatty acyl-CoA reductase 3-like [Brassica rapa]
Length=492

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G+ RD+I L+++RP+I+TST+KEPF GW EG+RTIDSLA+GY KGR
Sbjct  238  NTYVFTKAMGEMMVGEKRDNISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGR  297

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I+D++PADMVV
Sbjct  298  LTCFLGDLNAISDVMPADMVV  318



>ref|XP_007015863.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
 gb|EOY33482.1| Jojoba acyl CoA reductase-related male sterility protein [Theobroma 
cacao]
Length=491

 Score =   132 bits (333),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            N YVFTKAMGEML+G ++ ++P +I+RPTI+TSTYKEPF GW EGVRTIDSLA+GYAKG+
Sbjct  235  NAYVFTKAMGEMLVGYMKGNMPTVIIRPTIITSTYKEPFPGWAEGVRTIDSLAVGYAKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FLGD ++I D+IPADMVV
Sbjct  295  LTFFLGDLESIVDVIPADMVV  315



>ref|XP_010045241.1| PREDICTED: fatty acyl-CoA reductase 3-like [Eucalyptus grandis]
 gb|KCW87399.1| hypothetical protein EUGRSUZ_B03877 [Eucalyptus grandis]
Length=492

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G+L++DI  +I+RPTIVTSTYKEPF GW EGVRT+D+LA+GYA G+
Sbjct  235  NTYVFTKAMGEMLVGELKEDISAVIVRPTIVTSTYKEPFPGWAEGVRTVDTLAVGYATGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   + D IPADMVV
Sbjct  295  LTCFLGDTNGVVDTIPADMVV  315



>ref|XP_008378269.1| PREDICTED: fatty acyl-CoA reductase 3-like [Malus domestica]
Length=278

 Score =   129 bits (324),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++P++I+RPTI+TSTYKEPF GWVEG+RTIDS+A+GYAKG+
Sbjct  23   NTYVFTKAMGEMLIGDLKENLPVVIIRPTIITSTYKEPFPGWVEGIRTIDSIAVGYAKGK  82

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D+IPADMVV
Sbjct  83   LTFFLCDINAIVDVIPADMVV  103



>gb|AFK47309.1| unknown [Lotus japonicus]
Length=491

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++P++ILRPTIVTSTY+EPF GWVEGVRTIDSL + Y KG+
Sbjct  235  NTYVFTKAMGEMLVGTLKENMPVVILRPTIVTSTYREPFPGWVEGVRTIDSLIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D K + D+IPADMVV
Sbjct  295  LTCFLADIKAVFDVIPADMVV  315



>ref|XP_006279378.1| hypothetical protein CARUB_v10007996mg [Capsella rubella]
 gb|EOA12276.1| hypothetical protein CARUB_v10007996mg [Capsella rubella]
Length=421

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+D+ L+I+RP+IVTSTYKEPF GW EG+RTIDSLA+GY  G+
Sbjct  240  NTYVFTKAMGEMIVGANREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSLAVGYGTGK  299

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   ++D+IPADMVV
Sbjct  300  LTCFLGDLNAVSDVIPADMVV  320



>ref|XP_009405296.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   131 bits (329),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYV+TKAM EMLLG+LR ++PL+ILRPTI+TS +++P  GW+EG RTIDSL +GY KG+
Sbjct  235  NTYVYTKAMAEMLLGELRGNLPLVILRPTIITSIHRDPVPGWIEGTRTIDSLIMGYVKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF GDP+T+ D+IP DMVV
Sbjct  295  ITCFFGDPETVADMIPGDMVV  315



>ref|XP_002305561.2| hypothetical protein POPTR_0004s19580g [Populus trichocarpa]
 gb|EEE86072.2| hypothetical protein POPTR_0004s19580g [Populus trichocarpa]
Length=492

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++ ++I+RPTIVTST KEPF GWVEG+RTIDSLA+GY KGR
Sbjct  236  NTYVFTKAMGEMLVGDLKENLSVVIIRPTIVTSTLKEPFPGWVEGIRTIDSLAVGYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  296  LTCFLGDITGIVDVIPADMVV  316



>emb|CDY35688.1| BnaC02g09540D [Brassica napus]
Length=492

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+GK R+D+PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLMGKYREDLPLVIVRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL DP T+ DLIPADMVV
Sbjct  295  LKCFLADPNTVLDLIPADMVV  315



>ref|XP_007205116.1| hypothetical protein PRUPE_ppa004817mg [Prunus persica]
 gb|EMJ06315.1| hypothetical protein PRUPE_ppa004817mg [Prunus persica]
Length=490

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++PL+I+RPTI+TSTYKEPF GWVEGVRTIDSLA+GY KG+
Sbjct  235  NTYVFTKAMGEMLIGDLKENLPLVIVRPTIITSTYKEPFPGWVEGVRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D+IPADMVV
Sbjct  295  LTFFLCDINAIADVIPADMVV  315



>ref|XP_010425870.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Camelina 
sativa]
Length=456

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+D+ L+I+RP+IVTSTYKEPF GW EG+RTIDS+A GY  G+
Sbjct  241  NTYVFTKAMGEMIVGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGK  300

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD  +++D+IPADMVV
Sbjct  301  LTCFLGDINSVSDVIPADMVV  321



>ref|XP_010514781.1| PREDICTED: fatty acyl-CoA reductase 3-like [Camelina sativa]
Length=495

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+D+ L+I+RP+IVTSTYKEPF GW EG+RTIDS+A GY  G+
Sbjct  240  NTYVFTKAMGEMIIGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGK  299

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD  +++D+IPADMVV
Sbjct  300  LTCFLGDINSVSDVIPADMVV  320



>ref|XP_010503101.1| PREDICTED: fatty acyl-CoA reductase 3-like [Camelina sativa]
Length=495

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+D+ L+I+RP+IVTSTYKEPF GW EG+RTIDS+A GY  G+
Sbjct  240  NTYVFTKAMGEMIIGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGK  299

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD  +++D+IPADMVV
Sbjct  300  LTCFLGDINSVSDVIPADMVV  320



>ref|XP_011044886.1| PREDICTED: fatty acyl-CoA reductase 3-like [Populus euphratica]
Length=332

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            +TYVFTKAMGEML+G L++D+ ++I+RPTIVTSTYKEPF  WVEGVRTIDSLA+GY KGR
Sbjct  126  STYVFTKAMGEMLVGHLKEDLSVVIIRPTIVTSTYKEPFPDWVEGVRTIDSLAVGYGKGR  185

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC LGD   I D+IPADMVV
Sbjct  186  LTCVLGDITGIVDVIPADMVV  206



>ref|XP_011044880.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Populus 
euphratica]
Length=490

 Score =   130 bits (327),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLL   +D +PLLI+RPT+V STYKEPF GW+EGVRTIDSL +GY +GR
Sbjct  235  NTYVFTKAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSLIVGYGQGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF+  P++  D+IPADMVV
Sbjct  295  VTCFISGPRSTLDVIPADMVV  315



>ref|XP_011046268.1| PREDICTED: fatty acyl-CoA reductase 3-like [Populus euphratica]
Length=492

 Score =   130 bits (327),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++ ++I+RPTIVTST KEPF GW+EG+RTIDSLA+GY KGR
Sbjct  236  NTYVFTKAMGEMLVGDLKENLSVVIIRPTIVTSTLKEPFPGWIEGIRTIDSLAVGYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  296  LTCFLGDITGIVDVIPADMVV  316



>ref|XP_011090360.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Sesamum indicum]
Length=487

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 4/81 (5%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVF+KAMGEMLLG L+++IPL+I+RPTIVTSTYKEPF GW EGV    SLA+GY KGR
Sbjct  236  NTYVFSKAMGEMLLGHLKENIPLVIVRPTIVTSTYKEPFPGWAEGV----SLAVGYGKGR  291

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLG+PKT+ D IPADMVV
Sbjct  292  ITCFLGNPKTVIDAIPADMVV  312



>ref|XP_009364297.1| PREDICTED: fatty acyl-CoA reductase 3-like [Pyrus x bretschneideri]
Length=490

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++P++I+RPTI+TSTYKEPF GWVEG+RTIDS+A+GYAKG+
Sbjct  235  NTYVFTKAMGEMLIGDLKENLPVVIIRPTIITSTYKEPFPGWVEGIRTIDSIAVGYAKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D+IPADMVV
Sbjct  295  LTFFLCDINAIVDVIPADMVV  315



>ref|XP_010425869.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Camelina 
sativa]
Length=496

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+D+ L+I+RP+IVTSTYKEPF GW EG+RTIDS+A GY  G+
Sbjct  241  NTYVFTKAMGEMIVGAKREDMSLVIIRPSIVTSTYKEPFPGWTEGIRTIDSIAAGYGTGK  300

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD  +++D+IPADMVV
Sbjct  301  LTCFLGDINSVSDVIPADMVV  321



>ref|XP_008801227.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Phoenix dactylifera]
Length=490

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYV+TKAMGEMLLG LR D+PL+ILRPT++TS YKEP  GW+EG RTIDSL +GYAKG+
Sbjct  235  NTYVYTKAMGEMLLGHLRGDLPLVILRPTMITSIYKEPLPGWIEGTRTIDSLIIGYAKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L+CF G+P+ + D++P DMVV
Sbjct  295  LSCFFGEPELVMDVVPGDMVV  315



>ref|XP_003606153.1| Fatty acyl-CoA reductase [Medicago truncatula]
Length=381

 Score =   128 bits (322),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G+L+ ++ ++I+RP IVTST+KEPF GW EGVRTIDSLA+ Y KG+
Sbjct  175  NTYVFTKAMGEMLVGQLKGNLSVVIIRPAIVTSTFKEPFPGWSEGVRTIDSLAVAYGKGK  234

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  235  LTCFLGDLNAIVDVIPADMVV  255



>emb|CAN81280.1| hypothetical protein VITISV_041831 [Vitis vinifera]
Length=469

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG+ ++++PL+ILRPTI+TSTY EPF GW+EG+RTIDS+   Y KG+
Sbjct  235  NTYVFTKAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDSVLATYCKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL DP+ I D IP DMVV
Sbjct  295  LTCFLADPECILDAIPGDMVV  315



>gb|AFK38315.1| unknown [Medicago truncatula]
 gb|AES88360.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   129 bits (324),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G +++ + ++I+RPTI+TSTYKEPF GWVEGVRTIDSL + Y KG+
Sbjct  236  NTYVFTKAMGEMLVGTMKEKLSIVIVRPTIITSTYKEPFPGWVEGVRTIDSLIVAYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D + + D+IPADMVV
Sbjct  296  LTCFLADLEAVFDVIPADMVV  316



>ref|XP_004241314.1| PREDICTED: fatty acyl-CoA reductase 3 [Solanum lycopersicum]
Length=491

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            N YVFTKA+ EM+LG +++D+ L+I RPTIVTST ++PF GWVEG+RTIDSLA+GY KG+
Sbjct  235  NPYVFTKALAEMILGDMKEDVLLVIFRPTIVTSTLRDPFPGWVEGIRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGDP+ I DLIPADMVV
Sbjct  295  LTCFLGDPEAIIDLIPADMVV  315



>ref|XP_008228911.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Prunus 
mume]
Length=490

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+G L++++PL+ILRPTI+TSTYKEPF GWVEG+RTIDSLA+GY KG+
Sbjct  235  NTYVFTKAIGEMLIGDLKENLPLVILRPTIITSTYKEPFPGWVEGIRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D++PADMVV
Sbjct  295  LTFFLCDINAIADVVPADMVV  315



>ref|XP_007206366.1| hypothetical protein PRUPE_ppa017843mg [Prunus persica]
 gb|EMJ07565.1| hypothetical protein PRUPE_ppa017843mg [Prunus persica]
Length=493

 Score =   129 bits (324),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ LG+ +D++P++I+RPT+VTSTYKEPF GW++G RTIDS+  GY KG+
Sbjct  237  NTYVFTKAMGEVFLGRSKDELPVVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP T+ D+IP DMVV
Sbjct  297  LTCLLADPTTVFDMIPVDMVV  317



>emb|CDY09144.1| BnaA02g05700D [Brassica napus]
Length=492

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+GK R+++PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLVGKYRENLPLVIVRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL DP T+ DLIPADMVV
Sbjct  295  LKCFLADPNTVFDLIPADMVV  315



>ref|XP_003606163.1| Fatty acyl-CoA reductase [Medicago truncatula]
Length=431

 Score =   129 bits (323),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G +++ + ++I+RPTI+TSTYKEPF GWVEGVRTIDSL + Y KG+
Sbjct  175  NTYVFTKAMGEMLVGTMKEKLSIVIVRPTIITSTYKEPFPGWVEGVRTIDSLIVAYGKGK  234

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D + + D+IPADMVV
Sbjct  235  LTCFLADLEAVFDVIPADMVV  255



>ref|XP_009126546.1| PREDICTED: fatty acyl-CoA reductase 1-like [Brassica rapa]
Length=492

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+GK R+++PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLVGKYRENLPLVIVRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL DP T+ DLIPADMVV
Sbjct  295  LKCFLADPNTVFDLIPADMVV  315



>ref|XP_010651912.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase isoform X2 
[Vitis vinifera]
Length=460

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG+ ++++PL+ILRPTI+TSTY EPF GW+EG+RTID++  GY KG+
Sbjct  235  NTYVFTKAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDNVLAGYCKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP+ I D IP DMVV
Sbjct  295  LTCLLADPECILDAIPGDMVV  315



>gb|KGN46944.1| hypothetical protein Csa_6G151810 [Cucumis sativus]
Length=499

 Score =   128 bits (322),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 12/93 (13%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGV------------RT  145
            NTYVFTKAMGEM++G L+D++PL+++RPTIVTSTYKEPF GW+EGV            RT
Sbjct  230  NTYVFTKAMGEMIIGDLKDEVPLIVIRPTIVTSTYKEPFPGWIEGVRIWGQTLCINLCRT  289

Query  146  IDSLALGYAKGRLTCFLGDPKTITDLIPADMVV  244
            IDSL +GYAKG+LTCF+    +I DLIPADMVV
Sbjct  290  IDSLIVGYAKGKLTCFVAGINSIIDLIPADMVV  322



>ref|XP_008357549.1| PREDICTED: fatty acyl-CoA reductase 3-like [Malus domestica]
Length=278

 Score =   125 bits (315),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++P++I+RPTI++STYKEPF GWVEG+RTIDS+A+GY KG+
Sbjct  23   NTYVFTKAMGEMLIGDLKENLPVVIIRPTIISSTYKEPFPGWVEGIRTIDSIAVGYGKGK  82

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D+IPADMVV
Sbjct  83   LTFFLCDIDAIVDVIPADMVV  103



>ref|XP_007020558.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12083.1| Fatty acid reductase 4 [Theobroma cacao]
Length=492

 Score =   128 bits (322),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  + D+PL+I+RPT++ STYKEPF GW+EGVRTIDS+ + Y KG+
Sbjct  237  NTYVFTKAMGEMLLGNFKGDLPLVIIRPTMIASTYKEPFPGWIEGVRTIDSVIVSYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF G P +  D+IPADMVV
Sbjct  297  LTCFPGYPNSALDVIPADMVV  317



>gb|KEH29873.1| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=491

 Score =   128 bits (322),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G+L+ ++ ++I+RP IVTST+KEPF GW EGVRTIDSLA+ Y KG+
Sbjct  235  NTYVFTKAMGEMLVGQLKGNLSVVIIRPAIVTSTFKEPFPGWSEGVRTIDSLAVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IPADMVV
Sbjct  295  LTCFLGDLNAIVDVIPADMVV  315



>ref|XP_002263184.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase isoform X1 
[Vitis vinifera]
 emb|CBI28354.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG+ ++++PL+ILRPTI+TSTY EPF GW+EG+RTID++  GY KG+
Sbjct  235  NTYVFTKAMGEMLLGQFKENLPLVILRPTIITSTYMEPFSGWIEGIRTIDNVLAGYCKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP+ I D IP DMVV
Sbjct  295  LTCLLADPECILDAIPGDMVV  315



>ref|XP_004515386.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLL +L++++ ++++RP IVTST+KEPF GW EGVRTIDSLAL Y KG+
Sbjct  235  NTYVFTKAMGEMLLEQLKENLSVVVVRPAIVTSTFKEPFPGWAEGVRTIDSLALAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF+GD K I D IPADMVV
Sbjct  295  LTCFIGDIKAIVDAIPADMVV  315



>ref|XP_002313667.2| acyl CoA reductase family protein [Populus trichocarpa]
 gb|EEE87622.2| acyl CoA reductase family protein [Populus trichocarpa]
Length=489

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLL   +D +PLLI+RPT+V STYKEPF GW+EGVRTIDS+ +GY KGR
Sbjct  235  NTYVFTKAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSVIVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF+  P++  D+IPADMVV
Sbjct  295  VTCFISGPRSTLDVIPADMVV  315



>ref|XP_007132412.1| hypothetical protein PHAVU_011G092500g [Phaseolus vulgaris]
 gb|ESW04406.1| hypothetical protein PHAVU_011G092500g [Phaseolus vulgaris]
Length=492

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+ ++ ++I+RPTIVTST+KEPF GW EGVRTIDSLA+ Y KG+
Sbjct  237  NTYVFTKAMGEMLVEQLKGNLSVVIIRPTIVTSTFKEPFPGWAEGVRTIDSLAVAYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD K I D IPADMVV
Sbjct  297  LTCFLGDLKAIVDAIPADMVV  317



>ref|XP_009119230.1| PREDICTED: fatty acyl-CoA reductase 3 [Brassica rapa]
Length=493

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R ++PL+++RPTI+TST KEPF GW EG+RTIDSL +GY KGR
Sbjct  239  NTYVFTKAMGEMIVGAKRGNLPLVLIRPTIITSTIKEPFPGWTEGIRTIDSLGVGYGKGR  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   ++D++PADMVV
Sbjct  299  LTCFLGDLNAVSDVMPADMVV  319



>ref|XP_004291620.1| PREDICTED: fatty acyl-CoA reductase 3-like [Fragaria vesca subsp. 
vesca]
Length=490

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G+ R ++P++ILRPTI+TSTYKEPF GWVEG+RTIDS+A+GY KG+
Sbjct  235  NTYVFTKAMGEMLIGEHRGNLPVVILRPTIITSTYKEPFPGWVEGIRTIDSVAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D + I D++PADMVV
Sbjct  295  LTFFLCDIEAIVDIVPADMVV  315



>ref|XP_006412311.1| hypothetical protein EUTSA_v10025005mg [Eutrema salsugineum]
 gb|ESQ53764.1| hypothetical protein EUTSA_v10025005mg [Eutrema salsugineum]
Length=494

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R +I L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  239  NTYVFTKAMGEMLVGTKRGNISLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D++PADMVV
Sbjct  299  LTCFLADLNAISDVMPADMVV  319



>gb|AID60102.1| alcohol-forming fatty acyl-CoA reductase [Brassica napus]
 emb|CDX75382.1| BnaA01g03200D [Brassica napus]
Length=493

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G+ R ++PL+++RP+I+TST KEPF GW EG+RTIDSL +GY KGR
Sbjct  239  NTYVFTKAMGEMIVGEKRGNLPLVLIRPSIITSTIKEPFPGWTEGIRTIDSLGVGYGKGR  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   ++D++PADMVV
Sbjct  299  LTCFLGDLNAVSDVMPADMVV  319



>ref|NP_001030809.1| fatty acyl-CoA reductase 4 [Arabidopsis thaliana]
 dbj|BAE99400.1| acyl CoA reductase - protein [Arabidopsis thaliana]
 gb|ACF22894.1| At3g44540 [Arabidopsis thaliana]
 gb|AEE77913.1| fatty acid reductase 4 [Arabidopsis thaliana]
Length=433

 Score =   127 bits (318),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL DP ++ DLIP DMV
Sbjct  295  LKCFLADPNSVLDLIPVDMV  314



>ref|XP_010432512.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010432513.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Camelina 
sativa]
Length=511

 Score =   127 bits (319),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R++I L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  259  NTYVFTKAMGEMVVGAKRENISLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  318

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D++PADMVV
Sbjct  319  LTCFLCDLNAISDVMPADMVV  339



>ref|XP_004506277.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L++++ ++I+RP IVTST+KEPF GW EGVRTIDSLAL Y KG+
Sbjct  235  NTYVFTKAMGEMLVEQLKENLSVVIVRPAIVTSTFKEPFPGWGEGVRTIDSLALAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD K I D IPADMVV
Sbjct  295  LTCFLGDVKAIVDAIPADMVV  315



>gb|KDP42364.1| hypothetical protein JCGZ_01940 [Jatropha curcas]
Length=492

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEMLL   + ++PLLI+RPT++TSTYKEPF GW+EGVRTIDS+  GYAKG+
Sbjct  235  NTYVFTKAIGEMLLMHFKKNMPLLIIRPTMITSTYKEPFPGWIEGVRTIDSVIAGYAKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF+ DP++  D+IP DMVV
Sbjct  295  VTCFISDPQSTLDVIPGDMVV  315



>ref|XP_010447195.1| PREDICTED: fatty acyl-CoA reductase 3-like [Camelina sativa]
Length=491

 Score =   127 bits (318),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R++I L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  239  NTYVFTKAMGEMVVGAKRENISLVMLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D++PADMVV
Sbjct  299  LTCFLCDLNAISDVMPADMVV  319



>ref|XP_009376588.1| PREDICTED: fatty acyl-CoA reductase 3-like [Pyrus x bretschneideri]
Length=490

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++P++I+RPTI++STYKEPF GWVEG+RTIDS+A+GY KG+
Sbjct  235  NTYVFTKAMGEMLIGDLKENLPVVIIRPTIISSTYKEPFPGWVEGIRTIDSIAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D+IPADMVV
Sbjct  295  LTFFLCDIDAIVDVIPADMVV  315



>gb|AIE57506.1| CER4 [Camelina sativa]
Length=468

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R++I L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  216  NTYVFTKAMGEMVVGAKRENISLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  275

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D++PADMVV
Sbjct  276  LTCFLCDLNAISDVMPADMVV  296



>ref|XP_009338685.1| PREDICTED: fatty acyl-CoA reductase 3-like [Pyrus x bretschneideri]
Length=490

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++P++I+RPTI++STYKEPF GWVEG+RTIDS+A+GY KG+
Sbjct  235  NTYVFTKAMGEMLIGDLKENLPVVIIRPTIISSTYKEPFPGWVEGIRTIDSIAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL D   I D+IPADMVV
Sbjct  295  LTFFLCDIDAIVDVIPADMVV  315



>ref|XP_010535678.1| PREDICTED: fatty acyl-CoA reductase 3-like [Tarenaya hassleriana]
Length=489

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R++  L+ILRP I+TST KEPF GW EGVRTIDSLA+GY KG+
Sbjct  235  NTYVFTKAMGEMLVGAKRENTSLVILRPAIITSTLKEPFPGWTEGVRTIDSLAVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I+DLIP DMV 
Sbjct  295  LTCFLGDLNAISDLIPGDMVA  315



>ref|XP_010686043.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Beta 
vulgaris subsp. vulgaris]
Length=491

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            N YVFTKA+GEM+L   + DIPL+I+RPTIVTST+KEP  GWVEG+RTIDSLA+ Y KGR
Sbjct  235  NVYVFTKALGEMMLLHEKGDIPLVIIRPTIVTSTFKEPIPGWVEGIRTIDSLAVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFLGDP +I D+IPADMV
Sbjct  295  LPCFLGDPDSIADVIPADMV  314



>ref|XP_010943712.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Elaeis guineensis]
Length=490

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYV+TKA+GEMLLG LR D+PL+ILRPTI+TS YKEP  GW+EG RTID L +GYAKG+
Sbjct  235  NTYVYTKALGEMLLGHLRGDLPLVILRPTIITSIYKEPLPGWIEGSRTIDILIIGYAKGK  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L+CF G+P+ I DL+P DMV
Sbjct  295  LSCFFGEPELIADLVPGDMV  314



>gb|KFK30008.1| hypothetical protein AALP_AA7G205800 [Arabis alpina]
Length=493

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R++I L+++RP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  239  NTYVFTKAMGEMIVGVKRENISLVLIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D+IPADMVV
Sbjct  299  LTCFLTDVNAISDVIPADMVV  319



>ref|XP_006283617.1| hypothetical protein CARUB_v10004673mg [Capsella rubella]
 gb|EOA16515.1| hypothetical protein CARUB_v10004673mg [Capsella rubella]
Length=491

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R +I L++LRP+I+TST+KEPF GW EGVRTIDSLA+GY KG+
Sbjct  239  NTYVFTKAMGEMVVGAKRGNISLVLLRPSIITSTFKEPFSGWTEGVRTIDSLAVGYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D++PADMVV
Sbjct  299  LTCFLCDLNAISDVMPADMVV  319



>gb|AEV53412.1| fatty acyl-CoA reductase 3 [Populus tomentosa]
Length=489

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLL   +D +PL+I+RPT+V STYKEPF GW+EGVRTIDS+ +GY KGR
Sbjct  235  NTYVFTKAMGEMLLVNFKDGLPLVIIRPTMVASTYKEPFPGWIEGVRTIDSIIVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF+  P++  D+IPADMVV
Sbjct  295  VTCFISGPRSTLDVIPADMVV  315



>ref|XP_002867157.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43416.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=493

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+++ L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  239  NTYVFTKAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   I+D++PADMVV
Sbjct  299  LTCFLCDLNAISDVLPADMVV  319



>ref|XP_003539173.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
 gb|KHN38646.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   125 bits (315),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L++++ ++I+RPT+VTSTY+EPF GWVEGVRTIDSL + Y KG+
Sbjct  235  NTYVFTKAMGEMLIETLKENVSVVIVRPTMVTSTYREPFPGWVEGVRTIDSLIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D K   D+IPADMVV
Sbjct  295  LTCFLADIKATFDVIPADMVV  315



>ref|XP_003539817.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
1 [Glycine max]
 gb|KHN21131.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+ ++ ++ +RPTIVTST+KEPF GW EGVRTIDSLA+ Y KG+
Sbjct  237  NTYVFTKAMGEMLVEQLKGNLSVVTIRPTIVTSTFKEPFPGWAEGVRTIDSLAVAYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD K I D IPADMVV
Sbjct  297  LTCFLGDLKAIVDAIPADMVV  317



>ref|XP_006487974.1| PREDICTED: fatty acyl-CoA reductase 3-like [Citrus sinensis]
Length=492

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK MGEM +  L++++ + I+RPTIVT TYKEPF GW EG+RTIDSLALGY KGR
Sbjct  235  NTYVFTKVMGEMFIEHLKENMSVAIVRPTIVTGTYKEPFPGWAEGIRTIDSLALGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADM  238
            LTCFLGD K I D+IPADM
Sbjct  295  LTCFLGDVKGIVDVIPADM  313



>ref|XP_006400757.1| hypothetical protein EUTSA_v10013355mg [Eutrema salsugineum]
 gb|ESQ42210.1| hypothetical protein EUTSA_v10013355mg [Eutrema salsugineum]
Length=493

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+GK R+++PL+ILRPT++TST  EPF GW+EG+RTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLMGKYRENLPLVILRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  295  LKCFLADSNSVFDLIPADMVV  315



>emb|CDX69007.1| BnaC01g04460D [Brassica napus]
Length=493

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R ++PL+++RP+I+TST KEPF GW EG+RTID+L +GY KGR
Sbjct  239  NTYVFTKAMGEMIVGAKRGNLPLVLIRPSIITSTIKEPFPGWTEGIRTIDTLGVGYGKGR  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   ++D++PADMVV
Sbjct  299  LTCFLGDLNAVSDVMPADMVV  319



>ref|XP_004487511.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=491

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+ +LR ++ ++ILRPTIVTST+KEPF GW EG+RTIDSLA+ Y KG+
Sbjct  236  NTYVFTKAVGEMLVEQLRGNLSVVILRPTIVTSTFKEPFPGWSEGIRTIDSLAVAYGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L+CFLGD + + D+IPADMVV
Sbjct  296  LSCFLGDVECVVDIIPADMVV  316



>ref|XP_011088867.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Sesamum 
indicum]
Length=442

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDD---IPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYA  172
            NTY FTKAMGEMLLG L+DD   + L+I+RPTI+TST+KEPF GW+EGVR IDS  +GY 
Sbjct  234  NTYSFTKAMGEMLLGHLKDDKTPLALVIIRPTIITSTFKEPFPGWLEGVRNIDSFIVGYG  293

Query  173  KGRLTCFLGDPKTITDLIPADMVV  244
            KG++TCF G P++I DLIPADMVV
Sbjct  294  KGKMTCFPGCPQSIVDLIPADMVV  317



>ref|XP_004145802.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cucumis sativus]
 gb|KGN46945.1| hypothetical protein Csa_6G152310 [Cucumis sativus]
Length=493

 Score =   124 bits (312),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++PL+I+RPTI+TSTYKEPF GW+EG RTIDSL +GYAKG+
Sbjct  237  NTYVFTKAMGEMLINDLKHNLPLIIIRPTIITSTYKEPFSGWIEGTRTIDSLIVGYAKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT    D  +I D+IPADMVV
Sbjct  297  LTFIPCDTNSIIDVIPADMVV  317



>ref|NP_190040.3| fatty acyl-CoA reductase 4 [Arabidopsis thaliana]
 sp|Q9LXN3.1|FACR4_ARATH RecName: Full=Probable fatty acyl-CoA reductase 4 [Arabidopsis 
thaliana]
 emb|CAB88536.1| acyl CoA reductase-protein [Arabidopsis thaliana]
 gb|AEE77912.1| fatty acid reductase 4 [Arabidopsis thaliana]
Length=493

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL DP ++ DLIP DMV 
Sbjct  295  LKCFLADPNSVLDLIPVDMVA  315



>gb|KHN38645.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=493

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+ ++ ++I+RP+IVTST KEPF GW EGVRTIDSLA+ Y KG+
Sbjct  237  NTYVFTKAMGEMLVEQLKGNLSVVIIRPSIVTSTLKEPFPGWAEGVRTIDSLAVAYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD K I D IPADMVV
Sbjct  297  LTCFLGDLKAIVDAIPADMVV  317



>ref|XP_006591085.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Glycine 
max]
Length=493

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+ +L+ ++ ++I+RP+IVTST KEPF GW EGVRTIDSLA+ Y KG+
Sbjct  237  NTYVFTKAMGEMLVEQLKGNLSVVIIRPSIVTSTLKEPFPGWAEGVRTIDSLAVAYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD K I D IPADMVV
Sbjct  297  LTCFLGDLKAIVDAIPADMVV  317



>ref|NP_567936.5| fatty acyl-CoA reductase CER4 [Arabidopsis thaliana]
 sp|Q93ZB9.1|FACR3_ARATH RecName: Full=Fatty acyl-CoA reductase 3; AltName: Full=Protein 
ECERIFERUM 4 [Arabidopsis thaliana]
 gb|AAL15288.1| AT4g33790/T16L1_280 [Arabidopsis thaliana]
 gb|AAL49822.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|AEE86278.1| fatty acyl-CoA reductase CER4 [Arabidopsis thaliana]
Length=493

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+++ L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  239  NTYVFTKAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   ++D++PADMVV
Sbjct  299  LTCFLCDLDAVSDVMPADMVV  319



>gb|AES88411.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=494

 Score =   124 bits (312),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLL   +D++PL+I+RPT++TST K+PF GW+EG+RTIDSL   Y  G+
Sbjct  236  NTYTFTKAMGEMLLVHHKDNVPLIIIRPTMITSTNKDPFPGWIEGLRTIDSLIYAYGHGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            + CFLG+PKT+ D IPADMV+
Sbjct  296  VKCFLGNPKTVIDAIPADMVI  316



>emb|CAA20592.1| male sterility 2-like protein [Arabidopsis thaliana]
Length=463

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+++ L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  209  NTYVFTKAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  268

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   ++D++PADMVV
Sbjct  269  LTCFLCDLDAVSDVMPADMVV  289



>emb|CAB80096.1| male sterility 2-like protein [Arabidopsis thaliana]
Length=480

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+++ L++LRP+I+TST+KEPF GW EG+RTIDSLA+GY KG+
Sbjct  226  NTYVFTKAMGEMMVGTKRENLSLVLLRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGKGK  285

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL D   ++D++PADMVV
Sbjct  286  LTCFLCDLDAVSDVMPADMVV  306



>ref|XP_002875671.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51930.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
Length=493

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNHRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL DP ++ DLIP DMV
Sbjct  295  LKCFLADPNSVLDLIPVDMV  314



>ref|XP_004171145.1| PREDICTED: fatty acyl-CoA reductase 3-like, partial [Cucumis 
sativus]
Length=400

 Score =   124 bits (310),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++PL+I+RPTI+TSTYKEPF GW+EG RTIDSL +GYAKG+
Sbjct  237  NTYVFTKAMGEMLINDLKHNLPLIIIRPTIITSTYKEPFSGWIEGTRTIDSLIVGYAKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT    D  +I D+IPADMVV
Sbjct  297  LTFIPCDTNSIIDVIPADMVV  317



>ref|XP_002529056.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF33300.1| Male sterility protein, putative [Ricinus communis]
Length=493

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAM EMLL  +++++PLLI+RPT++TSTYK+PF GW+EGVRTIDS+ +GY K +
Sbjct  235  NTYVFTKAMAEMLLVHMKENLPLLIIRPTMITSTYKQPFPGWIEGVRTIDSVIVGYGKRK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF+  P++I D+IPADMVV
Sbjct  295  ITCFVSSPRSILDVIPADMVV  315



>ref|XP_011088866.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Sesamum 
indicum]
Length=494

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDD---IPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYA  172
            NTY FTKAMGEMLLG L+DD   + L+I+RPTI+TST+KEPF GW+EGVR IDS  +GY 
Sbjct  234  NTYSFTKAMGEMLLGHLKDDKTPLALVIIRPTIITSTFKEPFPGWLEGVRNIDSFIVGYG  293

Query  173  KGRLTCFLGDPKTITDLIPADMVV  244
            KG++TCF G P++I DLIPADMVV
Sbjct  294  KGKMTCFPGCPQSIVDLIPADMVV  317



>ref|XP_008229411.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Prunus 
mume]
Length=789

 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ L + +D++P++I+RPT+VTSTYKEPF GW++G RTIDS+  GY KG+
Sbjct  237  NTYVFTKAMGEVFLRRSKDELPVVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP T+ D+IP DMVV
Sbjct  297  LTCLLADPSTVFDMIPVDMVV  317


 Score =   126 bits (316),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ L + +D++P++I+RPT+VTSTYKEPF GW++G RTIDS+  GY KG+
Sbjct  533  NTYVFTKAMGEVFLRRSKDELPVVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGK  592

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP T+ D+IP DMVV
Sbjct  593  LTCLLADPSTVFDMIPVDMVV  613



>ref|XP_002872001.1| hypothetical protein ARALYDRAFT_489098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48260.1| hypothetical protein ARALYDRAFT_489098 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R+ +PL+I+RPTI+TST+ +PF GW+EG++TIDS+ + Y KG 
Sbjct  109  NTYVFTKAMGEMLIGHYRESMPLVIIRPTIITSTFSDPFPGWIEGLKTIDSVIIFYGKGM  168

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D KT+ D+IP DMVV
Sbjct  169  LKCFLVDQKTVCDIIPVDMVV  189



>ref|XP_002875662.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51921.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=446

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+++ ++I+RP+I+TST+KEPF GW EG+RTIDSLA+GY  G+
Sbjct  191  NTYVFTKAMGEMIVGVKRENMSVVIIRPSIITSTFKEPFPGWTEGIRTIDSLAVGYGTGK  250

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD    +D+IPADMVV
Sbjct  251  LTCFLGDLNATSDVIPADMVV  271



>gb|KDO58051.1| hypothetical protein CISIN_1g037479mg [Citrus sinensis]
Length=492

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK MGEM +  L++++ + I+RPTI+T TYKEPF GW EG+RTIDSLA+GY KGR
Sbjct  235  NTYVFTKVMGEMFIEHLKENMSVAIVRPTIITGTYKEPFPGWAEGIRTIDSLAVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADM  238
            LTCFLGD K I D+IPADM
Sbjct  295  LTCFLGDVKGIVDVIPADM  313



>gb|KFK39898.1| hypothetical protein AALP_AA3G303100 [Arabis alpina]
Length=495

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R++ PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  236  NTYVFTKAMGEMLMGHYRENFPLIIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  296  LKCFLADSNSVFDLIPADMVV  316



>ref|XP_006291287.1| hypothetical protein CARUB_v10017423mg, partial [Capsella rubella]
 gb|EOA24185.1| hypothetical protein CARUB_v10017423mg, partial [Capsella rubella]
Length=385

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST+ EPF GW+EG+RTIDS+ + + KGR
Sbjct  226  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVVVAFGKGR  285

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL +P ++ DLIP DMV
Sbjct  286  LKCFLANPNSVLDLIPVDMV  305



>ref|XP_006349114.1| PREDICTED: fatty acyl-CoA reductase 1-like [Solanum tuberosum]
Length=485

 Score =   123 bits (309),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG  ++D+ L+I+RPTI+TSTYKEPF GW+EGV+T+DS  LGY KG 
Sbjct  227  NTYSFTKAMGEMLLGHYKEDLRLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILGYGKGV  286

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L    GDP TI D+IP DMVV
Sbjct  287  LNFCFGDPNTILDMIPGDMVV  307



>ref|XP_008352400.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Malus 
domestica]
Length=370

 Score =   122 bits (307),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ L   + ++PL+I+RPT+VTSTYKEPF GW++G RTIDS+  GY KG+
Sbjct  165  NTYVFTKAMGEIFLENSKGNLPLVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGK  224

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP ++ D+IP DMVV
Sbjct  225  LTCLLADPMSVFDMIPVDMVV  245



>ref|XP_007150088.1| hypothetical protein PHAVU_005G125500g [Phaseolus vulgaris]
 gb|ESW22082.1| hypothetical protein PHAVU_005G125500g [Phaseolus vulgaris]
Length=491

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  + ++ ++I+RPTIVTSTY+EPF GW+EG+RTIDSL + Y +G+
Sbjct  235  NTYVFTKAMGEMIVGTTKGNMNVVIVRPTIVTSTYREPFPGWIEGLRTIDSLVVAYGRGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCFLGD K + DLIPADMVV
Sbjct  295  ITCFLGDIKAVFDLIPADMVV  315



>ref|XP_011044902.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Populus 
euphratica]
Length=490

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            N YVFT AMGEMLL   +D +PLLI+RPT+V STYKEPF GW+EGVRTIDS+ +GY KGR
Sbjct  235  NPYVFTTAMGEMLLVNFKDSLPLLIIRPTMVASTYKEPFPGWIEGVRTIDSVIVGYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF+  P++  D+IPADMVV
Sbjct  295  VTCFISGPRSTLDVIPADMVV  315



>ref|XP_008458594.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Cucumis 
melo]
Length=442

 Score =   122 bits (307),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++PL+I+RPTIVTSTYKEPF GW+EG+RTID+  +GYAKG+
Sbjct  236  NTYVFTKAMGEMLINDLKHNLPLIIIRPTIVTSTYKEPFSGWIEGMRTIDNFIVGYAKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT    D  +I D+IPADMVV
Sbjct  296  LTFIPCDTNSIIDMIPADMVV  316



>ref|XP_010514784.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina 
sativa]
Length=433

 Score =   122 bits (307),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNNHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL DP ++ DL+P DMV
Sbjct  295  LKCFLADPNSVLDLVPVDMV  314



>emb|CDY26934.1| BnaC09g36490D [Brassica napus]
Length=493

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R+++PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLIGSSRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  +I DLIPADMVV
Sbjct  295  LKCFLADSTSIFDLIPADMVV  315



>ref|XP_006419126.1| hypothetical protein EUTSA_v10002497mg [Eutrema salsugineum]
 gb|ESQ37562.1| hypothetical protein EUTSA_v10002497mg [Eutrema salsugineum]
Length=495

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM++G  R+++ L+ILRP+I++ST+KEPF GW EG+RTID +A+GY  G+
Sbjct  240  NTYVFTKAMGEMMVGATRENMSLVILRPSIISSTFKEPFPGWTEGIRTIDGIAVGYGTGK  299

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   I D+IP DMVV
Sbjct  300  LTCFLGDLNAIIDVIPVDMVV  320



>emb|CDY30935.1| BnaA06g19780D [Brassica napus]
Length=493

 Score =   122 bits (307),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++PL+I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ DLIP DMV
Sbjct  295  LKCFLADSNSVLDLIPVDMV  314



>ref|NP_197642.1| fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
 sp|Q39152.1|FACR1_ARATH RecName: Full=Fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
 emb|CAA68191.1| male sterility 2-like protein [Arabidopsis thaliana]
 dbj|BAB09122.1| male sterility 2-like protein [Arabidopsis thaliana]
 gb|AAK59547.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|AAK93752.1| putative male sterility 2 protein [Arabidopsis thaliana]
 gb|ABZ10951.1| fatty acyl CoA reductase [Arabidopsis thaliana]
 gb|AED93034.1| fatty acyl-CoA reductase 1 [Arabidopsis thaliana]
Length=491

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+GK R+++PL+I+RPT++TST  EPF GW+EG++T+DS+ + Y KGR
Sbjct  233  NTYVFTKAMGEMLMGKYRENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGR  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  293  LKCFLADSNSVFDLIPADMVV  313



>ref|XP_002872004.1| hypothetical protein ARALYDRAFT_910242 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48263.1| hypothetical protein ARALYDRAFT_910242 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+GK R+++PL+I+RPT++TST  EPF GW+EG++T+DS+ + Y KGR
Sbjct  233  NTYVFTKAMGEMLMGKYRENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGR  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  293  LKCFLADSNSVFDLIPADMVV  313



>ref|XP_009364295.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Pyrus 
x bretschneideri]
Length=493

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+++ + +D++P+LILRPT+VTSTYKEPF GWV+G RTIDS+  GY KG+
Sbjct  236  NTYVFTKAMGEIVIEQSKDNLPVLILRPTVVTSTYKEPFPGWVQGFRTIDSVIAGYCKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP ++ D+IP DMVV
Sbjct  296  LTCLLFDPTSVFDMIPVDMVV  316



>ref|XP_008458595.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Cucumis 
melo]
Length=401

 Score =   122 bits (305),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++PL+I+RPTIVTSTYKEPF GW+EG+RTID+  +GYAKG+
Sbjct  236  NTYVFTKAMGEMLINDLKHNLPLIIIRPTIVTSTYKEPFSGWIEGMRTIDNFIVGYAKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT    D  +I D+IPADMVV
Sbjct  296  LTFIPCDTNSIIDMIPADMVV  316



>ref|XP_009150272.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Brassica rapa]
Length=493

 Score =   122 bits (307),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++PL+I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ DLIP DMV
Sbjct  295  LKCFLADSNSVLDLIPVDMV  314



>ref|XP_004291621.1| PREDICTED: fatty acyl-CoA reductase 1-like [Fragaria vesca subsp. 
vesca]
Length=493

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ L + +D++PL+I+RPTIVTSTYKEPF GW++G RTIDS+  GY KG+
Sbjct  236  NTYVFTKAMGEIFLQRSKDNLPLVIVRPTIVTSTYKEPFPGWIQGFRTIDSVIAGYCKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP T+ D+IP DM+V
Sbjct  296  LTCLLVDPATVLDMIPVDMLV  316



>ref|XP_009762890.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Nicotiana 
sylvestris]
Length=272

 Score =   120 bits (300),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG L++++ L+I+RPTI+TSTYKEPF GW+EGV+T+DS  LGY KG 
Sbjct  16   NTYSFTKAMGEMLLGHLKENLQLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILGYGKGI  75

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L    GDP T  D IP DMVV
Sbjct  76   LNFCFGDPNTKIDAIPGDMVV  96



>emb|CDX92346.1| BnaA10g13850D [Brassica napus]
Length=493

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R+++PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLIGSSRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  295  LKCFLADSTSVFDLIPADMVV  315



>ref|XP_009120651.1| PREDICTED: fatty acyl-CoA reductase 1 [Brassica rapa]
Length=493

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R+++PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLIGSSRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  295  LKCFLADSTSVFDLIPADMVV  315



>ref|XP_007205112.1| hypothetical protein PRUPE_ppa004772mg [Prunus persica]
 gb|EMJ06311.1| hypothetical protein PRUPE_ppa004772mg [Prunus persica]
Length=492

 Score =   122 bits (305),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ LG+ +D +P++I+RP+++TS+YKEPF GWV+G RTIDS+  GY KG+
Sbjct  236  NTYVFTKAMGEIFLGESKDHLPIVIIRPSVITSSYKEPFPGWVQGFRTIDSVIAGYCKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP ++ D+IP DMVV
Sbjct  296  LTCLLVDPMSVLDMIPVDMVV  316



>gb|KFK39899.1| hypothetical protein AALP_AA3G303200 [Arabis alpina]
Length=495

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  R+++PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  236  NTYVFTKAMGEMLMGNYRENLPLVIIRPTMITSTLAEPFPGWIEGLRTIDSVIVAYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIP DMVV
Sbjct  296  LKCFLADSNSVFDLIPVDMVV  316



>ref|XP_007150087.1| hypothetical protein PHAVU_005G125400g [Phaseolus vulgaris]
 gb|ESW22081.1| hypothetical protein PHAVU_005G125400g [Phaseolus vulgaris]
Length=524

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+ KL+ ++ ++I+RPTIVTST KEPF GWVEG+RTIDSLA+ Y KG+
Sbjct  269  NTYVFTKAVGEMLVEKLKGNLSVVIIRPTIVTSTMKEPFPGWVEGIRTIDSLAVTYGKGK  328

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   + D++PADMVV
Sbjct  329  LTCFLGDINGVVDVVPADMVV  349



>ref|XP_006279379.1| hypothetical protein CARUB_v10007997mg [Capsella rubella]
 gb|EOA12277.1| hypothetical protein CARUB_v10007997mg [Capsella rubella]
Length=368

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST+ EPF GW+EG+RT+DS+ + + KGR
Sbjct  110  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTLDSVVVAFGKGR  169

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL DP ++ DLIP DMV 
Sbjct  170  LKCFLADPNSVLDLIPVDMVA  190



>emb|CDY21232.1| BnaC03g53920D [Brassica napus]
Length=492

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++PL+I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  234  NTYVFTKSMGEMLLGNHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  293

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ DLIP DMV
Sbjct  294  LKCFLADSNSVLDLIPVDMV  313



>gb|AAR88762.1| acyl CoA reductase [Hevea brasiliensis]
Length=382

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G L++++PL+I+RP+++TSTYKEPF GW+EG RTID+L L Y KGR
Sbjct  126  NTYVFTKAMGEMLVGHLKENLPLVIIRPSMITSTYKEPFPGWIEGARTIDALTLSYGKGR  185

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT F+  P  I D+IP DMVV
Sbjct  186  LTFFVAGPALIIDVIPGDMVV  206



>ref|XP_007208215.1| hypothetical protein PRUPE_ppa018909mg [Prunus persica]
 gb|EMJ09414.1| hypothetical protein PRUPE_ppa018909mg [Prunus persica]
Length=493

 Score =   122 bits (305),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+LL   +D++ ++I+RPT+VTSTYKEPF GWV+G RTIDS+  GY KG+
Sbjct  236  NTYVFTKAMGEILLRHSKDNLSVVIIRPTVVTSTYKEPFPGWVQGFRTIDSVIAGYCKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DPK++ D++P DMVV
Sbjct  296  LTCLLVDPKSVFDMVPVDMVV  316



>ref|XP_009364296.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Pyrus 
x bretschneideri]
Length=492

 Score =   121 bits (304),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ L   + ++PL+I+RPT+VTSTYKEPF GW++G RTIDS+  GY KG+
Sbjct  237  NTYVFTKAMGEIFLENSKGNLPLVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAGYCKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP ++ D+IP DMVV
Sbjct  297  LTCLLADPMSVFDMIPVDMVV  317



>ref|XP_010248281.1| PREDICTED: fatty acyl-CoA reductase 2-like, partial [Nelumbo 
nucifera]
Length=343

 Score =   120 bits (301),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            +TYVFTKAMGEMLL  +R DIP++I+RP+++ ST +EPF GW+EG+R +D + L Y KG+
Sbjct  89   DTYVFTKAMGEMLLNSMRGDIPVVIMRPSVIESTLREPFPGWIEGIRMMDPIILSYGKGQ  148

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL DPKT+ D+IPADMVV
Sbjct  149  LTGFLTDPKTVLDVIPADMVV  169



>gb|KFK33883.1| hypothetical protein AALP_AA5G072700, partial [Arabis alpina]
Length=481

 Score =   121 bits (304),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  +++ PL+I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNHKENFPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ DLIP DMV
Sbjct  295  LKCFLADSNSVLDLIPVDMV  314



>ref|XP_008378258.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Malus 
domestica]
Length=314

 Score =   120 bits (300),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+++   + ++P+LILRPT+VTSTYKEPF GWV+G RTIDS+  GY KG+
Sbjct  57   NTYVFTKAMGEIVIXHSKXNLPVLILRPTVVTSTYKEPFPGWVQGFRTIDSVIAGYCKGK  116

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP ++ D+IP DMVV
Sbjct  117  LTCLLFDPTSVFDMIPVDMVV  137



>ref|XP_010514783.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Camelina 
sativa]
Length=493

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNNHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL DP ++ DL+P DMV
Sbjct  295  LKCFLADPNSVLDLVPVDMV  314



>ref|XP_008353939.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Malus 
domestica]
Length=493

 Score =   121 bits (304),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+ L   R+++PL+I+RPT+VTSTYKEPF GW++G RTIDS+   Y KG+
Sbjct  237  NTYVFTKAMGEIFLENSRENLPLVIIRPTVVTSTYKEPFPGWIQGFRTIDSVIAAYCKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTC L DP ++ D+IP DMVV
Sbjct  297  LTCLLVDPMSVFDMIPVDMVV  317



>ref|XP_002523777.1| Male sterility protein, putative [Ricinus communis]
 gb|EEF38503.1| Male sterility protein, putative [Ricinus communis]
Length=493

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM+L  +++D+ LLI+RPT++TSTY+EPF GW+EG RT+DS+ +GY KG+
Sbjct  235  NTYVFTKAMGEMILMHMKEDLSLLIIRPTMITSTYREPFPGWIEGARTVDSVIVGYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            + CF+  P+++ D+IPADMVV
Sbjct  295  VGCFVSRPESVLDVIPADMVV  315



>emb|CDP06949.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   120 bits (301),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM+L + ++ + ++I+RPTIVTST+K+PF GW++GVRTIDS  + Y KG+
Sbjct  127  NTYVFTKAMGEMVLEQFKEKLKVVIVRPTIVTSTFKDPFPGWIQGVRTIDSFLVAYGKGK  186

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L   LGDPK+I DLIP DMVV
Sbjct  187  LKFVLGDPKSILDLIPGDMVV  207



>ref|XP_010535677.1| PREDICTED: fatty acyl-CoA reductase 1-like [Tarenaya hassleriana]
Length=487

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R+ +PL+I+RPT++TST  EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKAMGEMLLGSHRESMPLVIIRPTMITSTLSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPADM  238
            L CFL DP ++ DLIP DM
Sbjct  295  LKCFLADPNSVFDLIPVDM  313



>ref|XP_010493325.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Camelina sativa]
Length=493

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +P++++RPTI+TST  +PF GW+EG++TIDS+ L Y KG 
Sbjct  235  NTYVFTKAMGEMLLGHCRGSMPIVVIRPTIITSTISDPFPGWIEGLKTIDSVILSYGKGM  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D KT+ D+IPADMVV
Sbjct  295  LKCFLVDQKTVCDIIPADMVV  315



>ref|XP_008245932.1| PREDICTED: fatty acyl-CoA reductase 3-like [Prunus mume]
Length=314

 Score =   119 bits (298),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GE+ LG+ +D  P++I+RP+++TS+YKEPF GWV+G RTIDS+  GY KG+
Sbjct  57   NTYVFTKAVGEIFLGQSKDHFPIVIIRPSVITSSYKEPFPGWVQGFRTIDSVIAGYCKGK  116

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TC L DP ++ D+IP DMVV
Sbjct  117  VTCLLVDPMSVFDMIPVDMVV  137



>ref|XP_002305562.1| hypothetical protein POPTR_0004s19600g [Populus trichocarpa]
 gb|EEE86073.1| hypothetical protein POPTR_0004s19600g [Populus trichocarpa]
Length=490

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+   +DD+P+LI+RPT+V STYKEPF GW+EG+RTIDS+ +GY  G+
Sbjct  235  NTYVFTKAMGEMLVVNFKDDLPVLIIRPTMVASTYKEPFPGWIEGLRTIDSIIVGYGIGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            ++CF+  P+   D+IPADMVV
Sbjct  295  VSCFISGPQATLDVIPADMVV  315



>ref|XP_006419124.1| hypothetical protein EUTSA_v10002499mg [Eutrema salsugineum]
 gb|ESQ37560.1| hypothetical protein EUTSA_v10002499mg [Eutrema salsugineum]
Length=493

 Score =   120 bits (301),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++PL+I+RPT++TST+ EPF GW+EG+RTIDS+ + + KGR
Sbjct  235  NTYVFTKSMGEMLLGYHRENLPLVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAFGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DLIP D
Sbjct  295  LKCFLADPNSVLDLIPVD  312



>ref|NP_197634.1| putative fatty acyl-CoA reductase 7 [Arabidopsis thaliana]
 sp|Q9FMQ9.1|FACR7_ARATH RecName: Full=Putative fatty acyl-CoA reductase 7 [Arabidopsis 
thaliana]
 dbj|BAB08341.1| acyl CoA reductase-like protein [Arabidopsis thaliana]
 gb|AED93024.1| putative fatty acyl-CoA reductase 7 [Arabidopsis thaliana]
Length=409

 Score =   119 bits (299),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R+ +P++I+RPTI+TST+ +PF GW+EG++T+DS+ + Y KG 
Sbjct  162  NTYVFTKAMGEMLLGHYRETMPIVIIRPTIITSTFSDPFPGWIEGLKTVDSVIIFYGKGI  221

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D KT+ D+IP DMVV
Sbjct  222  LKCFLVDQKTVCDIIPVDMVV  242



>ref|XP_007020559.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12084.1| Fatty acid reductase 4 [Theobroma cacao]
Length=492

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  + D+PL+I+RPT++ S YKEPF GW+EGVRTID + + Y KG+
Sbjct  237  NTYVFTKAMGEMLLGNFKGDLPLVIIRPTMIASPYKEPFPGWIEGVRTIDRVIVSYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF G P    D+IPADMVV
Sbjct  297  LTCFPGYPSYALDVIPADMVV  317



>ref|XP_006279365.1| hypothetical protein CARUB_v10007993mg [Capsella rubella]
 gb|EOA12263.1| hypothetical protein CARUB_v10007993mg [Capsella rubella]
Length=493

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+++P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNQRENLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DLIP D
Sbjct  295  LKCFLADPNSVLDLIPVD  312



>sp|Q9XGY7.1|FAR_SIMCH RecName: Full=Alcohol-forming fatty acyl-CoA reductase [Simmondsia 
chinensis]
 gb|AAD38039.1|AF149917_1 acyl CoA reductase [Simmondsia chinensis]
 gb|AAD38040.1|AF149918_1 acyl CoA reductase [synthetic construct]
 gb|AFI74369.1| acyl-CoA reductase [synthetic construct]
Length=493

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            N YVFTKA+GEMLL + + DIPL I+RPTI+TST+KEPF GWVEGVRTID++ + Y KGR
Sbjct  236  NVYVFTKALGEMLLMQYKGDIPLTIIRPTIITSTFKEPFPGWVEGVRTIDNVPVYYGKGR  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L C L  P TI DLIPADMVV
Sbjct  296  LRCMLCGPSTIIDLIPADMVV  316



>ref|XP_010454504.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Camelina sativa]
Length=489

 Score =   119 bits (299),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +P +I+RPTI+TST  +PF GW+EG++T+DS+ L Y KG 
Sbjct  235  NTYVFTKAMGEMLLGHYRGSMPTVIIRPTIITSTISDPFPGWIEGLKTVDSVILSYGKGM  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D KT+ D+IPADMVV
Sbjct  295  LKCFLVDQKTVCDIIPADMVV  315



>ref|XP_003596783.1| Fatty acyl-CoA reductase [Medicago truncatula]
 gb|AES67034.1| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+ KL+ ++ ++ILRP IVTST +EPF GWVEG+RTIDSLA+ Y KG+
Sbjct  237  NTYVFTKALGEMLVEKLKGNLSVVILRPAIVTSTLREPFPGWVEGLRTIDSLAVVYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   + D IPADMVV
Sbjct  297  LTCFLGDINGVVDAIPADMVV  317



>ref|XP_009419426.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R D+P++ILRPTI+TS   +P  GWVEG RTIDS+ +GYAKG+
Sbjct  235  NTYVFTKAMGEMLLGHSRGDLPMVILRPTIITSVQSDPLPGWVEGTRTIDSVLIGYAKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF GD   I D++P DMVV
Sbjct  295  ITCFFGDLDIIMDVVPGDMVV  315



>ref|XP_009373003.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Pyrus 
x bretschneideri]
Length=490

 Score =   119 bits (298),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GE+ L   +D++PL+I+RPTIVTSTYKEPF GW +G+RTIDS+  GY KG+
Sbjct  234  NTYVFTKAIGEIFLHHSKDNLPLVIIRPTIVTSTYKEPFPGWTQGLRTIDSVFAGYGKGK  293

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L C L DP ++ D+IP DMVV
Sbjct  294  LKCLLVDPMSVFDMIPVDMVV  314



>ref|XP_004506152.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=490

 Score =   119 bits (298),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  +++ + + I+RPT++TSTYKEPF GWVEG+RTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLIETMKETLSIFIVRPTMITSTYKEPFPGWVEGIRTIDSIIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFL + K + D+IPAD VV
Sbjct  295  LTCFLANVKAVFDVIPADFVV  315



>ref|XP_006290972.1| hypothetical protein CARUB_v10017087mg [Capsella rubella]
 gb|EOA23870.1| hypothetical protein CARUB_v10017087mg [Capsella rubella]
Length=493

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  R+ +P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLGNQRETLPIVIIRPTMITSTFSEPFSGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DLIP D
Sbjct  295  LKCFLADPNSVLDLIPVD  312



>ref|XP_010421031.1| PREDICTED: putative fatty acyl-CoA reductase 7 [Camelina sativa]
Length=489

 Score =   119 bits (298),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +P++I+RPTI+TST   PF GW+EG++T+DS+ + Y KG 
Sbjct  235  NTYVFTKAMGEMLLGHYRGSMPIVIIRPTIITSTISNPFPGWIEGLKTVDSVIISYGKGM  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D KT+ D+IPADMVV
Sbjct  295  LRCFLVDQKTVCDIIPADMVV  315



>gb|AES98766.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=492

 Score =   119 bits (298),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+   +D++PL+I+RPT+VTST K+PF GW+EG+RT D++  GY  G+
Sbjct  236  NTYVFTKAMGEMLVVNQKDNVPLIIIRPTMVTSTNKDPFPGWIEGLRTTDTVIRGYGIGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CF+G+P TI D+IPAD+V+
Sbjct  296  LACFVGNPNTILDIIPADLVI  316



>ref|XP_006851509.1| hypothetical protein AMTR_s00040p00158690 [Amborella trichopoda]
 gb|ERN13090.1| hypothetical protein AMTR_s00040p00158690 [Amborella trichopoda]
Length=487

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEM++G LR D+P++I+RP+I+ ST+ +PF GW+EG RTIDSL + + KG+
Sbjct  236  NTYTFTKAMGEMMMGHLRGDLPVVIMRPSIIESTFSDPFPGWMEGARTIDSLIVNFGKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL DP  + D+IPADMVV
Sbjct  296  LKCFLADPNLVLDVIPADMVV  316



>ref|XP_011005173.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Populus euphratica]
Length=495

 Score =   119 bits (298),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID +A+GYAKG
Sbjct  235  NTYVFTKAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKG  294

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            +L  F  +PK   D+IPADMV+
Sbjct  295  KLKHFPFNPKLTVDVIPADMVI  316



>ref|XP_006349112.1| PREDICTED: probable fatty acyl-CoA reductase 5-like, partial 
[Solanum tuberosum]
Length=352

 Score =   118 bits (295),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG  ++D+ L+I+RPTI+TSTYKEPF GW+EGV+T+DS  L Y KG 
Sbjct  231  NTYSFTKAMGEMLLGHYKEDLQLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILAYGKGV  290

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +    GDP T  D+IP DMVV
Sbjct  291  MNFCFGDPNTKLDMIPGDMVV  311



>ref|XP_003615808.1| Fatty acyl-CoA reductase [Medicago truncatula]
Length=497

 Score =   119 bits (298),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+   +D++PL+I+RPT+VTST K+PF GW+EG+RT D++  GY  G+
Sbjct  241  NTYVFTKAMGEMLVVNQKDNVPLIIIRPTMVTSTNKDPFPGWIEGLRTTDTVIRGYGIGK  300

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CF+G+P TI D+IPAD+V+
Sbjct  301  LACFVGNPNTILDIIPADLVI  321



>gb|AES88362.2| gland-specific fatty acyl-CoA reductase [Medicago truncatula]
Length=495

 Score =   119 bits (298),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLL   +D++PL+I+RPT+VTST K+PF GW+EG RT+DS+   Y KG+
Sbjct  239  NTYVFTKAMGEMLLVHHKDNVPLIIIRPTMVTSTSKDPFPGWIEGQRTVDSMICAYGKGK  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L  FLG+P+TI D++PAD+V+
Sbjct  299  LPYFLGNPRTILDIMPADLVI  319



>ref|XP_009610474.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=488

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG L++++ L+I+RPTI+TSTY EPF GW+EGV+T+DS  L Y KG 
Sbjct  232  NTYSFTKAMGEMLLGHLKENLHLVIIRPTIITSTYYEPFPGWIEGVKTVDSFFLAYGKGI  291

Query  182  LTCFLGDPKTITDLIPADMVV  244
               FLGDP T  DLIP DMVV
Sbjct  292  SNIFLGDPNTNVDLIPGDMVV  312



>ref|XP_010255716.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nelumbo nucifera]
Length=493

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG++R+++PL+I+RPTIVTSTY+EPF GW+EG RT+D++   YAK +
Sbjct  236  NTYVFTKAMGEMLLGQMRENVPLVIMRPTIVTSTYREPFPGWIEGFRTVDAMMTAYAKAK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +T +    + I DLIP DMVV
Sbjct  296  MTFWACGLEMIVDLIPGDMVV  316



>ref|XP_006349136.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum tuberosum]
Length=515

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG  ++D+ L+I+RPTI+TSTYK+PF GW+EGV+T+DS  L Y KG 
Sbjct  227  NTYSFTKAMGEMLLGHYKEDLQLVIIRPTIITSTYKDPFPGWIEGVKTVDSFILAYGKGV  286

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +    GDP TI D+IP DMVV
Sbjct  287  MNFCFGDPNTILDMIPGDMVV  307



>ref|XP_009610473.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=491

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG L++++ L+I+RPTI+TSTY EPF GW+EGV+T+DS  L Y KG 
Sbjct  235  NTYSFTKAMGEMLLGHLKENLHLVIIRPTIITSTYYEPFPGWIEGVKTVDSFFLAYGKGI  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
               FLGDP T  DLIP DMVV
Sbjct  295  SNIFLGDPNTNVDLIPGDMVV  315



>ref|XP_006419122.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
 gb|ESQ37558.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
Length=496

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++D+PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKEDLPLVIIRPTMITSTIYEPFSGWIEGLRTVDSVIIAYGKGA  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IP DMV
Sbjct  296  LKCFLADVNSVCDMIPVDMV  315



>gb|EMT08796.1| Fatty acyl-CoA reductase 1 [Aegilops tauschii]
Length=489

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG LR D+P++I+RP+I+TS  KEP  GW+EGVRTIDS+ LGYAK  
Sbjct  234  NTYVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGVRTIDSVFLGYAKQA  293

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L  FL DP TI D+IP DMVV
Sbjct  294  LKFFLVDPNTIMDVIPGDMVV  314



>ref|XP_008228906.1| PREDICTED: fatty acyl-CoA reductase 3-like [Prunus mume]
Length=493

 Score =   118 bits (296),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GE+ LG+ +D  P++I+RP+++TS+YKEPF GWV+G RTIDS+  GY KG+
Sbjct  236  NTYVFTKAVGEIFLGQSKDHFPIVIIRPSVITSSYKEPFPGWVQGFRTIDSVIAGYCKGK  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TC L DP ++ D+IP DMVV
Sbjct  296  VTCLLVDPMSVFDMIPVDMVV  316



>ref|XP_003538130.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Glycine 
max]
Length=492

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++ ++I+RPT++TSTYKEPF GWVEGVRTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D   I D+IPADMVV
Sbjct  295  LPCFLLDINAIFDVIPADMVV  315



>gb|KHN38647.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=492

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++ ++I+RPT++TSTYKEPF GWVEGVRTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D   I D+IPADMVV
Sbjct  295  LPCFLLDINAIFDVIPADMVV  315



>ref|XP_006371441.1| hypothetical protein POPTR_0019s10400g [Populus trichocarpa]
 gb|ERP49238.1| hypothetical protein POPTR_0019s10400g [Populus trichocarpa]
Length=353

 Score =   117 bits (294),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID + +GYAKG
Sbjct  92   NTYVFTKAMGEMLLVHYNRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVVVGYAKG  151

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            +L  F  +P+ I D+IPADMV+
Sbjct  152  KLKHFPFNPQLIVDVIPADMVI  173



>ref|XP_010503104.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X3 [Camelina 
sativa]
Length=433

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++++RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNNHKEDLPVVVIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DL+P D
Sbjct  295  LKCFLADPNSVLDLVPVD  312



>ref|XP_006287458.1| hypothetical protein CARUB_v10000664mg [Capsella rubella]
 gb|EOA20356.1| hypothetical protein CARUB_v10000664mg [Capsella rubella]
Length=536

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  ++++PL+I+RPT++TST  EPF GW+EG++T+DS+ + Y KGR
Sbjct  277  NTYVFTKAMGEMLMGYYKENLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGR  336

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  337  LKCFLADSNSVFDLIPADMVV  357



>ref|XP_007020562.1| Fatty acid reductase 4 [Theobroma cacao]
 gb|EOY12087.1| Fatty acid reductase 4 [Theobroma cacao]
Length=523

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  + D+PL+I+RPT++ STYKEPF GW+EGVRTIDS+ + Y KG+
Sbjct  237  NTYVFTKAMGEMLLGNFKGDLPLVIIRPTMIASTYKEPFPGWIEGVRTIDSVIVSYGKGK  296

Query  182  LTCFLGDPKTITDLIPAD  235
            LTCF G P +  D IPAD
Sbjct  297  LTCFPGYPNSALD-IPAD  313



>ref|XP_010425873.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina 
sativa]
Length=433

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 48/78 (62%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNYHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DL+P D
Sbjct  295  LKCFLADPNSVLDLVPVD  312



>ref|XP_009785725.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nicotiana sylvestris]
 ref|XP_009785726.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nicotiana sylvestris]
Length=489

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG L++D+ L+ILRPTI+ STYKEPF GW+EG+RT D+  + Y KG+
Sbjct  234  NTYTFTKAMGEMLLGHLKEDLQLIILRPTIILSTYKEPFPGWIEGMRTADTFIVAYGKGK  293

Query  182  LTCFLGDPKTITDLIPADMVV  244
                +GD ++I D+IPADMVV
Sbjct  294  QNVIMGDKESIIDVIPADMVV  314



>ref|XP_006591086.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X2 [Glycine 
max]
Length=443

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++ ++I+RPT++TSTYKEPF GWVEGVRTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLVETLKKNMSVIIVRPTMITSTYKEPFPGWVEGVRTIDSVIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D   I D+IPADMVV
Sbjct  295  LPCFLLDINAIFDVIPADMVV  315



>ref|XP_006419123.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
 gb|ESQ37559.1| hypothetical protein EUTSA_v10002495mg [Eutrema salsugineum]
Length=457

 Score =   117 bits (294),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++D+PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKEDLPLVIIRPTMITSTIYEPFSGWIEGLRTVDSVIIAYGKGA  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IP DMV
Sbjct  296  LKCFLADVNSVCDMIPVDMV  315



>gb|AIZ97193.1| fatty acyl-coenzyme A reductase [Triticum aestivum]
Length=494

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG LR D+P++I+RP+I+TS  KEP  GW+EGVRTIDS+ LGYAK  
Sbjct  239  NTYVFTKAMGEMLLGHLRGDLPVVIIRPSIITSILKEPLPGWMEGVRTIDSVFLGYAKQA  298

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L  FL DP TI D IP DMVV
Sbjct  299  LKFFLVDPNTIMDAIPGDMVV  319



>ref|XP_011005175.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X3 [Populus euphratica]
Length=445

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID +A+GYAKG
Sbjct  235  NTYVFTKAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKG  294

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            +L  F  +PK   D+IPADMV+
Sbjct  295  KLKHFPFNPKLTVDVIPADMVI  316



>ref|XP_011005176.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X4 [Populus euphratica]
Length=433

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID +A+GYAKG
Sbjct  235  NTYVFTKAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKG  294

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            +L  F  +PK   D+IPADMV+
Sbjct  295  KLKHFPFNPKLTVDVIPADMVI  316



>ref|XP_009419498.1| PREDICTED: probable fatty acyl-CoA reductase 4, partial [Musa 
acuminata subsp. malaccensis]
Length=304

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYV TKAMGEMLLG  R D+P++ILRPTI+TS   +P  GW+EG RTIDS+ +GYAKG+
Sbjct  49   NTYVLTKAMGEMLLGHSRGDLPMVILRPTIITSVQSDPLPGWIEGTRTIDSVIIGYAKGK  108

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +TCF GD   I D++P DMVV
Sbjct  109  ITCFFGDLDVIMDVVPGDMVV  129



>ref|XP_010520424.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X3 [Tarenaya 
hassleriana]
Length=502

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +PL+I+RP+++TST+ EPF GW+EG+RTIDS+ + Y KG+
Sbjct  249  NTYVFTKAMGEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGK  308

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFLGDP ++ DLIP D
Sbjct  309  LKCFLGDPNSVFDLIPVD  326



>ref|XP_010520425.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X4 [Tarenaya 
hassleriana]
Length=501

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +PL+I+RP+++TST+ EPF GW+EG+RTIDS+ + Y KG+
Sbjct  249  NTYVFTKAMGEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGK  308

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFLGDP ++ DLIP D
Sbjct  309  LKCFLGDPNSVFDLIPVD  326



>ref|XP_006349134.1| PREDICTED: fatty acyl-CoA reductase 1-like [Solanum tuberosum]
Length=427

 Score =   117 bits (293),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEM+LG L++++ L+I+RPTI+TSTYKEPF GW+EGV+T+D+  L Y KG 
Sbjct  170  NTYSFTKAMGEMMLGHLKENLQLVIVRPTIITSTYKEPFPGWIEGVKTLDTFILVYGKGI  229

Query  182  LTCFLGDPKTITDLIPADMVV  244
               FL DP T  DLIP DMVV
Sbjct  230  SNVFLADPNTKPDLIPGDMVV  250



>ref|XP_007132408.1| hypothetical protein PHAVU_011G092300g [Phaseolus vulgaris]
 gb|ESW04402.1| hypothetical protein PHAVU_011G092300g [Phaseolus vulgaris]
Length=488

 Score =   117 bits (294),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEM L   +D++PL+I+RPT+VTST  +PF GW+EG+RT+D++   Y +G+
Sbjct  233  NTYVFTKAMGEMQLVHHKDNVPLIIIRPTMVTSTLNDPFPGWIEGLRTLDNIICSYGQGK  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +T FLG PKTI D+IPADMV+
Sbjct  293  ITSFLGHPKTILDIIPADMVI  313



>ref|XP_011005174.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X2 [Populus euphratica]
Length=459

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID +A+GYAKG
Sbjct  235  NTYVFTKAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKG  294

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            +L  F  +PK   D+IPADMV+
Sbjct  295  KLKHFPFNPKLTVDVIPADMVI  316



>ref|XP_010520422.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=505

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +PL+I+RP+++TST+ EPF GW+EG+RTIDS+ + Y KG+
Sbjct  252  NTYVFTKAMGEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGK  311

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFLGDP ++ DLIP D
Sbjct  312  LKCFLGDPNSVFDLIPVD  329



>ref|XP_010520423.1| PREDICTED: fatty acyl-CoA reductase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=504

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG  R  +PL+I+RP+++TST+ EPF GW+EG+RTIDS+ + Y KG+
Sbjct  252  NTYVFTKAMGEMLLGDNRGSMPLVIVRPSMITSTFSEPFPGWIEGLRTIDSVIVAYGKGK  311

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFLGDP ++ DLIP D
Sbjct  312  LKCFLGDPNSVFDLIPVD  329



>ref|XP_007132410.1| hypothetical protein PHAVU_011G092400g [Phaseolus vulgaris]
 gb|ESW04404.1| hypothetical protein PHAVU_011G092400g [Phaseolus vulgaris]
Length=395

 Score =   117 bits (292),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEM L   +D++PL+I+RPT+VTST K+PF GW+EG+RT+DS+   Y +G+
Sbjct  233  NTYAFTKAMGEMQLVHHKDNVPLIIIRPTMVTSTLKDPFPGWIEGLRTLDSIICSYGQGK  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +T FLG PKTI D IPADMV+
Sbjct  293  ITNFLGHPKTILDTIPADMVI  313



>gb|AFK38475.1| unknown [Lotus japonicus]
Length=272

 Score =   115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+  L+ ++ ++I+RPTIVTST+KEPF GWVE +RTIDSL + Y KG+
Sbjct  16   NTYVFTKAMGEMLVETLKGNMSVVIVRPTIVTSTFKEPFPGWVECLRTIDSLIVAYGKGK  75

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCF  D K + D+IPADMVV
Sbjct  76   LTCFAADLKAVFDVIPADMVV  96



>ref|XP_010454514.1| PREDICTED: fatty acyl-CoA reductase 1-like [Camelina sativa]
Length=491

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  ++ +PL+I+RPT++TST  EPF GW+EG++T+DS+ + Y KGR
Sbjct  233  NTYVFTKAMGEMLMGYYKETLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGR  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  293  LKCFLADSNSVFDLIPADMVV  313



>ref|XP_007132411.1| hypothetical protein PHAVU_011G092400g [Phaseolus vulgaris]
 gb|ESW04405.1| hypothetical protein PHAVU_011G092400g [Phaseolus vulgaris]
Length=489

 Score =   117 bits (293),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEM L   +D++PL+I+RPT+VTST K+PF GW+EG+RT+DS+   Y +G+
Sbjct  233  NTYAFTKAMGEMQLVHHKDNVPLIIIRPTMVTSTLKDPFPGWIEGLRTLDSIICSYGQGK  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +T FLG PKTI D IPADMV+
Sbjct  293  ITNFLGHPKTILDTIPADMVI  313



>ref|XP_010493337.1| PREDICTED: fatty acyl-CoA reductase 1 [Camelina sativa]
Length=491

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  ++ +PL+I+RPT++TST  EPF GW+EG++T+DS+ + Y KGR
Sbjct  233  NTYVFTKAMGEMLMGYYKETLPLVIIRPTMITSTIAEPFPGWIEGLKTLDSVIVAYGKGR  292

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ DLIPADMVV
Sbjct  293  LKCFLADSNSVFDLIPADMVV  313



>ref|XP_002875673.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51932.1| oxidoreductase, acting on the CH-CH group of donors [Arabidopsis 
lyrata subsp. lyrata]
Length=485

 Score =   117 bits (293),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNYKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IPADMV
Sbjct  296  LKCFLVDVNSVCDMIPADMV  315



>ref|XP_010326151.1| PREDICTED: fatty acyl-CoA reductase 2-like [Solanum lycopersicum]
Length=554

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            +TY FTKA+GEM++  +R +IP+LI+RP+I+TS+YKEPFLGW++G RTID +   Y KG 
Sbjct  300  DTYSFTKAIGEMMINSMRHEIPILIIRPSIITSSYKEPFLGWMQGFRTIDPIIFFYGKGD  359

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L+C  GDP  + DL+P DMVV
Sbjct  360  LSCIFGDPNCLVDLVPVDMVV  380



>ref|XP_010503102.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Camelina 
sativa]
Length=493

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++++RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNNHKEDLPVVVIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DL+P D
Sbjct  295  LKCFLADPNSVLDLVPVD  312



>emb|CAB88538.1| acyl CoA reductase-like protein [Arabidopsis thaliana]
Length=449

 Score =   117 bits (292),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IPADMV
Sbjct  296  LKCFLVDVNSVCDMIPADMV  315



>ref|XP_003543433.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
1 [Glycine max]
 gb|KHN21438.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+ +L+  + ++I+RPTIVTST +EPF GWVEGVRTIDSLA+ Y KG+
Sbjct  235  NTYVFTKAVGEMLVEQLKGRLSVVIMRPTIVTSTLREPFPGWVEGVRTIDSLAVTYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLG+   + D +PADMVV
Sbjct  295  LTCFLGNINGVVDAVPADMVV  315



>ref|XP_003615809.1| Fatty acyl-CoA reductase [Medicago truncatula]
Length=273

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+   +D++PL+I+RPT++TST K+PF GW+EGVRT+DS+  GY  G+
Sbjct  17   NTYVFTKAMGEMLVVNQKDNVPLIIIRPTMITSTNKDPFPGWIEGVRTMDSVICGYGLGK  76

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CF+G+  T+ D IPAD+VV
Sbjct  77   LACFVGNANTVLDTIPADLVV  97



>ref|XP_011015001.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like [Populus 
euphratica]
Length=251

 Score =   114 bits (285),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID +A+GYAKG
Sbjct  85   NTYVFTKAMGEMLLVHYSRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVAVGYAKG  144

Query  179  RLTCFLGDPKTITDLIPADMVV  244
             L     +PK   D+IPADMV+
Sbjct  145  NLKHLTFNPKLTVDVIPADMVI  166



>ref|XP_010503103.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina 
sativa]
Length=493

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++++RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNNHKEDLPVVVIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DL+P D
Sbjct  295  LKCFLADPNSVLDLVPVD  312



>ref|XP_010425872.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Camelina 
sativa]
Length=496

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLL   ++D+P++I+RPT++TST+ EPF GW+EG+RTIDS+ + Y KGR
Sbjct  235  NTYVFTKSMGEMLLNYHKEDLPVVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGR  294

Query  182  LTCFLGDPKTITDLIPAD  235
            L CFL DP ++ DL+P D
Sbjct  295  LKCFLADPNSVLDLVPVD  312



>emb|CAB88537.1| acyl CoA reductase-like protein [Arabidopsis thaliana]
Length=402

 Score =   115 bits (289),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLGK ++++PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGKHKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IP DMV
Sbjct  296  LKCFLVDVNSVCDMIPVDMV  315



>ref|XP_009786820.1| PREDICTED: probable fatty acyl-CoA reductase 4 [Nicotiana sylvestris]
Length=185

 Score =   112 bits (280),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG L++ + L+I+ PTI+TST KEPF GW+EGV+T+DS  L Y KG 
Sbjct  18   NTYSFTKAMGEMLLGHLKESLQLVIICPTIITSTCKEPFPGWIEGVKTVDSFFLAYGKGI  77

Query  182  LTCFLGDPKTITDLIPADMVV  244
               FLGDP T  DLIP DMVV
Sbjct  78   SNVFLGDPNTNVDLIPGDMVV  98



>ref|XP_003540237.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
Length=490

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  + ++ ++I+RPT+VTSTYKEPF GW+EG+RTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLVGTTKGNMNVVIVRPTMVTSTYKEPFPGWIEGLRTIDSIVVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL + + + D+IPADMVV
Sbjct  295  LVCFLANLEAVFDVIPADMVV  315



>ref|XP_006371440.1| hypothetical protein POPTR_0019s10390g [Populus trichocarpa]
 gb|ERP49237.1| hypothetical protein POPTR_0019s10390g [Populus trichocarpa]
Length=496

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEMLL    RD +PL+I+RPT+VTSTY+EPF GW+EGVRTID + +GYAKG
Sbjct  235  NTYVFTKAMGEMLLVHYNRDTVPLVIIRPTMVTSTYQEPFPGWIEGVRTIDGVVVGYAKG  294

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            +L  F  +P+ I D+IPADMV+
Sbjct  295  KLKHFPFNPQLIVDVIPADMVI  316



>ref|XP_009610475.1| PREDICTED: fatty acyl-CoA reductase 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   116 bits (291),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG L++++ L I+RPTI+TSTYKEPF GW+EGV+T+DS  + Y KG 
Sbjct  236  NTYSFTKAMGEMLLGHLKENLQLAIIRPTIITSTYKEPFPGWIEGVKTVDSFIVAYGKGI  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L    GDP T  D IP DMVV
Sbjct  296  LNFCFGDPNTKIDAIPGDMVV  316



>ref|NP_190041.2| fatty acyl-CoA reductase 5 [Arabidopsis thaliana]
 sp|Q0WRB0.1|FACR5_ARATH RecName: Full=Probable fatty acyl-CoA reductase 5 [Arabidopsis 
thaliana]
 dbj|BAF00339.1| acyl CoA reductase -like protein [Arabidopsis thaliana]
 gb|AEE77914.1| fatty acyl-CoA reductase 5 [Arabidopsis thaliana]
Length=496

 Score =   116 bits (290),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLGK ++++PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGKHKENLPLVIIRPTMITSTLSEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IP DMV
Sbjct  296  LKCFLVDVNSVCDMIPVDMV  315



>ref|XP_010111080.1| Fatty acyl-CoA reductase 1 [Morus notabilis]
 gb|EXC29942.1| Fatty acyl-CoA reductase 1 [Morus notabilis]
Length=807

 Score =   118 bits (295),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEM L +  +D++ ++I+RPT++TSTYK PF GW+EGVRT+DS+ +GY KG
Sbjct  237  NTYVFTKAMGEMCLQQSDQDNLSIVIIRPTMITSTYKYPFPGWIEGVRTVDSVIVGYGKG  296

Query  179  RLTCFLGDPKTITDLIPADMVV  244
            ++T FLG P  I DLIPADMVV
Sbjct  297  KVTSFLGSPSLILDLIPADMVV  318



>ref|XP_010313341.1| PREDICTED: fatty acyl-CoA reductase 3-like isoform X1 [Solanum 
lycopersicum]
Length=489

 Score =   115 bits (289),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEMLLG  ++++ L+I+RPTI+TSTYKEPF GW+EGV+T+DS  L Y KG 
Sbjct  231  NTYSFTKAMGEMLLGHYKEELKLVIIRPTIITSTYKEPFPGWIEGVKTVDSFILAYGKGV  290

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +    GDP T  D+IP DMVV
Sbjct  291  MNFCFGDPNTKLDMIPGDMVV  311



>gb|ABK23559.1| unknown [Picea sitchensis]
Length=296

 Score =   114 bits (285),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEM++   R+++P++ILRPTI+ ST  EPF GW+EG RT+D+  +GY KGR
Sbjct  194  NTYSFTKAMGEMVVENRRENLPVVILRPTIIESTLAEPFPGWMEGTRTMDTFIVGYGKGR  253

Query  182  LTCFLGDPKTITDLIPADMVV  244
            ++ FLGDP+   D+IPADMVV
Sbjct  254  ISFFLGDPELFLDVIPADMVV  274



>gb|AFK33782.1| unknown [Medicago truncatula]
Length=492

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+ KL+ ++ ++ILRP IVT T +EPF GWVEG+RTID LA+ Y KG+
Sbjct  237  NTYVFTKALGEMLVEKLKGNLSVVILRPAIVTGTLREPFPGWVEGLRTIDCLAVVYGKGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LTCFLGD   + D IPADMVV
Sbjct  297  LTCFLGDINGVVDAIPADMVV  317



>ref|XP_010314793.1| PREDICTED: fatty acyl-CoA reductase 3-like [Solanum lycopersicum]
Length=488

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTK+MGEMLLG L++D+ L+ILRPTI+ STYKEPF GW+EG+RT D+  +GY KG+
Sbjct  234  NTYSFTKSMGEMLLGHLKEDLQLIILRPTIILSTYKEPFPGWIEGMRTTDTFIVGYGKGK  293

Query  182  LTCFLGDPKTITDLIPADMVV  244
                +G   TI D+IPADMVV
Sbjct  294  QKVAMGGRDTIIDVIPADMVV  314



>gb|KHN21439.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G  + ++ ++I+RPT+VTSTY EPF GW+EG+RTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLVGTTKGNMNVVIVRPTMVTSTYTEPFPGWIEGLRTIDSIVVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL + K + D+IPADMVV
Sbjct  295  LACFLANLKAVFDVIPADMVV  315



>ref|XP_011090362.1| PREDICTED: fatty acyl-CoA reductase 3-like [Sesamum indicum]
Length=495

 Score =   115 bits (288),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEM L   ++   ++I+RPTI+TSTY+EPF GW+EGVRT+DS+ +GY +G+
Sbjct  237  NTYVFTKAIGEMFLENFKEKATVIIIRPTIITSTYREPFPGWIEGVRTLDSIFVGYGQGK  296

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L  F+GDP +  D+IP DMVV
Sbjct  297  LKFFVGDPDSTLDMIPGDMVV  317



>ref|XP_006586435.1| PREDICTED: probable fatty acyl-CoA reductase 5-like [Glycine 
max]
Length=431

 Score =   115 bits (287),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGE+LL K++D +PL ++RPT V ST+ EPF GW+EGVRTID + + Y +G 
Sbjct  265  NTYVFTKAMGEILLMKMKDTLPLFVIRPTTVVSTHSEPFPGWIEGVRTIDFVVVNYGQGI  324

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT F+G+ +TI DLIP DMVV
Sbjct  325  LTSFVGNSETILDLIPVDMVV  345



>gb|KHN27659.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=249

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMG ML+G  + ++ ++I+RPT+VTSTYKEPF GW+EG+RTIDS+ + Y KG+
Sbjct  42   NTYVFTKAMGVMLVGTTKGNMNVVIVRPTMVTSTYKEPFPGWIEGLRTIDSIVVAYGKGK  101

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL + + + D+IPADMVV
Sbjct  102  LVCFLANLEAVFDVIPADMVV  122



>ref|XP_010687363.1| PREDICTED: fatty acyl-CoA reductase 3-like [Beta vulgaris subsp. 
vulgaris]
Length=488

 Score =   115 bits (287),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+G+ R ++P++I+RPTIV ST KEPF GWVEG RTIDS+A+ Y KG 
Sbjct  234  NTYVFTKAMGEMLVGQQRGNLPVVIMRPTIVCSTLKEPFPGWVEGCRTIDSVAVMYGKGS  293

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L+ F  D  ++ DLIPADM V
Sbjct  294  LSLFPADGSSVLDLIPADMFV  314



>ref|XP_006851510.1| hypothetical protein AMTR_s00040p00161230, partial [Amborella 
trichopoda]
 gb|ERN13091.1| hypothetical protein AMTR_s00040p00161230, partial [Amborella 
trichopoda]
Length=390

 Score =   114 bits (286),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEML+G LR+++P++I+RP+I+ ST+ +PF GW+EG RT DSL + +AKG+
Sbjct  228  NTYTFTKAMGEMLMGHLREEVPVVIMRPSIIASTFSDPFPGWIEGARTFDSLIVNFAKGK  287

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +  FL  P  I D+IP DMVV
Sbjct  288  VNYFLAKPNVIMDVIPGDMVV  308



>ref|NP_190042.2| fatty acyl-CoA reductase 8 [Arabidopsis thaliana]
 sp|Q1PEI6.1|FACR8_ARATH RecName: Full=Fatty acyl-CoA reductase 8 [Arabidopsis thaliana]
 gb|ABE65991.1| acyl CoA reductase [Arabidopsis thaliana]
 gb|ABZ10955.1| fatty acyl CoA reductase [Arabidopsis thaliana]
 gb|AEE77915.1| fatty acyl-CoA reductase 8 [Arabidopsis thaliana]
Length=496

 Score =   115 bits (287),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IPADMV
Sbjct  296  LKCFLVDVNSVCDMIPADMV  315



>gb|ABK28586.1| unknown [Arabidopsis thaliana]
Length=497

 Score =   115 bits (287),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST  EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IPADMV
Sbjct  296  LKCFLVDVNSVCDMIPADMV  315



>ref|XP_003540238.1| PREDICTED: fatty acyl-CoA reductase 3-like [Glycine max]
 gb|KHN27658.1| Fatty acyl-CoA reductase 3 [Glycine soja]
Length=490

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKA+GEML+ +L+  + ++I+RPTIVTST +EPF GW EGVRTIDSLA+ Y KG+
Sbjct  235  NTYVFTKAVGEMLVEQLKGSLSVVIMRPTIVTSTLREPFPGWAEGVRTIDSLAVTYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFLG+   + D++PADMVV
Sbjct  295  LKCFLGNINGVVDVVPADMVV  315



>ref|XP_010109930.1| Fatty acyl-CoA reductase 1 [Morus notabilis]
 gb|EXC24906.1| Fatty acyl-CoA reductase 1 [Morus notabilis]
Length=550

 Score =   115 bits (289),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKL-RDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKG  178
            NTYVFTKAMGEM L +  +D++ ++I+RPT++TSTYK+PF GW+EGVRT+DS+ +GY KG
Sbjct  287  NTYVFTKAMGEMCLQQSDQDNLSIVIIRPTMITSTYKDPFPGWIEGVRTVDSVIVGYGKG  346

Query  179  RLTCFLGDPKTITDLIPADM  238
            ++T FLG P  I DLIPADM
Sbjct  347  KVTSFLGSPSLILDLIPADM  366



>ref|XP_010430959.1| PREDICTED: probable fatty acyl-CoA reductase 5 [Camelina sativa]
Length=443

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST+ EPF GW+EG+RT+DS+ + Y KG 
Sbjct  182  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTVDSVIIAYGKGV  241

Query  182  LTCFLGDPKTITDLIPADMV  241
            L CFL D  ++ D+IP DMV
Sbjct  242  LKCFLVDVNSVCDMIPVDMV  261



>gb|KCW58563.1| hypothetical protein EUGRSUZ_H01219 [Eucalyptus grandis]
Length=355

 Score =   114 bits (284),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGK-LRDDIPLLILRPTIVTSTYKEPFLGWVEGV--RTIDSLALGYA  172
            NTY  TKAMGEM++   L+ DI L+++RPTIVTSTY+EPF GW EG   RT+DS+A+ Y 
Sbjct  189  NTYTLTKAMGEMMVQHHLKQDIHLVVMRPTIVTSTYREPFAGWTEGFPPRTMDSIAIHYG  248

Query  173  KGRLTCFLGDPKTITDLIPADMVV  244
            +GRL  FLGDP TI D+IP DMVV
Sbjct  249  RGRLKYFLGDPNTILDMIPVDMVV  272



>emb|CDP14283.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   114 bits (284),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            +TYVFTKAMGEM++  LR DIP++I+RP+++ STY+EPF GW+EG R +D + L Y KG+
Sbjct  85   DTYVFTKAMGEMMIDSLRGDIPVVIIRPSVIESTYREPFPGWIEGSRMMDPVLLYYGKGQ  144

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L+ FL DP  + D++PADMVV
Sbjct  145  LSGFLADPNGVLDVVPADMVV  165



>ref|XP_004487512.1| PREDICTED: fatty acyl-CoA reductase 3-like [Cicer arietinum]
Length=492

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEML+   ++++ ++ILRPTIVTSTY+EPF GWVEG+RTIDS+ + Y KG+
Sbjct  235  NTYVFTKAMGEMLVEASKENMSVVILRPTIVTSTYREPFPGWVEGLRTIDSIIVAYGKGK  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT F+ D   + D+IPADMVV
Sbjct  295  LTSFMADLDAVFDVIPADMVV  315



>gb|AEQ33639.1| male sterility protein 2 [Lycium barbarum]
Length=264

 Score =   112 bits (280),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            +TYVFTKAMGEM++  +R DIP++I+RP+++ STY+EPF GW+EG R +D + L Y KG+
Sbjct  1    DTYVFTKAMGEMMIDTMRSDIPVVIIRPSVIESTYREPFPGWMEGNRMMDPIILHYGKGQ  60

Query  182  LTCFLGDPKTITDLIPADMVV  244
            LT FL DP  + D++PADMVV
Sbjct  61   LTGFLVDPNGVLDVVPADMVV  81



>ref|XP_010503105.1| PREDICTED: probable fatty acyl-CoA reductase 5 [Camelina sativa]
Length=497

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST+ EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ D+IP DMV 
Sbjct  296  LKCFLVDVNSVCDMIPVDMVA  316



>ref|XP_010514782.1| PREDICTED: probable fatty acyl-CoA reductase 5 [Camelina sativa]
Length=497

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTK+MGEMLLG  ++++PL+I+RPT++TST+ EPF GW+EG+RT+DS+ + Y KG 
Sbjct  236  NTYVFTKSMGEMLLGNHKENLPLVIIRPTMITSTFSEPFPGWIEGLRTVDSVIIAYGKGV  295

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L CFL D  ++ D+IP DMV 
Sbjct  296  LKCFLVDVNSVCDMIPVDMVA  316



>ref|XP_003573673.1| PREDICTED: fatty acyl-CoA reductase 1-like [Brachypodium distachyon]
Length=496

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTYVFTKAMGEMLLG LR D+P++ILRP+I+TST KEP  GW+EG+RTIDS+ +GYAK  
Sbjct  238  NTYVFTKAMGEMLLGHLRGDLPVVILRPSIITSTLKEPLPGWMEGIRTIDSVVIGYAKQT  297

Query  182  LTCFLGDPKTITDLIPADMVV  244
            L+ FL D   I D+IP DMVV
Sbjct  298  LSFFLVDLDLIMDVIPGDMVV  318



>ref|XP_004241312.1| PREDICTED: probable fatty acyl-CoA reductase 4 isoform X1 [Solanum 
lycopersicum]
Length=491

 Score =   114 bits (286),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGKLRDDIPLLILRPTIVTSTYKEPFLGWVEGVRTIDSLALGYAKGR  181
            NTY FTKAMGEM+LG L++++ ++++RPTI+T TYKEPF GW+EGV+T+DS  L Y KG 
Sbjct  235  NTYSFTKAMGEMILGHLKENLEIVVIRPTIITGTYKEPFPGWIEGVKTVDSFLLAYGKGG  294

Query  182  LTCFLGDPKTITDLIPADMVV  244
            +  + GDP +  D+IP DMVV
Sbjct  295  MKFYYGDPYSKLDVIPGDMVV  315



>ref|XP_010070011.1| PREDICTED: alcohol-forming fatty acyl-CoA reductase-like isoform 
X1 [Eucalyptus grandis]
Length=293

 Score =   112 bits (281),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 3/84 (4%)
 Frame = +2

Query  2    NTYVFTKAMGEMLLGK-LRDDIPLLILRPTIVTSTYKEPFLGWVEGV--RTIDSLALGYA  172
            NTY  TKAMGEM++   L+ DI L+++RPTIVTSTY+EPF GW EG   RT+DS+A+ Y 
Sbjct  33   NTYTLTKAMGEMMVQHHLKQDIHLVVMRPTIVTSTYREPFAGWTEGFPPRTMDSIAIHYG  92

Query  173  KGRLTCFLGDPKTITDLIPADMVV  244
            +GRL  FLGDP TI D+IP DMVV
Sbjct  93   RGRLKYFLGDPNTILDMIPVDMVV  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514220833636