BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23089_g3_i1 len=1654 path=[3139:0-846 3986:847-870 6708:871-899
11003:900-928 5726:929-1042 6880:1043-1653]

Length=1654
                                                                      Score     E

ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     493   8e-168   
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     493   1e-167   
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     487   2e-165   
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     473   7e-160   
emb|CDP21061.1|  unnamed protein product                                466   1e-156   
emb|CDO96753.1|  unnamed protein product                                444   2e-148   
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     433   5e-144   
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          427   7e-142   Vitis vinifera
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     424   1e-140   
emb|CDO96754.1|  unnamed protein product                                420   9e-139   
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     419   1e-138   
gb|KCW45467.1|  hypothetical protein EUGRSUZ_L00816                     419   3e-138   
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    417   6e-138   
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    417   1e-137   
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                     417   1e-137   
ref|XP_010057069.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     415   6e-137   
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    424   2e-135   
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     410   4e-135   
emb|CBI30663.3|  unnamed protein product                                428   1e-133   
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     406   2e-133   
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             404   7e-133   
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890    418   7e-133   
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    403   2e-132   
ref|NP_174182.1|  GDSL esterase/lipase                                  401   2e-131   Arabidopsis thaliana [mouse-ear cress]
emb|CDO96750.1|  unnamed protein product                                399   8e-131   
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     399   1e-130   
gb|AAM65183.1|  lipase, putative                                        397   5e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174181.1|  GDSL esterase/lipase                                  395   3e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94634.1|  BnaC07g10240D                                          395   5e-129   
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     393   9e-129   
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    394   1e-128   
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     393   1e-128   
emb|CDY15655.1|  BnaA07g08260D                                          392   3e-128   
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          391   1e-127   
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg                390   2e-127   
ref|NP_001031122.1|  GDSL esterase/lipase                               390   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174179.3|  GDSL esterase/lipase                                  390   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             392   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     390   2e-127   
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    390   2e-127   
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     389   3e-127   
dbj|BAD95190.1|  hypothetical protein                                   390   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     389   4e-127   
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     389   9e-127   
ref|XP_002893538.1|  predicted protein                                  402   9e-127   
ref|NP_973932.1|  GDSL esterase/lipase                                  388   1e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                    389   1e-126   
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     389   1e-126   
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 389   1e-126   
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          388   2e-126   
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    403   2e-126   
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     388   3e-126   
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     387   3e-126   
emb|CDY30819.1|  BnaC05g21950D                                          387   3e-126   
gb|AAF24548.2|AC007508_11  F1K23.17                                     400   6e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252    405   7e-126   
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     386   8e-126   
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          386   1e-125   
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             385   2e-125   
emb|CDO96752.1|  unnamed protein product                                384   3e-125   
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     385   4e-125   
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     384   5e-125   
ref|XP_003593737.1|  GDSL esterase/lipase                               384   5e-125   
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     384   7e-125   
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     383   1e-124   
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     384   1e-124   
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg             383   1e-124   
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    383   2e-124   
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     382   4e-124   
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    382   4e-124   
gb|AAG60153.1|AC074360_18  lipase, putative                             382   5e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     382   5e-124   
gb|AFK42362.1|  unknown                                                 381   6e-124   
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     381   1e-123   
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    382   1e-123   
ref|NP_174180.1|  GDSL esterase/lipase                                  381   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174440.2|  GDSL esterase/lipase                                  381   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     380   1e-123   
gb|KHG23842.1|  hypothetical protein F383_29871                         380   1e-123   
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    381   1e-123   
emb|CDX90163.1|  BnaA08g18210D                                          380   1e-123   
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     380   2e-123   
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     380   3e-123   
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645    398   3e-123   
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     379   5e-123   
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             379   6e-123   
dbj|BAD44668.1|  putative lipase                                        379   8e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     379   1e-122   
ref|NP_180304.1|  GDSL esterase/lipase                                  378   1e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43309.1|  BnaC03g58810D                                          378   1e-122   
emb|CDY30822.1|  BnaC05g21980D                                          378   2e-122   
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     378   2e-122   
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     377   2e-122   
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     377   3e-122   
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                    402   3e-122   
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     376   4e-122   
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280          376   4e-122   
ref|XP_002879083.1|  predicted protein                                  377   5e-122   
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     376   9e-122   
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             375   9e-122   
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     377   1e-121   
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925    389   1e-121   
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3       374   2e-121   
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    374   6e-121   
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg             385   1e-120   
emb|CDO99485.1|  unnamed protein product                                373   2e-120   
emb|CDY64716.1|  BnaCnng44670D                                          372   2e-120   
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     372   3e-120   
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     373   4e-120   
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     372   4e-120   
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     372   4e-120   
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...    371   5e-120   Brassica napus [oilseed rape]
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     371   5e-120   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    371   6e-120   
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    371   6e-120   
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    370   1e-119   
emb|CDY63998.1|  BnaA07g36520D                                          370   1e-119   
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     371   1e-119   
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     371   1e-119   
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     370   1e-119   
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    370   2e-119   
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    383   2e-119   
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    369   2e-119   
gb|AAX62802.1|  lipase 2                                                369   3e-119   Brassica napus [oilseed rape]
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    368   5e-119   
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     368   8e-119   
gb|KHN08454.1|  GDSL esterase/lipase                                    378   2e-118   
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like     367   2e-118   
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     367   2e-118   
ref|NP_174186.1|  GDSL esterase/lipase                                  367   3e-118   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02148.1|  putative lipase                                        365   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    366   8e-118   
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592    379   8e-118   
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     365   8e-118   
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670          365   1e-117   
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    379   1e-117   
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650          364   2e-117   
emb|CDO96749.1|  unnamed protein product                                365   2e-117   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          363   3e-117   Sorghum bicolor [broomcorn]
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     364   4e-117   
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     364   4e-117   
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     364   4e-117   
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     363   7e-117   
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970          363   1e-116   
ref|NP_001241470.1|  uncharacterized protein LOC100816865               361   4e-116   
ref|NP_001149156.1|  esterase precursor                                 360   4e-116   Zea mays [maize]
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     360   1e-115   
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g             360   1e-115   
ref|NP_174185.2|  GDSL esterase/lipase                                  360   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     358   2e-115   
ref|XP_007020872.1|  SGNH hydrolase-type esterase superfamily pro...    357   3e-115   
emb|CDX90162.1|  BnaA08g18220D                                          359   4e-115   
ref|NP_001149094.1|  LOC100282715 precursor                             359   4e-115   Zea mays [maize]
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    358   5e-115   
emb|CDM83549.1|  unnamed protein product                                358   5e-115   
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    358   5e-115   
gb|AFW80395.1|  esterase                                                357   6e-115   
ref|NP_174188.1|  lipase ARAB-1                                         358   8e-115   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA94228.1|  putative esterase                                      357   9e-115   Oryza sativa Japonica Group [Japonica rice]
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    358   9e-115   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001042396.1|  Os01g0215700                                       357   1e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     357   1e-114   
gb|EEE54111.1|  hypothetical protein OsJ_00875                          357   1e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    357   1e-114   
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    357   2e-114   
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    356   3e-114   
ref|NP_001130974.1|  uncharacterized protein LOC100192079               357   4e-114   Zea mays [maize]
ref|XP_003593736.1|  GDSL esterase/lipase                               356   6e-114   
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     355   9e-114   
gb|EMT22154.1|  GDSL esterase/lipase                                    355   1e-113   
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580          354   3e-113   Sorghum bicolor [broomcorn]
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     353   1e-112   
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     352   1e-112   
emb|CDY15657.1|  BnaA07g08280D                                          353   1e-112   
emb|CDY43308.1|  BnaC03g58800D                                          353   1e-112   
emb|CDX94632.1|  BnaC07g10260D                                          352   1e-112   
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     351   1e-112   
dbj|BAJ86481.1|  predicted protein                                      352   1e-112   
ref|XP_003593740.1|  GDSL esterase/lipase                               352   2e-112   
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    352   2e-112   
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     352   2e-112   
emb|CDX94633.1|  BnaC07g10250D                                          352   3e-112   
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    351   3e-112   
emb|CDO96755.1|  unnamed protein product                                350   4e-112   
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     351   4e-112   
emb|CDY15658.1|  BnaA07g08290D                                          350   7e-112   
gb|EMT27195.1|  GDSL esterase/lipase                                    351   8e-112   
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    350   8e-112   
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     350   8e-112   
ref|NP_001043721.1|  Os01g0649900                                       350   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     349   1e-111   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     348   1e-111   
ref|XP_010316801.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    347   2e-111   
gb|AAX59709.1|  lipase 1                                                348   2e-111   Brassica napus [oilseed rape]
ref|XP_010316802.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    346   2e-111   
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     348   3e-111   
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     348   4e-111   
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          348   6e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55085.1|  hypothetical protein OsJ_02827                          348   6e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     347   1e-110   
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     347   1e-110   
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g             346   1e-110   
gb|ACN28025.1|  unknown                                                 347   2e-110   Zea mays [maize]
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          348   2e-110   Sorghum bicolor [broomcorn]
ref|NP_001140937.1|  hypothetical protein                               348   3e-110   Zea mays [maize]
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     347   3e-110   
emb|CDM83548.1|  unnamed protein product                                347   4e-110   
ref|XP_002893540.1|  predicted protein                                  369   6e-110   
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     343   9e-110   
dbj|BAK06933.1|  predicted protein                                      345   1e-109   
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880          344   2e-109   
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320          343   2e-109   
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   343   3e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232088.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    344   3e-109   
dbj|BAJ93079.1|  predicted protein                                      345   4e-109   
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     342   6e-109   
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          342   7e-109   
ref|XP_003569457.2|  PREDICTED: GDSL esterase/lipase At1g28600-li...    344   7e-109   
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     342   8e-109   
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     342   1e-108   
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     341   1e-108   
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                     342   2e-108   Zea mays [maize]
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     340   3e-108   
gb|ACL53525.1|  unknown                                                 342   4e-108   Zea mays [maize]
ref|XP_007025435.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    339   4e-108   
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     340   4e-108   
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     341   4e-108   
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     341   5e-108   
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     341   5e-108   
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   339   8e-108   
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             339   1e-107   
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     339   1e-107   
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     339   1e-107   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     339   1e-107   
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     338   1e-107   
ref|XP_004969325.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     340   1e-107   
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    338   2e-107   
ref|XP_008812182.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     336   3e-107   
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     337   4e-107   
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             337   5e-107   
dbj|BAJ97312.1|  predicted protein                                      338   6e-107   
ref|XP_006415634.1|  hypothetical protein EUTSA_v10009717mg             337   1e-106   
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     336   2e-106   
dbj|BAJ98364.1|  predicted protein                                      336   2e-106   
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     335   2e-106   
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     335   4e-106   
ref|XP_008654982.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1         337   5e-106   
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     333   9e-106   
ref|XP_008675274.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    335   9e-106   
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     334   9e-106   
gb|EAY75181.1|  hypothetical protein OsI_03071                          335   1e-105   Oryza sativa Indica Group [Indian rice]
gb|AAF24544.2|AC007508_7  F1K23.13                                      357   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     333   1e-105   
ref|NP_564314.1|  GDSL esterase/lipase                                  333   2e-105   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA58335.1|  TPA: hypothetical protein ZEAMMB73_102185              335   3e-105   
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    332   3e-105   
ref|XP_008675273.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    335   3e-105   
emb|CDM83418.1|  unnamed protein product                                333   4e-105   
ref|XP_002456053.1|  hypothetical protein SORBIDRAFT_03g029590          332   1e-104   Sorghum bicolor [broomcorn]
dbj|BAD68794.1|  lipase-like                                            330   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          330   2e-104   Vitis vinifera
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     330   3e-104   
gb|KDP21068.1|  hypothetical protein JCGZ_21539                         329   5e-104   
ref|NP_849723.1|  GDSL esterase/lipase                                  330   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    329   7e-104   
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     330   7e-104   
gb|EPS71267.1|  hypothetical protein M569_03493                         330   9e-104   
ref|NP_199403.1|  GDSL esterase/lipase                                  328   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         328   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     327   3e-103   
ref|XP_006646093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     327   4e-103   
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     327   5e-103   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     327   5e-103   
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     327   5e-103   
ref|XP_010918534.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    327   6e-103   
gb|EEC71081.1|  hypothetical protein OsI_02841                          327   7e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940          327   1e-102   Sorghum bicolor [broomcorn]
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein                325   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein         325   3e-102   
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    325   3e-102   
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          325   3e-102   
ref|XP_004958488.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     326   3e-102   
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     325   3e-102   
ref|NP_001031103.1|  GDSL esterase/lipase                               322   4e-102   
gb|KHG30334.1|  hypothetical protein F383_10781                         324   5e-102   
ref|XP_010918533.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    327   5e-102   
ref|XP_010918532.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    327   5e-102   
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    325   6e-102   
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     325   1e-101   
ref|XP_003593742.1|  GDSL esterase/lipase                               323   1e-101   
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910          323   2e-101   
dbj|BAJ90990.1|  predicted protein                                      323   2e-101   
gb|EEE59101.1|  hypothetical protein OsJ_10956                          321   7e-101   
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200          332   1e-100   
ref|NP_001050175.1|  Os03g0365800                                       322   1e-100   
ref|XP_004971993.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     320   1e-100   
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     320   2e-100   
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     319   4e-100   
gb|KHG11244.1|  hypothetical protein F383_11796                         317   7e-100   
gb|EAY90131.1|  hypothetical protein OsI_11697                          318   2e-99    
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     317   3e-99    
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     317   4e-99    
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910          317   4e-99    
ref|XP_006651409.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     315   3e-98    
gb|EAY75193.1|  hypothetical protein OsI_03085                          315   3e-98    
ref|XP_009383158.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     314   5e-98    
gb|EAZ27028.1|  hypothetical protein OsJ_10957                          314   1e-97    
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     314   1e-97    
ref|NP_973931.1|  GDSL esterase/lipase                                  310   1e-97    
ref|XP_009382515.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     313   1e-97    
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     313   2e-97    
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     313   2e-97    
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          313   2e-97    
ref|NP_001057786.1|  Os06g0531900                                       313   2e-97    
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          313   4e-97    
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     312   4e-97    
ref|NP_001172483.1|  Os01g0649400                                       309   5e-97    
emb|CDY48195.1|  BnaA04g15590D                                          312   5e-97    
ref|NP_001042399.1|  Os01g0216400                                       311   8e-97    
ref|NP_001150078.1|  esterase                                           311   8e-97    
gb|EAZ01210.1|  hypothetical protein OsI_23235                          311   9e-97    
gb|EMT08653.1|  GDSL esterase/lipase                                    312   1e-96    
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     310   1e-96    
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    310   1e-96    
ref|XP_010929733.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     310   1e-96    
gb|EAY90132.1|  hypothetical protein OsI_11698                          311   2e-96    
gb|ACF85857.1|  unknown                                                 310   5e-96    
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     308   6e-96    
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     308   8e-96    
dbj|BAJ92568.1|  predicted protein                                      308   1e-95    
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     307   1e-95    
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910          308   1e-95    
gb|EAZ11035.1|  hypothetical protein OsJ_00879                          308   1e-95    
ref|XP_008364168.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     305   1e-95    
ref|XP_010557579.1|  PREDICTED: GDSL esterase/lipase At5g03980          307   2e-95    
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     307   2e-95    
emb|CDX77066.1|  BnaC04g38610D                                          308   3e-95    
gb|EAY75182.1|  hypothetical protein OsI_03072                          305   3e-95    
ref|XP_008783973.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     306   6e-95    
ref|XP_003593744.1|  GDSL esterase/lipase                               305   6e-95    
dbj|BAJ97605.1|  predicted protein                                      305   7e-95    
gb|ABK24921.1|  unknown                                                 306   9e-95    
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     305   1e-94    
dbj|BAB89203.1|  lipase-like                                            305   1e-94    
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     305   1e-94    
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     305   2e-94    
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570          304   2e-94    
ref|XP_004980345.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     304   3e-94    
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910          304   4e-94    
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     304   5e-94    
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     303   5e-94    
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     303   5e-94    
ref|NP_001176564.1|  Os11g0521000                                       303   6e-94    
ref|XP_002457134.1|  hypothetical protein SORBIDRAFT_03g001820          303   6e-94    
ref|XP_009414901.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     303   7e-94    
ref|XP_006646152.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     303   8e-94    
gb|ACG38031.1|  alpha-L-fucosidase 2 precursor                          303   1e-93    
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    302   1e-93    
ref|NP_001141565.1|  uncharacterized protein LOC100273681               302   2e-93    
ref|XP_008791125.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     302   2e-93    
ref|NP_001172233.1|  Os01g0216900                                       302   3e-93    
ref|XP_004959853.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     301   4e-93    
ref|XP_004971762.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     301   5e-93    
gb|EAY96951.1|  hypothetical protein OsI_18870                          300   7e-93    
gb|AAS91011.1|  putative lipase                                         300   7e-93    
ref|NP_001054912.2|  Os05g0209600                                       300   8e-93    
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     300   1e-92    
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     300   1e-92    
gb|KEH34273.1|  GDSL-like lipase/acylhydrolase                          301   1e-92    
ref|XP_002456055.1|  hypothetical protein SORBIDRAFT_03g029610          300   1e-92    
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    300   1e-92    
ref|XP_008673524.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     300   2e-92    
gb|EMT22799.1|  GDSL esterase/lipase                                    302   2e-92    
ref|XP_009409411.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     299   2e-92    
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    300   2e-92    
ref|XP_010241274.1|  PREDICTED: acetylajmalan esterase-like             299   3e-92    
ref|XP_002457140.1|  hypothetical protein SORBIDRAFT_03g001880          299   3e-92    
ref|XP_004971499.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     300   3e-92    
ref|XP_002461107.1|  hypothetical protein SORBIDRAFT_02g040890          300   4e-92    
gb|KEH36573.1|  GDSL-like lipase/acylhydrolase                          297   5e-92    
dbj|BAK01569.1|  predicted protein                                      298   5e-92    
ref|XP_009383572.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     298   5e-92    
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     298   6e-92    
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    298   6e-92    
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100          298   7e-92    
ref|XP_006651410.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     298   9e-92    
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     297   1e-91    
dbj|BAK05815.1|  predicted protein                                      296   2e-91    
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    296   3e-91    
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650          297   3e-91    
ref|XP_008675276.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     296   3e-91    
ref|XP_010231604.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     296   4e-91    
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                     296   4e-91    
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     296   4e-91    
ref|XP_004959854.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     296   5e-91    
ref|XP_007214461.1|  hypothetical protein PRUPE_ppa023988mg             298   5e-91    
ref|XP_006643906.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     296   6e-91    
ref|XP_010251328.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     295   7e-91    
gb|ABL11233.1|  UCW116, putative lipase                                 295   8e-91    
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    295   8e-91    
dbj|BAJ90380.1|  predicted protein                                      295   9e-91    
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136    306   9e-91    
ref|XP_007213171.1|  hypothetical protein PRUPE_ppa026981mg             293   1e-90    
emb|CDO98569.1|  unnamed protein product                                295   1e-90    
ref|XP_009608032.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    293   2e-90    
ref|XP_002454932.1|  hypothetical protein SORBIDRAFT_03g001650          294   2e-90    
ref|XP_004491864.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     295   2e-90    
ref|XP_003563800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     295   2e-90    
gb|EAZ18532.1|  hypothetical protein OsJ_34061                          294   2e-90    
gb|EAY81107.1|  hypothetical protein OsI_36286                          294   2e-90    
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     294   2e-90    
gb|KGN49290.1|  hypothetical protein Csa_6G519430                       292   2e-90    
ref|XP_002457133.1|  hypothetical protein SORBIDRAFT_03g001810          294   3e-90    
ref|NP_001042391.1|  Os01g0214800                                       293   3e-90    
ref|XP_004516452.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     293   5e-90    
dbj|BAJ86410.1|  predicted protein                                      293   6e-90    
dbj|BAK06902.1|  predicted protein                                      293   8e-90    
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor     292   1e-89    
ref|XP_006643907.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     292   1e-89    
ref|XP_006651412.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     292   1e-89    
gb|EAZ04881.1|  hypothetical protein OsI_27063                          292   2e-89    
ref|XP_002279349.1|  PREDICTED: acetylajmalan esterase                  291   2e-89    
ref|XP_009397450.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     291   3e-89    
gb|KEH34272.1|  GDSL-like lipase/acylhydrolase                          292   3e-89    
ref|NP_001060434.1|  Os07g0642200                                       291   3e-89    
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...    291   4e-89    
ref|XP_004510075.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     291   4e-89    
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1                 291   4e-89    
ref|XP_004515399.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     291   4e-89    
ref|XP_003577537.1|  PREDICTED: acetylajmalan esterase                  291   5e-89    
ref|XP_004969329.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    291   5e-89    
gb|ACF83155.1|  unknown                                                 290   7e-89    
ref|XP_010683532.1|  PREDICTED: acetylajmalan esterase-like             290   7e-89    
gb|EMT33597.1|  GDSL esterase/lipase                                    290   7e-89    
ref|NP_001151215.1|  LOC100284848 precursor                             290   7e-89    
gb|KHN31271.1|  GDSL esterase/lipase                                    290   8e-89    
gb|EYU28066.1|  hypothetical protein MIMGU_mgv1a009376mg                289   1e-88    
ref|XP_007138118.1|  hypothetical protein PHAVU_009G181700g             290   1e-88    
gb|KHN08453.1|  GDSL esterase/lipase                                    287   1e-88    
ref|XP_004964800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     289   2e-88    
gb|EEE65121.1|  hypothetical protein OsJ_20187                          289   2e-88    
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    289   2e-88    
ref|XP_002450809.1|  hypothetical protein SORBIDRAFT_05g018910          289   3e-88    
ref|XP_004516453.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     290   3e-88    
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     288   3e-88    
ref|XP_004971763.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     288   3e-88    
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     288   3e-88    
ref|XP_004965532.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    288   3e-88    
ref|XP_006658887.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     289   4e-88    
ref|XP_007018722.1|  SGNH hydrolase-type esterase superfamily pro...    288   4e-88    
dbj|BAD73016.1|  putative esterase                                      289   5e-88    
gb|EMT25207.1|  GDSL esterase/lipase                                    288   5e-88    
gb|KHG07034.1|  Acetylajmalan esterase                                  288   5e-88    
ref|XP_006663479.1|  PREDICTED: acetylajmalan esterase-like             288   6e-88    
ref|XP_006645636.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     288   6e-88    
ref|XP_004968644.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     288   6e-88    
ref|XP_009782266.1|  PREDICTED: acetylajmalan esterase-like             288   7e-88    
gb|KCW64327.1|  hypothetical protein EUGRSUZ_G01959                     288   7e-88    
ref|XP_010066434.1|  PREDICTED: acetylajmalan esterase                  288   7e-88    
ref|XP_002454933.1|  hypothetical protein SORBIDRAFT_03g001670          288   9e-88    
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          288   9e-88    
ref|XP_003566943.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     287   1e-87    
ref|XP_009390675.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     289   1e-87    
ref|XP_004968622.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     287   1e-87    
ref|XP_004968624.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     286   2e-87    
ref|XP_008675275.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     286   2e-87    
ref|XP_009380501.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     286   2e-87    
gb|EEC80750.1|  hypothetical protein OsI_23233                          286   3e-87    
ref|NP_001054913.1|  Os05g0210100                                       286   3e-87    
emb|CDP09073.1|  unnamed protein product                                286   3e-87    
gb|EMT27686.1|  GDSL esterase/lipase                                    286   4e-87    
ref|XP_003565527.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     285   4e-87    
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                    286   4e-87    
dbj|BAJ90120.1|  predicted protein                                      285   5e-87    
ref|XP_002463272.1|  hypothetical protein SORBIDRAFT_02g040950          286   6e-87    
ref|XP_002438500.1|  hypothetical protein SORBIDRAFT_10g020940          285   6e-87    
ref|XP_010241275.1|  PREDICTED: acetylajmalan esterase-like             285   6e-87    
ref|XP_010251983.1|  PREDICTED: acetylajmalan esterase-like             285   7e-87    
ref|XP_004963464.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     286   7e-87    
ref|XP_003600821.1|  GDSL esterase/lipase                               285   7e-87    
ref|XP_004979339.1|  PREDICTED: acetylajmalan esterase-like             285   8e-87    
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          285   9e-87    
ref|XP_003564307.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     284   1e-86    
dbj|BAK02457.1|  predicted protein                                      284   2e-86    
emb|CDM82194.1|  unnamed protein product                                283   2e-86    
ref|NP_001057785.1|  Os06g0531600                                       284   2e-86    
tpg|DAA52848.1|  TPA: hypothetical protein ZEAMMB73_895572              285   2e-86    
ref|XP_004963669.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     284   2e-86    
ref|NP_001147763.1|  esterase precursor                                 285   2e-86    
ref|NP_001168581.1|  hypothetical protein precursor                     283   2e-86    
ref|NP_001151338.1|  LOC100284971 precursor                             283   2e-86    
ref|XP_003560500.1|  PREDICTED: acetylajmalan esterase-like             284   2e-86    
ref|XP_008673536.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    285   3e-86    
ref|XP_006344835.1|  PREDICTED: acetylajmalan esterase-like             283   3e-86    
gb|AES71072.2|  GDSL-like lipase/acylhydrolase                          283   3e-86    
dbj|BAA94236.1|  putative esterase                                      283   4e-86    
ref|NP_001152155.1|  esterase precursor                                 283   5e-86    
ref|XP_009767428.1|  PREDICTED: acetylajmalan esterase-like isofo...    283   6e-86    
ref|XP_009409412.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     282   6e-86    
gb|EAY78349.1|  hypothetical protein OsI_33438                          283   6e-86    



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   493 bits (1270),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 233/365 (64%), Positives = 288/365 (79%), Gaps = 4/365 (1%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             YI L+L  S G V G CY++I+SFGDSLTDTGNLIR+SKS N +V S+V PYGETFFHHP
Sbjct  10    YIILLLISSFGLVLG-CYESIISFGDSLTDTGNLIRLSKS-NKHVASSVPPYGETFFHHP  67

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFG--GKTTGDRSFAKGVNFAVAGATAMDMSFFTE  1025
             TGR+SDGRLIIDF+A SMG P + PY G     T  R+  +G+NFAVAGATA+D+SF  +
Sbjct  68    TGRFSDGRLIIDFIAESMGFPLIPPYAGVMKNMTSSRNSIRGINFAVAGATAVDISFLEK  127

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             RG+ N  TNVSLG EL+WFKQML   C +P+ C+E+L +S++LMGEIGGNDYN+ F QG 
Sbjct  128   RGVKNPATNVSLGTELEWFKQMLPILCNSPTSCREFLGNSLVLMGEIGGNDYNHPFSQGR  187

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
              +EEV ++VP+V+  I   I+ELI+ GAQ LIVPGNLPIGCS SYL+ F  SN  EYD +
Sbjct  188   SREEVQTYVPEVVKAIGLAIHELIELGAQTLIVPGNLPIGCSASYLNTFENSNKDEYDAE  247

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLE  485
             TGCINWLN+F EYHN+LLQ+E++ +RELHP   IIYADYYNAAM++Y+SP  +GF +T+ 
Sbjct  248   TGCINWLNNFAEYHNQLLQEEIHRIRELHPQANIIYADYYNAAMQIYQSPKKFGFTSTIV  307

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
             ACCGGGGPYN +  A CGS LS VC++PSS++SWDG+HLTEAAY+WI  GLL GP+T PK
Sbjct  308   ACCGGGGPYNYDSLASCGSPLSNVCNNPSSHVSWDGVHLTEAAYRWIAKGLLQGPYTIPK  367

Query  304   INGEC  290
             IN  C
Sbjct  368   INELC  372



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   493 bits (1269),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 290/365 (79%), Gaps = 4/365 (1%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             YI L+L  S G V G CY++I+SFGDSLTDTGNLIR+SKS N++V S+V PYGETFFHHP
Sbjct  11    YIILMLIASFGLVLG-CYESIISFGDSLTDTGNLIRLSKS-NSHVASSVPPYGETFFHHP  68

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFG--GKTTGDRSFAKGVNFAVAGATAMDMSFFTE  1025
             TGR+SDGRL+IDF+A SMG P + PY G     T +R+  +GVNFAVAGATA+D+SF  +
Sbjct  69    TGRFSDGRLVIDFIAESMGFPLIPPYAGVMKNMTSNRNSIRGVNFAVAGATAVDISFLQK  128

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             RG+ N  TNVSLG EL+WFKQML   C +P+ C+E+L +S++LMGEIGGNDYN+ F QG 
Sbjct  129   RGVKNPATNVSLGTELEWFKQMLPILCNSPTSCREFLGNSLVLMGEIGGNDYNHPFSQGK  188

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
             P+EEV ++VP+V+  I   I+ELI+ GAQ LIVPGNLPIGCS SYL+ F  SN +EYD +
Sbjct  189   PREEVQTYVPEVVKAIGLAIHELIELGAQTLIVPGNLPIGCSASYLTNFKNSNKNEYDSE  248

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLE  485
             TGCINWLN+F EYHN+LLQ+E++ +RELHP   +IYADYYNAAM++Y+SP  +GF +T+ 
Sbjct  249   TGCINWLNNFAEYHNQLLQEEIHRIRELHPQANVIYADYYNAAMQIYKSPKKFGFTSTIV  308

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
             ACCGGGGPYN +  A CGS LS VC++PSSY+SWDG+HLTEAAY+ I  GLL GP+  P+
Sbjct  309   ACCGGGGPYNYDSLAICGSPLSNVCNNPSSYVSWDGVHLTEAAYRLIAKGLLQGPYAIPR  368

Query  304   INGEC  290
             +N  C
Sbjct  369   MNELC  373



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   487 bits (1254),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 230/361 (64%), Positives = 281/361 (78%), Gaps = 4/361 (1%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPT  1196
             + ++L  S GHV G CY++I+SFGDSL DTGNLIR+SKS N  V S+VLPYGETFFHHPT
Sbjct  14    VIILLITSFGHVHG-CYESIISFGDSLADTGNLIRLSKS-NKIVASSVLPYGETFFHHPT  71

Query  1195  GRYSDGRLIIDFMALSMGLPFVEPYFG--GKTTGDRSFAKGVNFAVAGATAMDMSFFTER  1022
             GR+SDGRL+IDF+A  MG P V PY G     +  ++  +GVNFAVAGATA+D+S+  +R
Sbjct  72    GRFSDGRLVIDFIAEGMGFPLVPPYVGVMKNMSSSKNSMRGVNFAVAGATAVDISYLEKR  131

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             GI N  TNVSLG +L+WFKQML   C +P+ CKE+LE+S+ LMGEIGGNDYN+ F QG  
Sbjct  132   GIKNPATNVSLGTQLEWFKQMLPILCDSPTSCKEFLENSLFLMGEIGGNDYNHPFSQGKS  191

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
              E+V SFVP VI+ I   INELI+ GAQ LIVPGNLPIGCS SYL+ F  SN  EYD  T
Sbjct  192   GEDVQSFVPAVISAIGLAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKEYDDST  251

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEA  482
             GCINWLNDF EYHN+LLQ+E++ LRE+HPH  IIYADYYNAAM++Y+SP  +GF +T+ A
Sbjct  252   GCINWLNDFAEYHNQLLQQEIHKLREIHPHANIIYADYYNAAMQIYKSPKKFGFTSTIVA  311

Query  481   CCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CCGGGGPYN +    CGS  S  CD+PSSY+SWDG+HLTEAAY+ I +GLL GP+T P++
Sbjct  312   CCGGGGPYNYDSKRPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAEGLLQGPYTIPQM  371

Query  301   N  299
             N
Sbjct  372   N  372



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   473 bits (1217),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 270/347 (78%), Gaps = 3/347 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             G Y++I+SFGDSL DTGNLIR+SKS N  V S+VLPYGETFFHHPTGR+SDGRL+IDF+A
Sbjct  24    GSYESIISFGDSLADTGNLIRLSKS-NKIVASSVLPYGETFFHHPTGRFSDGRLVIDFIA  82

Query  1153  LSMGLPFVEPYFG--GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
               MG P V PY G     +  ++  +GVNFAVAGATA+D+S+  +RGI N  TNVSLG +
Sbjct  83    EGMGFPLVPPYVGVMKNMSSSKNSIRGVNFAVAGATAVDISYLEKRGIKNPATNVSLGTQ  142

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             L+WFKQML   C +P+ CKEYLE+S+ LMGEIGGNDYN+ F QG   EEV SFVP VI+ 
Sbjct  143   LEWFKQMLPILCDSPTSCKEYLENSLFLMGEIGGNDYNHPFSQGKSGEEVKSFVPAVISA  202

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I   INELI+ GAQ LIVPGNLPIGCS SYL+ F  SN  +YD  TGCI WLN+F EYHN
Sbjct  203   IGQAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKKDYDNSTGCIIWLNEFAEYHN  262

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHA  440
             +LLQ+E++ LRE+HPH  IIYADYYNAAM++YRSP  +GF +T+ ACCGGGG YN + + 
Sbjct  263   QLLQQEIHKLREIHPHANIIYADYYNAAMQIYRSPKKFGFTSTIVACCGGGGVYNYDSNR  322

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
              CGS  S  CD+PSSY+SWDG+HLTEAAY+ I  GLL GP+T P++N
Sbjct  323   PCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAKGLLQGPYTIPQMN  369



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   466 bits (1198),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 267/360 (74%), Gaps = 2/360 (1%)
 Frame = -1

Query  1357  VSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDG  1178
              ST   AG CYK+I+SFGDS+ DTGNL+R+  S N     ++ PYGE+FFH PTGR+S+G
Sbjct  26    TSTRASAGICYKSIISFGDSIADTGNLLRLCPS-NYPPHFSLPPYGESFFHRPTGRFSNG  84

Query  1177  RLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTN  998
             RL+IDF A S GLP + PY  G+    R F +GVNFAVAGATA+D SFF ERG+ N  TN
Sbjct  85    RLVIDFFAESFGLPLIPPYLAGEDARGRDFRQGVNFAVAGATALDSSFFRERGVRNPLTN  144

Query  997   VSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFV  818
             VSLG +L WFK ++ SFC   S C+E+L +S++LMGEIGGNDYN+A +QG   +++ SFV
Sbjct  145   VSLGTQLRWFKDVMPSFCSNSSDCREFLRTSLVLMGEIGGNDYNHALVQGIKIDQIKSFV  204

Query  817   PKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLND  638
             P VI+ I+S I E+IK GA  LIVPGN PIGCS  YL+YF  SN  +YD  TGCINWLND
Sbjct  205   PAVISEISSAIEEVIKLGAVTLIVPGNFPIGCSAVYLTYFQGSNQQDYDKATGCINWLND  264

Query  637   FTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGP  461
             F++YHN LLQKELN +R+LHPH  IIYADYYNAAMRLYRSPN YGF    L+ACCGGGGP
Sbjct  265   FSKYHNRLLQKELNRIRKLHPHATIIYADYYNAAMRLYRSPNKYGFRGGALKACCGGGGP  324

Query  460   YNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  281
             YN N    CG   +T CD PS Y+ WDG+HLTEAAYQ I  GLL GPF++P +N  C L+
Sbjct  325   YNYNSSVECGYPPATSCDDPSLYVCWDGLHLTEAAYQLIAGGLLQGPFSTPPMNTICALA  384



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   444 bits (1143),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/362 (60%), Positives = 264/362 (73%), Gaps = 12/362 (3%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSK----------SSNAYVMSAVLPYGETFFHHPTGR  1190
             AG CY +I+SFGDSL DTGNL+R+ +          SSN      + PYGETFFHHPTGR
Sbjct  32    AGTCYNSIISFGDSLADTGNLLRLDRLSSSSSSSSSSSNTPPHFFLPPYGETFFHHPTGR  91

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS-FAKGVNFAVAGATAMDMSFFTERGII  1013
              SDGRL+IDF+A S+G P + PYF GK    RS F KG NFAV GATA+D S F ERGI 
Sbjct  92    CSDGRLVIDFIAESLGFPLIRPYFAGKDIRGRSDFIKGSNFAVIGATAIDDSVFRERGIH  151

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
             N  TNVSLG +L WFK+ML+SFC+  S CKE LESS++LMGEIGGNDYN+A  QG   +E
Sbjct  152   NPFTNVSLGTQLGWFKEMLASFCKESSDCKELLESSLVLMGEIGGNDYNHALFQGLKIKE  211

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V SFVP V+  I+S I ELI  GA+ L+VPGNLPIGCS SYL+YF +SN  +YD +TGCI
Sbjct  212   VESFVPLVVQTISSAIQELIDLGAETLVVPGNLPIGCSSSYLTYFQSSNKHDYDMETGCI  271

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACC  476
              WLN+F +YHN+LL  E+N +REL+PH  I+YADYYNAAM LYRSP  YGF+   L+ACC
Sbjct  272   KWLNEFAKYHNKLLLTEINRIRELNPHALIVYADYYNAAMTLYRSPQKYGFKAGALKACC  331

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGPYN N  A CG   +T CD PS Y++WDG+HLTEAAY++I   LL GP++  +IN 
Sbjct  332   GAGGPYNYNASAPCGYPPATSCDDPSLYVAWDGLHLTEAAYRFIARRLLQGPYSGLRINR  391

Query  295   EC  290
              C
Sbjct  392   FC  393



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score =   433 bits (1113),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 214/373 (57%), Positives = 261/373 (70%), Gaps = 9/373 (2%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             TAI + I L+ F        GC+ +I+SFGDSL DTGN + +S+        AV PYGET
Sbjct  15    TAIAFIILLLNFF---QATKGCFNSIISFGDSLADTGNKLHLSQYKTHLPHFAVRPYGET  71

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+SDGRL+IDF+A S+GLP V PY GGK   D +F +GVNFAV GATA+D ++
Sbjct  72    FFHHPTGRFSDGRLVIDFIAESLGLPLVPPYLGGK---DENFKQGVNFAVGGATALDYAY  128

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               E+G+     NVSLG +L WFK+MLSS C+ PS CKE+L+ S+IL+GEIGGND+NY FL
Sbjct  129   LFEKGV-RPDNNVSLGTQLSWFKEMLSSLCKFPSECKEFLQKSLILVGEIGGNDFNYGFL  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                 KEEV S+VP VI  I+S I ELI+ GA  L+VPG LPIGCS +YL+ F  SN   Y
Sbjct  188   GNSTKEEVESYVPAVINTISSAIQELIELGASTLVVPGELPIGCSTAYLTKFTHSNKEHY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP+TGCINWLN F++++NELLQKEL+ LRELHP   IIYADYYNAAM+ Y SP ++GF  
Sbjct  248   DPKTGCINWLNHFSQHYNELLQKELHLLRELHPSVTIIYADYYNAAMQFYVSPTSHGFRK  307

Query  493   -TLEACCGGGGPYNSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
               L+ACCG GGPYN    A CG      +C   S Y SWDGMH TEAAY+WI  GLL G 
Sbjct  308   GALDACCGAGGPYNFKFSAVCGDPPARNICSDTSQYASWDGMHFTEAAYKWIARGLLEGT  367

Query  319   FTSPKINGECILS  281
             FT P +   C  +
Sbjct  368   FTFPPLAKICTFN  380



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score =   427 bits (1097),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 215/365 (59%), Positives = 256/365 (70%), Gaps = 8/365 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             +I +++F  T  V G CY++I SFGDSLTDTGNL+  S + N     A  PYGETFFH P
Sbjct  5     FILVLIFAHTQQVIG-CYESIFSFGDSLTDTGNLLLASPAHN-LPHFAKPPYGETFFHRP  62

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERG  1019
             TGR SDGRLIIDF+A  +GLP + PY   +TT  R   + VNFA+ GATA+D  FF  R 
Sbjct  63    TGRCSDGRLIIDFIAGFLGLPLIHPYL--ETTDPR---QSVNFAIVGATALDDEFFQARN  117

Query  1018  IINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPK  839
             I    TN+SLG +L WFK  L S C T S C E   SS+ LMGEIGGNDY Y F QG   
Sbjct  118   IHIPYTNISLGIQLGWFKDKLLSLCPTFSNCNELFNSSLFLMGEIGGNDYGYPFFQGRSL  177

Query  838   EEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTG  659
             EE+ ++VP VI  IAS I ELI+ GA  L+VPG LP GCS SYL+ F T N  +YDP TG
Sbjct  178   EEIRTYVPPVIHAIASAITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIEDYDPVTG  237

Query  658   CINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEA  482
             C+NWLN+F EYHNE L+ ELN +REL+PHT IIYADYYNAAMR+YRSPN +GF+   L A
Sbjct  238   CLNWLNEFAEYHNEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTA  297

Query  481   CCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CCGGGGPYN N    CG+  +T CD PS Y+SWDG+HLTEAAY+WI +GLL  P+T P +
Sbjct  298   CCGGGGPYNYNSSVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPL  357

Query  301   NGECI  287
             N  CI
Sbjct  358   NASCI  362



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score =   424 bits (1090),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 210/374 (56%), Positives = 263/374 (70%), Gaps = 9/374 (2%)
 Frame = -1

Query  1405  FSQGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLP  1226
             ++  TAI   I ++ F        GC+ +I+SFGDSL DTGN + +S++       AV P
Sbjct  11    YTWNTAIACIILVLNFF---QATEGCFNSIISFGDSLADTGNRLHLSQNKTLLPHFAVRP  67

Query  1225  YGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAM  1046
             YGETFFH PTGR+SDGR++IDF+A S+GLP V PY GGK   D  F +GVNFAV GATA+
Sbjct  68    YGETFFHRPTGRFSDGRIVIDFIAESLGLPLVPPYLGGK---DERFKQGVNFAVGGATAL  124

Query  1045  DMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYN  866
             D ++  E+G+     NVSLG +L WFK+MLSS C+ PS CKE+L++S+IL+GEIGGND+N
Sbjct  125   DYAYLLEKGVTPG-NNVSLGTQLIWFKEMLSSLCKFPSECKEFLQNSLILVGEIGGNDFN  183

Query  865   YAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSN  686
             Y FL    KEEV S+VP VI  I+S I ELI+ GA  L+VPG+LPIGCS +YL+ FM S+
Sbjct  184   YGFLGNSTKEEVESYVPAVINTISSAIQELIELGASTLVVPGDLPIGCSTAYLTKFMHSD  243

Query  685   ASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNY  506
                YDP+TGCINWLN F +++NELLQKEL+ LR+LHP   IIYADYYNAAM+ Y SP ++
Sbjct  244   KENYDPKTGCINWLNHFAQHYNELLQKELHLLRKLHPSATIIYADYYNAAMQFYVSPMSH  303

Query  505   GF-ENTLEACCGGGGPYNSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGL  332
             GF +  L+ACCG GGPYN    A CG      +C   S Y SWDGMH TEAAY+WI  GL
Sbjct  304   GFTKGALDACCGAGGPYNFKFSAVCGDPPARNICSDTSLYASWDGMHFTEAAYKWIARGL  363

Query  331   LIGPFTSPKINGEC  290
             L G FT P +   C
Sbjct  364   LEGTFTFPPLAKIC  377



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   420 bits (1079),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 215/374 (57%), Positives = 261/374 (70%), Gaps = 6/374 (2%)
 Frame = -1

Query  1393  TAITYYI--FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVL--P  1226
             TA T  I  FL   ++    AG CYK+++SFGDSL DTGNL  +   S++         P
Sbjct  11    TAFTIIILTFLNSSITVSASAGICYKSLISFGDSLADTGNLFHLDSPSSSSDAPHFFLPP  70

Query  1225  YGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK-TTGDRSFAKGVNFAVAGATA  1049
             YGET+FHHPTGR SDGRL++DF+A S+GLP + PY   K T+G   F +GVNFAV GATA
Sbjct  71    YGETYFHHPTGRCSDGRLVVDFIAESLGLPLLPPYLARKDTSGSLDFLEGVNFAVVGATA  130

Query  1048  MDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDY  869
             +D SFF ERGI N  TN SL  EL WF  +    C     CK++L+SS++LMGEIGGNDY
Sbjct  131   LDGSFFRERGIDNPATNASLATELGWFIDIFFYICHVIPDCKDFLQSSLVLMGEIGGNDY  190

Query  868   NYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTS  689
             NY  LQG   EEV SFVP V+  I+S I ELI+ GA  L+VPGN PIGCS SYL+Y+ +S
Sbjct  191   NYPLLQGRNIEEVQSFVPLVVQTISSAIQELIELGAVTLVVPGNFPIGCSASYLTYYQSS  250

Query  688   NASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNN  509
                +YD  TGCI WLN+F +YHN++LQ E+N +REL+PH  IIYADYYNAAMRLYR PN 
Sbjct  251   KKQDYDTDTGCIKWLNNFAKYHNQVLQSEINRIRELNPHATIIYADYYNAAMRLYRFPNK  310

Query  508   YGFE-NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGL  332
             YGF+   L+ACCG GGPYN N    CG Q +  CD P  Y+SWDG+HLTEAAY+WI  GL
Sbjct  311   YGFKGEVLKACCGAGGPYNYNSTVPCGYQPAASCDDPPLYVSWDGLHLTEAAYRWIARGL  370

Query  331   LIGPFTSPKINGEC  290
             L GPF++P IN  C
Sbjct  371   LEGPFSTPPINTVC  384



>ref|XP_010057068.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Eucalyptus grandis]
 gb|KCW74054.1| hypothetical protein EUGRSUZ_E02674 [Eucalyptus grandis]
Length=402

 Score =   419 bits (1078),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 252/350 (72%), Gaps = 3/350 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GCY++I+SFGDSL DTGN + +++S+     +  LPYG+T F  PTGR+SDGRL+IDF+A
Sbjct  29    GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLPYGQTHFRRPTGRFSDGRLVIDFVA  88

Query  1153  LSMGLPFVEPYFGGKTTGD-RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNEL  977
               +GLP+V PY+G    G    F KGVNFAV GATA+D SFF  RG+ ++  N SLG +L
Sbjct  89    ERLGLPYVAPYYGDDGGGSVEDFRKGVNFAVGGATALDGSFFEGRGMGSNFPNESLGVQL  148

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
               FK++L S C T S CK++L +S++LMGEIGGNDYN+ F  G   EE+  FVP VI  I
Sbjct  149   GLFKELLPSLCYTSSDCKDFLGNSLVLMGEIGGNDYNHPFFMGKDLEEIQDFVPLVIEEI  208

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
              S I+ELI  GA  ++VPGN PIGC P+YL+ F +S+   YDP TGC+NWLN+F++YHNE
Sbjct  209   VSAISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQYHNE  268

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNPHA  440
              LQ +L+HLRELHP T+IIY DYYNAA+R ++SPN +GFE     ACCGGGG +N N  A
Sbjct  269   QLQLKLDHLRELHPRTKIIYVDYYNAAIRFFQSPNKFGFEGQVFRACCGGGGTHNYNSSA  328

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              C S  + VCD PSSY SWDG+H TEAAY+WI   +  GPFT PK++  C
Sbjct  329   LCSSN-TKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGPFTVPKLDISC  377



>gb|KCW45467.1| hypothetical protein EUGRSUZ_L00816 [Eucalyptus grandis]
Length=402

 Score =   419 bits (1076),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 251/350 (72%), Gaps = 3/350 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GCY++I+SFGDSL DTGN + +++S+     +  LPYG+T F  PTGR+SDGRL+IDF+A
Sbjct  29    GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLPYGQTHFRRPTGRFSDGRLVIDFVA  88

Query  1153  LSMGLPFVEPYFGGKTTGD-RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNEL  977
               +GLP+V PY+G    G    F KGVNFAV GATA+D SFF  RG+ ++  N SLG +L
Sbjct  89    ERLGLPYVAPYYGDDGGGSVEDFRKGVNFAVGGATALDGSFFEGRGMGSNFPNESLGVQL  148

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
               FK++L S C T S CKE+L +S++LMGEIGGNDYN+ F  G   EE+  FVP VI  I
Sbjct  149   GLFKELLPSLCYTSSDCKEFLGNSLVLMGEIGGNDYNHPFFMGKDLEEIKDFVPLVIEEI  208

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
              S I+ELI  GA  ++VPGN PIGC P+YL+ F +S+   YDP TGC+NWLN+F++YHNE
Sbjct  209   VSAISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQYHNE  268

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNPHA  440
              LQ +L+HLRELHP T+IIY DYYNAA+R Y+SPN +GFE     ACCGGGG +N N  A
Sbjct  269   QLQLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNYNSSA  328

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              C S  + VCD PSSY SWDG+H TEAAY+WI   +  G FT PK++  C
Sbjct  329   LCSSN-TKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  377



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score =   417 bits (1072),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 205/366 (56%), Positives = 262/366 (72%), Gaps = 5/366 (1%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             +IFLVL  +   + G C+ +I+SFGDSL DTGN + +S +       ++ PYGETFFHHP
Sbjct  13    FIFLVLNHNFQRIEG-CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHP  71

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR-SFAKGVNFAVAGATAMDMSFFTER  1022
             TGR+SDGRL+IDF+A S+GLP V  Y  GK   +   F +GVNFAV GATA+D ++  ++
Sbjct  72    TGRFSDGRLVIDFIAESLGLPLVPAYLEGKDERNNVKFRQGVNFAVGGATALDSAYLLDK  131

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             GII +  NVSLG ++DWFK M++SFC+ PS C+E+L++S+ILMGEIGGND+NY FL    
Sbjct  132   GIIPN-NNVSLGTQMDWFKDMMTSFCKFPSECEEFLQNSLILMGEIGGNDFNYGFLGNST  190

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
             KEEV S+VP V+  I+S I ELI+ GA  L+VPG+LPIGCS +YL+ FM S+  +YDP+T
Sbjct  191   KEEVESYVPAVVKTISSAIQELIELGASTLLVPGDLPIGCSTAYLTKFMHSDKGQYDPKT  250

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLE  485
             GCINWLN F++ +NELLQKEL+ LR+L+P   IIYADYYNAAM+ Y SP ++GF    L 
Sbjct  251   GCINWLNKFSQQYNELLQKELHLLRDLNPAATIIYADYYNAAMQFYASPKSHGFRKGALV  310

Query  484   ACCGGGGPYNSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
             ACCG GGPYN    A CG      +C   S Y SWDGMH TEAAY+WI  GLL G FT P
Sbjct  311   ACCGAGGPYNFKFSALCGDPSARDICSDTSVYASWDGMHFTEAAYKWIATGLLQGTFTFP  370

Query  307   KINGEC  290
              +   C
Sbjct  371   PVPKIC  376



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/381 (53%), Positives = 257/381 (67%), Gaps = 6/381 (2%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             T  ++ + L       H    CY++I+SFGDS+ DTGNL+ +S   N     A+ PYGET
Sbjct  12    TLTSFLLILFAVPIDSHRPRRCYESIISFGDSIADTGNLLILS-DPNHLPHFALPPYGET  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFH PTGR+SDGRLIIDF+A S+ LPFV PYFG +   +RSF KG+NFAVAGATA+D+S 
Sbjct  71    FFHFPTGRHSDGRLIIDFIAESLDLPFVPPYFGSR---NRSFLKGINFAVAGATALDISC  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
                +G+ +  TNVSLG +L+ FK++L S C  PS C E+L  S+ILMGEIGGNDYNY F 
Sbjct  128   LKGKGVPSDITNVSLGVQLNIFKEILPSLCSPPSDCSEFLSRSLILMGEIGGNDYNYPFF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G   +E+   VP VI VI+S I EL+  G +  +VPGN PIGCS +YL+ + T N  +Y
Sbjct  188   AGKNVDEIREMVPLVINVISSAIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+ WLN+F E+HNE LQ ELN LR+L+PH  I+YADYYN  +RL++ P  +GF N
Sbjct  248   DPLTGCLKWLNEFAEHHNERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMN  307

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L  CCG GGPYN +P   CG  +   CD+PS Y++WDG HLTE AY+WI  GLL GP+
Sbjct  308   RPLSVCCGAGGPYNYSPSRLCGDGV-PYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPY  366

Query  316   TSPKINGECILSRPKTKIPDS  254
               P  N  C  S+ +   PD 
Sbjct  367   ADPAFNSYCFDSKLQNSSPDK  387



>gb|KCW45468.1| hypothetical protein EUGRSUZ_L00817 [Eucalyptus grandis]
Length=398

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 254/360 (71%), Gaps = 7/360 (2%)
 Frame = -1

Query  1357  VSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDG  1178
             +S+   A GCY +I+SFGDSL DTGN + +S+S      +  LPYGET+F  PTGR+SDG
Sbjct  28    ISSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLPYGETYFRRPTGRFSDG  87

Query  1177  RLIIDFMALSMGLPFVEPYFG---GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINS  1007
             RL+IDF+A  +GLPFV PY+G   G++  D  F KGVNFAVAGATA+D SFF  RG+ N 
Sbjct  88    RLVIDFIAEWLGLPFVAPYYGDDGGRSAAD--FRKGVNFAVAGATALDASFFEGRGLGND  145

Query  1006  CTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVM  827
               N+SLG +L  FK++L S C T S CK++L +S++LMGEIGGNDYNY F  G   EE+ 
Sbjct  146   FPNISLGVQLGLFKELLPSVCSTSSDCKQFLGNSLVLMGEIGGNDYNYHFFVGRDLEEIQ  205

Query  826   SFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINW  647
               VP VI  I S I+ELI  GA +++VPGN PIGC P YL+ F  S+   YD  TGC+NW
Sbjct  206   GIVPLVIEGIVSAISELIDLGAVMILVPGNFPIGCLPIYLTEFQGSDKEAYDSSTGCLNW  265

Query  646   LNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGG  470
             LN+F++YHNE LQ++LNHLRELHP   IIY DYYNAA+R Y+SP+ +GF+   L ACCGG
Sbjct  266   LNEFSQYHNEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGG  325

Query  469   GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              G YN N    C S  + VCD PSSY SWDG+H TEAAY+WI  G+  G FT PK++  C
Sbjct  326   EGTYNYNILEPCNSN-ARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>ref|XP_010057069.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Eucalyptus grandis]
 gb|KCW74053.1| hypothetical protein EUGRSUZ_E02673 [Eucalyptus grandis]
Length=400

 Score =   415 bits (1067),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 253/360 (70%), Gaps = 7/360 (2%)
 Frame = -1

Query  1357  VSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDG  1178
             +S+   A GCY +I+SFGDSL DTGN + +S+S      +  LPYGET+F  PTGR+SDG
Sbjct  30    ISSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLPYGETYFRRPTGRFSDG  89

Query  1177  RLIIDFMALSMGLPFVEPYFG---GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINS  1007
             RL+IDF+A  +GLPFV PY+G   G++  D  F KGVNFAVAGATA+D SFF  RG+ N 
Sbjct  90    RLVIDFIAEWLGLPFVAPYYGDDGGRSAAD--FGKGVNFAVAGATALDASFFEGRGLGND  147

Query  1006  CTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVM  827
               N+SLG +L  FK++L S C T S CK++L +S++LMGEIGGNDYNY F  G   +E+ 
Sbjct  148   FPNISLGVQLGLFKELLPSVCSTSSDCKQFLGNSLVLMGEIGGNDYNYHFFMGRDLKEIQ  207

Query  826   SFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINW  647
               VP VI  I S I+ELI  GA  ++VPGN PIGC P YL+ F  S+   YD  TGC+NW
Sbjct  208   GIVPLVIEEIVSAISELIDLGAVTILVPGNFPIGCLPIYLTEFQGSDMEAYDSSTGCLNW  267

Query  646   LNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGG  470
             LN+F++YHNE LQ++LNHLRELHP   IIY DYYNAA+R Y+SP+ +GF+   L ACCGG
Sbjct  268   LNEFSQYHNEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGG  327

Query  469   GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              G YN N    C S  + VCD PSSY SWDG+H TEAAY+WI  G+  G FT PK++  C
Sbjct  328   EGTYNYNILEPCNSN-ARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  386



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score =   424 bits (1090),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 253/351 (72%), Gaps = 2/351 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLP-YGETFFHHPTGRYSDGRLIIDFM  1157
             GC+ +I SFGDSLTDTGNL+++S   ++ +     P YG TFFH PTGR SDGRL+IDF+
Sbjct  61    GCFTSIFSFGDSLTDTGNLLQLSLLESSKLSHFDFPPYGRTFFHSPTGRCSDGRLVIDFV  120

Query  1156  ALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNEL  977
             A  +GLPF+ PYFG +    ++F KGVNFAV GATA+D +FF ERGI N  TNVSLG EL
Sbjct  121   AEGLGLPFLPPYFGVQNGRPKNFQKGVNFAVVGATALDDAFFKERGIKNPFTNVSLGVEL  180

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
               FK++L S C + S CKE L  S+I+MGEIGGNDYNYAF +G   EE+  FVP V+  I
Sbjct  181   GLFKEVLPSLCSSSSDCKELLRESLIVMGEIGGNDYNYAFEEGKNPEEIREFVPLVVHTI  240

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
             +S INELI+ GA   +VPGNLPIGCSP+YL+YF  S+  EYDP TGC+ WLN F+EYHNE
Sbjct  241   SSAINELIELGAVTFLVPGNLPIGCSPAYLTYFQGSDKGEYDPLTGCLTWLNQFSEYHNE  300

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAY  437
             LLQ+EL+ +RELHPH  IIYADYYN AMR Y  P+ +GF  T+ ACCG G PYN +    
Sbjct  301   LLQQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGKGVPYNYSSSMA  360

Query  436   CGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
             CG   L T CD PSSY+SWDG+H TEA Y+WI   +L   FT P IN  C+
Sbjct  361   CGDPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  411


 Score =   361 bits (927),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 225/320 (70%), Gaps = 3/320 (1%)
 Frame = -1

Query  1261  SSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAK  1082
              S+    SA  PYG TFFHHPTGR SDGRL+IDF+A   GLPF+ PYFGG+     +F K
Sbjct  450   ESSKLPQSAFPPYGRTFFHHPTGRCSDGRLVIDFIAEDFGLPFLPPYFGGENGRPNNFQK  509

Query  1081  GVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSV  902
             GVNFAV GATA+D     ERGI N  TNV+LG EL +F+ +LSS C + S C++ L +S+
Sbjct  510   GVNFAVEGATALDDEILKERGITNPNTNVTLGVELGFFRDVLSSLCSSSSDCRKLLINSL  569

Query  901   ILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGC  722
             I+MGEIGGNDYN+AF +G   EE    VP VI  IAS I+ELI+ GA   +VPGNLPIGC
Sbjct  570   IVMGEIGGNDYNFAFEEGKSNEETRELVPLVIDTIASAIHELIELGAVTFLVPGNLPIGC  629

Query  721   SPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYN  542
              PSYL+ +  S+  EYDP TGC+ WLN F+EYHN+LLQ+EL  ++E+HPH  I YADYY+
Sbjct  630   LPSYLTNYQGSDEEEYDPLTGCLTWLNQFSEYHNQLLQEELARIQEIHPHVNIFYADYYS  689

Query  541   AAMRLYRSPNNYGF--ENTLEACCGGGGPYNSNPHAYCGSQLST-VCDSPSSYISWDGMH  371
             AA+R Y SP  +GF  E   +ACCGGGGPYN N  A CG  L T  CD PSSY+SWDG+H
Sbjct  690   AAIRFYLSPKQFGFRKETQRKACCGGGGPYNFNLSAVCGYPLVTSCCDDPSSYVSWDGIH  749

Query  370   LTEAAYQWIVDGLLIGPFTS  311
              TEAA + +   +L G  T+
Sbjct  750   YTEAANRLLSRAILDGLHTN  769



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score =   410 bits (1055),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 263/367 (72%), Gaps = 6/367 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             ++FLVL  +  ++ G C+ +I+SFGDSL DTGN + ++ +       ++ PYGETFFHHP
Sbjct  13    FLFLVLNHNFQNIEG-CFDSIISFGDSLADTGNKLHITLNKIPPSHFSLPPYGETFFHHP  71

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR--SFAKGVNFAVAGATAMDMSFFTE  1025
             TGR+SDGRL+IDF+A S GLP V  Y  GK   +    F +GVNFAV GATA+D ++  +
Sbjct  72    TGRFSDGRLVIDFIAESFGLPLVPAYLEGKDERNYIVKFRQGVNFAVGGATALDSAYLLD  131

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             +G+ +S  NVSLG +LDWFK M+SSFC+ PS CKE+L++S+ILMGEIGGND+NY FL   
Sbjct  132   KGVTSS-NNVSLGTQLDWFKDMMSSFCKFPSECKEFLQNSLILMGEIGGNDFNYGFLGNS  190

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
              KEEV S+VP VI  ++S I ELI+ GA  L+VPG+LPIGCS +YL+ +M S+  +YDP+
Sbjct  191   TKEEVESYVPAVIKTLSSAIQELIELGASTLLVPGDLPIGCSTAYLTKYMHSDKGQYDPK  250

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TL  488
             TGC+NWLN+F++ +NELLQKEL+ LR+L+P   IIYADYYNAAM+ Y SP ++GF    L
Sbjct  251   TGCLNWLNNFSQQYNELLQKELHLLRDLYPAATIIYADYYNAAMQFYASPKSHGFRKGAL  310

Query  487   EACCGGGGPYNSNPHAYCGSQLS-TVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
              ACCG GGPYN      CG   +  +C   S Y SWDGMH TEAAY+WI  GLL G FT 
Sbjct  311   VACCGAGGPYNFMFSTICGDPAARNICSDTSVYASWDGMHFTEAAYKWIATGLLKGTFTF  370

Query  310   PKINGEC  290
             P +   C
Sbjct  371   PPLPKIC  377



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score =   428 bits (1101),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 215/365 (59%), Positives = 256/365 (70%), Gaps = 8/365 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             +I +++F  T  V G CY++I SFGDSLTDTGNL+  S + N     A  PYGETFFH P
Sbjct  5     FILVLIFAHTQQVIG-CYESIFSFGDSLTDTGNLLLASPAHN-LPHFAKPPYGETFFHRP  62

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERG  1019
             TGR SDGRLIIDF+A  +GLP + PY   +TT  R   + VNFA+ GATA+D  FF  R 
Sbjct  63    TGRCSDGRLIIDFIAGFLGLPLIHPYL--ETTDPR---QSVNFAIVGATALDDEFFQARN  117

Query  1018  IINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPK  839
             I    TN+SLG +L WFK  L S C T S C E   SS+ LMGEIGGNDY Y F QG   
Sbjct  118   IHIPYTNISLGIQLGWFKDKLLSLCPTFSNCNELFNSSLFLMGEIGGNDYGYPFFQGRSL  177

Query  838   EEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTG  659
             EE+ ++VP VI  IAS I ELI+ GA  L+VPG LP GCS SYL+ F T N  +YDP TG
Sbjct  178   EEIRTYVPPVIHAIASAITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIEDYDPVTG  237

Query  658   CINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEA  482
             C+NWLN+F EYHNE L+ ELN +REL+PHT IIYADYYNAAMR+YRSPN +GF+   L A
Sbjct  238   CLNWLNEFAEYHNEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTA  297

Query  481   CCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CCGGGGPYN N    CG+  +T CD PS Y+SWDG+HLTEAAY+WI +GLL  P+T P +
Sbjct  298   CCGGGGPYNYNSSVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPL  357

Query  301   NGECI  287
             N  CI
Sbjct  358   NASCI  362


 Score =   323 bits (827),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 216/336 (64%), Gaps = 8/336 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y++I SFGDSL DTGN   +   + A+ +   LPYGETFF H TGR SDGRLI+DF+A +
Sbjct  372   YESIFSFGDSLADTGNF--LLSGALAFPVIRELPYGETFFRHATGRCSDGRLIVDFIAEA  429

Query  1147  MGLPFVEPYFG-GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELD  974
              G+P++ PY   GK    +SF  GVNFAVAGATA+D  FF  + +     TN SL  +L 
Sbjct  430   FGIPYLPPYLSLGK---GKSFRHGVNFAVAGATALDPEFFYHQKLGRILWTNNSLSVQLG  486

Query  973   WFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             WFK++  S C T   C  +   S+ L+GEIGGNDYNY F  G   ++V + VP V+  I 
Sbjct  487   WFKKLKPSICTTKKGCDNFFRKSIFLVGEIGGNDYNYPFFVGGSIKQVQALVPLVVEAIT  546

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
                + LI+ GA  L+VPGN PIGCS  YL+ F + N ++YD   GC+   N F +YHN  
Sbjct  547   KAASMLIEEGAVTLMVPGNFPIGCSAVYLTIFRSPNKADYDENNGCLKAFNAFAQYHNTH  606

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAY  437
             L+  L+ L   +PH +IIYADYYNAAM L+++P ++GF N  L ACCGGGGPYN N  A 
Sbjct  607   LKLALDKLGLKYPHAKIIYADYYNAAMPLFQAPRSFGFYNGALRACCGGGGPYNFNNSAR  666

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLL  329
             CG   S  C+ PSSY +WDG+HLTE AY+ I   L+
Sbjct  667   CGHIGSKACNDPSSYANWDGIHLTEGAYKIIATCLI  702



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score =   406 bits (1043),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 201/393 (51%), Positives = 263/393 (67%), Gaps = 9/393 (2%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFV---STGHVAGGCYKAIVSFGDSLTDTGNL-IRMSKSSNAYV  1244
             MA S   +I   + + +F+   ST  V   CY +I SFGDSL DTGNL I  ++    Y 
Sbjct  1     MARSAPISIWKILLVAVFLALASTNQVLS-CYTSIFSFGDSLADTGNLLILQAQEHKPYS  59

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
               + +PYGET+FH PTGR S+GRL+IDF+A S+GLPF+ P+   +    +   +G+NFAV
Sbjct  60    RISRVPYGETYFHRPTGRSSNGRLVIDFIAQSLGLPFIPPFL--QRNNSQPVQQGLNFAV  117

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEI  884
              GATA+D SF  ERGI N  +N SLG +  WFKQ+L S C   + C+E L  S++L GEI
Sbjct  118   VGATALDDSFLRERGIFNPDSNNSLGIQFQWFKQVLPSLCDPSTNCRELLARSLVLAGEI  177

Query  883   GGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLS  704
             GGND+N+AF +G    ++   VP VI  + ST+  LI+ GA  L+VPGNLPIGCS +YL+
Sbjct  178   GGNDFNHAFFEGKSFHDIRPLVPLVINAVTSTVQMLIEQGAVTLLVPGNLPIGCSAAYLT  237

Query  703   YFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLY  524
              F + N  +YDP+TGC+ WLN+F +  N+ L KEL+ +REL+PH  IIYADYYNAAMR+Y
Sbjct  238   QFQSPNKDDYDPETGCLKWLNEFAQKFNDHLVKELDGMRELYPHATIIYADYYNAAMRIY  297

Query  523   RSPNNYGFEN-TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQW  347
             RSP+ YGF N  L ACCGGGGPYN +  A CG   S  C+ PSSY+SWDG+HLTEAAY+ 
Sbjct  298   RSPSQYGFTNGALTACCGGGGPYNYDRTAMCGDAGSRTCEDPSSYVSWDGIHLTEAAYRL  357

Query  346   IVDGLLIGPFTSPKINGECILSRPKTKIPDS*R  248
             I +GL+ GP+  P I   C  S P+    D+ R
Sbjct  358   IAEGLIRGPYAVPSIKHSCA-SLPQIPFADTRR  389



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   404 bits (1038),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 250/351 (71%), Gaps = 5/351 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GCY +I+ FGDS+TDTGNL     + +        PYGET+FHHPTGR SDGRL+IDF+A
Sbjct  25    GCYNSIIGFGDSITDTGNLYNSDPNRSLNFFHP--PYGETYFHHPTGRCSDGRLVIDFIA  82

Query  1153  LSMGLPFVEPYFGGKTTGD--RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
               +GLP V PY   +++    ++F  GVNFAVAGATA+D +F  E G   SCTN SL  +
Sbjct  83    EFLGLPLVPPYLESQSSNQSVQNFEAGVNFAVAGATALDAAFLEEMGDSVSCTNDSLSIQ  142

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             L+WFKQML S C T S C + L +S+ILMGEIGGNDYN A L G   E+V ++VP VI  
Sbjct  143   LEWFKQMLPSLCNTSSDCNKVLSTSLILMGEIGGNDYNDALLAGKSIEKVQAYVPLVIET  202

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             IASTINELI+ GA  L+VPGN PIGC P+YL+ + +S+ ++YDP TGC+NWLN F+ YHN
Sbjct  203   IASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGYHN  262

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPH  443
             + LQ  L+ +R LHP   IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N  
Sbjct  263   DQLQIALSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNAS  322

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             A CG   ++ C++P+ +ISWDG+H TEAA++WI   +L G +T P+++  C
Sbjct  323   ALCGDAGASACENPAQFISWDGLHSTEAAHRWITKAILQGNYTVPRVSTLC  373



>ref|XP_010040115.1| PREDICTED: uncharacterized protein LOC104428890 [Eucalyptus grandis]
Length=814

 Score =   418 bits (1075),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 251/350 (72%), Gaps = 3/350 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GCY++I+SFGDSL DTGN + +++S+     +  LPYG+T F  PTGR+SDGRL+IDF+A
Sbjct  441   GCYRSIISFGDSLADTGNALHLARSAGRSTHAGSLPYGQTHFRRPTGRFSDGRLVIDFVA  500

Query  1153  LSMGLPFVEPYFGGKTTGD-RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNEL  977
               +GLP+V PY+G    G    F KGVNFAV GATA+D SFF  RG+ ++  N SLG +L
Sbjct  501   ERLGLPYVAPYYGDDGGGSVEDFRKGVNFAVGGATALDGSFFEGRGMGSNFPNESLGVQL  560

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
               FK++L S C T S CKE+L +S++LMGEIGGNDYN+ F  G   EE+  FVP VI  I
Sbjct  561   GLFKELLPSLCYTSSDCKEFLGNSLVLMGEIGGNDYNHPFFMGKDLEEIKDFVPLVIEEI  620

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
              S I+ELI  GA  ++VPGN PIGC P+YL+ F +S+   YDP TGC+NWLN+F++YHNE
Sbjct  621   VSAISELIHLGAVTILVPGNFPIGCLPAYLTKFQSSDKEAYDPSTGCLNWLNEFSQYHNE  680

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNPHA  440
              LQ +L+HLRELHP T+IIY DYYNAA+R Y+SPN +GFE     ACCGGGG +N N  A
Sbjct  681   QLQLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNYNSSA  740

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              C S  + VCD PSSY SWDG+H TEAAY+WI   +  G FT PK++  C
Sbjct  741   LCSSN-TKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  789


 Score =   417 bits (1071),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 254/360 (71%), Gaps = 7/360 (2%)
 Frame = -1

Query  1357  VSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDG  1178
             +S+   A GCY +I+SFGDSL DTGN + +S+S      +  LPYGET+F  PTGR+SDG
Sbjct  28    ISSSSPAPGCYDSIISFGDSLADTGNELHLSRSEGRPNQAGSLPYGETYFRRPTGRFSDG  87

Query  1177  RLIIDFMALSMGLPFVEPYFG---GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINS  1007
             RL+IDF+A  +GLPFV PY+G   G++  D  F KGVNFAVAGATA+D SFF  RG+ N 
Sbjct  88    RLVIDFIAEWLGLPFVAPYYGDDGGRSAAD--FRKGVNFAVAGATALDASFFEGRGLGND  145

Query  1006  CTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVM  827
               N+SLG +L  FK++L S C T S CK++L +S++LMGEIGGNDYNY F  G   EE+ 
Sbjct  146   FPNISLGVQLGLFKELLPSVCSTSSDCKQFLGNSLVLMGEIGGNDYNYHFFVGRDLEEIQ  205

Query  826   SFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINW  647
               VP VI  I S I+ELI  GA +++VPGN PIGC P YL+ F  S+   YD  TGC+NW
Sbjct  206   GIVPLVIEGIVSAISELIDLGAVMILVPGNFPIGCLPIYLTEFQGSDKEAYDSSTGCLNW  265

Query  646   LNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGG  470
             LN+F++YHNE LQ++LNHLRELHP   IIY DYYNAA+R Y+SP+ +GF+   L ACCGG
Sbjct  266   LNEFSQYHNEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGG  325

Query  469   GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              G YN N    C S  + VCD PSSY SWDG+H TEAAY+WI  G+  G FT PK++  C
Sbjct  326   EGTYNYNILEPCNSN-ARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/348 (57%), Positives = 247/348 (71%), Gaps = 7/348 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I+SFGDSL DTGN +  S +S   +  A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31    CYTSIISFGDSLADTGNFLYSSNNSPGAI--ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +G+P V PY  G   GD  F +GVNFAVAGATA+D  FF E+G+  S T  SLG +++W
Sbjct  89    DIGIPLVPPYLEGP--GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C + S CK  L SS+ LMGEIGGNDYN+ F QG   +E+ +FVP +I+ I+S
Sbjct  147   FKQLLPSLCSSGSDCKGILSSSLFLMGEIGGNDYNHPFFQGKTVDEIRTFVPSIISAISS  206

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI WLN+F EYHN LL
Sbjct  207   AINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLL  266

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
               EL+HL++LHPH  IIYADYY A + ++RSP  +GF+   L ACCGGGGPYN +    C
Sbjct  267   VDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS--VPC  324

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             G + +TVC+ PS+Y+ WDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  325   GGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  372



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 257/378 (68%), Gaps = 8/378 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGE  1217
             ++  ++F  LFV+       C  +K+I+SFGDS+ DTGNL+ +S   N   ++A  PYGE
Sbjct  6     SLVIFLFSTLFVTIVSSETPCPNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  1216  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMS  1037
             TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F KGVNFAVAGATA+  S
Sbjct  65    TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNFDKGVNFAVAGATALKSS  121

Query  1036  FFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAF  857
             F  +RGI    TNVSLG +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F
Sbjct  122   FLKKRGI-QPHTNVSLGVQLKSFKKSLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPF  180

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
                 P +EV   VP VI  I+STI ELI  G +  +VPG  PIGCS  YL+ + TSN  E
Sbjct  181   FNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDE  240

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-  500
             YDP TGC+ WLN F EYH+E L+ ELN LR+L+PH  IIYADYYN+ +R+++ P  +GF 
Sbjct  241   YDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFM  300

Query  499   ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             E    ACCG GGPYN N    CGS     C  PS Y+ WDG+H+TEAAY+WI DG+L GP
Sbjct  301   ERPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGP  360

Query  319   FTSPKINGECILSRPKTK  266
             + +P  +  C+ S  K +
Sbjct  361   YANPPFDRSCLRSEIKKE  378



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   399 bits (1025),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 242/351 (69%), Gaps = 6/351 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             AI    FL L  S    AG CYK+I+ FGDSLTDTGNL+++    N        PYGETF
Sbjct  15    AILVLSFLKLSTSARASAGSCYKSIIGFGDSLTDTGNLVQLFPPDNP-THCYRPPYGETF  73

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             F HPTGR  DGRLIIDF+A S GLP V  Y     + D  F +GVNFAV+GATA++ SFF
Sbjct  74    FKHPTGRCCDGRLIIDFIAESFGLPLVPAYLWRDESTD--FRQGVNFAVSGATALNNSFF  131

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFCQT-PSRC-KEYLESSVILMGEIGGNDYNYAF  857
              E G+ +  TNVSLG +L WFK +L S C +  S C +E+L+SS +LMGEIGG+DYN A 
Sbjct  132   LEMGLQDLSTNVSLGTQLRWFKDILPSLCSSNSSDCSREFLQSSFVLMGEIGGDDYNAAL  191

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
             L G   +EV  +VP V+  IAS I ELIK GA  L+VPGN PIGC  SYL+YF +S+  +
Sbjct  192   LGGIKPDEVKPYVPGVVREIASAIEELIKLGAVTLVVPGNFPIGCLASYLTYFQSSSQHD  251

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE  497
             YD  TGCINWLND  +YHN LLQKELN +R+L PH  IIYADYYNAAMRLYRSPN YGF 
Sbjct  252   YDTDTGCINWLNDLAKYHNRLLQKELNRIRKLLPHATIIYADYYNAAMRLYRSPNKYGFR  311

Query  496   -NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQW  347
                L ACCG GGPYN N    CG   +T C  PS Y++WDG+HLTEAAYQ+
Sbjct  312   GEALRACCGTGGPYNCNTSIPCGYLPATPCKDPSLYVTWDGLHLTEAAYQF  362



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score =   399 bits (1024),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/392 (51%), Positives = 264/392 (67%), Gaps = 12/392 (3%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             +T+++   LF++T + +   +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFF
Sbjct  11    VTFFLSSTLFLATAN-SESRFKSIISFGDSIADTGNLLGLS-DPNDLPHVAFPPYGETFF  68

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             +H TGR+S+GRLIIDF+A  +GLP V P++G +   + +F KGVNFAV GATA++ SF  
Sbjct  69    NHSTGRFSNGRLIIDFIAEYLGLPLVPPFYGSQ---NANFDKGVNFAVGGATALERSFLE  125

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             ERGI  + TNVSLG +L  FK +L + C +PS C++ +E ++ILMGE+GGND NYAF  G
Sbjct  126   ERGIHFAYTNVSLGVQLQSFKNLLPNLCDSPSECRDMIEDALILMGEVGGNDLNYAFFVG  185

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
              P EE+   +P VIT I+S I ELI  G +  +VPGN P+GCS +YL+ + TSN  EYDP
Sbjct  186   KPIEEIKELIPLVITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDP  245

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-  491
              TGC+ WLN F EY NE LQ EL+ LR+L+PH  IIYADYYNA  R+++ P  +GF N  
Sbjct  246   VTGCLKWLNKFAEYFNEQLQAELDRLRKLYPHVNIIYADYYNALSRIFQEPAKFGFMNRP  305

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L ACCG GG YN  P   CG +    CD PS Y++WDG+H+TEAAY+ I +GLL GP+  
Sbjct  306   LPACCGLGGQYNYTPGKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVI  365

Query  310   PKINGECILSRPKTKIPDS*RLGLSAAQFEII  215
             P  N  C+ S  K         G S A+F ++
Sbjct  366   PPFNWSCLSSELKKNN------GSSDAEFSLV  391



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score =   397 bits (1020),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 195/378 (52%), Positives = 256/378 (68%), Gaps = 8/378 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGE  1217
             ++  ++F  LFV+       C  +K+I+SFGDS+ DTGNL+ +S   N   ++A  PYGE
Sbjct  6     SLVIFLFSTLFVTIVSSETPCRNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  1216  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMS  1037
             TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F KGVNFAVAGATA+  S
Sbjct  65    TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNFDKGVNFAVAGATALKSS  121

Query  1036  FFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAF  857
             F  +RGI    TNVSL  +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F
Sbjct  122   FLKKRGI-QPHTNVSLRVQLKSFKKSLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPF  180

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
                 P +EV   VP VI  I+STI ELI  G +  +VPG  PIGCS  YL+ + TSN  E
Sbjct  181   FNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDE  240

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-  500
             YDP TGC+ WLN F EYH+E L+ ELN LR+L+PH  IIYADYYN+ +R+++ P  +GF 
Sbjct  241   YDPTTGCLKWLNKFGEYHSEKLKAELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFM  300

Query  499   ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             +    ACCG GGPYN N    CGS     C  PS Y+ WDG+H+TEAAY+WI DG+L GP
Sbjct  301   DRPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGP  360

Query  319   FTSPKINGECILSRPKTK  266
             + +P  +  C+ S  K +
Sbjct  361   YANPPFDRSCLRSEIKKE  378



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score =   395 bits (1016),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 259/378 (69%), Gaps = 7/378 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  +I   L V++ +    C  +K+I+SFGDS+ DTGNL+ +S   N    SA  PYGET
Sbjct  12    LVRFILSTLLVTSVNSQTQCRNFKSIISFGDSIADTGNLLGLS-DPNDLPASAFPPYGET  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGRYSDGRLIIDF+A  +G P V P++G +   + +F KGVNFAVAGATA++ SF
Sbjct  71    FFHHPTGRYSDGRLIIDFIAEFLGFPLVPPFYGCQ---NANFKKGVNFAVAGATALEPSF  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI ++ TNVSL  +L  F + L + C +PS C++ +E+++ILMGEIGGNDYN+A  
Sbjct  128   LEERGIHSTITNVSLSVQLRSFTESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             Q  P +EV   VP VI  I+S I EL+  G +  +VPGN PIG S SYL+ + TSN  EY
Sbjct  188   QRKPVKEVEELVPFVIATISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+ WLNDF+EY+N+ LQ+ELN LR+L+PH  IIYADYYNA +RL++ P  +GF N
Sbjct  248   DPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMN  307

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN N    CGS     CD PS Y+++DG+H+TEAAY+ I +GLL GP+
Sbjct  308   RPLPACCGVGGSYNFNFSRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPY  367

Query  316   TSPKINGECILSRPKTKI  263
               P     C+ S    K+
Sbjct  368   AIPPFKWSCLSSEIMNKM  385



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score =   395 bits (1014),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 256/375 (68%), Gaps = 7/375 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +T+++   LF++T +       +K+I+SFG+S+ DTGNL+ +S   N     A  PYGET
Sbjct  14    VTFFLSSTLFLATANSEPQRRRFKSIISFGNSIADTGNLLGLS-DPNDLPHVAFPPYGET  72

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FF+H TGR+S+GRLIIDF+A  +GLP V P++G +   + +F KGVNFAV GATA++ SF
Sbjct  73    FFNHSTGRFSNGRLIIDFIAEYLGLPLVPPFYGSQ---NANFEKGVNFAVGGATALERSF  129

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI  + TNVSLG +L  FK +L + C +PS C++ +E+++ILMGE+GGND NYAF 
Sbjct  130   LEERGIHFAYTNVSLGVQLQSFKGLLPNLCDSPSECRDMIENALILMGEVGGNDLNYAFF  189

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G P EE+   VP VIT I+S I ELI  G +  +VPGN P+GCS +YL+ + TSN  EY
Sbjct  190   VGKPIEEIRELVPLVITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEY  249

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+ WLN F EY NE LQ EL+ LR+L+PH  IIYADYYNA  RL++ P  YGF N
Sbjct  250   DPVTGCLKWLNKFAEYFNEQLQAELDRLRKLYPHVNIIYADYYNALARLFQEPAKYGFMN  309

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN  P   CG +    C  PS Y++WDG+H+TEAAY+ I +GLL GP+
Sbjct  310   RPLPACCGFGGQYNYTPGKKCGFEGVDYCKDPSKYVNWDGVHMTEAAYRLIAEGLLKGPY  369

Query  316   TSPKINGECILSRPK  272
               P  N  C+ S  K
Sbjct  370   VIPPFNWSCLSSEIK  384



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   393 bits (1010),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 238/350 (68%), Gaps = 8/350 (2%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GC+ AI SFGDS+ DTGN +R+     +   S   PYG TFF  PTGR+SDGR+IIDF
Sbjct  27    ASGCFTAIFSFGDSIADTGNAVRLGSLGAS---SGSPPYGRTFFDRPTGRFSDGRVIIDF  83

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A  +GLP V PY  G +  D  F +G NFAV GATA+D+ FF+ +GI  S T+ SL  +
Sbjct  84    IAQGLGLPLVRPYLDGGSGDD--FRQGANFAVGGATALDLDFFSSKGIQASWTDRSLRVQ  141

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             ++ FKQ+LSS     S  KE L SS+ILMGEIGGNDYN+ F QG   +EV +FVP VI  
Sbjct  142   IESFKQLLSSLS---SDTKEVLNSSLILMGEIGGNDYNHPFFQGINADEVRTFVPSVIGA  198

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I+S IN+LI+ G + L+VPGN PIGC P+YL  F + N  +YD QTGCI WLN+F+EYHN
Sbjct  199   ISSAINDLIELGVKTLLVPGNFPIGCIPAYLDVFQSKNVEDYDSQTGCIKWLNEFSEYHN  258

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHA  440
              LLQ EL+ LR+LHPH  IIYA+YY+A +  +R+P  +GF+  L ACCG  GPY  N   
Sbjct  259   RLLQDELDRLRKLHPHVTIIYANYYDATISFFRAPQLFGFKAPLHACCGSDGPYGVNRFV  318

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              CG + +TVC  PSS ISWDG+HLTEAAY+ I   LL GP   P I   C
Sbjct  319   QCGHKDATVCSDPSSSISWDGIHLTEAAYETIARSLLEGPHAKPPITRAC  368



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   394 bits (1012),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 247/360 (69%), Gaps = 19/360 (5%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I+SFGDSL DTGN +  S +S   +  A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31    CYTSIISFGDSLADTGNFLYSSNNSPGAI--ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +G+P V PY  G   GD  F +GVNFAVAGATA+D  FF E+G+  S T  SLG +++W
Sbjct  89    DIGIPLVPPYLEGP--GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEW  146

Query  970   FKQMLSSFCQTPS------------RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVM  827
             FKQ+L S C + S             CK  L SS+ LMGEIGGNDYN+ F QG   +E+ 
Sbjct  147   FKQLLPSLCSSGSGYPFTHVMFTMVDCKGILSSSLFLMGEIGGNDYNHPFFQGKTVDEIR  206

Query  826   SFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINW  647
             +FVP +I+ I+S IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI W
Sbjct  207   TFVPSIISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKW  266

Query  646   LNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGG  470
             LN+F EYHN LL  EL+HL++LHPH  IIYADYY A + ++RSP  +GF+   L ACCGG
Sbjct  267   LNEFAEYHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGG  326

Query  469   GGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             GGPYN +    CG + +TVC+ PS+Y+ WDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  327   GGPYNIS--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  384



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 243/348 (70%), Gaps = 4/348 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GCY +I SFGDS+TDTGNL   SK+S+ +      PYGET+FHHPTGR SDGRLIIDF
Sbjct  30    AFGCYSSIFSFGDSITDTGNLYISSKNSSFHFF--FPPYGETYFHHPTGRCSDGRLIIDF  87

Query  1159  MALSMGLPFVEPYFGGKTTGD-RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGN  983
             +A  +GLP+V PY   K+    ++   GVNFAV GATAMD  F    G  N  TN SLG 
Sbjct  88    IAEFLGLPYVRPYTEVKSNASPQNIEGGVNFAVIGATAMDAEFLAAMGDENDYTNSSLGT  147

Query  982   ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             +L WFK++L S C T S C + L SS++L+GEIG NDYN A L G   E+V ++VP VIT
Sbjct  148   QLHWFKELLPSLCNTSSNCNKLLSSSLVLVGEIGSNDYNDALLAGKNIEQVQTYVPLVIT  207

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+S INELI+ GA  L+VPGN PIGC P YL+ F TS+  +Y+  TGC+NWLN F EYH
Sbjct  208   EISSAINELIELGAVTLVVPGNFPIGCLPIYLTKFQTSDKGQYNSSTGCLNWLNKFAEYH  267

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  446
             N+ LQ EL+ ++ LHP+  IIYADYYNA M  Y SP+ +GF   T++ACCGGGGPYN N 
Sbjct  268   NDQLQIELSRIQRLHPNINIIYADYYNAVMHFYHSPDQFGFIGGTVKACCGGGGPYNYNS  327

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
              A CGS  ++ C++P+ +I+WDG+H TEAAY+WIV  L  G +  P I
Sbjct  328   SAQCGSIEASACENPAEFINWDGIHFTEAAYRWIVKVLFKGKYNVPGI  375



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score =   392 bits (1008),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 255/373 (68%), Gaps = 6/373 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             + +++   LF++  + +   +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFF
Sbjct  11    VPFFLSSTLFLAIAN-SESRFKSIISFGDSIADTGNLLGLS-DPNDLPHVAFPPYGETFF  68

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             +H TGR+S+GRLIIDF+A  +GLP V P++G +   + +F KGVNFAV GATA++ SF  
Sbjct  69    NHSTGRFSNGRLIIDFIAEYLGLPLVPPFYGSQ---NANFDKGVNFAVGGATALERSFLE  125

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             ERGI  + TNVSLG +L  FK +L + C +PS C++ +E ++ILMGE+GGND NYAF  G
Sbjct  126   ERGIHFAYTNVSLGVQLQSFKGLLPNLCDSPSECRDMIEDALILMGEVGGNDLNYAFFVG  185

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
              P EE+   +P VIT I+S I ELI  G +  +VPGN P+GCS +YL+ + TSN  EYDP
Sbjct  186   KPIEEIKELIPLVITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNVEEYDP  245

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-  491
              TGC+ WLN F EY NE LQ EL+ LR+++PH  IIYADYYNA  R+++ P  +GF N  
Sbjct  246   VTGCLKWLNKFAEYFNEQLQAELDRLRKMYPHVNIIYADYYNALSRIFQEPAKFGFMNRP  305

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L ACCG GG YN  P   CG +    CD PS Y++WDG+H+TEAAY+ I +GLL GP+  
Sbjct  306   LPACCGLGGQYNYTPGKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVI  365

Query  310   PKINGECILSRPK  272
             P  N  C+ S  K
Sbjct  366   PPFNWSCLSSELK  378



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 257/373 (69%), Gaps = 8/373 (2%)
 Frame = -1

Query  1393  TAITYYIFLVLFVS---TGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPY  1223
             + I + IFLVL  S      ++  C+ +I+SFGDSLTDTGN   +++  N     A LPY
Sbjct  6     SKIAFIIFLVLLNSIEGQRLISLRCFNSIISFGDSLTDTGNEFYLTRYRNPSPYFARLPY  65

Query  1222  GETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMD  1043
             GETFFH PTGR+S+GRLIIDF+A S+GLP +  YFG K   +  F +GVNFAV G+TA+D
Sbjct  66    GETFFHRPTGRFSNGRLIIDFIAESLGLPLIPAYFGEKD--NVKFTQGVNFAVGGSTALD  123

Query  1042  MSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNY  863
              ++ + +G+  + TN SL  +L W K+MLSS C+ PS CKE+L++S+I +GEIGGND+ Y
Sbjct  124   PTYLSNKGV-KTTTNASLVAQLGWLKEMLSSHCKFPSECKEFLKNSLIFVGEIGGNDFIY  182

Query  862   AFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA  683
              F   + KE+V S+VP VI  I+S I E+IK+GA  ++VPG++P+GCS + L+ FM SN 
Sbjct  183   GFFGNNTKEKVESYVPAVINTISSVIKEVIKFGASRVVVPGSMPLGCSTALLTIFMDSNK  242

Query  682   SEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYG  503
              +YDP TGCINWLN F++ +N+LLQ EL+ +R+LHP   IIYAD+YNAAM+ Y SPN YG
Sbjct  243   EDYDPITGCINWLNQFSKNYNKLLQMELHLVRQLHPSVTIIYADHYNAAMQFYLSPNTYG  302

Query  502   F-ENTLEACCGGGGPYNSNPHAYCGSQLS-TVCDSPSSYISWDGMHLTEAAYQWIVDGLL  329
             F +  L ACCG GGPYN      CG   +  +C  PS Y SWDGMH TEAAY+ I   LL
Sbjct  303   FTKGALVACCGAGGPYNYKLFELCGDPTARNICSDPSIYASWDGMHFTEAAYKLIATSLL  362

Query  328   IGPFTSPKINGEC  290
              G FT P +   C
Sbjct  363   EGNFTFPSLPKIC  375



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/379 (53%), Positives = 253/379 (67%), Gaps = 20/379 (5%)
 Frame = -1

Query  1390  AITYYIFLVLFVS--------TGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSA  1235
             A+ Y I L+  ++         G    GCY++I+SFGDSL DTGNL+ +S + N    +A
Sbjct  2     AVAYAIILIFLLAQSSSAAAANGKSEFGCYESIISFGDSLADTGNLLLLSPADNK-PAAA  60

Query  1234  VLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRS--FAKGVNFAVA  1061
               PYG TFFH PTGR+SDGRL+IDF+A   GLPFV PY GG+    R    +KGVNFAV 
Sbjct  61    RPPYGRTFFHRPTGRFSDGRLVIDFIAQRFGLPFVPPYIGGQNGELRGGGVSKGVNFAVV  120

Query  1060  GATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIG  881
             GATA+   F+ + G  N  TNVSLG +LDWFK+ LS+        K+YLE S++++GEIG
Sbjct  121   GATALGYEFYEKLGFHNPVTNVSLGTQLDWFKRFLSTIPDG----KKYLERSLVVVGEIG  176

Query  880   GNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSY  701
             GNDYN+   QG   + + SF P V+  I STI ELIK G + ++VP   PIGC P YL+ 
Sbjct  177   GNDYNHPLSQGATYDVIQSFAPAVVDYIGSTIQELIKLGVKTMLVPAIPPIGCLPVYLTQ  236

Query  700   FMTSNA-SEYDPQTGCINWLNDFTEYHNELLQKELNHLREL-HP-HTRIIYADYYNAAMR  530
             F  S+   +YDP+TGC+NWLN+F  YHN+LL+KELN ++EL +P    IIYADYYNAAMR
Sbjct  237   FKKSSTIRDYDPKTGCLNWLNEFARYHNKLLKKELNRIQELINPDQIDIIYADYYNAAMR  296

Query  529   LYRSPNNYGF--ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAA  356
              Y SPN YG   +  L ACCG GGPYN N  A CGS  +T CD PSS+ SWDG+H TEAA
Sbjct  297   FYLSPNEYGLSKKGILRACCGAGGPYNYNASAECGSSPATCCDDPSSFASWDGLHFTEAA  356

Query  355   YQWIVDGLLIGPFTSPKIN  299
             Y+ I  GL  GP+T+P++ 
Sbjct  357   YRLIAQGLFDGPYTTPRVK  375



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/369 (54%), Positives = 253/369 (69%), Gaps = 8/369 (2%)
 Frame = -1

Query  1363  LFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
             LFVS       C  +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20    LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +GLP+V PYFG  T G+  F KGVNFAVA ATA++ SF  E+G  +
Sbjct  79    FSDGRLIIDFIAEFLGLPYVPPYFG-STNGN--FEKGVNFAVASATALESSFLEEKGY-H  134

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEV  830
                N SLG +L  FKQ L + C  PS C++ + +++ILMGEIG NDYN+ F Q  P +EV
Sbjct  135   CPHNFSLGVQLKIFKQSLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFQLRPLDEV  194

Query  829   MSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCIN  650
                VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP TGC+ 
Sbjct  195   KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLK  254

Query  649   WLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCG  473
             WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P+ YGF N  L ACCG
Sbjct  255   WLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCG  314

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGE  293
              GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P  +  
Sbjct  315   VGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWS  374

Query  292   CILSRPKTK  266
             C+ S  K K
Sbjct  375   CLSSMIKKK  383



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 257/376 (68%), Gaps = 8/376 (2%)
 Frame = -1

Query  1387  ITYYIFLVLF-VSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGE  1217
             +++++ L  F ++T +    C  +K+I+SFGDS+ DTGNL+ +S  +N   + A LPYGE
Sbjct  9     VSFFLILSTFCLTTVNSEPQCHNFKSIISFGDSIADTGNLLALSDPTNLPKV-AFLPYGE  67

Query  1216  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMS  1037
             TFFHHPTGR+S+GRLIIDF+A  +G P V P++G +   + +F KGVNFAV GATA++ S
Sbjct  68    TFFHHPTGRFSNGRLIIDFIAEFLGFPLVPPFYGSQ---NANFEKGVNFAVGGATALERS  124

Query  1036  FFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAF  857
             F  ERGI    TNVSL  +L  FK+ L + C +PS C++ +E+S+ILMGEIGGNDYNYAF
Sbjct  125   FLEERGIHFPYTNVSLAVQLSSFKESLPNLCVSPSDCRDMIENSLILMGEIGGNDYNYAF  184

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
               G   EE+   VP VI  I+S I ELI  G +  +VPG  P+GCS +YLS + TSN  E
Sbjct  185   FVGKNIEEIKELVPLVIETISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEE  244

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-  500
             YDP TGC+ WLN F+EYH+E LQ ELN L++L+PH  IIYADYYN  +RL + P  +GF 
Sbjct  245   YDPLTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFI  304

Query  499   ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
                L ACC  GGP+N       G+Q+   CD PS Y+SWDG+H+TEAAY+ + +G+L GP
Sbjct  305   SRPLPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGP  364

Query  319   FTSPKINGECILSRPK  272
             +  P  +  C+ S  K
Sbjct  365   YAIPPFDWSCLSSEIK  380



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 249/369 (67%), Gaps = 6/369 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             ++F VL +ST     GCY +I SFGDSL DTGN   +S   N    S  LPYGETFFHHP
Sbjct  57    FLFNVLILSTVSCTTGCYTSIFSFGDSLADTGNSRNLSPPDNLPHYS-FLPYGETFFHHP  115

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAK-GVNFAVAGATAMDMSFFTER  1022
             TGR SDGRL+IDF+A  +GLPFV PYFGG      SF + GVNFAVAGATA+D +F  E+
Sbjct  116   TGRCSDGRLVIDFIAEYLGLPFVPPYFGGSM---ESFKEAGVNFAVAGATALDAAFLQEK  172

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             G+    TN+SL  +L  FK++L S C TPS CK+ L  S+IL+GEIGGNDYN+ F +G  
Sbjct  173   GLAKLVTNISLVVQLGLFKELLPSLCSTPSDCKKLLGESLILLGEIGGNDYNHPFFEGIN  232

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
              E +   VP VI  I   I ELI+ GA  ++VPGNLPIGCSPSYL+ F  S+  +YD  T
Sbjct  233   FETIQDLVPYVINTIGLAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKKDYDHLT  292

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLE  485
             GC+NWLN F + HNE L KEL  +++LHPH +IIYADYYNAAM  Y SPN +GF    L+
Sbjct  293   GCLNWLNKFAQEHNEQLIKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGFTGGVLK  352

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
             +CCG GG YN N    CG+ L +VCD P+S+++WDG+H TEA Y+ I + ++ G  + P 
Sbjct  353   SCCGWGGMYNYNSLVKCGNPLVSVCDDPTSFVNWDGIHYTEATYKLIFESIIEGSNSYPS  412

Query  304   INGECILSR  278
                 C L+ 
Sbjct  413   FKAFCNLNH  421



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 254/378 (67%), Gaps = 9/378 (2%)
 Frame = -1

Query  1402  SQGTAITYYIFLVLFVST---GHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAV  1232
             S G +   Y+  ++ VS     HV G C+ +++SFGDSLTDTGNL   S + + +     
Sbjct  3     SMGWSFQAYLMNLILVSVFIIPHVLG-CFNSVISFGDSLTDTGNLYNSSPNRSLHYFQP-  60

Query  1231  LPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGG--KTTGDRSFAKGVNFAVAG  1058
              PYGET+FHHPTGR SDGRLIIDF+A  +GLP V P+      T   ++F  GVNFAV G
Sbjct  61    -PYGETYFHHPTGRCSDGRLIIDFIAQFLGLPLVPPFLQSLNSTQPVQNFEAGVNFAVIG  119

Query  1057  ATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGG  878
             AT +D SF     I +  TN SL  +L+WFKQML S C T   CK++L +S+ILMG IG 
Sbjct  120   ATGLDASFLATMEIHSPSTNNSLRIQLEWFKQMLPSLCNTSLDCKKFLSTSLILMGSIGC  179

Query  877   NDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYF  698
             NDYN   L G   E V S++P VI  IASTINELI+ GA  ++VPGN PIGC PSYLS F
Sbjct  180   NDYNDGLLGGKSIELVRSYLPLVIEAIASTINELIELGAATILVPGNNPIGCLPSYLSKF  239

Query  697   MTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRS  518
              +S+ S+YD  TGC+ WLN+F +YHNE LQ EL+ +R LHP   I+YADYYNA ++LY+S
Sbjct  240   ESSDKSQYDASTGCLKWLNEFAQYHNEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQS  299

Query  517   PNNYGFE-NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIV  341
             P  +GF   T +ACCGGGGPYN N    CG+  +TVC++PS +I+WDGMH TEAAY+ + 
Sbjct  300   PRQFGFTGETSKACCGGGGPYNFNSSVQCGNAGATVCENPSQFINWDGMHCTEAAYRLMT  359

Query  340   DGLLIGPFTSPKINGECI  287
               LL G +T P++   C+
Sbjct  360   KALLQGNYTFPRLASLCV  377



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/377 (52%), Positives = 252/377 (67%), Gaps = 7/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             I  +    L V++      C  +++I+SFGDS+TDTGNLI +S + N    SA LPYGET
Sbjct  12    IVSFFLYTLLVTSVSSETKCLNFQSIISFGDSITDTGNLIALS-TPNELPESAFLPYGET  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGRYSDGRLIIDF+A  +GLP V P++G K   + +F KGVNFAV GATA++ S 
Sbjct  71    FFHHPTGRYSDGRLIIDFIAEVLGLPHVPPFYGSK---NGNFEKGVNFAVGGATALECSV  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI     N SLG +L  FK+ L S C +PS C + + +++IL+GEIGGNDYNY F 
Sbjct  128   LEERGISCPPKNKSLGVQLTNFKESLRSLCGSPSDCIDMIGNALILIGEIGGNDYNYPFF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                  EEV   VP VI+ I+STI EL+  G +  +VPG+ P+GCS  YL+ + TSN   Y
Sbjct  188   GHKNIEEVKELVPLVISTISSTITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKEAY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DPQTGC+ WLN+F+EYHNE LQ ELN LR+L+P+  IIY DYYNA +RL + P  +G   
Sbjct  248   DPQTGCLTWLNEFSEYHNEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMN  307

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
             N L  CCG GG YN      CG +    C+ PS Y++WDG+H+TEAAY+WI +GLL GP+
Sbjct  308   NPLPVCCGLGGRYNYTFGVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPY  367

Query  316   TSPKINGECILSRPKTK  266
              +P  +  C+ S  K K
Sbjct  368   ATPPFDWSCLSSEIKDK  384



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 248/368 (67%), Gaps = 6/368 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             ++F VL +ST     GCY +I SFGDSL DTGN   +S   N    S  LPYGETFFHHP
Sbjct  13    FLFNVLILSTISCTIGCYTSIFSFGDSLADTGNSRNLSPPDNLPHFS-FLPYGETFFHHP  71

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAK-GVNFAVAGATAMDMSFFTER  1022
             TGR SDGRL+IDF+A  +GLPFV PYFGG      SF + GVNFAVAGATA+D +F  E+
Sbjct  72    TGRCSDGRLVIDFIAEYLGLPFVPPYFGGSM---ESFKEAGVNFAVAGATALDAAFLQEK  128

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             G+    TN+SL  +L  FK++L S C TPS CK+ L  S+IL+GEIGGNDYN+ F +G  
Sbjct  129   GLTKLVTNISLVVQLGLFKELLPSLCSTPSDCKKLLGDSLILLGEIGGNDYNHPFFEGIN  188

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
              E +   VP VI  I   I ELI+ GA  ++VPGNLPIGCSPSYL+ F  S+  +YD  T
Sbjct  189   FETIQDLVPYVINTIGLAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKKDYDHFT  248

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLE  485
             GC+ WLN F + HNE L KEL  +++LHPH +IIYADYYNAAM  Y SPN +GF    L+
Sbjct  249   GCLKWLNKFAQEHNEQLMKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGFTGGVLK  308

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
             +CCG GG YN N    CG+ L + CD P+S+++WDG+H TEA Y+ I + ++ G ++ P 
Sbjct  309   SCCGWGGMYNYNSLVNCGNPLVSACDDPTSFVNWDGIHYTEATYKLIFESIIEGSYSYPS  368

Query  304   INGECILS  281
                 C L+
Sbjct  369   FKAFCYLN  376



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score =   390 bits (1001),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 253/369 (69%), Gaps = 8/369 (2%)
 Frame = -1

Query  1363  LFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
             LFVS       C  +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20    LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +GLP+V PYFG  T G+  F +GVNFAVA ATA++ SF  E+G  +
Sbjct  79    FSDGRLIIDFIAEFLGLPYVPPYFG-STNGN--FERGVNFAVASATALESSFLEEKGY-H  134

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEV  830
                N SLG +L  FKQ L + C  PS C++ + +++ILMGEIG NDYN+ F Q  P +EV
Sbjct  135   CPHNFSLGVQLKIFKQSLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFQLRPLDEV  194

Query  829   MSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCIN  650
                VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP TGC+ 
Sbjct  195   KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLK  254

Query  649   WLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCG  473
             WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P+ YGF N  L ACCG
Sbjct  255   WLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCG  314

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGE  293
              GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P  +  
Sbjct  315   VGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWS  374

Query  292   CILSRPKTK  266
             C+ S  K K
Sbjct  375   CLSSMIKKK  383



>ref|XP_009347996.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Pyrus x bretschneideri]
Length=376

 Score =   389 bits (999),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 243/352 (69%), Gaps = 4/352 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A  C+ +I SFGDSL DTGNL ++S S N  +     PYG T+FH PTGR SDGRL+IDF
Sbjct  25    ASCCFSSIFSFGDSLADTGNL-KIS-SPNETIHFFFPPYGMTYFHLPTGRCSDGRLVIDF  82

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A  +GLP V PY   + +  ++F  GVNFAVAGATA+D +F  E G  N  TN SLG +
Sbjct  83    IAEYLGLPLVRPYLESQKS-IQNFEGGVNFAVAGATALDATFLEEMGDSNPRTNNSLGIQ  141

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             +DWFK++L  FC   S C E+L  S+ILMGEIGGNDYN A L G   E+V  +VP VI  
Sbjct  142   MDWFKEILPYFCNISSNCSEFLSGSLILMGEIGGNDYNDALLGGKSIEQVQEYVPLVIEE  201

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I  +INELI+ GA  L+VPGN+PIGC P YL+ +  S+ S+YDP TGC+NWLN F EY+N
Sbjct  202   IGLSINELIELGAATLLVPGNVPIGCLPIYLTNYEGSDKSDYDPSTGCLNWLNKFVEYYN  261

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPH  443
             E LQ ELN +R LHPH  IIYADYYNA M LY SP  +GF   T +ACCGGGG YN N  
Sbjct  262   EQLQTELNRIRSLHPHVNIIYADYYNAMMYLYHSPEQFGFIGGTPKACCGGGGTYNYNSS  321

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
             A CG + ++ C +P  +ISWDG+H TEAAY+WI + LL G +T P I+  C+
Sbjct  322   AQCGMRQASACQNPEEFISWDGIHFTEAAYKWITNALLKGNYTDPCISSLCV  373



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score =   389 bits (998),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 240/352 (68%), Gaps = 7/352 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C  +I SFGDSL DTGN +  S+ +   +  A LPYGET+FH PTGRY+DGRLIIDF+A 
Sbjct  31    CCTSIFSFGDSLADTGNFLYSSRDNPRAI--ARLPYGETYFHRPTGRYTDGRLIIDFIAQ  88

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +G+P V PY  G   GD  F +GVNFAVAGATA+D  FF E+G+  S T  SLG +++W
Sbjct  89    DIGIPLVPPYLEGP--GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C + S CK  L SS+ LMGEIGGNDYN+ F QG   +E+ +FVP VI+ I+S
Sbjct  147   FKQLLPSLCSSSSDCKGILSSSLFLMGEIGGNDYNHPFFQGRTVDEIRTFVPSVISAISS  206

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              IN LI+ GA+ ++VPGN PIGC   YL  F +    +YD +TGCI WLN+F EYHN LL
Sbjct  207   AINVLIQLGAKTMVVPGNFPIGCVSRYLQTFQSQRKEDYDSETGCIKWLNEFAEYHNRLL  266

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
               EL+HLR+LHPH  IIYADYY A + ++R P  +GF E  L ACCG GGPYN      C
Sbjct  267   VDELDHLRQLHPHVTIIYADYYEALLHIFRFPTQFGFKEPPLAACCGAGGPYNV--FVAC  324

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  278
             G + +TVC+ PS Y+ WDG+HLTEAAY  I  GLL G + +P I   C   R
Sbjct  325   GDRAATVCNDPSKYVCWDGIHLTEAAYGTIAQGLLEGSYATPPITQACAHIR  376



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   402 bits (1033),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 258/377 (68%), Gaps = 7/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  ++   L V++ +    C  +K+I+SFGDS+ DTGNL+ +S  +N    SA  PYGET
Sbjct  431   LVSFLLSTLLVTSANSQTQCRNFKSIISFGDSIADTGNLLGLSDPNN-LPASAFPPYGET  489

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGRYSDGRLIIDF+A  +G P V P++G +   + +F KGVNFAVAGATA+D SF
Sbjct  490   FFHHPTGRYSDGRLIIDFIAEFLGFPLVHPFYGCQ---NANFEKGVNFAVAGATALDTSF  546

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               E GI +  TNVSL  +L  FK+ L + C +PS C++ +E+++ILMGEIGGNDYN+A  
Sbjct  547   LEEGGIHSDITNVSLSVQLRSFKESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALF  606

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             Q    EEV   VP V++ I+  I EL+  G +  +VPGN P+GCS +YL+ + TSN  EY
Sbjct  607   QRKAIEEVEELVPFVVSAISLAIKELVCMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEY  666

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+ WLN F+EY+NE LQKELN L+EL+PH  IIYADYYNA +RL+  P  +GF N
Sbjct  667   DPLTGCLTWLNVFSEYYNEQLQKELNRLKELYPHVNIIYADYYNALLRLFPEPAKFGFMN  726

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN N    CGS     C+ PS Y++WDG+H+TEAAY+WI +GLL GP+
Sbjct  727   RPLPACCGLGGSYNFNFSRRCGSVGVEYCNDPSKYVNWDGIHMTEAAYRWISEGLLKGPY  786

Query  316   TSPKINGECILSRPKTK  266
               P  N  C+ S    K
Sbjct  787   AIPTFNWSCLSSEIMNK  803


 Score =   394 bits (1011),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 255/378 (67%), Gaps = 8/378 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGE  1217
             A+  +++  L V+       C  +K+I+SFGDS+ DTGNL+ +S  +N  V +A  PYGE
Sbjct  6     ALLTFLYSTLLVTIVSSETPCQNFKSIISFGDSIADTGNLVGLSNRNNLPV-TAFPPYGE  64

Query  1216  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMS  1037
             TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   + +F KGVNFAVAGATA++ S
Sbjct  65    TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NGNFDKGVNFAVAGATALESS  121

Query  1036  FFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAF  857
             F  +RGI +  TNVSLG +L  FK+ L   C +PS C++ + +++ILMGEIGGNDYN+ F
Sbjct  122   FLMKRGI-HPHTNVSLGVQLKSFKKSLPDLCGSPSDCRDKIGNALILMGEIGGNDYNFPF  180

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
              +  P +EV   VP VI  I+S I ELI  GA+  +VPG  PIGCS  YL+ + TSN  E
Sbjct  181   FERKPIKEVKELVPFVIATISSAITELIGMGAKTFLVPGEFPIGCSVVYLTLYQTSNKEE  240

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-  500
             YDP TGC+ WLN F EYH++ L+ ELN LR+L+PH  IIYADYYNA +RL++ P  +GF 
Sbjct  241   YDPLTGCLKWLNKFGEYHSQQLKTELNRLRKLNPHVNIIYADYYNALLRLFKEPAKFGFM  300

Query  499   ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             +  L ACCG GG YN N    CGS     C  PS Y+ WDG+H+TE AY+WI DG+L GP
Sbjct  301   DRPLHACCGIGGQYNFNFTRKCGSVGVESCKDPSKYVGWDGVHMTEGAYKWIADGILKGP  360

Query  319   FTSPKINGECILSRPKTK  266
             +  P     C+ S  K K
Sbjct  361   YAIPPFGRSCLRSEIKNK  378



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/378 (51%), Positives = 259/378 (69%), Gaps = 8/378 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGE  1217
             ++  +    LFV+       C   ++I+SFGDS+TDTGNL+ +S   N   ++A LPYGE
Sbjct  6     SLVSFFLSTLFVTIVSSQTQCRNLESIISFGDSITDTGNLVGLS-DRNHLPVTAFLPYGE  64

Query  1216  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMS  1037
             TFFHHPTGR  +GR+IIDF+A  +GLP V P++G K   + +F KGVNFAVAGATA++ S
Sbjct  65    TFFHHPTGRSCNGRIIIDFIAEFLGLPHVPPFYGSK---NGNFEKGVNFAVAGATALETS  121

Query  1036  FFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAF  857
                +RGI    +N+SLG +L  FK+ L + C +P+ C++ + ++ I+MGEIGGND+N+AF
Sbjct  122   ILEKRGIYYPHSNISLGIQLKTFKESLPNLCGSPTDCRDMIGNAFIIMGEIGGNDFNFAF  181

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
                +   EV   VP VIT I+S I EL+  G +  +VPGN P+GCS +YL+ + TSN  E
Sbjct  182   FV-NKTSEVKELVPLVITKISSAIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEE  240

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-  500
             YDP TGC+ WLNDF+EY+NE LQ ELN L +L+PH  IIY DY+NA +RLY+ P+ +GF 
Sbjct  241   YDPLTGCLTWLNDFSEYYNEKLQAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFM  300

Query  499   ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             +  L ACCG GGPYN      CGS     C  PS Y++WDG+H+TEAAY+WI DGLL GP
Sbjct  301   DRPLPACCGLGGPYNFTLSKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLLKGP  360

Query  319   FTSPKINGECILSRPKTK  266
             +T P  +  C+ S+ K+K
Sbjct  361   YTIPSFHWLCLGSKIKSK  378



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/353 (53%), Positives = 249/353 (71%), Gaps = 5/353 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             ++ I+SFGDSL DTGNLI +S + N    SA  PYGETFFH+P+GR+SDGRL+IDF+A  
Sbjct  31    FEWIISFGDSLADTGNLIGLS-TPNDLPESAFPPYGETFFHYPSGRFSDGRLVIDFIAEF  89

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP V P++G ++    +F KGVNFAV GATA++ S   +RGI  +  N+SLG +L  F
Sbjct  90    LGLPHVPPFYGSQSG---NFEKGVNFAVGGATALECSILEKRGIHCTHGNISLGVQLQSF  146

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ML   C +PS C++ + +++ILMGEIGGNDYNY F      EE+   VP V++ I+S 
Sbjct  147   KEMLPKLCASPSDCRDMIGNALILMGEIGGNDYNYPFFGLQTIEEIKELVPLVVSTISSA  206

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I EL++ G +  +VPG+ P+GCS +YL+ + TSN  EYDP TGC+ WLN+F+EYHNE LQ
Sbjct  207   ITELVEMGGRTFLVPGDFPLGCSVAYLTLYQTSNRVEYDPLTGCLTWLNEFSEYHNEHLQ  266

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              EL+ LR L+PH  IIY DYYNA +R++  P  +G  N  L ACCG GGPYN N    CG
Sbjct  267   AELDKLRNLYPHVTIIYGDYYNALLRIFEDPAKFGLMNRPLPACCGLGGPYNFNFSIKCG  326

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  272
             ++ S  C  PS Y++WDG+HLTEAAY+WI +GLL GP+  P ++  CI S+ K
Sbjct  327   TRGSEYCSDPSKYVNWDGVHLTEAAYRWISEGLLKGPYAIPHLDMSCISSKVK  379



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   389 bits (999),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 244/354 (69%), Gaps = 5/354 (1%)
 Frame = -1

Query  1348  GHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLI  1169
             G    GCY +I SFGDSL DTGNL+         +     PYG T+FH PTGR+SDGRLI
Sbjct  45    GSATTGCYSSIFSFGDSLADTGNLLHTLGRDGTRIGRP--PYGMTYFHRPTGRFSDGRLI  102

Query  1168  IDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSL  989
             +DF+A +MGLP + PY    T GD    KGVNFAV GATAM+  FF +RGI    TNVSL
Sbjct  103   VDFIAQAMGLPLLPPYLEETTGGD--MRKGVNFAVGGATAMENGFFRKRGIHIKFTNVSL  160

Query  988   GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  809
             G+++ WF+Q+L S C + S C++ L  S++LMG IGGNDYN  F++G    E+ SFVP+V
Sbjct  161   GDQIHWFRQLLPSLCSSSSACEDMLHKSLVLMGAIGGNDYNDPFMEGRSLREIKSFVPRV  220

Query  808   ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  629
             ++ I+S I+ELI+ GA+ L+VPG  P+GC+ +YL+Y+ T  A +YD  TGC+ WLN+F+ 
Sbjct  221   VSTISSAIDELIELGARTLLVPGITPLGCNSAYLTYYRTHQAEDYDSTTGCLKWLNEFSM  280

Query  628   YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNS  452
             YHN  LQ EL  L++LHPH  IIYADYY A+M ++ +PN +GF E  L ACCGGGGPYN 
Sbjct  281   YHNGRLQAELRRLQQLHPHATIIYADYYGASMSIFSNPNAFGFGEEPLVACCGGGGPYNY  340

Query  451   NPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             N    CGS+ STVC  PS Y+ WDG+H+TEA Y+ I  GLL GPF +P I   C
Sbjct  341   NFSRQCGSEGSTVCGDPSRYVHWDGLHMTEATYRSIASGLLHGPFAAPAIGSTC  394



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/369 (53%), Positives = 254/369 (69%), Gaps = 8/369 (2%)
 Frame = -1

Query  1363  LFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
             LFV+ G     C  +++I+SFGDS+ DTGNL+ +S   N   MSA  PYGETFFHHPTGR
Sbjct  20    LFVTIGSSESQCQNFESIISFGDSIADTGNLLSLSDRYN-LPMSAFPPYGETFFHHPTGR  78

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +GLP+V PYFG   + + +F KGVNFAVA ATA++ SF  ERG  +
Sbjct  79    FSDGRLIIDFIAEFLGLPYVPPYFG---SINGNFEKGVNFAVASATALESSFLEERGY-H  134

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEV  830
                N+SLG +L  FK+ L + C  PS C+E + +++ILMGEIG NDYN+ F +  P +EV
Sbjct  135   CPHNISLGIQLKSFKESLPNICGLPSDCREMIGNALILMGEIGANDYNFPFFELRPLDEV  194

Query  829   MSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCIN  650
                VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+ + TSN  EYDP TGC+ 
Sbjct  195   KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLYQTSNVEEYDPLTGCLI  254

Query  649   WLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCG  473
             WLN F EYH+E L++EL  LR+L+PH  IIYADYYNA++RL + P  YGF N  L ACCG
Sbjct  255   WLNKFGEYHSEQLKEELKRLRQLNPHVNIIYADYYNASLRLGQEPTKYGFINRHLSACCG  314

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGE  293
              G PYN N    CGS     C+ PS Y++WDG+H+TEAA++ + DGLL GP+  P  N  
Sbjct  315   VGRPYNFNFSRSCGSVGVESCNDPSKYVAWDGLHMTEAAHKSMADGLLNGPYAIPPFNWS  374

Query  292   CILSRPKTK  266
             C+ S+ K K
Sbjct  375   CLSSKIKKK  383



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 245/353 (69%), Gaps = 7/353 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY ++ SFGDSLTDTGNL  +S   +   +  + PYG+T FH P GR SDGRLI+DF+A 
Sbjct  34    CYTSLFSFGDSLTDTGNLYFISPRQSPDCL--LPPYGQTHFHRPNGRCSDGRLILDFLAE  91

Query  1150  SMGLPFVEPYFGGKTTGDR--SFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNE  980
             S+GLP+V+PY G K    +  +  +GVNFAVAGATA+D  FF E+G  ++   N SLG +
Sbjct  92    SLGLPYVKPYLGFKNGAVKRGNIEQGVNFAVAGATALDRGFFEEKGFAVDVTANFSLGVQ  151

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             LDWFK++L S C + S CK+ + SS+ ++GEIGGNDY Y   +     ++++++P+VI+V
Sbjct  152   LDWFKELLPSLCNSSSSCKKVIGSSLFIVGEIGGNDYGYPLSETTAFGDLVTYIPQVISV  211

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I S I ELI  GA   +VPG+LP+GC+P+YL+ F T +  EYD Q GC+ WLN F EYHN
Sbjct  212   ITSAIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYD-QAGCLKWLNTFYEYHN  270

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPH  443
             ELLQ E+N LR L+P T IIYADY+NAA+  Y SP  +GF  N L+ CCGGGGPYN N  
Sbjct  271   ELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNYNET  330

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECIL  284
             A CG      CD PS Y+SWDG HLTEAAY+W+  GLL GP+T PK N  C +
Sbjct  331   AMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCFI  383



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score =   403 bits (1036),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 253/353 (72%), Gaps = 9/353 (3%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRM--SKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             GCY +I++FGDSLTDTGNL     +KS N +      PYG+T+FHHPTGR SDGRL+IDF
Sbjct  533   GCYNSIIAFGDSLTDTGNLYNSYPNKSLNFFHP----PYGQTYFHHPTGRCSDGRLVIDF  588

Query  1159  MALSMGLPFVEPYFGGKTTGD--RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLG  986
             +A  +GLP V PY   + +    ++F  GVNFAV GATA+D +F  E G   + TN SL 
Sbjct  589   IAEFLGLPLVPPYLESQDSNQSVQNFEAGVNFAVVGATALDAAFLEEMGDSTAFTNNSLS  648

Query  985   NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
              +L+WFKQML S C T S C + L +S+ILMGEIGGNDYN A L G   E+V ++VP VI
Sbjct  649   IQLEWFKQMLPSLCNTSSDCNKLLSTSLILMGEIGGNDYNNALLAGKSIEKVQAYVPLVI  708

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               IASTINELI+ GA  L+VPGN PIGC P+YL+ + +S+ ++YDP TGC+NWLN F+ Y
Sbjct  709   ETIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGY  768

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSN  449
             HN+ LQ EL+ +R LHP   IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N
Sbjct  769   HNDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYN  828

Query  448   PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
               A CG   ++VC++P+ +ISWDG+H TEAAY+WI   +L G +T P+++  C
Sbjct  829   ASALCGDAGASVCENPAQFISWDGLHSTEAAYRWITKAILQGNYTVPRVSTLC  881


 Score =   374 bits (959),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 248/367 (68%), Gaps = 14/367 (4%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRM--SKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             G Y +I+SFGDSLTDTGN      +KS N +      PYG+T+FHHPTGR SDGRL+IDF
Sbjct  32    GRYNSIISFGDSLTDTGNFYNSYPNKSLNFFHP----PYGQTYFHHPTGRCSDGRLVIDF  87

Query  1159  MALSMGLPFVEPYFGGKTTGD--RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLG  986
             +A  +GLP V PY   + +    ++F  GVNFAVAGATA+D +F  E G     TN SL 
Sbjct  88    IAEFLGLPLVPPYLESQNSNQSVQNFEAGVNFAVAGATALDAAFLEEMGDSTPYTN-SLS  146

Query  985   NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
              +L+WFKQML S C T S  K+ L +S+ILMGEIGGNDYN   L G   E+V ++VP VI
Sbjct  147   IQLEWFKQMLPSLCNTSSDRKKLLSTSLILMGEIGGNDYNNPLLAGKSIEKVQAYVPLVI  206

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               IASTINELI+ GA  L+VPGN PIGC P+YL+ + +S+ ++YDP TGC+NWLN F+ Y
Sbjct  207   ETIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDPSTGCLNWLNKFSGY  266

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSN  449
             HN+ LQ EL+ +R LHP   IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N
Sbjct  267   HNDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYN  326

Query  448   PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQW----IVDGLLIGPFTSPKINGECILS  281
               A CG   ++VC++P+ +ISWDG+H TEAAY +      D  L G    P +     + 
Sbjct  327   TSALCGDAGASVCENPAQFISWDGLHSTEAAYSYAGAIFADACLKGLNGVPDVVECSFVQ  386

Query  280   RPKTKIP  260
                T++P
Sbjct  387   SSVTELP  393



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score =   388 bits (997),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 190/375 (51%), Positives = 250/375 (67%), Gaps = 5/375 (1%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPT  1196
             +F+ + + +       +++I+SFGDS+ DTGNL+ +S   N     A  PYGETFFHHPT
Sbjct  27    LFVTVTIVSSETLCRNFESIISFGDSIADTGNLVALS-DHNHLPGPAFPPYGETFFHHPT  85

Query  1195  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI  1016
             GR  DGR+IIDF+A  +GLP+V PYFG K   + +F KGVNFA+A ATA++ S F ERG 
Sbjct  86    GRSCDGRIIIDFIAEFLGLPYVPPYFGSK---NGNFEKGVNFAIASATALESSIFEERGF  142

Query  1015  INSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKE  836
                 +N+SLG +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F Q  P +
Sbjct  143   HIPYSNISLGVQLKSFKESLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFQRKPVK  202

Query  835   EVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGC  656
             EV   VP VI  I+S + ELI  G +  +VPGN PIGCS  YL+ + TSN  EYDP TGC
Sbjct  203   EVEELVPLVINTISSAVTELIAMGGRTFLVPGNFPIGCSVIYLTLYQTSNKEEYDPLTGC  262

Query  655   INWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEAC  479
             + WLN+F EYH E L  ELN LR+L+PH  IIYADYYNA +RL++ P  +GF N    AC
Sbjct  263   LKWLNNFGEYHEEQLHAELNRLRKLNPHVNIIYADYYNALLRLFQEPAKFGFGNRPFPAC  322

Query  478   CGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             CG GGPYN + +  CGS     C+ PS Y+ WDG+H+TEAAY+ I DG+L GP+  P  N
Sbjct  323   CGIGGPYNFSLNRNCGSVGVKSCNDPSKYVGWDGIHMTEAAYKLIADGILQGPYAIPPFN  382

Query  298   GECILSRPKTKIPDS  254
               C+ S    K  D+
Sbjct  383   WSCLNSETNKKSLDT  397



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score =   387 bits (994),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 248/355 (70%), Gaps = 6/355 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGRYSDGRLIIDF+A  
Sbjct  27    FESIISFGDSIADTGNLLGLSDRNN-LPMSAFPPYGETFFHHPTGRYSDGRLIIDFIAEF  85

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   +R+F KGVNFAVA ATA++ SF  ERG  +   N+SLG +L  F
Sbjct  86    LGLPYVPPYFGFK---NRNFEKGVNFAVASATALESSFLEERGY-HCPHNISLGVQLKIF  141

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  P +EV   VP VI+ I+S 
Sbjct  142   KESLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFESRPFDEVKELVPFVISTISSA  201

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP TGC+ W N F EYH+E LQ
Sbjct  202   ITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQ  261

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYCG  431
              E+  LR+L+PH  IIYADYYNA++ L + P  Y F N TL ACCG G PYN +    CG
Sbjct  262   VEIKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQSCG  321

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C+ PS Y++WDG+H+TEAAY+ + DGLL GP+ +P  N  C+ S+ K K
Sbjct  322   SVGVESCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATPPFNWSCLSSKIKNK  376



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score =   387 bits (995),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 256/366 (70%), Gaps = 9/366 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAG--GC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFH  1205
             FL+  ++T  V     C  +K+I+ FGDS+TDTGNL+ +S+ +N    SA  PYGETFFH
Sbjct  16    FLITLLTTAAVTSEQQCRNFKSIIIFGDSITDTGNLLHLSEPNN-LPQSAFPPYGETFFH  74

Query  1204  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTE  1025
              PTGR+S+GRLIIDF+A  + LP+V PYFG   + + SF KG+NFAVAGATA++ SF   
Sbjct  75    VPTGRFSNGRLIIDFIAEFLRLPYVPPYFG---SPNGSFQKGINFAVAGATALEQSFLES  131

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             RGI  + TNVSLG +L  FKQ L + C +PS C+E +  ++I++GEIGGNDYNY  L G 
Sbjct  132   RGIHYAYTNVSLGVQLKSFKQSLPNICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGK  191

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
               EE+   VP VI+ I+S I EL+  G + ++VP +LPIGC  S+L+ + TSN  EY+P 
Sbjct  192   SIEEIKELVPLVISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPL  251

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  488
             TGC+NWLN+F E+HN+ LQ+ELN L++L+PH  I+YADYYNA + +++ P  +GF N  L
Sbjct  252   TGCLNWLNEFVEHHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFMNRPL  311

Query  487   EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              ACCG GGPYN N  + CG++    C  PS Y+ WDG HLTE+AY+W+  GLL GP+T P
Sbjct  312   SACCGTGGPYNFNNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLP  371

Query  307   KINGEC  290
               +  C
Sbjct  372   AFDWSC  377



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score =   400 bits (1029),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 257/378 (68%), Gaps = 8/378 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGE  1217
             ++  ++F  LFV+       C  +K+I+SFGDS+ DTGNL+ +S   N   ++A  PYGE
Sbjct  6     SLVIFLFSTLFVTIVSSETPCPNFKSIISFGDSIADTGNLVGLS-DRNQLPVTAFPPYGE  64

Query  1216  TFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMS  1037
             TFFHHPTGR  DGR+I+DF+A  +GLP+V PYFG K   +R+F KGVNFAVAGATA+  S
Sbjct  65    TFFHHPTGRSCDGRIIMDFIAEFVGLPYVPPYFGSK---NRNFDKGVNFAVAGATALKSS  121

Query  1036  FFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAF  857
             F  +RGI    TNVSLG +L  FK+ L + C +PS C++ + +++ILMGEIGGNDYN+ F
Sbjct  122   FLKKRGI-QPHTNVSLGVQLKSFKKSLPNLCGSPSDCRDMIGNALILMGEIGGNDYNFPF  180

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
                 P +EV   VP VI  I+STI ELI  G +  +VPG  PIGCS  YL+ + TSN  E
Sbjct  181   FNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDE  240

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-  500
             YDP TGC+ WLN F EYH+E L+ ELN LR+L+PH  IIYADYYN+ +R+++ P  +GF 
Sbjct  241   YDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFM  300

Query  499   ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             E    ACCG GGPYN N    CGS     C  PS Y+ WDG+H+TEAAY+WI DG+L GP
Sbjct  301   ERPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGP  360

Query  319   FTSPKINGECILSRPKTK  266
             + +P  +  C+ S  K +
Sbjct  361   YANPPFDRSCLRSEIKKE  378


 Score =   394 bits (1013),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 259/378 (69%), Gaps = 7/378 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  +I   L V++ +    C  +K+I+SFGDS+ DTGNL+ +S   N    SA  PYGET
Sbjct  432   LVRFILSTLLVTSVNSQTQCRNFKSIISFGDSIADTGNLLGLS-DPNDLPASAFPPYGET  490

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGRYSDGRLIIDF+A  +G P V P++G +   + +F KGVNFAVAGATA++ SF
Sbjct  491   FFHHPTGRYSDGRLIIDFIAEFLGFPLVPPFYGCQ---NANFKKGVNFAVAGATALEPSF  547

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI ++ TNVSL  +L  F + L + C +PS C++ +E+++ILMGEIGGNDYN+A  
Sbjct  548   LEERGIHSTITNVSLSVQLRSFTESLPNLCGSPSDCRDMIENALILMGEIGGNDYNFALF  607

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             Q  P +EV   VP VI  I+S I EL+  G +  +VPGN PIG S SYL+ + TSN  EY
Sbjct  608   QRKPVKEVEELVPFVIATISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEY  667

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+ WLNDF+EY+N+ LQ+ELN LR+L+PH  IIYADYYNA +RL++ P  +GF N
Sbjct  668   DPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMN  727

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN N    CGS     CD PS Y+++DG+H+TEAAY+ I +GLL GP+
Sbjct  728   RPLPACCGVGGSYNFNFSRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPY  787

Query  316   TSPKINGECILSRPKTKI  263
               P     C+ S    K+
Sbjct  788   AIPPFKWSCLSSEIMNKM  805



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score =   405 bits (1041),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/348 (57%), Positives = 248/348 (71%), Gaps = 9/348 (3%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GCY +I+SFGDS+ DTGNL   + S N  +     PYGET+FH P GR SDGRLIIDF
Sbjct  18    ALGCYSSIISFGDSIADTGNL--YNSSPNKSLDFFFPPYGETYFHRPVGRCSDGRLIIDF  75

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A  MGLP V+PY         +   GVNFAV G+TA+D +F  E G+ N  TN SL  +
Sbjct  76    IAEYMGLPLVQPYLESHNQTVHNIEGGVNFAVVGSTALDTAFLEEMGVYNDITNNSLRIQ  135

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             LDWF++MLS  C T S C + L SS++LMGEIGGNDYN A L G   E+V  +VP VI  
Sbjct  136   LDWFQEMLSFLCNTSSDCNKLLSSSLVLMGEIGGNDYNNALLGGKSIEKVEKYVPLVIEA  195

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             IASTINELI +GA  L+VPGN PIGC P+YL     +N SEYDP TGC+NWLN F+EYHN
Sbjct  196   IASTINELIAFGASTLVVPGNFPIGCIPAYL-----TNESEYDPLTGCLNWLNKFSEYHN  250

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNPH  443
             ELLQ+EL+ +R LHP+  IIYADYYNA ++LY+SP+ +GF   T +ACCGGGGPYN N  
Sbjct  251   ELLQRELSRIRILHPYVNIIYADYYNAMLQLYQSPDQFGFTGETTKACCGGGGPYNYNSS  310

Query  442   AYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             A CGS + + +C++P+ +ISWDG+H TEAAY+WI  GLL G +T P+I
Sbjct  311   ALCGSPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQI  358


 Score =   400 bits (1029),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 245/355 (69%), Gaps = 8/355 (2%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMS--KSSNAYVMSAVLPYGETFFHHPTGRYSDGRLII  1166
             A GCY +I+SFGDS++DTGNL   S  KS N +      PYGET+FHHPTGR SDGRL+I
Sbjct  478   ALGCYSSIISFGDSVSDTGNLYNSSPNKSFNFFFP----PYGETYFHHPTGRCSDGRLVI  533

Query  1165  DFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLG  986
             DF+A SMGLP V+PY         +   GVNFAV GA A+D +F  E  + N  TN SL 
Sbjct  534   DFIAESMGLPLVQPYLESHNQTADNIEGGVNFAVVGAAALDTAFLEEMAVYNEITNDSLR  593

Query  985   NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
              +LDWF++MLS  C T S C + L  S++LMGEIGGNDY  A   G   E+V  +VP VI
Sbjct  594   IQLDWFQEMLSLLCNTSSDCNKLLSGSLVLMGEIGGNDYYNALFSGKSTEQVEKYVPFVI  653

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               IAS INELI  GA  L+VPG  P GC P++L+ + TS+  EYDP TGC+NWLN FTEY
Sbjct  654   EAIASAINELIALGASTLLVPGVFPFGCVPAFLTRYQTSDEDEYDPSTGCLNWLNKFTEY  713

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSN  449
             HNELLQ EL  ++ LHPH  IIYADYYNA + L++SP+ +GF   T +ACCGGGGPYN N
Sbjct  714   HNELLQIELRRIQSLHPHVNIIYADYYNAMLELHQSPDQFGFTGETTKACCGGGGPYNYN  773

Query  448   PHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
               A CG+ + + +C++P+ +ISWDG+H TEAAY+WI  GLL   +T P+I+  C+
Sbjct  774   SSALCGTPEANVLCENPAQFISWDGLHSTEAAYRWIAKGLLNRNYTVPQISALCV  828


 Score = 78.6 bits (192),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  490  LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIG  323
            L ACCGGG PYN N  A CG   ST C  PSSY++WDG+HLTEAAY++I  GL+ G
Sbjct  365  LRACCGGGEPYNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHG  420



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score =   386 bits (992),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 255/366 (70%), Gaps = 9/366 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAG--GC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFH  1205
             FL+  ++T  V     C  +K+I+ FGDS+TDTGNL+ +S  +N    SA  PYGETFFH
Sbjct  16    FLITLLTTAAVTSEQQCRNFKSIIIFGDSITDTGNLLHLSDLNN-LPQSAFPPYGETFFH  74

Query  1204  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTE  1025
              PTGR+S+GRLIIDF+A  + LP+V PYFG   + + SF KGVNFAVAGATA++ SF   
Sbjct  75    VPTGRFSNGRLIIDFIAEFLRLPYVPPYFG---SPNESFQKGVNFAVAGATALERSFLES  131

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             RGI  + TNVSLG +L  FK+ L + C +PS C+E +  ++I++GEIGGNDYNY  L G 
Sbjct  132   RGIHYAYTNVSLGVQLKSFKKSLPNICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGK  191

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
               EE+   VP VI+ I+S I EL+  G + ++VP +LPIGC  S+L+ + TSN  EY+P 
Sbjct  192   SIEEIKELVPLVISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNPL  251

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  488
             TGC+NWLN+F E+HN+ LQ+ELN L++L+PH  I+YADYYNA + +++ P  +GF N  L
Sbjct  252   TGCLNWLNEFVEHHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFVNRPL  311

Query  487   EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              ACCG GGPYN N  + CG++    C  PS Y+ WDG HLTE+AY+W+  GLL GP+T P
Sbjct  312   SACCGTGGPYNFNNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLP  371

Query  307   KINGEC  290
               +  C
Sbjct  372   AFDWSC  377



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score =   386 bits (992),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 248/355 (70%), Gaps = 6/355 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGRYSDGRLIIDF+A  
Sbjct  35    FESIISFGDSIADTGNLLGLSDQNN-LPMSAFPPYGETFFHHPTGRYSDGRLIIDFIAEF  93

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAVA ATA++ SF  ERG  +   N+SLG +L  F
Sbjct  94    LGLPYVPPYFGSK---NENFEKGVNFAVASATALESSFLEERGY-HCPHNISLGVQLKIF  149

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  P +EV   VP VI+ I+S 
Sbjct  150   KESLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFESRPFDEVKELVPFVISTISSA  209

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS ++L+ + TSN  EYDP TGC+ W N F EYH+E LQ
Sbjct  210   ITELIGMGGRTFLVPGGFPIGCSVAFLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQ  269

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYCG  431
              ELN LR+L+PH  IIYADYYNA++ L + P  Y F N TL ACCG G PYN +    CG
Sbjct  270   VELNRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQSCG  329

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C+ PS Y++WDG+H+TEAA++ + DGLL GP+ +P  N  C+ S+ K +
Sbjct  330   SAGVKSCNDPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNE  384



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   385 bits (989),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 249/368 (68%), Gaps = 8/368 (2%)
 Frame = -1

Query  1378  YIFLVLFVST---GHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             +IFL  F+ T          +++I+SFGDS+ DTGNL+ +S  ++   M A  PYGETFF
Sbjct  15    FIFLSTFIVTNVSSETKCREFRSIISFGDSIADTGNLLGLSDPNDLPHM-AFPPYGETFF  73

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             HHPTGR+S+GRLIIDF+A  +GLP V P++G +   + +F KGVNFAV GATA++ SF  
Sbjct  74    HHPTGRFSNGRLIIDFIAEFLGLPLVPPFYGSQ---NANFDKGVNFAVGGATALERSFLE  130

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             ERGI    TNVSLG +L  FK+ L S C +PS C++ +E+++ILMGEIGGNDYNYAF   
Sbjct  131   ERGIHFPYTNVSLGVQLQSFKESLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVD  190

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                EE+    P VIT I+S I ELI  G +  +VPG  P+GCS  YL+   TSN  EYDP
Sbjct  191   KSIEEIKELTPLVITTISSAITELISMGGRTFLVPGEFPVGCSVFYLTSHQTSNMEEYDP  250

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-  491
              TGC+ WLN+F E H E L+ EL  L++L+PH  +IYADYYNA +RLY+ P  +GF N  
Sbjct  251   LTGCLKWLNNFGENHGEQLRAELKRLQKLYPHVNVIYADYYNALLRLYQEPAKFGFMNRP  310

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L ACCG GGPYN      CG+ +   C+ PS Y++WDG+HLTEAAY+ + +G+L GP+  
Sbjct  311   LSACCGSGGPYNYTVGRKCGTDIVESCNDPSKYVAWDGVHLTEAAYRLMAEGILKGPYAI  370

Query  310   PKINGECI  287
             P  +  C+
Sbjct  371   PPFDWSCL  378



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 241/367 (66%), Gaps = 7/367 (2%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPT  1196
             I L + +     A  CY ++ SFGDSL+D GNL+  S  S   +     P GET+F  PT
Sbjct  8     IILFILMIVSQSASECYTSMFSFGDSLSDNGNLLGFS--SPKTIHQGRPPNGETYFGQPT  65

Query  1195  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTT-GDRSFAKGVNFAVAGATAMDMSFFTERG  1019
             GR  DGRLI+D +A + GLP   PY   +     R F  GVNFAVAGA A+D SFF ERG
Sbjct  66    GRCCDGRLIVDMIAQNFGLPIPPPYVSIRNAKSSRDFYAGVNFAVAGAKALDPSFFDERG  125

Query  1018  IINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPK  839
             I  S TN +L  +LDWF+ +L S C T + C +YL+SS+ +MGEIGGNDYN+A LQG   
Sbjct  126   ISESVTNFTLRVQLDWFRDLLPSLCGTKANCMQYLQSSLTVMGEIGGNDYNHALLQGRSI  185

Query  838   EEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNAS---EYDP  668
             EEV +FVP V+  I+S I ++I+ GA   IVPGNLP+GC  +YL+YF  SN     +YD 
Sbjct  186   EEVKTFVPAVVGAISSAITDMIRLGAANFIVPGNLPLGCLAAYLTYFQNSNRDYDYDYDE  245

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NT  491
               GCINWLNDF ++HNE+LQ ELN +RELHPH  IIYADYYN+A+R YR P  +GF   T
Sbjct  246   APGCINWLNDFAKHHNEVLQIELNRIRELHPHVTIIYADYYNSAIRFYRWPKEFGFTGGT  305

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L ACCG GGPYN +    CG   +T C  PS+Y+ WDG+HLTEAA + IV GL  G +++
Sbjct  306   LSACCGAGGPYNFDSSVGCGDPPTTGCADPSAYVCWDGLHLTEAANRLIVKGLFEGSYSA  365

Query  310   PKINGEC  290
             P I   C
Sbjct  366   PPIKLIC  372



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score =   385 bits (988),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/390 (50%), Positives = 256/390 (66%), Gaps = 7/390 (2%)
 Frame = -1

Query  1405  FSQGTAITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAV  1232
             F + T   + I L+  V +      C  +K+I+SFGDS  DTGNL+ +S  +N     A 
Sbjct  9     FKKLTRTFFIITLLTTVVSSLEVKQCREFKSIISFGDSHADTGNLLGLSDPNNLPHF-AF  67

Query  1231  LPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGAT  1052
              PYGETFFHHPTGR+S+GR+IIDFMA  + LP V P++G +   + +F KGVNFAVAGAT
Sbjct  68    PPYGETFFHHPTGRFSNGRVIIDFMAEFLDLPLVPPFYGSQ---NANFKKGVNFAVAGAT  124

Query  1051  AMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGND  872
             A++ SF   RGI    TN+SLG +L  FK+ L   C +PS C++ +E+++ILMGEIGG D
Sbjct  125   ALERSFLEGRGIHFPYTNISLGVQLSSFKESLPKLCGSPSDCRDMIENALILMGEIGGTD  184

Query  871   YNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMT  692
             YNYAFL G   EEV   +P VIT I+S+I ELI  G +  +VPG+ P+GCS  YL+ + T
Sbjct  185   YNYAFLVGKSIEEVKELIPMVITAISSSITELIGMGGRTFLVPGDFPLGCSAIYLTSYQT  244

Query  691   SNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPN  512
             SN   YDP TGC+ WLN F E H+  LQ ELN L++L+PH  IIYADYYNA +R+Y+ P 
Sbjct  245   SNMEAYDPLTGCLTWLNKFGENHDAQLQAELNRLQKLYPHVNIIYADYYNALLRIYQEPT  304

Query  511   NYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDG  335
              +GF N  L ACCG GGPYN      CG+ +   C  PS Y++WDG+H+TEAAY  I +G
Sbjct  305   KFGFMNRPLSACCGVGGPYNFTSFWQCGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEG  364

Query  334   LLIGPFTSPKINGECILSRPKTKIPDS*RL  245
             +L GP+ +P  +  C+ S  K   P   R+
Sbjct  365   ILKGPYAAPPFDWSCLSSEIKDNGPSEKRI  394



>ref|XP_009774388.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana sylvestris]
Length=385

 Score =   384 bits (986),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 244/367 (66%), Gaps = 5/367 (1%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             I Y+   + F         CYK+I  FGDSLTD GNL+ +        M    PYG+T+F
Sbjct  11    IIYFSACIFFAFAKIATSNCYKSIFGFGDSLTDAGNLVHLYPPGRKPHM-YFPPYGKTYF  69

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             + PTGR SDGRL+ID +A   GLP   P    K  G+     G+NFAV G+ AMD  F+ 
Sbjct  70    NRPTGRCSDGRLLIDLIAQYYGLPLPPPSREAKDGGN--MQSGINFAVVGSRAMDAKFYE  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             +RGI ++ TNVS+ ++LDWFKQML   C  PS C ++LESS+ L+GE GGNDY +A L G
Sbjct  128   KRGIYDTVTNVSMWDQLDWFKQMLPYLCHNPSGCSKFLESSLFLLGEFGGNDYTHALLSG  187

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                 E++  +P V+  IAS  +EL++ GA+ ++VP  LP+GC+ SYL+Y+ + N  +YD 
Sbjct  188   KNINEILPIIPSVVHTIASGAHELVELGAKTIMVPSVLPLGCASSYLTYYQSWNEEDYD-  246

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENT  491
             + GC+ W N F  +HN+LLQ+EL+ LRE+HPH  IIYADYYNAAM+LYRSP+ YGF +  
Sbjct  247   ELGCLIWPNHFASHHNQLLQRELHRLREIHPHVNIIYADYYNAAMQLYRSPSKYGFLKGG  306

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L  CCGGGGPYN NP A CG   +T C+ P+ YI+WDG HLTEAAY+W+   LL GPFT+
Sbjct  307   LVTCCGGGGPYNFNPFAPCGDYPATSCEDPNQYINWDGYHLTEAAYRWMTKSLLEGPFTN  366

Query  310   PKINGEC  290
             P IN  C
Sbjct  367   PPINSVC  373



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score =   384 bits (985),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 254/369 (69%), Gaps = 7/369 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             ++F+VL +     A  CY +I SFGDSLTDTGNL  +S+  +   +  + PYG+T FHHP
Sbjct  12    WLFIVLPLVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCL--LPPYGKTHFHHP  69

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERG  1019
              GR SDGRLI+DF+A    LP+++PY G    G+     GVNFAVAGATA+D SFF E+ 
Sbjct  70    NGRCSDGRLIVDFIAEFFRLPYLKPYLGFINGGN--IEHGVNFAVAGATALDRSFFEEKE  127

Query  1018  IINSCT-NVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
              +   T N SL  +LD FK++L S C + S CK  L SS+ ++GEIGGNDY +   Q   
Sbjct  128   FVVEVTANYSLIVQLDGFKELLPSICNSTSSCKGVLHSSLFIVGEIGGNDYGFPLFQTSV  187

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
               +++++VP+V++VI S+I ELI  GA  ++VPG+LP+GC+P+YL+ F T +  EYD Q 
Sbjct  188   FGDLITYVPRVVSVITSSIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYD-QA  246

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLE  485
             GC+ WLN F EYHNELLQ EL+ LR L+P T IIYADY+NAA++LY+SP  YGF+ N  +
Sbjct  247   GCLKWLNKFFEYHNELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFK  306

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
              CCGGGGPYN N  A CG+     CD PS Y+SWDG HLTEAA++W+ + LL GP+T PK
Sbjct  307   VCCGGGGPYNYNDSALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPK  366

Query  304   INGECILSR  278
              +  C+ S 
Sbjct  367   FSFSCLSSE  375



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 197/374 (53%), Positives = 261/374 (70%), Gaps = 15/374 (4%)
 Frame = -1

Query  1369  LVLFVSTGHVAGGC---YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             LV  V+T   AG C   Y +I SFGDSLTDTGNL  +S   +   M  + P+G+T FHHP
Sbjct  4     LVFLVTTLVFAGTCRAYYTSIFSFGDSLTDTGNLNFISPPLSPDCM--LPPFGQTHFHHP  61

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFG---GKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
              GR SDGRLIIDF+A S+GL +V+PY G   G+ TG+     GVNFA+AGATA+D+SFF 
Sbjct  62    NGRCSDGRLIIDFIAESLGLSYVKPYLGFKNGEVTGN--IENGVNFAIAGATALDLSFFE  119

Query  1027  ERG-IINSCTNVSLGNELDWFKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAF  857
             E+G ++++ TN SL  ++DWFK++L S C + S   CK+ L SS+ ++GEIGGNDY++  
Sbjct  120   EKGFVVDATTNYSLRFQIDWFKELLPSICNSSSTEGCKDVLHSSLFIVGEIGGNDYSFPL  179

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
              + +  E+++++VP+VI+VI S I +LI  GA  ++VPG+LP+GC+P+ L+ F T N  E
Sbjct  180   FETNAFEDLITYVPQVISVITSAIKDLIDLGAVTILVPGSLPLGCNPALLTKFATINEEE  239

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE  497
             YD Q GC+  LN F EYHNELLQ ELN LR L+P T IIYADY+NAA++ Y+SP  +GFE
Sbjct  240   YD-QAGCLKLLNMFFEYHNELLQFELNRLRVLYPFTNIIYADYFNAALQFYKSPEQFGFE  298

Query  496   -NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
              N L+ CCGGGGPYN N  A CG+     CD  S Y+SWDG HLTEAAY+W+   LL G 
Sbjct  299   RNALQVCCGGGGPYNFNDTALCGNLEVIACDDTSKYVSWDGYHLTEAAYRWMAMSLLDGQ  358

Query  319   FTSPKINGECILSR  278
             +T PK +  C+ S 
Sbjct  359   YTIPKFSLSCLTSN  372



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/367 (50%), Positives = 242/367 (66%), Gaps = 5/367 (1%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             +T Y   +L  +       C+ +I SFGDSL DTGNL+         +  A LPYGET+F
Sbjct  25    VTLYDTSILRSTFAATTASCFASIFSFGDSLADTGNLLHYLGDDAGAL--AQLPYGETYF  82

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             HH TGR SDGRLIIDF+A + GLP V PY  G +  D  F  G NFAVAGATA+D  FF 
Sbjct  83    HHATGRLSDGRLIIDFIAQASGLPLVPPYLAGTSAQD--FRYGANFAVAGATALDNDFFR  140

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
              +G+  + T  SLG + +WFKQ+L S C T S CK  + +S+ L+GEIG ND++++F QG
Sbjct  141   AKGLNVTWTEYSLGVQFNWFKQLLPSLCSTDSDCKGIMSNSLFLVGEIGWNDHSHSFEQG  200

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                +E+ +F+P ++ VI+S I++LIK GA+  +VPG  P GC  +YL+ F + +A +YDP
Sbjct  201   RTTDEIRTFIPNIVEVISSVIDDLIKLGAKTFVVPGIFPSGCVSTYLTAFQSEDAEDYDP  260

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-  491
              TGCI W+N+F+ YHN LLQ EL+ LR LHPH  IIYADYY A M ++ SP  +GF+   
Sbjct  261   DTGCIRWVNEFSAYHNHLLQNELDRLRRLHPHVTIIYADYYEALMSIFHSPQKFGFKKAP  320

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L+ACCGGGGPYN N    CG+ ++TVC  PS ++ WDG HLT+AA + +  GLL GP+  
Sbjct  321   LDACCGGGGPYNVNFSLLCGAPMTTVCRDPSMFVFWDGTHLTDAASEIVARGLLEGPYAD  380

Query  310   PKINGEC  290
             P I   C
Sbjct  381   PPIIQTC  387



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score =   384 bits (987),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/353 (52%), Positives = 245/353 (69%), Gaps = 5/353 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  53    FKSIISFGDSIADTGNLLGLS-DPNELPHVAFPPYGETFFHHPTGRFSNGRLIIDFIADF  111

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP V P++G +   + +F KGVNFAVAGATA++ SF  ++GI+   TNVSLG ++  F
Sbjct  112   LGLPLVPPFYGSQ---NANFEKGVNFAVAGATALERSFLEKKGILFPHTNVSLGVQISSF  168

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   +P VIT I+S 
Sbjct  169   KESLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSIEEIKELIPLVITTISSA  228

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G + ++VPG+ P+GCS +YL+ +  S    YDP TGC+ WLN F E H+  L+
Sbjct  229   ITELIGMGGRTILVPGDFPLGCSATYLTLYQKSKKEAYDPSTGCLTWLNKFGENHDVQLR  288

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              ELN L++L+PH  IIYADYYNA +R+Y+ P N+GF N  L ACCG GGPYN      CG
Sbjct  289   AELNRLQKLYPHVNIIYADYYNALLRIYQEPENFGFMNRPLSACCGVGGPYNFTSFWQCG  348

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  272
             + +   C+ PS Y++WDG+H+TEAAY  I +G+L GP+  P  N  C+ S  K
Sbjct  349   TDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGPYAVPPFNWSCLSSEFK  401



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 246/365 (67%), Gaps = 18/365 (5%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GC+ +++SFGDSLTDTGNL   S + + +      PYGET+FHHPTGR SDGRLIIDF+A
Sbjct  28    GCFNSVISFGDSLTDTGNLYNSSPNRSLHYFQP--PYGETYFHHPTGRCSDGRLIIDFIA  85

Query  1153  LSMGLPFVEPYFGGKTTGD--RSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
               +GLP V P+     +    ++F  GVNFAV GAT +D SF     I +  TN SL  +
Sbjct  86    QFLGLPLVPPFLQNLNSNQSVQNFEAGVNFAVIGATGLDASFLATMEIHSPSTNNSLRIQ  145

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             L+WFKQML S C T   CK++L +S+ILMG IG NDYN   L G   E V S++P VI  
Sbjct  146   LEWFKQMLPSLCNTSLDCKKFLSTSLILMGSIGCNDYNDGLLGGKSIELVRSYLPLVIEA  205

Query  799   IASTIN-------------ELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTG  659
             IASTIN             ELI+ GA  ++VPGN PIGC P+YLS F TS+ ++YDP TG
Sbjct  206   IASTINSFFLNFLWLHGLQELIELGAATILVPGNNPIGCLPAYLSKFETSDKNQYDPSTG  265

Query  658   CINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEA  482
             C+ WLN+F +YHNE LQ EL+ +R LHP   I+YADYYNA ++LY+SP+ +GF   T +A
Sbjct  266   CLKWLNEFAQYHNEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQSPHQFGFTGETSKA  325

Query  481   CCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CCGGGGPYN NP   CG+  +TVC++PS +I+WDGMH TEAAY+ +   LL G +T P++
Sbjct  326   CCGGGGPYNFNPSLQCGNAGATVCENPSQFINWDGMHSTEAAYRLMTKALLQGNYTFPRL  385

Query  301   NGECI  287
                C+
Sbjct  386   ASLCV  390



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/377 (51%), Positives = 251/377 (67%), Gaps = 10/377 (3%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             I  +    L V++      C  +++I+SFGDS+TDTGNLI +S + N    SA LPYGET
Sbjct  12    IVSFFLYTLLVTSVSSETKCLNFQSIISFGDSITDTGNLIALS-TPNELPESAFLPYGET  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGRYSDGRLIIDF+A  +GLP V P++G K   + +F KGVNFAV GATA++ S 
Sbjct  71    FFHHPTGRYSDGRLIIDFIAEVLGLPHVPPFYGSK---NGNFEKGVNFAVGGATALECSV  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI     N SLG +L  FK+ L S C +PS   + + +++IL+GEIGGNDYNY F 
Sbjct  128   LEERGISCPPKNKSLGVQLTNFKESLRSLCGSPS---DMIGNALILIGEIGGNDYNYPFF  184

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                  EEV   VP VI+ I+STI EL+  G +  +VPG+ P+GCS  YL+ + TSN   Y
Sbjct  185   GHKNIEEVKELVPLVISTISSTITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKEAY  244

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DPQTGC+ WLN+F+EYHNE LQ ELN LR+L+P+  IIY DYYNA +RL + P  +G   
Sbjct  245   DPQTGCLTWLNEFSEYHNEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMN  304

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
             N L  CCG GG YN      CG +    C+ PS Y++WDG+H+TEAAY+WI +GLL GP+
Sbjct  305   NPLPVCCGLGGRYNYTFGVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPY  364

Query  316   TSPKINGECILSRPKTK  266
              +P  +  C+ S  K K
Sbjct  365   ATPPFDWSCLSSEIKDK  381



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score =   382 bits (981),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/371 (51%), Positives = 249/371 (67%), Gaps = 11/371 (3%)
 Frame = -1

Query  1351  TGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRL  1172
             T H A  CY +I SFGDSL DTGNL+     +N +V    LPYGET+F  PTGR+SDGRL
Sbjct  25    TSHAAITCYTSIFSFGDSLADTGNLLHDVGKNNIHV--GRLPYGETYFRRPTGRFSDGRL  82

Query  1171  IIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVS  992
             ++DF+A +MGLP + PY  G   G + F +G NFAVAGATA++  FFTE+GI    +N S
Sbjct  83    VVDFLAQAMGLPLLPPYLAGP--GRKGFRRGANFAVAGATAIENGFFTEKGIQVLWSNNS  140

Query  991   LGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPK  812
             LG++++WF+Q+L S C + S C +   +S+ L+GEIGGNDYNY FLQ    +E++S+VP+
Sbjct  141   LGSQIEWFRQLLPSLCSSDSDCNDMFRNSLFLVGEIGGNDYNYPFLQARSLDEIVSYVPR  200

Query  811   VITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFT  632
             V+  I+S I  LI+ GA+ L+VPGN PIGC+ +YL+ F ++ + +YD   GCI WLN F+
Sbjct  201   VMDAISSAITALIELGARTLVVPGNFPIGCNSAYLTVFRSNRSEDYD-AIGCIKWLNKFS  259

Query  631   EYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYN  455
              +HN  L+  LN +R  +PH  +IYADYY+AAM L+ SP   GF  + L ACCGGGGPYN
Sbjct  260   RFHNNRLRVVLNRVRLRNPHATVIYADYYSAAMSLFSSPEPSGFRISPLPACCGGGGPYN  319

Query  454   SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI----  287
              N    CG+  S +C  PS YI+WDGMH+TEAAY+ I  GLL GP   P I   C     
Sbjct  320   YNSSLQCGNSGSNICADPSIYITWDGMHMTEAAYRKIAIGLLKGPNAVPAILNTCPQTNQ  379

Query  286   -LSRPKTKIPD  257
               SRP+  + D
Sbjct  380   EFSRPQYVLSD  390



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   382 bits (981),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 247/355 (70%), Gaps = 6/355 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGR+SDG LIIDF+A  
Sbjct  36    FESIISFGDSIADTGNLLGLSDRNN-LPMSAFPPYGETFFHHPTGRFSDGHLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAVA ATA++ SF  ERG  +   N+SLG +L  F
Sbjct  95    LGLPYVPPYFGSK---NENFEKGVNFAVASATALESSFLEERGY-HCPHNISLGVQLKIF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  P +EV   VP VI+ I+S 
Sbjct  151   KESLPNLCGLPSDCRDMIRNALILMGEIGANDYNFPFFESRPFDEVKELVPFVISNISSA  210

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP TGC+ W N F EYH+E LQ
Sbjct  211   ITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQ  270

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYCG  431
              EL  LR+L+PH  IIYADYYNA++ L + P  Y F N TL ACCG G PYN +    CG
Sbjct  271   VELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQSCG  330

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C++PS Y++WDG+H+TEAA++ + DGLL GP+ +P  N  C+ S+ K K
Sbjct  331   SVGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNK  385



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score =   382 bits (980),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 251/369 (68%), Gaps = 11/369 (3%)
 Frame = -1

Query  1363  LFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
             LFVS       C  +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20    LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +GLP+V PYFG  T G+  F KGVNFAVA ATA++ SF  E+G  +
Sbjct  79    FSDGRLIIDFIAEFLGLPYVPPYFG-STNGN--FEKGVNFAVASATALESSFLEEKGY-H  134

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEV  830
                N SLG +L  FKQ L + C  PS   + + +++ILMGEIG NDYN+ F Q  P +EV
Sbjct  135   CPHNFSLGVQLKIFKQSLPNLCGLPS---DMIGNALILMGEIGANDYNFPFFQLRPLDEV  191

Query  829   MSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCIN  650
                VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP TGC+ 
Sbjct  192   KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLK  251

Query  649   WLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCG  473
             WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P+ YGF N  L ACCG
Sbjct  252   WLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCG  311

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGE  293
              GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P  +  
Sbjct  312   VGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWS  371

Query  292   CILSRPKTK  266
             C+ S  K K
Sbjct  372   CLSSMIKKK  380



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score =   382 bits (980),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 245/368 (67%), Gaps = 8/368 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             A TY+ F+    S       CY AI SFGDSL DTGN +  S +++  V  A LPYGET+
Sbjct  29    ATTYHPFISKNTSP---TTSCYTAIFSFGDSLADTGNFLHYSGNNSGPV--AQLPYGETY  83

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             FH  TGR+SDGRLIIDF+A +MGLP V PY  GK + D  F  G NFAVAGATA+D  F+
Sbjct  84    FHRATGRFSDGRLIIDFIAQAMGLPLVPPYLAGKHSQD--FRHGANFAVAGATALDNDFY  141

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
               +G+       SLG ++ WFKQ+L S C + S CK ++ +S+ L+GEIG NDYN+ F+Q
Sbjct  142   RAKGLKVVWPEYSLGIQIKWFKQLLPSLCSSDSDCKSFMSNSLFLVGEIGWNDYNHPFVQ  201

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
             G   EE+   VP +I VI+S I +LI+ GA+ L+VPG +P GC   YL+ F +    +YD
Sbjct  202   GMTIEEIRKLVPDIIHVISSAITDLIQLGAKTLVVPGIVPSGCVSLYLTVFQSQKGEDYD  261

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
             P+TGCI W N+F+E HN L+ +EL+ LR LHPH  II+A+YY+A M ++RSP  +GF+ +
Sbjct  262   PRTGCIKWANEFSEEHNRLISEELDRLRRLHPHATIIHANYYDALMSIFRSPQQFGFKKS  321

Query  490   -LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              L+ACCGG GPYN N    CG   +TVC  P+ ++ WDG HLTEAAY+ I  GLL GP+ 
Sbjct  322   PLDACCGGDGPYNMNISLRCGDPKTTVCRDPAKFVFWDGTHLTEAAYEVISRGLLEGPYA  381

Query  313   SPKINGEC  290
             +P I   C
Sbjct  382   TPSIIQTC  389



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score =   381 bits (978),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 190/369 (51%), Positives = 253/369 (69%), Gaps = 7/369 (2%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             ++F+VL +     A  CY +I SFGDSLTDTGNL  +S+  +   +  + PYG+T FHHP
Sbjct  12    WLFIVLPLVFTTAATSCYSSIFSFGDSLTDTGNLYFISQPQSPDCL--LPPYGKTHFHHP  69

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERG  1019
              GR SDGRLI+DF+A    LP+++PY G    G+     GVNFAVAGATA+D SFF E+ 
Sbjct  70    NGRCSDGRLIVDFIAEFFRLPYLKPYLGFINGGN--IEHGVNFAVAGATALDRSFFEEKE  127

Query  1018  IINSCT-NVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
              +   T N SL  +LD FK++L S C + S CK  L SS+ ++GEIGGNDY +   Q   
Sbjct  128   FVVEVTANYSLIVQLDGFKELLPSICNSTSSCKGVLHSSLFIVGEIGGNDYGFPLFQTSV  187

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
               +++++VP+V++VI S+I ELI  GA  ++VPG+LP+GC+P+YL+ F T +  EYD Q 
Sbjct  188   FGDLITYVPRVVSVITSSIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYD-QA  246

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLE  485
             GC+ WLN F EY NELLQ EL+ LR L+P T IIYADY+NAA++LY+SP  YGF+ N  +
Sbjct  247   GCLKWLNKFFEYRNELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFK  306

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
              CCGGGGPYN N  A CG+     CD PS Y+SWDG HLTEAA++W+ + LL GP+T PK
Sbjct  307   VCCGGGGPYNYNDSALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPK  366

Query  304   INGECILSR  278
              +  C+ S 
Sbjct  367   FSFSCLSSE  375



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/379 (51%), Positives = 253/379 (67%), Gaps = 9/379 (2%)
 Frame = -1

Query  1390  AITYYIFL-VLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYG  1220
              I   IFL  LFV+       C  +++I+SFGDS+ DTGNL+ +S   N   +S   PYG
Sbjct  11    GIISLIFLSTLFVTMVGSESQCRNFESIISFGDSIGDTGNLLGLSDDPNNLALSGYPPYG  70

Query  1219  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDM  1040
             ETFFH PTGR+SDGRLIIDF+A  +GLP+V PYFG K   + +F KGVNFAVA ATA++ 
Sbjct  71    ETFFHQPTGRFSDGRLIIDFIAEFLGLPYVPPYFGSK---NGNFEKGVNFAVASATALEC  127

Query  1039  SFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYA  860
             SF  ERG  +   N+SLG +L  FK+ L + C  PS C++ + +++ILMG+IG NDYN  
Sbjct  128   SFLAERGY-HCRNNISLGVQLKIFKESLPNLCGLPSDCRDMIGNALILMGDIGANDYNLL  186

Query  859   FLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNAS  680
             F +  P  EV   VP VI+ I+S I ELI  G +  +VPG  P GCS +YL+ + TSN +
Sbjct  187   FFKRRPFHEVKELVPLVISTISSAITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLA  246

Query  679   EYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF  500
             EYD   GC+ WLN F+EYH+E LQ EL  LR+L+PH  II+ADYYN  +RL + P+ YGF
Sbjct  247   EYD-SLGCLKWLNKFSEYHDEQLQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGF  305

Query  499   -ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIG  323
              +  L ACCG GGPYN N +  CGS     C+ PS Y++WDG+H+TEAAY+ + DGLL G
Sbjct  306   TKEPLYACCGVGGPYNFNFNTKCGSVEVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKG  365

Query  322   PFTSPKINGECILSRPKTK  266
             P+ +P  N  C+ S+ K K
Sbjct  366   PYATPPFNWSCLSSKIKNK  384



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 250/376 (66%), Gaps = 11/376 (3%)
 Frame = -1

Query  1399  QGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYG  1220
             +  A+ Y I  +L  ST   A  C+++I+SFGDSL DTGN   +S   N     A  PYG
Sbjct  23    KKMAVAYAIISILVASTAASASQCFESIISFGDSLADTGNFFLLSPP-NKPPYCARPPYG  81

Query  1219  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR--SFAKGVNFAVAGATAM  1046
              TFFH PTGR SDGRL+IDF+A ++GLP VE Y  GK   ++   F+KGVNFAVAGAT +
Sbjct  82    RTFFHLPTGRSSDGRLVIDFIAEALGLPLVESYIAGKNAAEKGGRFSKGVNFAVAGATVL  141

Query  1045  DMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYN  866
             D  FF +RGI N  TNV+LG + DWF Q L+         ++++++S+IL+GEIGGNDY 
Sbjct  142   DTVFFDKRGIHNRVTNVTLGTQFDWFNQFLAVI----PNGRKFVKNSLILVGEIGGNDYG  197

Query  865   YAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSN  686
                L     + + SF+P V+  I STI ELIK GA  ++VPG +P+GC P+ L+++ TS+
Sbjct  198   NPLLLDIDPKAIRSFMPAVVNYIGSTIEELIKLGATTMLVPGVIPMGCLPALLTHYKTSS  257

Query  685   A-SEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNN  509
                +Y P TGC+NWLN+ + YHNELLQKEL+ LR LHPH  IIYAD YNA MR Y SP+ 
Sbjct  258   TEKDYHPTTGCLNWLNELSIYHNELLQKELSRLRHLHPHIAIIYADNYNAMMRFYLSPHQ  317

Query  508   YGF--ENTLEACCGGGGPYNSNPHAYCGS-QLSTVCDSPSSYISWDGMHLTEAAYQWIVD  338
             +GF  E+ L ACCGGGGPYN N  A CG+   +  C++PS Y++WDG+H TEAA +WI  
Sbjct  318   FGFAKESILRACCGGGGPYNFNGSALCGNLPRANCCENPSLYVNWDGLHCTEAANKWIAQ  377

Query  337   GLLIGPFTSPKINGEC  290
             GL  G +T P I   C
Sbjct  378   GLWEGSYTHPHIKTIC  393



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/367 (52%), Positives = 246/367 (67%), Gaps = 8/367 (2%)
 Frame = -1

Query  1378  YIFLVLFVST---GHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             +IFL  FV T          +K+I+SFGDS+ DTGNL+ +S   +   M A  PYGE FF
Sbjct  15    FIFLSTFVVTNVSSETKCREFKSIISFGDSIADTGNLLGLSDPKDLPHM-AFPPYGENFF  73

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             HHPTGR+S+GRLIIDF+A  +GLP V P++G   + + +F KGVNFAV GATA++ SF  
Sbjct  74    HHPTGRFSNGRLIIDFIAEFLGLPLVPPFYG---SHNANFEKGVNFAVGGATALERSFLE  130

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             +RGI    TNVSLG +L+ FK+ L S C +PS C++ +E+++ILMGEIGGNDYNYAF   
Sbjct  131   DRGIHFPYTNVSLGVQLNSFKESLPSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVD  190

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                EE+   +P VIT I+S I ELI  G +  +VPG  P+GCS  YL+   TSN  EYDP
Sbjct  191   KGIEEIKELMPLVITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNMEEYDP  250

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-  491
              TGC+ WLN F E H E L+ ELN L++L+PH  IIYADYYNA   LY+ P  +GF N  
Sbjct  251   LTGCLKWLNKFGENHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRP  310

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L ACCG GGPYN      CG+ +   CD PS Y++WDG+H+TEAAY+ + +G+L GP+  
Sbjct  311   LSACCGAGGPYNYTVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAI  370

Query  310   PKINGEC  290
             P  +  C
Sbjct  371   PPFDWSC  377



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/369 (53%), Positives = 250/369 (68%), Gaps = 11/369 (3%)
 Frame = -1

Query  1363  LFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
             LFVS       C  +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGR
Sbjct  20    LFVSIVSSESQCRNFESIISFGDSIADTGNLLGLSDHNN-LPMSAFPPYGETFFHHPTGR  78

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +GLP+V PYFG  T G+  F KGVNFAVA ATA++ SF  E+G  +
Sbjct  79    FSDGRLIIDFIAEFLGLPYVPPYFG-STNGN--FEKGVNFAVASATALESSFLEEKGY-H  134

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEV  830
                N SLG +L  FKQ L + C  PS C++ + +++ILMGEIG NDYN+ F Q  P +EV
Sbjct  135   CPHNFSLGVQLKIFKQSLPNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFQLRPLDEV  194

Query  829   MSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCIN  650
                VP VI+ I+S I ELI  G +  +VPG  P+GCS ++L+   TSN  EYDP TGC+ 
Sbjct  195   KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLK  254

Query  649   WLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCG  473
             WLN F EYH+E LQ+ELN LR+L+PH  IIYADYYNA++RL R P    F N  L ACCG
Sbjct  255   WLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPR---FINRHLSACCG  311

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGE  293
              GGPYN N    CGS     C  PS Y++WDG+H+TEAA++ + DGL+ GP+  P  +  
Sbjct  312   VGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWS  371

Query  292   CILSRPKTK  266
             C+ S  K K
Sbjct  372   CLSSMIKKK  380



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 239/350 (68%), Gaps = 7/350 (2%)
 Frame = -1

Query  1324  KAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSM  1145
             ++I+SFGDS+ DTGNL+ +S   N +   A+LPYGETFFHHPTGR+S+GRLIIDF+ L +
Sbjct  12    RSILSFGDSIADTGNLLGLS-DPNDHPQVALLPYGETFFHHPTGRFSNGRLIIDFIVLRL  70

Query  1144  GLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWFK  965
              L  V P++G +   + +F KGVNFAV GATA++ SF  ERGI   CTNVSLG +L  FK
Sbjct  71    SL--VPPFYGSQ---NANFEKGVNFAVGGATALERSFLEERGIHFPCTNVSLGVQLSSFK  125

Query  964   QMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTI  785
             + L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE    VP VI  I+S I
Sbjct  126   ESLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSTEETNELVPLVIRTISSAI  185

Query  784   NELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQK  605
              ELI  G +  +VPG  P+GCS  Y + + T+N  EYDP TGC+ WLN F EYHNE LQ 
Sbjct  186   TELIGMGGKAFLVPGEFPMGCSVVYWTIYQTTNMEEYDPLTGCLKWLNKFGEYHNEQLQV  245

Query  604   ELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGS  428
             ELN L++L+PH  IIYADYYN    +++ P  +GF N  L ACCG GGPYN      CG+
Sbjct  246   ELNRLQKLYPHVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYNYTVGKKCGT  305

Query  427   QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  278
              +   C  PS Y++WDG+HLTEAAY  I +G+L GP+T P  +  C+ SR
Sbjct  306   DVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCLSSR  355



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 238/347 (69%), Gaps = 3/347 (1%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSK-SSNAYVMSAVLPYGETFFHHPT  1196
               V+ VS      GC+ +I SFGDSLTDTGNL+ +S   SN    SA  P G TFFHHP+
Sbjct  19    LFVIIVSIIQPVNGCFTSIFSFGDSLTDTGNLLEISLLESNKLPPSAFPPNGRTFFHHPS  78

Query  1195  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI  1016
             GR  DGRL+IDF+A ++G+PF++P +  K    + F KG+NFAVAGATA++ SF  E GI
Sbjct  79    GRRCDGRLVIDFLAEALGIPFLQPSYTTKVGRLQKFQKGMNFAVAGATALNSSFLQENGI  138

Query  1015  INSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKE  836
              N  TN+SLG+EL+ FK +L S C + + CK+ L +S+I+MG IGGNDY++AF + +  E
Sbjct  139   YNRSTNISLGDELNSFKHLLPSLCSSSADCKKLLRNSLIVMGVIGGNDYSHAFREKN-NE  197

Query  835   EVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGC  656
                 FVP V+  IAS I+ELI+ GA   +VPGN PIGCSP  L+ +  SN  +YDP TGC
Sbjct  198   AARKFVPLVVHTIASAIHELIELGAMTFLVPGNFPIGCSPELLTNYQGSNKDKYDPLTGC  257

Query  655   INWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACC  476
             + WLN F+++HNELL+ EL  LR  HP   I+YADYYN AMR Y SP  +GF+ TL+ACC
Sbjct  258   LTWLNQFSQHHNELLRTELEKLRNRHPDINIVYADYYNIAMRFYHSPKQFGFKETLKACC  317

Query  475   GGGGPYNSNPHAYCG-SQLSTVCDSPSSYISWDGMHLTEAAYQWIVD  338
             G GG YN N    CG   L + C+ PSSYISWDG+H TEAA +W+ +
Sbjct  318   GIGGLYNYNSSRSCGYPPLKSSCNDPSSYISWDGIHYTEAANKWLAN  364



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 243/355 (68%), Gaps = 7/355 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   ++   PYGETFFHHPTGR SDGRLIIDF+A  
Sbjct  36    FQSIISFGDSIADTGNLLGLSDRNN-LSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAV  ATA++ SF  ERG  +   N+SLG ++  F
Sbjct  95    LGLPYVTPYFGSK---NGNFQKGVNFAVGSATALEASFLEERGY-HCSHNISLGVQVKVF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS CK  + +++ILMGEIGGNDYN  F +     EV   VP VI+ I+S 
Sbjct  151   KESLPNLCGLPSDCKNMIGNALILMGEIGGNDYNGPFFERRLINEVKELVPLVISTISSA  210

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP  GC+ WLN F EYH+E LQ
Sbjct  211   ITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIEEYDP-FGCLKWLNKFGEYHDEQLQ  269

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              EL  LR+L+PH  IIYADYYNA +RL + P  YGF N  L ACCG G PYN N    CG
Sbjct  270   AELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPLSACCGVGEPYNFNFSTCCG  329

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C+ PS Y++WDG+H+TEAAY++I DGLL GP+TSP  N  C+ S+ K K
Sbjct  330   SFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCLTSKIKNK  384



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   380 bits (977),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 250/380 (66%), Gaps = 10/380 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFL----VLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYV  1244
             MA      I+ ++FL    V+ V++       YK+I+SFGDS+ DTGN +R+S   N   
Sbjct  1     MASPLKKLISTFLFLLSSTVIMVASSEPLCHPYKSIISFGDSIADTGNYLRLS-DVNHLP  59

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
              +A LPYGETFFH P+GRYSDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV
Sbjct  60    QAAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGINFAV  116

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGE  887
              GATA+D +F  E+GI +  TNVSL  +L+ FKQ+L S C + SR C+E L  S+ILMGE
Sbjct  117   YGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQVLPSLCASSSRDCREMLGDSLILMGE  176

Query  886   IGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYL  707
             IGGNDYNY F +G    E+   VP +I  I+S I +L+  G +  +VPGN PIGCS SYL
Sbjct  177   IGGNDYNYPFFEGKSINEIKELVPLIIKTISSAIVDLVDLGGKTFLVPGNFPIGCSASYL  236

Query  706   SYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRL  527
             + F  +   E+DP TGCI WLN+F EYHNE L+ EL  L++L+PH  IIYADYYN+    
Sbjct  237   TLFHNAKEEEHDPFTGCIPWLNEFGEYHNEQLKTELKRLQKLYPHVNIIYADYYNSIHTF  296

Query  526   YRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
             ++ P  YGF+N  L ACCG GG YN   +  CG      C +PS Y++WDG HLTEAAY 
Sbjct  297   FQEPAKYGFKNRPLAACCGVGGKYNFTVNEECGYGGVNYCQNPSEYVNWDGYHLTEAAYH  356

Query  349   WIVDGLLIGPFTSPKINGEC  290
              I  GLL GP+ +P  +  C
Sbjct  357   KIAHGLLNGPYATPAFDWSC  376



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 242/371 (65%), Gaps = 11/371 (3%)
 Frame = -1

Query  1384  TYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGN-LIRMSKSSNAYVMSAVLPYGETFF  1208
             T +IFL         A  CY +I+SFGDS+ DTGN L+   + +         PYG+T+F
Sbjct  27    TVFIFL-----KSRPATTCYNSIISFGDSIADTGNYLVDFGEKAGPVGHP---PYGKTYF  78

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
               PTGR+SDGR+IIDF+A +MGLP V PY    +  D  +  GVNFAVAG TA+D  FF 
Sbjct  79    RRPTGRFSDGRVIIDFIAQAMGLPLVPPYLVRTSKQDLRY--GVNFAVAGVTALDGKFFR  136

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             ++G+  +    SL  ++ WFK++L S C + S C+ +   S++LMGEIGGNDYN+ F Q 
Sbjct  137   DKGMALTWPQYSLATQIQWFKKLLPSLCSSKSDCESFFSKSLVLMGEIGGNDYNHPFAQL  196

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                +E+ ++VP V+ + +  IN LI+ GA+ L+VPG  P+GC  +YL+   +    +YDP
Sbjct  197   KAIDEIRTYVPSVVNITSWAINSLIELGAKTLVVPGIFPLGCVSAYLTVHQSGRREDYDP  256

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTL  488
             QTGCI WLN+F+EYHN LLQ EL+ LR LHP   IIYA+YY+AAM +YR P  YGF+  L
Sbjct  257   QTGCIKWLNEFSEYHNSLLQTELDRLRRLHPRITIIYANYYDAAMDIYRHPLKYGFDAPL  316

Query  487   EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              ACCGGGGPYN N  A CG++  TVC  PS ++ WDGMHLT+AAY+ I  GLL G + S 
Sbjct  317   AACCGGGGPYNFNLTAMCGAREDTVCSDPSKHVCWDGMHLTDAAYEIIARGLLQGSYASA  376

Query  307   KINGECILSRP  275
              I   C+L  P
Sbjct  377   PITQACLLLEP  387



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score =   380 bits (975),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/348 (56%), Positives = 247/348 (71%), Gaps = 7/348 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I SFGDSL DTGNL+  S S+NA  + A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31    CYTSIFSFGDSLADTGNLL-YSPSNNAGAI-ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +G+P V PY  G   GD  F +G NFAV GATA+   FF E+G+  S T  SLG +++W
Sbjct  89    GIGIPLVPPYLAGP--GDHGFRQGANFAVGGATALGNDFFREKGLHVSWTEYSLGTQIEW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C + S CK  L +S+ L+GEIGGNDYN+ F QG   +E+ +FVP++I+ I+S
Sbjct  147   FKQLLPSLCSSSSDCKGILSNSLFLVGEIGGNDYNHPFFQGKTVDEIRTFVPRIISAISS  206

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI WLN+F+ +HN LL
Sbjct  207   AINVLIQLGAKTLVVPGNFPIGCVSWYLQIFQSQRKEDYDSQTGCIKWLNEFSAHHNRLL  266

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
               EL+ LR+LHPH  IIYADYY A + ++RSP  +GF+   L ACCGGGGPYN++    C
Sbjct  267   LDELDRLRQLHPHATIIYADYYKALLHIFRSPTQFGFKKAPLAACCGGGGPYNAS--VAC  324

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             G + +TVC+ PS Y+SWDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  325   GDRAATVCNDPSRYVSWDGMHLTEAAYKTIAQGLLEGPDTTPPITQAC  372



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score =   398 bits (1023),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 200/374 (53%), Positives = 257/374 (69%), Gaps = 13/374 (3%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             + Y I L+L  S   +A GCY +I+SFGDSL DTGNL+ +S  +N   +    PYG TFF
Sbjct  5     VGYAIILILVASISRLASGCYDSIISFGDSLADTGNLLLLSPPNNP-PLCGRPPYGRTFF  63

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR--SFAKGVNFAVAGATAMDMSF  1034
             H  TGRYSDGRL+IDF+A S+GLP VEPY   K   ++  SF+KGVNFAVAGATA+D  F
Sbjct  64    HRTTGRYSDGRLVIDFIAESLGLPLVEPYAAWKIAAEKGGSFSKGVNFAVAGATALDTMF  123

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
             F +RGI N  TN SLG +LDWFKQ L+         +++L+SS+I+MGEIGGNDYNY   
Sbjct  124   FDKRGIQNLVTNASLGIQLDWFKQFLARIPDG----RKFLKSSLIVMGEIGGNDYNYPIQ  179

Query  853   QGHPKEEVM-SFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA-S  680
             QG+   +V+ S VP V+  + S I ELIK GA+ ++VPGNL +GC P YL+ + TS+  +
Sbjct  180   QGNVDPQVIRSLVPTVVNYMGSIIEELIKLGAETMLVPGNLALGCLPLYLTQYKTSSTEN  239

Query  679   EYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF  500
             +YDP+TGC+NWLN+ + YHNELLQKEL  +R LHP   IIYADYYNA +R Y SP+ +GF
Sbjct  240   DYDPKTGCLNWLNELSIYHNELLQKELFRIRHLHPRISIIYADYYNATIRFYLSPDQFGF  299

Query  499   --ENTLEACCGGGGPYNSNPHAYCG--SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGL  332
               E+ L ACCGGGGPYN +P   CG     +  C++PS + SWDG+H TEAA +WI  G 
Sbjct  300   TKESVLRACCGGGGPYNYDPLTACGIDRPAANCCENPSLFASWDGIHFTEAANRWIAQGF  359

Query  331   LIGPFTSPKINGEC  290
             +   +T P I   C
Sbjct  360   IRQHYTHPPIKTLC  373


 Score =   392 bits (1007),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 249/366 (68%), Gaps = 5/366 (1%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
              L+L       +  C+ +I+SFGDS+ DTGN   +S  S       + PYGETFF+HPTG
Sbjct  407   ILILSHKLSFASASCFTSIISFGDSIADTGNAPYLSPESGRPPFYTLPPYGETFFNHPTG  466

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD---RSFAKGVNFAVAGATAMDMSFFTER  1022
             R SDGRLIIDF+A    LPFV P+  G   G+    SF  G NFAV GATA++ SFF ER
Sbjct  467   RCSDGRLIIDFIAEEFELPFVAPFLQGGRNGNVNSTSFRDGANFAVVGATALEDSFFDER  526

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             G+     NVSL  +L WF Q LS  C  T S CK ++E+S++L+GEIGGNDYN+A L G 
Sbjct  527   GVTVPLANVSLVAQLRWFNQFLSKICPTTSSDCKGFIETSLVLVGEIGGNDYNHALLGGI  586

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
              + EV SFVP V+ +I S I ELI  GA  L+VPGN PIGCS +YL+YF++ N  +Y+P 
Sbjct  587   KEAEVRSFVPHVVNIIGSAITELINLGAVTLMVPGNFPIGCSSAYLTYFLSENQDDYEPA  646

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTL  488
             TGCI WLN F +YHN+LL+KEL  +RELHPHT IIYADYYNA M LYRSP  +GF    L
Sbjct  647   TGCIKWLNRFAQYHNDLLKKELARIRELHPHTTIIYADYYNAVMDLYRSPIEHGFAGGAL  706

Query  487   EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              ACCGGGGPYN N   +CG   S  CD PS Y++WDGMH TEAAY+WI  GLL GP+T+P
Sbjct  707   GACCGGGGPYNCNLTVHCGYPPSNTCDDPSLYVNWDGMHFTEAAYKWIALGLLKGPYTTP  766

Query  307   KINGEC  290
              ++  C
Sbjct  767   PLSTVC  772



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   379 bits (974),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 242/355 (68%), Gaps = 7/355 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   ++   PYGETFFHHPTGR SDGRLIIDF+A  
Sbjct  36    FQSIISFGDSIADTGNLLGLSDRNN-LSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAV  ATA+++SF  ERG  +   N+SLG ++  F
Sbjct  95    LGLPYVTPYFGSK---NGNFQKGVNFAVGSATALEVSFLEERGY-HCPHNISLGVQVKIF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS CK  + +++ILMGEIGGNDYN  F Q  P +EV   VP VI+ I+S 
Sbjct  151   KESLPNLCGLPSDCKNMIGNALILMGEIGGNDYNGPFFQRRPVDEVKELVPLVISTISSA  210

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYD   GC+ WLN F EYH+E LQ
Sbjct  211   ITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYD-SFGCLKWLNKFGEYHDEQLQ  269

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
              EL  LR L+PH  IIYADYYNA +RL + P  YGF +  L ACCG G PYN N    CG
Sbjct  270   AELKRLRNLNPHVNIIYADYYNALLRLNQEPTKYGFIDKPLSACCGVGEPYNFNFSTCCG  329

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C+ PS Y++WDG+H+TEAAY+ + DGLL GP+ SP  N  C+ S+ K K
Sbjct  330   SFGVDSCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYASPPFNWTCLSSKIKNK  384



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score =   379 bits (973),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 239/349 (68%), Gaps = 5/349 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGN I +S   N    +A LPYGETFF  P+GRYSDGRLIIDF+A  
Sbjct  34    FKSIISFGDSIADTGNYIHLSSDVNHPPQAAFLPYGETFFRSPSGRYSDGRLIIDFIAEF  93

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG +     SF KG+NFAV GATA+D +F   +GI +  TNVSL  +L+ F
Sbjct  94    LGLPYVPPYFGSQNV---SFEKGINFAVYGATALDRAFLLAKGIESDFTNVSLSVQLNIF  150

Query  967   KQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             KQ+L + C + SR C+E LE S+ILMGEIGGNDYNY F +G    E+   VP VI  I+S
Sbjct  151   KQILPNLCASSSRDCREILEDSLILMGEIGGNDYNYPFFEGKSINELKDLVPLVIKAISS  210

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  G +  +VPGN P+GCSP+YL+ F T    E+DP TGCI WLN+F ++HNE L
Sbjct  211   AIVDLIDLGGKTFLVPGNFPLGCSPAYLTLFKTVEEEEHDPFTGCITWLNEFGQHHNEQL  270

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
             + EL  L++L+PH  IIYADYYN+    ++ P  YGF+N  L ACCG GG YN   +  C
Sbjct  271   KTELKRLQKLYPHVNIIYADYYNSMYPFFQEPARYGFKNRPLGACCGVGGNYNFTINEEC  330

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
             G +  + C +PS Y++WDG HLTEA +Q I  GLL GP+ +P  +  CI
Sbjct  331   GYEGVSYCQNPSEYVNWDGYHLTEATHQKIAHGLLNGPYATPAFDWSCI  379



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score =   379 bits (972),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 187/368 (51%), Positives = 248/368 (67%), Gaps = 6/368 (2%)
 Frame = -1

Query  1369  LVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
              ++ V T       +K+I+SFGDS+TDTGNL+ +S S N    SA  PYGETFFHHP+GR
Sbjct  13    FLITVVTSQTRCRNFKSIISFGDSITDTGNLLGLS-SPNDLPESAFPPYGETFFHHPSGR  71

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +G+P V P++G K   + +F KGVNFAV GATA++ S   E+G   
Sbjct  72    FSDGRLIIDFIAEFLGIPHVPPFYGSK---NGNFEKGVNFAVGGATALECSVLEEKGTHC  128

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
             S +N+SLGN+L  FK+ L   C + S  C++ +E++ IL+GEIGGNDYN+        EE
Sbjct  129   SQSNISLGNQLKSFKESLPYLCGSSSPDCRDMIENAFILIGEIGGNDYNFPLFDRKNIEE  188

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V   VP VIT I+S I+EL+  GA+  +VPGN P+GCS +YL+ + T N  EY+P TGC+
Sbjct  189   VKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCL  248

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACC  476
              WLNDF+ YHNE LQ EL  LR L+PH  IIY DYYN  +RL + P+ +G  +  L ACC
Sbjct  249   TWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACC  308

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGPYN      CGS+    C  PS Y++WDG+H+TEAAY+WI +G+L GP+  P  N 
Sbjct  309   GLGGPYNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNW  368

Query  295   ECILSRPK  272
              C+ S+ K
Sbjct  369   SCLDSKIK  376



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score =   379 bits (972),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 240/357 (67%), Gaps = 5/357 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFFH PTGR+S+GRLIIDF+A  
Sbjct  35    FKSIISFGDSIADTGNLLGLS-GPNELPHVAFPPYGETFFHRPTGRFSNGRLIIDFIAEF  93

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP V P++G +   + +F KGVNFAVAGATA++ S   ERGI    TN+SLG +L  F
Sbjct  94    LGLPLVPPFYGSQ---NANFEKGVNFAVAGATALERSLLEERGIHFPYTNISLGVQLSSF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L   C +PS C++ +E+++ILMGEIGGNDYNYAF      EE+   +P VIT I+S 
Sbjct  151   KASLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSIEEIKELIPLVITTISSA  210

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG+ P+GCS +YL+ + TSN   YDP TGC+ WLN F E H+E LQ
Sbjct  211   ITELIGMGGRTFLVPGDFPLGCSATYLTLYQTSNVEAYDPWTGCLTWLNKFGENHDEQLQ  270

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              EL  L++L+PH  IIYADYY A +R+Y+ P  +GF N  L ACCG GGPYN      CG
Sbjct  271   AELKKLQKLYPHVNIIYADYYKALLRIYQEPEKFGFMNRPLSACCGVGGPYNFTSFWQCG  330

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKIP  260
             + +   C+ PS Y++WDG+H+TEAAY  I +G+L G +  P  N  C+ S  K   P
Sbjct  331   TDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGAYAVPPFNWSCLSSEIKDNGP  387



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/368 (51%), Positives = 248/368 (67%), Gaps = 6/368 (2%)
 Frame = -1

Query  1369  LVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGR  1190
              ++ V T       +K+I+SFGDS+TDTGNL+ +S S N    SA  PYGETFFHHP+GR
Sbjct  17    FLITVVTSQTRCRNFKSIISFGDSITDTGNLLGLS-SPNDLPESAFPPYGETFFHHPSGR  75

Query  1189  YSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN  1010
             +SDGRLIIDF+A  +G+P V P++G K   + +F KGVNFAV GATA++ S   E+G   
Sbjct  76    FSDGRLIIDFIAEFLGIPHVPPFYGSK---NGNFEKGVNFAVGGATALECSVLEEKGTHC  132

Query  1009  SCTNVSLGNELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
             S +N+SLGN+L  FK+ L   C + S  C++ +E++ IL+GEIGGNDYN+        EE
Sbjct  133   SQSNISLGNQLKSFKESLPYLCGSSSPDCRDMIENAFILIGEIGGNDYNFPLFDRKNIEE  192

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V   VP VIT I+S I+EL+  GA+  +VPGN P+GCS +YL+ + T N  EY+P TGC+
Sbjct  193   VKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYNPLTGCL  252

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACC  476
              WLNDF+ YHNE LQ EL  LR L+PH  IIY DYYN  +RL + P+ +G  +  L ACC
Sbjct  253   TWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACC  312

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGPYN      CGS+    C  PS Y++WDG+H+TEAAY+WI +G+L GP+  P  N 
Sbjct  313   GLGGPYNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNW  372

Query  295   ECILSRPK  272
              C+ S+ K
Sbjct  373   SCLDSKIK  380



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 251/380 (66%), Gaps = 10/380 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFL----VLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYV  1244
             MA      I+ ++FL    V+ V++       YK+I+SFGDS+ DTGN +R+S   N   
Sbjct  1     MASPLKKLISTFLFLLSSTVIIVASSEPLCHPYKSIISFGDSIADTGNYLRLS-DVNHLP  59

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
              +A LPYGETFFH P+GRYSDGRLIIDF+A  +GLP+V PYFG +     S  +G+NFAV
Sbjct  60    QAAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SIEQGINFAV  116

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGE  887
              GATA+D +F  E+GI +  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMGE
Sbjct  117   YGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQVLPNLCASSSRDCREMLGDSLILMGE  176

Query  886   IGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYL  707
             IGGNDYNY F +G    E+   VP +I  I+S I +L+  G +  +VPGN PIGCS SYL
Sbjct  177   IGGNDYNYPFFEGKTVNEIKELVPLIIKTISSAIVDLVDLGGKTFLVPGNFPIGCSASYL  236

Query  706   SYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRL  527
             + F  +   E+DP TGCI WLN+F EYHN+ L+ EL  L++L+PH  IIYADYYN+    
Sbjct  237   TLFHNAKEEEHDPFTGCIPWLNEFGEYHNDQLKTELKRLQKLYPHVNIIYADYYNSIYTF  296

Query  526   YRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
             ++ P  YGF+N  L ACCG GG YN   +  CG +    C +PS Y++WDG HLTEAAY+
Sbjct  297   FQEPAKYGFKNRPLAACCGVGGKYNFTVNEECGYRGVNYCQNPSEYVNWDGYHLTEAAYR  356

Query  349   WIVDGLLIGPFTSPKINGEC  290
              I  GLL GP+ +P  +  C
Sbjct  357   KIAHGLLNGPYATPAFDWSC  376



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score =   378 bits (971),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 189/357 (53%), Positives = 242/357 (68%), Gaps = 10/357 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFM---  1157
             +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFF HPTGR+S+GRLIIDF+   
Sbjct  36    FKSIISFGDSIADTGNLLGLS-DPNHLPHVAFPPYGETFFQHPTGRFSNGRLIIDFIVRF  94

Query  1156  -ALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
              A  +G P V P++G +   +  F KGVNFAV GATA++ SF  ERGI  S TNVSLG +
Sbjct  95    TAEFLGFPLVPPFYGSQ---NAHFEKGVNFAVGGATALERSFLEERGIHFSYTNVSLGVQ  151

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             L  FK  L   C +PS C+E +++++ILMGEIGGNDYNY F  G   EEV  FVP VI+ 
Sbjct  152   LKSFKDALPKLCGSPSDCREMIKNALILMGEIGGNDYNYVFFVGKTIEEVREFVPLVIST  211

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP +GC+ WLN F +YH+
Sbjct  212   ISSAITELIGMGGRTFLVPGEFPIGCSVTYLTLYQTSNKEEYDP-SGCLKWLNKFAKYHS  270

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPH  443
             + LQ ELN LREL+PH  IIYADYYNA +RL++ P N+GF +  L ACCG GGPYN    
Sbjct  271   DQLQAELNKLRELYPHVNIIYADYYNALLRLFQEPGNFGFIDRPLHACCGFGGPYNFTFG  330

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  272
               CG +    C  PS YI WDG+H+TEA Y+ + +G+L GP+  P  +  C+ S+ K
Sbjct  331   RKCGFKGVESCSDPSKYICWDGVHMTEATYRLMAEGILKGPYAIPPFDWSCLSSKIK  387



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   378 bits (970),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 240/348 (69%), Gaps = 5/348 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I SFGDSL DTGN +  S +++  V  A  PYGET+FH  TGR+S+GRL++DF+A 
Sbjct  49    CYTSIFSFGDSLADTGNFLHYSGNNSGPV--AHHPYGETYFHRATGRFSNGRLVVDFIAQ  106

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             +MGLP V PY  GK + D  F  G NFAVAGATA+D  FF  +G+  +    SLG ++ W
Sbjct  107   AMGLPLVPPYLAGKNSQD--FRHGANFAVAGATALDNDFFRAKGLNVAWPEYSLGAQIKW  164

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C + S CK  + +S+ LMGEIG NDYN+ F+QG   +E+ +FVP +I +I+S
Sbjct  165   FKQLLPSLCSSDSDCKGLMSNSLFLMGEIGWNDYNHPFVQGMTIDEIRTFVPDIIHIISS  224

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI+ GA+ ++VPG +P GC   YL+ F +    +YDPQTGCI W N+F+E+H  LL
Sbjct  225   AITDLIELGAKTVVVPGIVPSGCVSLYLTVFQSQKREDYDPQTGCIKWANEFSEHHGRLL  284

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
              +EL+ LR LHPH  II+A+YY+A M ++RSP  +GF+ + L+ACCGG GPYN N    C
Sbjct  285   SEELDRLRRLHPHAIIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNLNISLRC  344

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             G  ++TVC  PS Y+ WDG HLTEAAY+ I  GLL GP+ +P I   C
Sbjct  345   GDPMTTVCHDPSKYVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  392



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 190/372 (51%), Positives = 242/372 (65%), Gaps = 20/372 (5%)
 Frame = -1

Query  1402  SQGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPY  1223
             S  T +   I +VL +S  H    CY +I SFGDSL DTGN++     S   V  + LPY
Sbjct  3     SSETHVGVVITIVLLLSV-HRVTSCYSSIFSFGDSLADTGNILASDGDSAGAV--SRLPY  59

Query  1222  GETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMD  1043
             GET+FH PTGRYSDGRLIIDF+A +MG+P + PY GG +  D  F  G NFAV GATA++
Sbjct  60    GETYFHRPTGRYSDGRLIIDFIAQAMGVPLLRPYLGGGS--DEDFRHGANFAVGGATALN  117

Query  1042  MSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCK-EYLESSVILMGEIGGNDYN  866
              SFF ++ I  S T  SL  +++WFKQ+L S   TPS  +   L +S+ L+GEIGGNDYN
Sbjct  118   SSFFRDKKIDVSWTEYSLQVQIEWFKQLLRS---TPSVSEPSILGNSLFLVGEIGGNDYN  174

Query  865   YAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSN  686
             + F Q    EE+ +FVP V+  I+S I +LIK GA+ L+VPGNLPIGC P YL+ F T  
Sbjct  175   HPFFQNRRVEEIRTFVPSVVKAISSAITDLIKLGAKNLVVPGNLPIGCVPVYLTQFQTQK  234

Query  685   ASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNY  506
               +YD +TGCI WLN+F++YHN LLQ E+  +R LHP+  I YADYY +AMRL+ SP  +
Sbjct  235   LDDYDAKTGCIRWLNEFSQYHNRLLQDEIERVRGLHPNATIAYADYYESAMRLFESPKQF  294

Query  505   GFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLI  326
             GF+  L ACC G           CG   + +C  PSSY SWDG+HLTEAAY+ I +GLL 
Sbjct  295   GFKEPLSACCVG-----------CGGPSAKLCSDPSSYASWDGLHLTEAAYRTIANGLLK  343

Query  325   GPFTSPKINGEC  290
             GP   P +N  C
Sbjct  344   GPLAVPSLNQTC  355



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score =   377 bits (969),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 242/367 (66%), Gaps = 5/367 (1%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             I Y+   + F S       CYK+I  FGDSLTD GNL+ +        M    PYG+T+F
Sbjct  14    IIYFFTCIFFASAKIATSNCYKSIFGFGDSLTDAGNLVHLYPPGRKPHM-YFPPYGKTYF  72

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             + PTGR SDGRL+ID +A   GLP   P    +  G+     G+NFAV G+ AMD  F+ 
Sbjct  73    NRPTGRCSDGRLLIDLIAQYYGLPLPPPSKEARDGGN--MQSGINFAVVGSRAMDAKFYE  130

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             +RGI +  TNVS+ ++LDWFKQML   C  PS C ++LE S+ L+GE GGNDY +A L G
Sbjct  131   KRGIYDKVTNVSMWDQLDWFKQMLPYLCHNPSGCSKFLERSLFLLGEFGGNDYTHALLSG  190

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                 E++  +P V+  I S  +EL++ GA+ ++VP  LP+GC+ SYL+Y+ + N  +YD 
Sbjct  191   KNINEILPIIPSVVHTIVSGAHELVELGAKTIMVPSVLPLGCTSSYLTYYQSWNEEDYD-  249

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENT  491
             + GC+ W N F  +HN+LLQ+EL+ LRE++PH  IIYADYYNAAM+LYR+P+ YGF +  
Sbjct  250   ELGCLIWPNHFATHHNQLLQRELHRLREINPHVNIIYADYYNAAMQLYRAPSKYGFLKGG  309

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L  CCG GGPYN NP A CG+  +T C+ P+ YI+WDG HLTEAAY+W+   LL GPFT+
Sbjct  310   LVTCCGAGGPYNFNPFAQCGNYPATSCEDPNQYINWDGYHLTEAAYKWMTKSLLEGPFTN  369

Query  310   PKINGEC  290
             P IN  C
Sbjct  370   PPINSFC  376



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score =   402 bits (1034),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/377 (52%), Positives = 259/377 (69%), Gaps = 8/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +++++F  L V+T +    C  +K+I+SFGDS+ DTGNL+ +S   N     A  PYGET
Sbjct  10    VSFFLF-TLLVTTVYSESQCRNFKSIISFGDSIADTGNLVGLS-DPNDLPHVAFPPYGET  67

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+S+GRL+IDFMA  +GLP V P++G   + + +F KGVNFAV GATA++ SF
Sbjct  68    FFHHPTGRFSNGRLVIDFMAEFLGLPLVPPFYG---SHNANFEKGVNFAVGGATALEQSF  124

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               E+GI    TNVSLG +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF 
Sbjct  125   LEEKGIHFPYTNVSLGVQLKSFKESLPKICGSPSDCRDMIENALILMGEIGGNDYNYAFF  184

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                  EE+   VP VIT I+S I ELI  G +  +VPGN PIGCS +YL+ + TSN  EY
Sbjct  185   VRKSIEEIKELVPLVITTISSAITELIGMGGRTFLVPGNFPIGCSVAYLTLYQTSNKKEY  244

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLN+F EYH E LQ ELN L++L+PH  IIYADYYN  +R+++ P  +GF  
Sbjct  245   DPLTGCLAWLNEFGEYHGEQLQVELNRLQKLYPHVNIIYADYYNPMLRIFQEPAKFGFIS  304

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN      CG+++   C+ PS Y++WDG+HLTEAAY+W+ DGLL GP+
Sbjct  305   RPLPACCGVGGLYNYTVGMQCGTEVVECCNDPSKYVNWDGVHLTEAAYRWLADGLLNGPY  364

Query  316   TSPKINGECILSRPKTK  266
               P  +  C+ S  K K
Sbjct  365   AIPPFDWSCLSSEIKNK  381


 Score =   184 bits (467),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 132/199 (66%), Gaps = 3/199 (2%)
 Frame = -1

Query  1273  RMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR  1094
              +    N    +A  PYGETFFH+PTGR+S+GRLIIDF+A  +GLP+V P FG +   + 
Sbjct  377   EIKNKGNELPPAAFPPYGETFFHNPTGRFSNGRLIIDFIAEFLGLPYVPPCFGSQ---NG  433

Query  1093  SFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYL  914
             SF KGVNFAVAGATA++ +F   +GI  + TNVSLG +L  FK+ L + C +P+ C+E +
Sbjct  434   SFEKGVNFAVAGATALEQAFLESKGIHYAYTNVSLGVQLKSFKESLLNLCGSPADCREMI  493

Query  913   ESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNL  734
              +++I++G IGGNDYNYA   G   EE    VP VI+ I+STI ELI  G + ++VP + 
Sbjct  494   GNALIIVGGIGGNDYNYASFVGKSIEETKELVPLVISTISSTITELISMGGRTILVPSDF  553

Query  733   PIGCSPSYLSYFMTSNASE  677
             PIG S   +S+   S  S+
Sbjct  554   PIGYSNQTVSHVGGSLTSQ  572


 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -1

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GG YN N    CG++    C  PS Y+ WDG HLTE+ Y+WI  GLL GP+T P  + 
Sbjct  1292  GAGGMYNYNSVRQCGTKGVDCCLDPSKYVHWDGSHLTESTYRWIAMGLLEGPYTIPAFDW  1351

Query  295   ECI  287
              C+
Sbjct  1352  SCL  1354



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 239/356 (67%), Gaps = 6/356 (2%)
 Frame = -1

Query  1345  HVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLII  1166
               +GGCY AI SFGDSL DTGN IR+              YG TFF+ PTGR+SDGRLI+
Sbjct  25    RASGGCYSAIFSFGDSLADTGNAIRLGGLGGPTGTPP---YGRTFFNRPTGRFSDGRLIV  81

Query  1165  DFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLG  986
             DF+A  +GLP + PY GG ++ D  F +GVNFAVAGATA+D+SFF E+GI  + T+ SL 
Sbjct  82    DFIAQGLGLPLLRPYLGGGSSED--FRQGVNFAVAGATALDLSFFREKGIQPTWTDKSLH  139

Query  985   NELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
              ++  FKQ+L S        K+ L SS+ILMGEIGGNDYN  F QG   +E+  FVP VI
Sbjct  140   VQIQLFKQLLPSIAAG-RDPKDVLNSSLILMGEIGGNDYNQPFFQGIKLDEIRPFVPSVI  198

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
             + I+S IN+LI+ GA+ L+VPGN PIGC P YL  + + N  EY+  TGCI WLN+ ++Y
Sbjct  199   SAISSGINDLIELGAKTLLVPGNFPIGCVPVYLDIYKSYNVEEYESDTGCIKWLNELSKY  258

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  446
             HN LL  EL+ LR+LHP+  IIYA+YY+A +  +R+P  +GF+  L ACCG  GPY+ N 
Sbjct  259   HNRLLLAELDRLRKLHPNVMIIYANYYDAMISFFRAPEVFGFKAPLHACCGSDGPYSVNR  318

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  278
             +A CG + + VC  PSS +SWDG+HLTEAAY  I   LL GP  +P +   C  +R
Sbjct  319   NAPCGHRNAKVCSDPSSSVSWDGIHLTEAAYGTIASSLLEGPHANPPLTRACSSTR  374



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 246/376 (65%), Gaps = 11/376 (3%)
 Frame = -1

Query  1402  SQGTAITYYIFLVL------FVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVM  1241
             S  + + +Y+ L+         S  H   G Y A+ SFGDSL DTGNL+    S   ++ 
Sbjct  3     SSSSCLNFYLLLIFSLCSCTIASKVHSKKGNYSALFSFGDSLADTGNLLLSGHSP--FIR  60

Query  1240  SAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVA  1061
              A  P+GETFFH PTGR SDGRL++DF+A + GLP + PY   K  G   F KGVNFAVA
Sbjct  61    IAHPPFGETFFHKPTGRCSDGRLVVDFVAEAFGLPLLPPYLS-KLKGPADFRKGVNFAVA  119

Query  1060  GATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIG  881
             GATA++ S+FT++ I    TN SL  +L WF  +L S C+T + CK YL+ SV L+GEIG
Sbjct  120   GATALNSSYFTKKNIGFLWTNSSLNVQLGWFYHLLPSLCRTDAACKSYLKKSVFLVGEIG  179

Query  880   GNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSY  701
             GNDYNYAF+QG   E+V S+VP VI  I +  + LI+ GA+ L+VPGNLP+GCS S L+ 
Sbjct  180   GNDYNYAFIQGKSIEQVKSYVPDVINAIMNAASVLIRIGAKTLVVPGNLPVGCSASILTG  239

Query  700   FMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYR  521
             F+T++ +EYDP+ GC+   N+F +YHN  L K +  +RE  PH  IIYADYYNAA+R  +
Sbjct  240   FLTTDKNEYDPRNGCLIRFNEFAQYHNSKLHKAIQAMRERFPHINIIYADYYNAAIRFVQ  299

Query  520   SPNNYGF--ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQW  347
             +P  +GF  E  L ACCGGGGPYN N    CG   +  C +P+ Y++WDG+HLTEAAY++
Sbjct  300   TPEMFGFRKETVLRACCGGGGPYNFNITDRCGHPGAHACANPARYVNWDGIHLTEAAYEF  359

Query  346   IVDGLLIGPFTSPKIN  299
             I   +L G F  P I 
Sbjct  360   IAKAMLNGEFMHPPIK  375



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   377 bits (967),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 254/386 (66%), Gaps = 8/386 (2%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMS  1238
             MA      +  +    L V+      GC  +K+I+SFGDS+TDTGNL+ +S S N    S
Sbjct  1     MASQDSHMLLSFFISTLLVTIVTSQTGCRNFKSIISFGDSITDTGNLLGLS-SPNDLPES  59

Query  1237  AVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAG  1058
             A  PYGETFFH+P+GR+SDGRLIIDF+A  +G+P V P++G K   + +F KGVNFAV G
Sbjct  60    AFPPYGETFFHYPSGRFSDGRLIIDFIAEFLGIPHVPPFYGSK---NGNFEKGVNFAVGG  116

Query  1057  ATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPS-RCKEYLESSVILMGEIG  881
             ATA++ S   ERG   S +N+SLGN+L  FK+ L   C + S  C++ + ++ IL+GEIG
Sbjct  117   ATALECSVLEERGTQCSQSNISLGNQLKSFKESLPYLCGSSSVDCRDMIGNAFILIGEIG  176

Query  880   GNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSY  701
             GNDYN+        EEV   VP VIT I+S I+EL+  GA+  +VPGN P+GCS +YL+ 
Sbjct  177   GNDYNFPLFDRKNIEEVKELVPLVITTISSVISELVDMGARTFLVPGNFPLGCSVAYLTL  236

Query  700   FMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYR  521
             + TSN  EY+P TGC+ WLNDF+ YHNE LQ ELN LR+L+PH  IIY DYYN  +RL +
Sbjct  237   YETSNEEEYNPLTGCLTWLNDFSVYHNEQLQAELNRLRKLYPHVNIIYGDYYNTLLRLVQ  296

Query  520   SPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWI  344
              P+ +G  +  L ACCG GGPYN      CGS+    C  PS Y++WDG+H+TEAAY+ I
Sbjct  297   EPSKFGLMDRPLPACCGVGGPYNFTFSIQCGSKGVEYCSDPSKYVNWDGIHMTEAAYKCI  356

Query  343   VDGLLIGPFTSPKINGECILSRPKTK  266
              +G+L GP+  P  +  C+ S  K K
Sbjct  357   SEGILKGPYAIPPFDWSCLSSEIKNK  382



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score =   376 bits (965),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 190/380 (50%), Positives = 251/380 (66%), Gaps = 10/380 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFL----VLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYV  1244
             MA      I+ ++FL    V+ V++       YK+I+SFGDS+ DTGN +R+S   N   
Sbjct  1     MASPLKKLISTFLFLLSSTVIMVASSEPLCHPYKSIISFGDSIADTGNYLRLS-DVNHLP  59

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
              +A LPYGETFF  P+GRYSDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV
Sbjct  60    QAAFLPYGETFFQPPSGRYSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGINFAV  116

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGE  887
              GATA+D +F  E+GI +  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMGE
Sbjct  117   YGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQILPNLCASTSRDCREMLGDSLILMGE  176

Query  886   IGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYL  707
             IGGNDYNY F +G     +   VP +I  I+S I +L+  G++  +VPGN PIGCS SYL
Sbjct  177   IGGNDYNYPFFEGKSINGIKELVPLIIKTISSAIVDLVDLGSKTFLVPGNFPIGCSASYL  236

Query  706   SYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRL  527
             + F  +   E+DP TGCI WLN+F EYHN+ L+ EL  L++L+PH  IIYADYYN+    
Sbjct  237   TLFQNAKEEEHDPFTGCIPWLNEFGEYHNDQLKNELKRLQKLYPHVNIIYADYYNSIHTF  296

Query  526   YRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
             ++ P  YGF+N  L ACCG GG YN   +  CG +    C +PS Y++WDG HLTEAAY+
Sbjct  297   FQEPAKYGFKNRPLAACCGVGGKYNFTVNEECGYRGVNYCQNPSEYVNWDGYHLTEAAYR  356

Query  349   WIVDGLLIGPFTSPKINGEC  290
              I  GLL GP+ +P  +  C
Sbjct  357   KIAHGLLNGPYATPAFDWSC  376



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score =   375 bits (964),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/369 (50%), Positives = 247/369 (67%), Gaps = 7/369 (2%)
 Frame = -1

Query  1384  TYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             T +  + L  ++      C  +K+I+SFGDS+TDTGNL+ +S  +N    +A  PYGETF
Sbjct  14    TLFFLIALLTTSVSSEQQCRKFKSIISFGDSITDTGNLLGLS-DANDLPQAAFPPYGETF  72

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             FH PTGR+S+GRLIIDF+A  +GLP+V PYFG +   + SF KGVNFAVAGATA++  F 
Sbjct  73    FHVPTGRFSNGRLIIDFIAEFLGLPYVPPYFGSQ---NGSFEKGVNFAVAGATALERVFL  129

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
               RGI  + TNVSL  +L  FK+ L + C +PS C+E + ++++++GEIGGNDYNY FL 
Sbjct  130   ESRGIHYAYTNVSLRVQLQSFKESLPNLCGSPSDCREMIGNALVIVGEIGGNDYNYGFLV  189

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
             G    E+   VP VI+ I+S + ELI  G + ++VP + PIGC PS+L+ + TSN  EYD
Sbjct  190   GKSIVEMKELVPLVISTISSVVTELISMGGRTILVPSDFPIGCWPSFLTQYQTSNQEEYD  249

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
             P TGC+ WLN+F E HNE LQ ELN L+ L+P   I+YADY+NA +  ++ P  +GF N 
Sbjct  250   PLTGCLKWLNEFIERHNEELQAELNRLQRLNPRVTILYADYHNALLHTFQEPTRFGFMNR  309

Query  490   -LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              L ACCG GGPY  N    CG++    C  PS Y+ WDG HLTE+AY+WI  GLL G +T
Sbjct  310   PLSACCGSGGPYKFNSVRQCGTKGVDCCVDPSKYVHWDGFHLTESAYRWIALGLLEGNYT  369

Query  313   SPKINGECI  287
              P  +  C+
Sbjct  370   VPAFDWSCL  378



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 252/369 (68%), Gaps = 8/369 (2%)
 Frame = -1

Query  1384  TYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             T+++  +L          C  +K+I+SFGDS+TDTGNL+ +S + N    SA  PYGETF
Sbjct  15    TFFLITLLTTVISSQVQQCRKFKSIISFGDSITDTGNLLGLSDADNL-PHSAFPPYGETF  73

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             FH PTGR+S+GRLIIDF+A  +GLP++ P++G +   + SF KGVNFAVAGATA+D +  
Sbjct  74    FHFPTGRFSNGRLIIDFIAEFLGLPYLPPFYGSQ---NASFEKGVNFAVAGATALDQTVL  130

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
               RGI    TNVSLG +   FK+ L + C +P+ C+E + ++++++GEIGGNDYNY FL 
Sbjct  131   ESRGIYYDYTNVSLGVQFKNFKESLPNICGSPADCREMIGTALLIVGEIGGNDYNYGFLV  190

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
             G   EE+   VP VI+ I+  I EL+K G + ++VP + PIGC  ++L+ +  SN  EYD
Sbjct  191   GKTVEELKELVPLVISSISFMITELVKMGGKTIMVPADFPIGCWTAFLTEYRISNNEEYD  250

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-  494
             P TGC+ WLN+F EYHN+ LQ+ELN +++++PH  IIYADYYNA +R+++ P  +GF + 
Sbjct  251   PLTGCLKWLNEFIEYHNKELQEELNRVQKIYPHVTIIYADYYNALLRIFQEPAKFGFTSG  310

Query  493   -TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L A CG GGPYN N  ++CG++    C  PS Y+ WDG HLTE+AY+WI  G L GP+
Sbjct  311   RPLSAFCGTGGPYNFNSMSWCGTKKVDSCSDPSKYVHWDGFHLTESAYRWIAMGFLKGPY  370

Query  316   TSPKINGEC  290
             T P  +  C
Sbjct  371   TIPAYDWSC  379



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score =   389 bits (999),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 190/377 (50%), Positives = 256/377 (68%), Gaps = 7/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  ++ L   V+  +    C  +++I+SFGDS+ DTGNL+ ++  S+    SA  PYG++
Sbjct  12    LVSFVILAFLVANLNSQTQCKNFRSIISFGDSIADTGNLLSLADPSD-LPGSAFPPYGKS  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             F +HPTGR+SDGRLIIDF+A  +GLP V P++  +     SF KGVNFAVAGATA++ SF
Sbjct  71    FLNHPTGRFSDGRLIIDFIAEFLGLPLVPPFYRSQHA---SFEKGVNFAVAGATALEPSF  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
                RGI +S TN SLG +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYN+A  
Sbjct  128   LERRGIHSSTTNFSLGVQLRSFKESLPCLCASPSDCRDMIENALILMGEIGGNDYNFALF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             Q    EEV   VP VI  I+S I EL++ G +  +VPGN P+GCS +YL+ + TSN  +Y
Sbjct  188   QRKAIEEVKELVPLVIATISSAITELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEKY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLNDF +YH+E LQ ELN L+ L+P+  IIYADYYNA +RLY+ P  +GF +
Sbjct  248   DPLTGCLTWLNDFGKYHSEQLQTELNRLKNLNPNVNIIYADYYNALLRLYQEPTKFGFIK  307

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN N    CGS     C  PS +++WDG+H+TEAAY+WI +GLL GP+
Sbjct  308   RPLPACCGLGGLYNFNFTRKCGSLGVESCIDPSEFVNWDGIHMTEAAYRWISEGLLNGPY  367

Query  316   TSPKINGECILSRPKTK  266
               P  N  C+ S+ K K
Sbjct  368   AIPPFNWSCLNSKIKNK  384


 Score =   380 bits (976),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 244/368 (66%), Gaps = 6/368 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             F+V +VS+       +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFFHHPTG
Sbjct  430   FIVTYVSS-ETQCREFKSIISFGDSIADTGNLLGLS-DPNELPHVAFPPYGETFFHHPTG  487

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R+S+GRLIIDF+A  +GLP V P++G +     +F KGVNFAV GATA++ SF  ERGI 
Sbjct  488   RFSNGRLIIDFLAEFLGLPLVPPFYGSQHA---NFEKGVNFAVGGATALERSFLEERGIH  544

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
                TNVSLG +L  FK+ L   C  PS C++ +E+++ILMGEIGGNDYNYAF      EE
Sbjct  545   FPYTNVSLGVQLSSFKESLPKLCGAPSDCRDMIENALILMGEIGGNDYNYAFFVNKSTEE  604

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
                 VP VI  I+S I ELI  G +  +VPG  P GCS  YL+ +  SN  EYDP TGC+
Sbjct  605   TKELVPLVIRTISSAITELISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVEEYDPLTGCL  664

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACC  476
              WLN F + H E L+ ELN L++L+PH  IIYADYYNA +R+Y+ P  +GF +  L ACC
Sbjct  665   TWLNKFGKNHGEQLRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMDRPLSACC  724

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGP+N      CG+ +   CD PS Y++WDG+HLTEAAY+ I +G+L GP+  P  + 
Sbjct  725   GVGGPHNFTAGNKCGTVVVESCDDPSKYVAWDGVHLTEAAYRLIAEGILKGPYAVPPFDW  784

Query  295   ECILSRPK  272
              C+ S  K
Sbjct  785   FCLSSEIK  792



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score =   374 bits (961),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 236/348 (68%), Gaps = 23/348 (7%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I+SFGDSL DTGN +  S +S   +  A LPYGET+FH PTGR+SDGRLIIDF+A 
Sbjct  31    CYTSIISFGDSLADTGNFLYSSNNSPGAI--ARLPYGETYFHRPTGRFSDGRLIIDFIAQ  88

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +G+P V PY  G   GD  F +GVNFAVAGATA+D  FF E+G+  S T  SLG +++W
Sbjct  89    DIGIPLVPPYLEGP--GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C + S                GGNDYN+ F QG   +E+ +FVP +I+ I+S
Sbjct  147   FKQLLPSLCSSGS----------------GGNDYNHPFFQGKTVDEIRTFVPSIISAISS  190

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              IN LI+ GA+ L+VPGN PIGC   YL  F +    +YD QTGCI WLN+F EYHN LL
Sbjct  191   AINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKEDYDSQTGCIKWLNEFAEYHNRLL  250

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
               EL+HL++LHPH  IIYADYY A + ++RSP  +GF+   L ACCGGGGPYN +    C
Sbjct  251   VDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS--VPC  308

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             G + +TVC+ PS+Y+ WDGMHLTEAAY+ I  GLL GP T+P I   C
Sbjct  309   GGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  356



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score =   374 bits (961),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 236/348 (68%), Gaps = 8/348 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIR-MSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             C  +I SFGDSL DTGNL+  +   +  +   A LPYGET+FH+ TGR+SDGRLIIDF+A
Sbjct  44    CLTSIFSFGDSLADTGNLLHYLGDDAGPF---AHLPYGETYFHNATGRFSDGRLIIDFIA  100

Query  1153  LSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELD  974
              S+GLP V PY  G    D  F  G NFAVAGATA+D  FF  +G+  + +  SL  + +
Sbjct  101   QSLGLPLVPPYLAGTNAQD--FRYGANFAVAGATALDNDFFRAKGLNVTWSEYSLVVQFN  158

Query  973   WFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             WFKQ+L S C T S CK  + +S+ L+GEIG ND+ Y+F +G   +E+ +F+P +I VI+
Sbjct  159   WFKQLLPSLCSTDSDCKGIISNSLFLVGEIGWNDHGYSFNEGRTADEIRTFIPNIIEVIS  218

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
             S I++LIK GA+ L+VPG  P GC P YL++  +    +YDP TGCI W+N+F+ YHN+L
Sbjct  219   SVIDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYHNQL  278

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYC  434
             LQ EL+ +R LHPH  IIYADYY A M ++RSP  +GFE   +ACCGGGGP  +N    C
Sbjct  279   LQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFEKPFDACCGGGGP--NNCAIQC  336

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             G    TVC  PS Y+SWDG HLTEAAY+ I  GLL G +T+P ++  C
Sbjct  337   GDPGFTVCSDPSKYVSWDGSHLTEAAYRAIALGLLQGSYTTPSMSRAC  384



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score =   385 bits (988),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/353 (53%), Positives = 247/353 (70%), Gaps = 5/353 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S   N     A  PYGETFFHHPTGR+S+GRL+IDF+A  
Sbjct  396   FKSIISFGDSIADTGNLVGLS-DPNDLPHVAFPPYGETFFHHPTGRFSNGRLVIDFIAEF  454

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP V P++G +   + +F KGVNFAV GATA++ SF  ERGI  + TNVSLG +L  F
Sbjct  455   LGLPLVPPFYGSQ---NANFEKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLRSF  511

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L + C + S C++ +E+++ILMGEIGGNDYNYAF  G P +E+   VP VI+ I+S 
Sbjct  512   KDSLPNLCGSSSDCRDMMENALILMGEIGGNDYNYAFFLGKPIQEIKELVPFVISSISSA  571

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG+ P+GCS +YL+ + TSN  EYDP+TGC+ WLN F EY+N+ LQ
Sbjct  572   IKELINMGGRTFLVPGDFPLGCSVAYLTIYQTSNMEEYDPKTGCLKWLNKFGEYYNKQLQ  631

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              ELN L++L+PH  IIYADYYNA  RL++ P  +GF N  L ACCG GG YN      CG
Sbjct  632   AELNKLQKLYPHVNIIYADYYNAVSRLFQEPAKFGFMNRPLPACCGLGGSYNFTFGRKCG  691

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPK  272
              Q    C+ P+ Y++WDG+HLTE+AY+ I +GLL GP+  P  +  C+ S  K
Sbjct  692   FQGVECCNDPTKYVNWDGVHLTESAYRLIAEGLLKGPYAIPPFDWSCLSSEIK  744


 Score =   379 bits (974),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 250/377 (66%), Gaps = 7/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +++++  +L V+T      C  +++I+SFGDS+ DTGNLI +S S N    SA  PYGET
Sbjct  15    VSFFLSTLLVVTTVRSETKCRSFESIISFGDSIADTGNLIGLS-SPNQLPESAFPPYGET  73

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+SDGRL+IDF+A  +G P V P++G K   + +F KGVNFAV  ATA++ SF
Sbjct  74    FFHHPTGRFSDGRLVIDFIAEFLGFPHVPPFYGSK---NGNFEKGVNFAVGAATALESSF  130

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI     N+SLG ++  FK+ L + C +PS C++ + +++ILMGEIGGNDYNY F 
Sbjct  131   LEERGIHCPYGNISLGVQIQSFKESLLNLCGSPSDCRDMIGNALILMGEIGGNDYNYPFF  190

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                  EE+   VP VI  I+S I EL+  G +  +VPGN P+GCS  YL+ + T N  +Y
Sbjct  191   GRKTIEEIKELVPLVINTISSAITELVDMGGKTFLVPGNFPLGCSVIYLTLYQTPNKEDY  250

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLN+F+EYHNE LQ ELN LR+L+PH  IIY DYYNA +RL + P  +G   
Sbjct  251   DPLTGCLTWLNEFSEYHNEKLQTELNRLRKLYPHVNIIYGDYYNALLRLIQEPAKFGLMS  310

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L  CCG GG YN      CGS+    CD PS Y++WDG+H+TE AY+ I +GLL GP+
Sbjct  311   RPLPVCCGSGGTYNFTFGVKCGSKGVGYCDDPSKYVNWDGVHMTETAYRLIAEGLLKGPY  370

Query  316   TSPKINGECILSRPKTK  266
             + P  +  C+ S  + K
Sbjct  371   SIPPFDWSCLSSEIENK  387



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   373 bits (957),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 250/378 (66%), Gaps = 15/378 (4%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGN-------LIRMSKSSNAYVMSA  1235
             T I++ +  ++ +S+   A GC+ +I + GDSL DTGN       +  +SK +   +   
Sbjct  10    TTISFSVTFLILLSSLKTASGCFTSIFALGDSLADTGNYATIYPPIFHLSKGT---LYCG  66

Query  1234  VLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYF-GGKTTGDRSFAKGVNFAVAG  1058
             + PYGET+FHHPTGR SDGRLIIDF+A   GLP V PY  G     +  F  G+NFAVAG
Sbjct  67    LPPYGETYFHHPTGRCSDGRLIIDFIAEYYGLPPVPPYLRGANHRSNSRFQAGLNFAVAG  126

Query  1057  ATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGG  878
             ATA+D+ F+ E+GI ++  N+S+  +L WFK +L S C + S C E  +SS+ LMG  GG
Sbjct  127   ATALDVPFYGEKGISSTLGNISMSTQLRWFKGLLPSLCNS-SSCSEVFKSSLFLMG-FGG  184

Query  877   NDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYF  698
             NDY  AFLQG   EE  S VP VI+   S INELI  G   ++V G LP GCSP+ L+YF
Sbjct  185   NDYGKAFLQGKSLEETKSLVPLVISATGSAINELIDLGVVNIMVNGLLPDGCSPAMLTYF  244

Query  697   MTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRS  518
              +SN  +YD  TGC++WLNDF+ YHNELLQ+ELN +R  HP   I+YADY+N  M+L+RS
Sbjct  245   KSSNKEDYDTATGCLSWLNDFSNYHNELLQEELNGVRANHPDALILYADYFNPLMQLFRS  304

Query  517   PNNYGF-ENTLEACCGGGG-PYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWI  344
             P   GF   +L ACCG GG PYN N  A CG   ST C  PS YISWDG+HLTEAAY+++
Sbjct  305   PEQNGFGGRSLMACCGDGGPPYNYNFSAQCGEPASTACAWPSLYISWDGIHLTEAAYRFM  364

Query  343   VDGLLIGPFTSPKINGEC  290
               GLL GP+T+P+IN  C
Sbjct  365   AKGLLEGPYTTPRINPLC  382



>emb|CDY64716.1| BnaCnng44670D [Brassica napus]
Length=389

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 246/371 (66%), Gaps = 6/371 (2%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             T+I  + F  + V++   +   YK+I+SFGDS+ DTGN + +    N    +A LPYGET
Sbjct  10    TSILLFFFYTIIVASSEPSCRLYKSIISFGDSIADTGNYLHLF-DVNHPPQAAFLPYGET  68

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FF  PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +GVNFAV GATA+D +F
Sbjct  69    FFSVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGVNFAVYGATALDRAF  125

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAF  857
               E+GI++  TNVSL  +L+ FKQ+L + C + S  C++ LE S+ILMGE+GGNDYNY F
Sbjct  126   LIEKGIVSDFTNVSLSVQLNTFKQILPTLCASSSHDCRKVLEDSLILMGELGGNDYNYPF  185

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
              +     E+    P +I  I+  I +LI  G +  +VPG+ P+GCS +YL+ F T+   +
Sbjct  186   FEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEKD  245

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE  497
             YDP TGC+ WLNDF ++H+E L+ E+  LR+L+PH  IIYADYYN+  RLY+ P  YGF+
Sbjct  246   YDPLTGCLPWLNDFGKHHDEQLKTEIRRLRKLYPHVNIIYADYYNSLYRLYQKPTKYGFK  305

Query  496   NT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             N  L ACCG GG YN      CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP
Sbjct  306   NRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGP  365

Query  319   FTSPKINGECI  287
             + +P  N  C+
Sbjct  366   YATPAFNWSCL  376



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 232/352 (66%), Gaps = 10/352 (3%)
 Frame = -1

Query  1342  VAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIID  1163
             +  GCY AI SFGDSL DTGN +     S+ +      PYGETFFHHPTGRYSDGR+++D
Sbjct  38    LVAGCYSAIFSFGDSLADTGNRLH----SHRFDPVGRFPYGETFFHHPTGRYSDGRVMLD  93

Query  1162  FMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGN  983
             F+A ++GLP V+PY  G   G+  F  G NFAV GATA+D  FF  +G+  S TN SL  
Sbjct  94    FIAQAIGLPMVQPYLAGTHDGE-DFRYGANFAVGGATALDNEFFRSKGMEVSWTNDSLSV  152

Query  982   ELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             +L+WFK +L S C T   C + +  S+  +GEIGGNDYN+AF QG   +E+ +FVP V++
Sbjct  153   QLEWFKHLLPSLCAT--NCSDLMSESLFSVGEIGGNDYNHAFFQGRGVDEIKTFVPGVVS  210

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I S I ELIK GA+ +IVPGN PIGC   YL+ F +    +Y+  TGCI WLN F+ YH
Sbjct  211   AIGSAIEELIKLGARTMIVPGNFPIGCVAVYLTMFQSDRREDYESGTGCIEWLNQFSMYH  270

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNP  446
             N  L  EL  LR  +P   IIYA+YY AAM ++RSP  YGF    L ACCGGGGPYN N 
Sbjct  271   NRHLLDELTQLRRRYPQATIIYANYYEAAMAIFRSPQEYGFGKFPLAACCGGGGPYNYNH  330

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                CG   + VC SPSS ISWDG+HLTEAAY+ I  GLL GP+T P ++  C
Sbjct  331   STKCGKD-AGVCSSPSSQISWDGIHLTEAAYRVIARGLL-GPYTIPSLSRSC  380



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score =   373 bits (958),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 242/358 (68%), Gaps = 6/358 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY ++ SFGDSL DTGNL+R     N  V    LPYGET+F  PTGR+ DGRL++DF+A 
Sbjct  72    CYTSVFSFGDSLADTGNLLRYLGKKNIDV--GRLPYGETYFRRPTGRFCDGRLVVDFIAQ  129

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             +MGLP + PY   ++     F +G NFAVAGATA++  FF E+G+    +N SLG +++W
Sbjct  130   AMGLPLLPPYLARRS--GHGFRQGANFAVAGATAIENGFFMEKGLHVPWSNNSLGIQIEW  187

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+L S C + S C    ++S+ L+GEIGGNDYNY FLQ    +EV+S+VP V+  I+S
Sbjct  188   FRQLLPSLCSSDSDCNVMFQNSLFLVGEIGGNDYNYPFLQARALDEVISYVPPVMDAISS  247

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I  LI+ GA+ L+VPGN PIGC+ +YL+ F ++ + +YD   GCI WLN F+ YHN  L
Sbjct  248   AITALIELGARTLVVPGNFPIGCNSAYLTVFHSNRSEDYD-AFGCIKWLNKFSRYHNNQL  306

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
             +  L  +R+ +PH  +IYADYY+AAM ++RSP   GF ++ L ACCGGGGPYN N    C
Sbjct  307   RVVLKRIRQRNPHATVIYADYYSAAMSMFRSPQLSGFRSSPLPACCGGGGPYNFNSFLQC  366

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKIP  260
             G+  S VC  PSSY++WDGMH+TEAAY+ I  GLL GP   P I   C  ++ KT  P
Sbjct  367   GNPGSNVCADPSSYVTWDGMHMTEAAYRKIATGLLEGPNAVPPILNTCPRTKQKTSRP  424



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score =   372 bits (954),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/371 (49%), Positives = 245/371 (66%), Gaps = 6/371 (2%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             T+   + F  + V++   +   YK+I+SFGDS+ DTGN + +S   N    +A LPYGET
Sbjct  10    TSFLLFFFYTIIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGET  68

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FF  PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +GVNFAV GATA+D +F
Sbjct  69    FFSVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGVNFAVYGATALDRAF  125

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAF  857
             F E+GI++  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F
Sbjct  126   FIEKGIVSDFTNVSLSVQLNTFKQILPTLCASSSRDCREMLGDSLILMGEIGGNDYNYPF  185

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
              +     E+    P +I  I+  I +LI  G +  +VPG+ P GCS +YL+ F T+   +
Sbjct  186   FEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEED  245

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE  497
             YDP TGC+ WLNDF ++H+E L+ E+  LR+ +PH  +IYADYYN+  RLY+ P  YGF+
Sbjct  246   YDPLTGCLPWLNDFGKHHDEQLKTEIKRLRKRYPHVNVIYADYYNSLYRLYQEPTKYGFK  305

Query  496   NT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             N  L ACCG GG YN      CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP
Sbjct  306   NRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGP  365

Query  319   FTSPKINGECI  287
             + +P  N  C+
Sbjct  366   YAAPAFNWSCL  376



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   372 bits (954),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/379 (50%), Positives = 248/379 (65%), Gaps = 9/379 (2%)
 Frame = -1

Query  1390  AITYYIFL-VLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYG  1220
              I   +FL  L V+T      C  +++I+SFG+S+ DTGNL+ +S   N   +S   PYG
Sbjct  11    GIISLVFLSTLLVTTVSSVSQCRNFESIISFGNSIGDTGNLLGLSDDPNNLALSGYPPYG  70

Query  1219  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDM  1040
             ETFFH PTGR+SDGRLIIDF+   +GLP+V PYFG K   + +F KGVNFAVA ATA+D 
Sbjct  71    ETFFHQPTGRFSDGRLIIDFITEFLGLPYVPPYFGSK---NGTFEKGVNFAVASATALDS  127

Query  1039  SFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYA  860
             SF  ERG  +   N+SLG +L  FK+ L   C  PS C++ + +++ILMG+IG NDYN  
Sbjct  128   SFLAERGY-HCRHNISLGVQLKIFKESLPDLCGLPSDCRDMIGNALILMGDIGANDYNLP  186

Query  859   FLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNAS  680
             F +  P +EV   VP VI+ I+S I ELI  G +  +VPG  P GCS +YL+ + TSN  
Sbjct  187   FFEHRPFDEVKELVPLVISTISSAITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLE  246

Query  679   EYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF  500
             EYD   GC+ WLN F EYH+E LQ EL  LR+L+PH  II+ADYYN  +RL + P+ YGF
Sbjct  247   EYD-SFGCLKWLNKFAEYHDEQLQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGF  305

Query  499   -ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIG  323
              +  L ACCG GG YN N    CG+     C+ PS Y++WDG+H+TEAAY+ + DGLL G
Sbjct  306   IKEPLSACCGVGGTYNFNLSTGCGNVGVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKG  365

Query  322   PFTSPKINGECILSRPKTK  266
             P+ +P  +  C+ S+ K K
Sbjct  366   PYATPPFSWSCLSSKIKNK  384



>sp|Q3ZFI4.1|SCE3_BRANA RecName: Full=Sinapine esterase; Short=BnSCE3; AltName: Full=Lipase 
2; Short=BnLIP2; Flags: Precursor [Brassica napus]
 gb|AAX58135.1| lipase 2 [Brassica napus]
Length=389

 Score =   371 bits (953),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 246/371 (66%), Gaps = 6/371 (2%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             T+   + F  + V++   +   YK+I+SFGDS+ DTGN + +S   N    +A LPYGET
Sbjct  10    TSFLLFFFYTIIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGET  68

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FF  PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +GVNFAV GATA+D +F
Sbjct  69    FFSVPTGRDSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGVNFAVYGATALDRAF  125

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAF  857
             F E+GI++  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMGE GGNDYNY F
Sbjct  126   FIEKGIVSDFTNVSLSVQLNTFKQILPTLCASSSRDCREMLGDSLILMGESGGNDYNYPF  185

Query  856   LQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASE  677
              +     E+    P +I  I+  I +LI  G +  +VPG+ P+GCS +YL+ F T+   +
Sbjct  186   FEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEKD  245

Query  676   YDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE  497
             YDP TGC+ WLNDF ++H+E L+ E+  LR+L+PH  I+YADYYN+  RLY+ P  YGF+
Sbjct  246   YDPLTGCLPWLNDFGKHHDEQLKTEIRRLRKLYPHVNIMYADYYNSLYRLYQKPTKYGFK  305

Query  496   NT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP  320
             N  L ACCG GG YN      CG +    C +PS YI+WDG H+TEAA+Q +  G+L GP
Sbjct  306   NRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHITEAAHQKMAHGILNGP  365

Query  319   FTSPKINGECI  287
             + +P  N  C+
Sbjct  366   YATPAFNWSCL  376



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score =   371 bits (952),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 247/367 (67%), Gaps = 14/367 (4%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAG---GC-YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             +I +V FV+    A     C Y+++ SFGDSL DTGNL   S     +      PYG+TF
Sbjct  9     WIAMVAFVAVSSSASLLVACPYRSMFSFGDSLADTGNLYLSSHPPTDHCFFP--PYGQTF  66

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             FHH +GR SDGRLIIDF+A S+GLP V+PYFGG         +G NFAV GATA+D SFF
Sbjct  67    FHHVSGRCSDGRLIIDFIAESLGLPLVKPYFGGWNV-----EEGANFAVIGATALDYSFF  121

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
              +RGI +  TN SL  +L+WFK++L++ C + + C E +E+S+ LMGEIGGND+NY F Q
Sbjct  122   QDRGI-SIPTNYSLTIQLNWFKELLTALCNSSTNCHEIVENSLFLMGEIGGNDFNYLFFQ  180

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
                  E+ S+VP VI  IAS INELI  GA+ L+VPGNLPIGCS  YL+ + T + ++YD
Sbjct  181   QKSIAEIKSYVPYVINAIASAINELIGLGARTLMVPGNLPIGCSVIYLTIYETIDKTQYD  240

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
              Q GC+ WLN+F EY+N  LQ EL+ LR  HP   IIYADYYNAA+ LYR P  +GF + 
Sbjct  241   -QFGCLKWLNEFGEYYNHKLQSELDKLRVFHPRANIIYADYYNAALPLYRDPTKFGFTD-  298

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L+ CCG GGPYN N    CG+     CD PS +I WDG+HLTEAAY++I  GL+ GP++ 
Sbjct  299   LKICCGMGGPYNFNKLTNCGNPSVIACDDPSKHIGWDGVHLTEAAYRFIAKGLIKGPYSL  358

Query  310   PKINGEC  290
             P+ +  C
Sbjct  359   PQFSTLC  365



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   371 bits (952),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 233/357 (65%), Gaps = 5/357 (1%)
 Frame = -1

Query  1348  GHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLI  1169
             G     CY  I SFGDSL DTGNLIR+    +A   +   PYG T+FH PTGR+SDGRLI
Sbjct  18    GSSTTACYSTIFSFGDSLADTGNLIRVP--GHADCQAGRPPYGMTYFHSPTGRFSDGRLI  75

Query  1168  IDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSL  989
             +D++A +MGLP + PY      G     KGVNFAVAGATAMD  FF E+GI    TN SL
Sbjct  76    VDYIAEAMGLPLLPPYLEAWRGG--RLRKGVNFAVAGATAMDNEFFQEKGITTGSTNCSL  133

Query  988   GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  809
               ++ WF+Q+L S C +P+ C++ L++++ LMGEIGGNDYN+   QG   +E  SFVP V
Sbjct  134   RFQIRWFQQLLPSLCASPTDCEDMLQNTLFLMGEIGGNDYNFPLSQGRSLQETESFVPLV  193

Query  808   ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  629
             +  I+S IN+LI+ GA+ L+VPG  P+GC+  YL+ + +  A +YD   GCI WLN+F++
Sbjct  194   VDTISSGINKLIELGARALLVPGITPLGCNTVYLTTYRSDRAEDYD-AIGCIRWLNEFSQ  252

Query  628   YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  449
             YHN  L  E+  L+ LHP   IIYADYY A M ++  P  +G E    ACCGGGGPYN N
Sbjct  253   YHNGHLHDEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEERFLACCGGGGPYNYN  312

Query  448   PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSR  278
                 CGS+  TVCD  S+Y+ WDG+H+TEA Y+ +  GLL GPF  P I   C  +R
Sbjct  313   SSRPCGSEGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGPFAVPAIATTCPATR  369



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   371 bits (953),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 191/374 (51%), Positives = 248/374 (66%), Gaps = 9/374 (2%)
 Frame = -1

Query  1384  TYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFH  1205
             T +I + +  S        ++ I+SFGDS+ DTGNL+ +S  +N   ++   PYGETFFH
Sbjct  19    TLFIMITMVNSESQCQN--FEYIISFGDSIADTGNLLCLSDRNN-LSLNGFPPYGETFFH  75

Query  1204  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTE  1025
             HPTGR SDGRLIIDF+A  +GLP+V PYFG K   + +F KGVNFAV  ATA++ SF  E
Sbjct  76    HPTGRSSDGRLIIDFIAEFLGLPYVTPYFGSK---NGNFQKGVNFAVGSATALEASFLEE  132

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
             RG  +   N+SLG ++  FK+ L + C  PS CK  + +++ILMGEIGGND+N  F Q  
Sbjct  133   RGY-HCPHNISLGVQVKVFKESLPNLCGLPSDCKNMIGNALILMGEIGGNDHNGPFFQRR  191

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
             P +EV   VP VI+ I+S I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP 
Sbjct  192   PIDEVKELVPLVISTISSAITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYDP-  250

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-L  488
              GC+ WLN F EYH+E L+ EL  LR+L+ H  IIYADYYNA + L + P  YGF N  L
Sbjct  251   FGCLKWLNKFGEYHDEQLEAELKRLRKLNHHVNIIYADYYNALLGLNQEPTKYGFINKPL  310

Query  487   EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              ACCG G PYN N    CGS     C+ PS Y++WDG+H+TEAAY+++ DG+L GP+TSP
Sbjct  311   SACCGVGEPYNFNFSTCCGSFGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSP  370

Query  307   KINGECILSRPKTK  266
               N  C+ S+ K K
Sbjct  371   PFNWTCLSSKIKNK  384



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 244/364 (67%), Gaps = 8/364 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             F+V+F S   +A   YK+I SFGDS  DTGNL   S   + +      PYG+TFFH  TG
Sbjct  15    FVVVFSSATILAACPYKSIFSFGDSFADTGNLYFSSHPPSHHCFFP--PYGQTFFHRVTG  72

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R SDGRLIIDF+A S+GLP ++PY G K    ++   G NFAV GATA+D+SFF ERGI 
Sbjct  73    RCSDGRLIIDFIAESLGLPLLKPYLGMK---KKNVVGGANFAVIGATALDLSFFEERGI-  128

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
             +  T+ SL  +L+WFK++L S C + + C E + +S+ LMGEIGGND+NY   Q     E
Sbjct  129   SIPTHYSLTVQLNWFKELLPSLCNSSADCHEVVGNSLFLMGEIGGNDFNYLLFQQRSIAE  188

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V +FVP VI  I S +NELI  GA+ LIVPGN+P+GCS +YL+ + T + ++YD Q GC+
Sbjct  189   VKTFVPYVIKAITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQYD-QYGCL  247

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCG  473
              WLN F EY+N+ LQ EL+ L+ LH H  IIYADYYNA + LYR P  +GF N L+ CCG
Sbjct  248   KWLNKFAEYYNQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCG  306

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGE  293
              GGPYN N  A CG      CD PS +I WDG+HLTEAAY+ I  GL+ GP+  P+ N  
Sbjct  307   MGGPYNYNASADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQGLIKGPYCLPRFNTL  366

Query  292   CILS  281
             C+++
Sbjct  367   CLIN  370



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score =   370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 244/369 (66%), Gaps = 11/369 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL+ F  T  VA     C  YK+I+SFGDS+ DTGN + +S   N    +A LPYGETFF
Sbjct  12    FLLFFFYTNIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGETFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
               PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +GVNFAV GATA+D +FF 
Sbjct  71    SVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGVNFAVYGATALDRAFFI  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQ  851
             E+GI++  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +
Sbjct  128   EKGIVSDFTNVSLSVQLNTFKQILPTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFE  187

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
                  E+    P +I  I+  I +LI  G +  +VPG+ P GCS +YL+ F T+   +YD
Sbjct  188   DKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEEDYD  247

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
             P TGC+ WLNDF ++H+E L+ E+  LR+ +PH  IIYADYYN+  RLY+ P  YGF+N 
Sbjct  248   PLTGCLPWLNDFGKHHDEQLKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNR  307

Query  490   -LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              L ACCG GG YN      CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP+ 
Sbjct  308   PLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYA  367

Query  313   SPKINGECI  287
             +P  N  C+
Sbjct  368   APAFNWSCL  376



>ref|XP_008439763.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=398

 Score =   371 bits (952),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 247/380 (65%), Gaps = 20/380 (5%)
 Frame = -1

Query  1372  FLVLFVSTG-----HVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
              ++ FV+T      +V G C+ +I +FGDSL+DTGNL   + +SN    S   PYG+TFF
Sbjct  12    LIIFFVATALSPSTNVLGNCFNSIFNFGDSLSDTGNLFN-NCNSNKPPKSCFTPYGDTFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT--GDRSFAKGVNFAVAGATAMDMSF  1034
              HPTGR+SDGRLIIDF+A S+GLP ++PY G +T       F KG+NFAVAGATA+D S+
Sbjct  71    RHPTGRFSDGRLIIDFIAQSLGLPLLQPYLGVETQRMSVAEFEKGLNFAVAGATALDASY  130

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPS--RCKEYLESSVILMGEIGGNDYNYA  860
               E+  +   TN SL  +L+WFK+  S  C + S  RC + L+ S+ ++GEIGGNDYNY 
Sbjct  131   LREKAFVEVPTNYSLSVQLEWFKKAYSLACPSSSSTRCTKILKKSLFVVGEIGGNDYNYP  190

Query  859   FLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNAS  680
             F + H  EE+ S VP V+  I S I ELI+ GAQ LIVPGNLPIGC P YL  + TS   
Sbjct  191   FFKQHSFEEIKSLVPVVVKSIGSAITELIQLGAQSLIVPGNLPIGCCPKYLKIYSTSIQ-  249

Query  679   EYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF  500
               D + GC++WLN F+EYHN+ LQ+ELN +R  HP+ +IIYADY+N+AM+ Y  P N+G 
Sbjct  250   --DSKNGCLDWLNQFSEYHNKHLQEELNRIRSQHPNVQIIYADYHNSAMQFYNHPENFGL  307

Query  499   ENTLEAC-------CGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIV  341
              NTLEAC           G Y     A   ++    CD PS Y+SWDG+HLTEAAY+ I 
Sbjct  308   ANTLEACLVDKNETLKKDGNYGLRSKAKTKTKTKKECDDPSKYVSWDGVHLTEAAYRLIA  367

Query  340   DGLLIGPFTSPKINGECILS  281
             + +L GP+T PK    CI+S
Sbjct  368   NAILQGPYTHPKFTTSCIMS  387



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score =   371 bits (952),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/351 (53%), Positives = 237/351 (68%), Gaps = 4/351 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I+SFGDS+ DTGNL+ +S+ S+   + A  PYGETFFH PTGR+SDGRL+IDF+A 
Sbjct  40    CYDSIISFGDSIADTGNLLSLSEPSHVPQV-AFPPYGETFFHRPTGRFSDGRLVIDFIAD  98

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             SMGLP V PYFG +  G+ SF +GVNFAV GATA+D S    RGI    TNVSLG +L  
Sbjct  99    SMGLPLVRPYFGSRN-GNGSFERGVNFAVGGATALDNSVLEGRGIHFDHTNVSLGVQLTV  157

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L S C+  S C E+L +S+ILMGEIGGNDYNYAF      + V   VP V+  I+S
Sbjct  158   FKEILPSLCRPSSDCSEFLNNSLILMGEIGGNDYNYAFFTHKSIQVVRELVPPVVDAISS  217

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I ELI  G +  +VPG+ PIGCS +YL+ F T N  EYDP TGC+ WLN+F EYHNE L
Sbjct  218   AIVELIDMGGRTFLVPGDFPIGCSTAYLTVFQTGNTEEYDPLTGCLTWLNEFAEYHNEQL  277

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q EL+ LR+L+PH  I+Y DYY+   R +  P+ YGF +  L ACCG GGPYN      C
Sbjct  278   QTELDRLRKLYPHVNIVYGDYYSVVSRFHAQPSKYGFGKMHLAACCGEGGPYNFTLGKQC  337

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  281
             GS +   C  PS Y+ +DG+H+TEA+Y  I + LL G   +  ++  C+ S
Sbjct  338   GSGVP-CCSDPSEYVYFDGVHMTEASYGRIAEHLLDGIRANSALDQCCLSS  387



>ref|XP_009352806.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Pyrus x bretschneideri]
Length=373

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 236/367 (64%), Gaps = 5/367 (1%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNL-IRMSKSSNAYVMSAVLPYGETFFHHP  1199
             I L+  V   H A  CY +I+ FGDSL DTGN+ +               PYGET+FHHP
Sbjct  5     ILLLTVVIIPH-ANCCYTSIIGFGDSLADTGNIYVDALDHHKGPYHFFFPPYGETYFHHP  63

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGD--RSFAKGVNFAVAGATAMDMSFFTE  1025
             TGR  DGRLIID +A SM LP + PY       +  R+  +GVNFAV GATA+D  F   
Sbjct  64    TGRCCDGRLIIDLIAESMRLPLIRPYLEVLNVNETMRNLEEGVNFAVVGATALDTDFLDP  123

Query  1024  RGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGH  845
              G  +  TN SL  ++DWFK MLS  C T S C+  L SS+I+MG IGGNDYN     G 
Sbjct  124   MGRYDVFTNFSLRIQVDWFKGMLSPLCNTSSDCRNVLSSSLIVMGPIGGNDYNCPLFAGE  183

Query  844   PKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQ  665
               E V ++VP VI  +AS INELI++GA  L+VPGN PIGC+ +YL+ +  S+ SEYDP 
Sbjct  184   SFEIVETYVPFVIEAMASAINELIQHGASTLLVPGNFPIGCTSAYLTLYEGSDESEYDPS  243

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTL  488
             TGC+ WLN F+EYHNELL+ +L+ +R LHPH  IIY D YNA ++LY+SP  +GF ENT 
Sbjct  244   TGCLTWLNKFSEYHNELLKTKLSQIRSLHPHVNIIYGDVYNAELQLYQSPEQFGFTENTS  303

Query  487   EACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              ACCGGGG YN N  A CG + ++ C +P+  I+WDG H TEAA QWI   LL G +T P
Sbjct  304   RACCGGGGTYNYNLSAPCGLRGASACANPAKSINWDGRHTTEAANQWITKALLNGIYTIP  363

Query  307   KINGECI  287
              I+  C+
Sbjct  364   HISTSCV  370



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 234/349 (67%), Gaps = 7/349 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIR-MSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             C  +I SFGDSL DTGNL+  +   +  +   A LPYGET+FH+ TGR+SDGRLIIDF+A
Sbjct  44    CLTSIFSFGDSLADTGNLLHYLGDDAGPF---AHLPYGETYFHNATGRFSDGRLIIDFIA  100

Query  1153  LSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELD  974
              S+GLP V PY  G    D  F  G NFAVAGATA+D  FF  +G+  + +  SL  + +
Sbjct  101   QSLGLPLVPPYLAGTNAQD--FRYGANFAVAGATALDNDFFRAKGLNVTWSEYSLVVQFN  158

Query  973   WFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             WFKQ+L S C T S CK  + +S+ L+GEIG ND+ Y+F +G   +E+ +F+P +I VI+
Sbjct  159   WFKQLLPSLCSTDSDCKGIISNSLFLVGEIGWNDHGYSFNEGRTADEIRTFIPNIIEVIS  218

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
             S I++LIK GA+ L+VPG  P GC P YL++  +    +YDP TGCI W+N+F+ YHN+L
Sbjct  219   SVIDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVEDYDPDTGCIKWVNEFSAYHNQL  278

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAY  437
             LQ EL+ +R LHPH  IIYADYY A M ++RSP  +GF+   L+ACCGGGGPYN N    
Sbjct  279   LQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFKKAPLDACCGGGGPYNVNFSLP  338

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             CG  ++TVC  PS ++ WD  H TEAA + +  GLL GP+  P I   C
Sbjct  339   CGGPMATVCKDPSKFVFWDDAHPTEAATEIVARGLLEGPYAYPPILQAC  387



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score =   383 bits (984),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 245/362 (68%), Gaps = 5/362 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S  +N     A  PYGETFFHHPTGR+S+GR+IIDF+A  
Sbjct  32    FKSIISFGDSIADTGNLLGLSDPNNLPHF-AFPPYGETFFHHPTGRFSNGRVIIDFIAEF  90

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             + LP V P++G +   +  F KGVNFAVAGATA++ SF   RGI    TN+SLG +L  F
Sbjct  91    LDLPLVPPFYGSQ---NAYFEKGVNFAVAGATALERSFLEARGIHFPYTNISLGVQLSSF  147

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L+  C +PS CK+ +E+++ILMGEIGGNDYNYAF      EE+ + +P VIT I+S 
Sbjct  148   KASLTKLCGSPSDCKDMIENALILMGEIGGNDYNYAFFVKKSIEEIKALIPLVITTISSA  207

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG+ P+GCS  YL+ + TSN   YDP TGC+ WLN F E HN+ LQ
Sbjct  208   ITELIDMGGRTFLVPGDFPLGCSAIYLTSYQTSNMEAYDPLTGCLTWLNKFGENHNKQLQ  267

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              ELN L +L+PH  IIYADYYNA +R+Y+ P+ +GF N  L ACCG GGPYN      CG
Sbjct  268   AELNRLLKLYPHVNIIYADYYNALLRIYQEPSKFGFMNRPLSACCGVGGPYNFTSFWQCG  327

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKIPDS*  251
             + +   C  PS Y++WDG+H+TEAAY  I +G+L GP+  P  +  C+ S  K   P   
Sbjct  328   ADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAVPPFDWSCLSSEIKDNGPSEK  387

Query  250   RL  245
             R+
Sbjct  388   RI  389


 Score =   365 bits (937),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/370 (49%), Positives = 244/370 (66%), Gaps = 6/370 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             F+V +VS+       +K+I+SFGDS+ DTGN + +S  +N     A  PYGETFFHH TG
Sbjct  442   FVVTYVSS-ETKCREFKSIISFGDSVADTGNFLGLSDRNNLPHF-AFPPYGETFFHHATG  499

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R+S+GRLIIDF+A  + LP V P++G +   + +F KGVNFAVAGATA++ SF  ERGI 
Sbjct  500   RFSNGRLIIDFIAEFLSLPLVPPFYGSQ---NANFEKGVNFAVAGATALEHSFLEERGID  556

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
                TNVSL  +L  FK  L +FC +PS C + +E+++ILMGEIG NDY Y F  G   +E
Sbjct  557   FFNTNVSLAVQLSSFKASLPNFCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGKSLQE  616

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V   +P VIT I+S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EYDP TGC+
Sbjct  617   VKELIPLVITTISSAITELISMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEYDPLTGCL  676

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACC  476
              WLN F E H+  L+ ELN +++L+PH  IIY DYYNA +R Y+ P  +GF +  L ACC
Sbjct  677   TWLNKFGENHDAQLRAELNRIQKLYPHVNIIYVDYYNALLRFYQEPAKFGFMDRPLPACC  736

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGPYN      CG+ +   C  PS Y++WDG+H+TEAAY+ + +G+L GP+  P  + 
Sbjct  737   GVGGPYNYTSVTQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPLFDW  796

Query  295   ECILSRPKTK  266
              C+ S  K K
Sbjct  797   SCLSSEIKDK  806



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/388 (49%), Positives = 248/388 (64%), Gaps = 18/388 (5%)
 Frame = -1

Query  1411  MAFSQGTAITYYI----FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYV  1244
             MA SQ   I Y+I    FL+L  +T      CY +I  FGDSLTDTGNL+    + N   
Sbjct  1     MASSQ-PIIIYFIGCNFFLLLACATS-----CYTSIFGFGDSLTDTGNLVHFYPNGNKPH  54

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
             M    PYGET+FHHPTGR SDGRL+ID +A   GLP   P     +   R+   G NFAV
Sbjct  55    M-YFPPYGETYFHHPTGRCSDGRLLIDLIAQHYGLPLPPP-----SLDRRNAQNGTNFAV  108

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEI  884
              G+  MD  F+ + GI +  TNVS+ ++L+WFKQML   C   S CKE+LESS+ L+GE 
Sbjct  109   VGSRVMDAQFYEKMGIYDIVTNVSMWDQLNWFKQMLPHLCHNSSGCKEFLESSLFLLGEF  168

Query  883   GGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLS  704
             GGNDY +A L      +++  +P V   IAS  +EL++ GA+ +IVP  LP+GCS SYL+
Sbjct  169   GGNDYTHALLSHKTLNDILPIIPLVAQSIASGAHELVELGARTIIVPSVLPLGCSSSYLT  228

Query  703   YFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLY  524
              F + N  +YD + GC+ W N+   YHNELLQKEL+ LRELHPH  IIYADYYNA+M++Y
Sbjct  229   NFESLNEEDYD-ELGCLIWPNELASYHNELLQKELHRLRELHPHVNIIYADYYNASMKIY  287

Query  523   RSPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQW  347
             R+P  YGF ++ L ACCGGGGPYN N  A CG+  +T C+ P  Y++WDG H +EAAY+W
Sbjct  288   RAPRKYGFLKSVLVACCGGGGPYNFNVSAQCGTSQATSCEDPKQYVNWDGYHFSEAAYKW  347

Query  346   IVDGLLIGPFTSPKINGECILSRPKTKI  263
             I   LL G F+ P +   C+    + ++
Sbjct  348   ITKSLLEGLFSYPPMKNLCLFDVVEAQV  375



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score =   369 bits (948),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 244/369 (66%), Gaps = 11/369 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL+ F  T  VA     C  YK+I+SFGDS+ DTGN + +S   N    +A LPYGETFF
Sbjct  12    FLLFFFYTNIVASSEPSCRRYKSIISFGDSIADTGNYLHLS-DVNHPPQAAFLPYGETFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
               PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +GVNFAV GATA+D +FF 
Sbjct  71    SVPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGVNFAVYGATALDRAFFI  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQ  851
             E+GI++  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMGEIGGNDYNY F +
Sbjct  128   EKGIVSDFTNVSLSVQLNTFKQILPTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFE  187

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
                  E+    P +I  I+  I +LI  G +  +VPG+ P GCS +YL+ F T+   +YD
Sbjct  188   DKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPGGCSAAYLTLFQTAKEEDYD  247

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
             P TGC+ WLNDF ++H+E L+ E+  LR+ +PH  IIYADYYN+  RLY+ P  YGF+N 
Sbjct  248   PLTGCLPWLNDFGKHHDEQLKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNR  307

Query  490   -LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              L ACCG GG YN      CG +    C +PS YI+WDG HLTEAA+Q +  G+L GP+ 
Sbjct  308   PLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYA  367

Query  313   SPKINGECI  287
             +P  N  C+
Sbjct  368   APAFNWSCL  376



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score =   368 bits (944),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/381 (48%), Positives = 235/381 (62%), Gaps = 33/381 (9%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             T  ++ + L       H    CY++I+SFGDS+ DTGNL+ +S   N     A+ PYGET
Sbjct  12    TLTSFLLILFAVPIDSHRPRRCYESIISFGDSIADTGNLLILS-DPNHLPHFALPPYGET  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFH PTGR+SDGRLIIDF+                              VAGATA+D+S 
Sbjct  71    FFHFPTGRHSDGRLIIDFI------------------------------VAGATALDISC  100

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
                +G+ +  TNVSLG +L+ FK++L S C  PS C E+L  S+ILMGEIGGNDYNY F 
Sbjct  101   LKGKGVPSDITNVSLGVQLNIFKEILPSLCSPPSDCSEFLSRSLILMGEIGGNDYNYPFF  160

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G   +E+   VP VI VI+S I EL+  G +  +VPGN PIGCS +YL+ + T N  +Y
Sbjct  161   AGKNVDEIREMVPLVINVISSAIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENMEKY  220

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+ WLN+F E+HNE LQ ELN LR+L+PH  I+YADYYN  +RL++ P  +GF N
Sbjct  221   DPLTGCLKWLNEFAEHHNERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMN  280

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L  CCG GGPYN +P   CG  +   CD+PS Y++WDG HLTE AY+WI  GLL GP+
Sbjct  281   RPLSVCCGAGGPYNYSPSRLCGDGV-PYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPY  339

Query  316   TSPKINGECILSRPKTKIPDS  254
               P  N  C  S+ +   PD 
Sbjct  340   ADPAFNSYCFDSKLQNSSPDK  360



>ref|XP_009414900.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   368 bits (945),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 234/353 (66%), Gaps = 10/353 (3%)
 Frame = -1

Query  1342  VAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAV--LPYGETFFHHPTGRYSDGRLI  1169
              A GCY +I SFGDS+ DTGN I     ++  ++ +V  LPYG+T+F H TGR+SDGRLI
Sbjct  28    TAVGCYTSIFSFGDSIADTGNAI-----NSGIIVESVRHLPYGQTYFGHATGRFSDGRLI  82

Query  1168  IDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSL  989
             +DF+A +MGLP + PY  G    D  F  G NFA AGATA++ SFF ++G   S     L
Sbjct  83    VDFIAEAMGLPMLRPYLAGGNAED--FRYGANFAFAGATALNASFFEDKGFQFSPMEYFL  140

Query  988   GNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKV  809
             G +L+WFKQ+L   C + S  K+ L +S+IL+GEIGGNDYNYAF Q    +E+ ++VP V
Sbjct  141   GVQLEWFKQLLPILC-SESNSKDILSNSLILLGEIGGNDYNYAFAQKQSIQEIRTYVPSV  199

Query  808   ITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTE  629
             I  I   ++ LI+ GA  L+VPGN PIGC P+YLS + ++ A EYDPQTGCI+WLN+ +E
Sbjct  200   IDAIRQAVDVLIQLGATTLVVPGNFPIGCVPAYLSDYQSTVAEEYDPQTGCISWLNELSE  259

Query  628   YHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSN  449
             YHN +L  ELN LR+++PH  IIYADYY A + + RSP  +GF+  L ACCG  G YN N
Sbjct  260   YHNSMLLDELNQLRKVYPHATIIYADYYEAVLNILRSPQQFGFKTPLAACCGSDGLYNFN  319

Query  448   PHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                 CG+Q+S VC  PS  +SWDG+H T+AAY  I   LL G +  P     C
Sbjct  320   WSKMCGTQMSKVCSDPSDSLSWDGIHFTDAAYSTIALSLLDGTYAYPSFTEAC  372



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score =   378 bits (970),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 243/358 (68%), Gaps = 9/358 (3%)
 Frame = -1

Query  1345  HVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLII  1166
             H+    Y+ I    DSLTDTGNL  +S   +   +  + PYG+T FH P GR SDGRLI+
Sbjct  340   HLTEAAYRIIAQ--DSLTDTGNLYFISPRQSPDCL--LPPYGQTHFHRPNGRCSDGRLIL  395

Query  1165  DFMALSMGLPFVEPYFGGKTTGDR--SFAKGVNFAVAGATAMDMSFFTERGI-INSCTNV  995
             DF+A S+GLP+V+PY G K    +  +  +GVNFAVAGATA+D  FF E+G  ++   N 
Sbjct  396   DFLAESLGLPYVKPYLGFKNGAVKRGNIEQGVNFAVAGATALDRGFFEEKGFAVDVTANF  455

Query  994   SLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVP  815
             SLG +LDWFK++L S C + S CK+ + SS+ ++GEIGGNDY Y   +     ++++++P
Sbjct  456   SLGVQLDWFKELLPSLCNSSSSCKKVIGSSLFIVGEIGGNDYGYPLSETTAFGDLVTYIP  515

Query  814   KVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDF  635
             +VI+VI S I ELI  GA   +VPG+LP+GC+P+YL+ F T +  EYD Q GC+ WLN F
Sbjct  516   QVISVITSAIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKEEYD-QAGCLKWLNTF  574

Query  634   TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPY  458
              EYHNELLQ E+N LR L+P T IIYADY+NAA+  Y SP  +GF  N L+ CCGGGGPY
Sbjct  575   YEYHNELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPY  634

Query  457   NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECIL  284
             N N  A CG      CD PS Y+SWDG HLTEAAY+W+  GLL GP+T PK N  C +
Sbjct  635   NYNETAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCFI  692


 Score =   357 bits (917),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 241/367 (66%), Gaps = 12/367 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             F+V+F S   +A   YK+I SFGDS  DTGNL   S   + +      PYG+TFFH  TG
Sbjct  15    FVVVFSSATILAACPYKSIFSFGDSFADTGNLYFSSHPPSHHCFFP--PYGQTFFHRVTG  72

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R SDGRLIIDF+A S+GLP ++PY G K    ++   G NFAV GATA+D+SFF ERGI 
Sbjct  73    RCSDGRLIIDFIAESLGLPLLKPYLGMKK---KNVVGGANFAVIGATALDLSFFEERGI-  128

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
             +  T+ SL  +L+WFK++L S C + + C E + +S+ LMGEIGGND+NY   Q     E
Sbjct  129   SIPTHYSLTVQLNWFKELLPSLCNSSADCHEVVGNSLFLMGEIGGNDFNYLLFQQRSIAE  188

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V +FVP VI  I S +NELI  GA+ LIVPGN+P+GCS +YL+ + T + ++YD Q GC+
Sbjct  189   VKTFVPYVIKAITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQYD-QYGCL  247

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCG  473
              WLN F EY+N+ LQ EL+ L+ LH H  IIYADYYNA + LYR P  +GF N L+ CCG
Sbjct  248   KWLNKFAEYYNQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCG  306

Query  472   GGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGP----FTSPK  305
              GGPYN N  A CG      CD PS +I WDG+HLTEAAY+ I    L       F SP+
Sbjct  307   MGGPYNYNASADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQDSLTDTGNLYFISPR  366

Query  304   INGECIL  284
              + +C+L
Sbjct  367   QSPDCLL  373



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 245/370 (66%), Gaps = 6/370 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC-YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             I+   F+V+  S+  +   C Y +I SFGDS  DTGNL   S     +      PYGET+
Sbjct  19    ISIVAFVVIASSSAPLLAACPYTSIFSFGDSFADTGNLYLSSHPPTHHCFFP--PYGETY  76

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             FH  TGR SDGRLIIDF+A S+GLP V+PYFG K  G  S  +G NFAV GATA+D SFF
Sbjct  77    FHRVTGRCSDGRLIIDFIAESLGLPLVKPYFGIKKFGGWSVEEGANFAVIGATALDFSFF  136

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
              ERGI +  TN SL  +L+WFK++L + C + + C E + +S+ LMGEIGGND+NY F  
Sbjct  137   EERGI-SIPTNYSLTMQLNWFKELLPALCNSSTDCHEVVGNSLFLMGEIGGNDFNYPFFL  195

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
                  EV ++VP VI  I S +NELI  GA+ LIVPGNLP+GCS +YL+ + T + ++YD
Sbjct  196   QRSVAEVKTYVPYVIRAITSAVNELIGLGARTLIVPGNLPLGCSINYLTIYETMDKNQYD  255

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
              Q GC+ WLN+F EY+N+ LQ EL+ LR LH H  IIYADYYNA + LY +   +GF N 
Sbjct  256   -QYGCLKWLNEFAEYYNQKLQSELDRLRGLHSHANIIYADYYNATLPLYHNTTMFGFTN-  313

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L+ CCG GGPYN N  A CG   +  CD PS +I WD +H TEAAY+ I +GL+ GP+  
Sbjct  314   LKTCCGMGGPYNYNAAADCGDPGAIACDDPSKHIGWDSVHFTEAAYRIIAEGLIKGPYCL  373

Query  310   PKINGECILS  281
             P+ N  C+++
Sbjct  374   PQFNTFCLMN  383



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/388 (49%), Positives = 249/388 (64%), Gaps = 11/388 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVLF +T  +      C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSLKKLISSFL-LVLFSTTIILVSSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               +A LPYGE+FFH PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFA
Sbjct  59    PQTAFLPYGESFFHPPTGRASDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMG  890
             V GATA+D +F   +GI    TNVSL  +L+ FKQ+L + C + SR C+E LE S+ILMG
Sbjct  116   VYGATALDRAFLVGKGIETDFTNVSLSVQLNTFKQILPNLCASSSRDCREILEESLILMG  175

Query  889   EIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSY  710
             EIGGNDYNY F +G    E    VP +I  I+S I +LI  G +  +VPG  P GCS +Y
Sbjct  176   EIGGNDYNYPFFEGKSINETKELVPLIIKAISSAIVDLIDLGGKTFLVPGGFPAGCSAAY  235

Query  709   LSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMR  530
             L+ F T    E+DP TGCI WLN+F E+HNE L+ EL  L++L+PH  IIYADY+N+  R
Sbjct  236   LTLFQTVAEQEHDPLTGCIPWLNEFGEHHNEQLKTELKRLQKLYPHVNIIYADYHNSLYR  295

Query  529   LYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
              ++ P  YGF+N L ACCG GG YN      CG +    C +PS +++WDG HLTEA YQ
Sbjct  296   FFQEPAKYGFKNPLAACCGVGGQYNFTIDKECGYEGVGYCQNPSEHVNWDGYHLTEATYQ  355

Query  349   WIVDGLLIGPFTSPKINGECILSRPKTK  266
              +   LL GP+ +P  +  C+ S    K
Sbjct  356   KMAHSLLNGPYATPAFDWSCLDSDSVAK  383



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/369 (50%), Positives = 248/369 (67%), Gaps = 12/369 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
              L+L+ +T  VA     C  YK+I+SFGDS+ DTGN + +S  +N    +A LPYGE+FF
Sbjct  15    LLILYYTTIVVASSESRCRRYKSIISFGDSIADTGNYVHLSNVNNL-PQAAFLPYGESFF  73

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             H P+GRYSDGRL+IDF+A  +GLP+V PYFG +     SF +G+NFAV GATA+D +F  
Sbjct  74    HPPSGRYSDGRLVIDFIAEFLGLPYVPPYFGSQNV---SFNQGINFAVYGATALDRAFLV  130

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQ  851
             ++GI +  TN+SL  +L+ FKQ+L + C + +R C+E L  S+ILMGEIGGNDYNY F +
Sbjct  131   KQGIKSDFTNISLSVQLNTFKQILPNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFE  190

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
             G    E+   VP +I  I+S I +LI  G +  +VPGN PIGCS +YL+ F T+   E+D
Sbjct  191   GKSINEIKELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATV-EHD  249

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT  491
             P TGCI WLN F E+HNE L+ EL  L++L+PH  IIYADYYN+   L++ P  YGF+N 
Sbjct  250   PFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNR  309

Query  490   -LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              L ACCG GG YN      CG    + C +PS Y++WDG HLTEA YQ +  GLL G +T
Sbjct  310   PLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYT  369

Query  313   SPKINGECI  287
             +P  +  C+
Sbjct  370   TPAFDWSCL  378



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score =   365 bits (937),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 239/349 (68%), Gaps = 7/349 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             YK+I+SFGDS+ DTGN + +S  +N    +A LPYGE+FFH P+GRYSDGRL+IDF+A  
Sbjct  3     YKSIISFGDSIADTGNYVHLSNVNNL-PQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEF  61

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG +     SF +G+NFAV GATA+D +F  ++GI +  TN+SL  +L+ F
Sbjct  62    LGLPYVPPYFGSQNV---SFNQGINFAVYGATALDRAFLVKQGIKSDFTNISLSVQLNTF  118

Query  967   KQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             KQ+L + C + +R C+E L  S+ILMGEIGGNDYNY F +G    E+   VP +I  I+S
Sbjct  119   KQILPNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEIKELVPLIIKAISS  178

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  G +  +VPGN PIGCS +YL+ F T+   E+DP TGCI WLN F E+HNE L
Sbjct  179   AIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATV-EHDPFTGCIPWLNKFGEHHNEQL  237

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
             + EL  L++L+PH  IIYADYYN+   L++ P  YGF+N  L ACCG GG YN      C
Sbjct  238   KIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFTIGKEC  297

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
             G    + C +PS Y++WDG HLTEA YQ +  GLL G +T+P  +  C+
Sbjct  298   GENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPAFDWSCL  346



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score =   366 bits (939),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 246/377 (65%), Gaps = 7/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             I +++     V+       C  +K+I+SFGDS+ DTGN + +S  +N     A  PYGET
Sbjct  13    IIFFLLSTFLVTNVSSKTQCREFKSIISFGDSIADTGNFLGLSDPNNLPHF-AFPPYGET  71

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+S+GR+IIDF+A  + LP V P++G +   + +F KGVNFAV GATA++ SF
Sbjct  72    FFHHPTGRFSNGRVIIDFIAEFLSLPLVPPFYGSQ---NANFEKGVNFAVGGATALEHSF  128

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI    TNVSL  +L  FK+ L + C +PS C + +E+++ILMGEIG NDY Y F 
Sbjct  129   LEERGIDFFNTNVSLAVQLSSFKESLPNLCGSPSDCTDMMENALILMGEIGLNDYFYLFF  188

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G   +EV   +P VIT ++S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EY
Sbjct  189   VGKSIQEVKELIPLVITTVSSAITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEY  248

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLN F E H+  L+ ELN +++L+PH  IIYADYYNA +R Y+ P  +GF +
Sbjct  249   DPLTGCLTWLNKFGENHDSQLRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMD  308

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GGPYN    + CG+ +   C  PS Y++WDG+H+TEAAY+ + +G+L GP+
Sbjct  309   RPLCACCGVGGPYNYTSVSQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPY  368

Query  316   TSPKINGECILSRPKTK  266
               P  +  C+ S  K K
Sbjct  369   AVPPFDWSCLSSEIKDK  385



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score =   379 bits (972),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 190/377 (50%), Positives = 251/377 (67%), Gaps = 7/377 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  +I L   V+  +    C  +++I+SFGDS+ DT NL+ +S   N    SA  PYGE+
Sbjct  12    LVSFIILAFLVTNLNSQTQCKNFRSIISFGDSIADTENLLSLS-DPNDLPGSAFPPYGES  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             F +HPTGR+SDGRLIIDF+A  + LP V P++G +     SF KGVNFAVAGATA++ SF
Sbjct  71    FLNHPTGRFSDGRLIIDFIAEFLDLPLVPPFYGSQHA---SFEKGVNFAVAGATALEPSF  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
                RGI +S TN SLG +L  FK+ L     + S C + +E+++ILMGEIGGNDYN+A  
Sbjct  128   LERRGIHSSTTNFSLGVQLRSFKESLHCLRVSLSDCIDMIENALILMGEIGGNDYNFALF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             Q    EEV   VP+VI  I+S   EL++ G +  +VPGN P+GCS +YL+ + TSN  EY
Sbjct  188   QRKAIEEVKELVPRVIATISSATTELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLNDF +YH+E LQ ELN L+ L+P+  IIYADYYNA + LY+ P  +GF +
Sbjct  248   DPLTGCLTWLNDFGKYHSEQLQTELNRLKNLYPNVNIIYADYYNALLCLYQEPTKFGFIK  307

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN N    CGS     C+ PS Y++WDG+H+TEAAY+WI +GLL GP+
Sbjct  308   RPLPACCGLGGLYNFNFTRKCGSLGVESCNDPSKYVNWDGIHMTEAAYRWISEGLLNGPY  367

Query  316   TSPKINGECILSRPKTK  266
               P  N  C+ S+ K K
Sbjct  368   AIPPFNWSCLNSKIKKK  384


 Score =   375 bits (962),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 245/368 (67%), Gaps = 7/368 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             F+V +VS+       +K+I+SFGDSL DTGNL+ +S   N     A  PYGETFFHHPTG
Sbjct  428   FMVTYVSS-ETQCREFKSIISFGDSLADTGNLLGLS-DPNELPHVAFPPYGETFFHHPTG  485

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R+S+GRLIIDF+A  +GLP V P++G +     +F KGVNFAV GATA++ SF  ERGI 
Sbjct  486   RFSNGRLIIDFIAEFLGLPLVPPFYGSQKA---NFEKGVNFAVGGATALERSFLEERGIH  542

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
                TNVSLG +L  FK+ L + C +PS C++ +E+++ILMGEIGGNDYNYAF      EE
Sbjct  543   FPYTNVSLGVQLTSFKESLPNLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNKSTEE  602

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
                 VP VI  I+S I  LI  G +  +VPG  P GCS  YL+ +  SN  EYDP TGC+
Sbjct  603   TNELVPLVIRTISSAIT-LISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVDEYDPLTGCL  661

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACC  476
              WLN + E H E L+ ELN L++L+PH  IIYADYYNA +R+Y+ P  +GF +  L ACC
Sbjct  662   TWLNKYGENHGEQLRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMKRPLSACC  721

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGPYN      CG+ +   C+ PS Y++WDG+HLTEAAY+ + +G+L GP+  P  + 
Sbjct  722   GVGGPYNFTAGKKCGTDVVDSCNDPSKYVAWDGVHLTEAAYRLMAEGILNGPYAVPPFDW  781

Query  295   ECILSRPK  272
              C+ S  K
Sbjct  782   SCLSSEIK  789



>ref|XP_008439761.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=384

 Score =   365 bits (938),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 246/375 (66%), Gaps = 11/375 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             FL+ F+ +     GCY +I +FGDSL+DTGNL       N   +    PYGETFFH PTG
Sbjct  12    FLISFLPS---VFGCYTSIFNFGDSLSDTGNLYYTCSFPNPPNV-CFFPYGETFFHRPTG  67

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFG-GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI  1016
             R+SDGRL++DF+A+S+GLP V+PY G  K      F KG+NFAV GATA+D+SFF +RGI
Sbjct  68    RFSDGRLVLDFLAMSLGLPPVQPYQGVEKGITAEDFQKGLNFAVGGATALDLSFFEQRGI  127

Query  1015  INSCTNV-SLGNELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
              N    V SLGN+ + F Q  SS C  +P +CK+  +SS+ +MGEIGGNDYNY F  G  
Sbjct  128   PNLPPTVDSLGNQFNSFNQSYSSICTSSPPKCKDIFKSSLFIMGEIGGNDYNYLFFDGRN  187

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYF-MTSNASEYDPQ  665
              EE+ S V  V+  IAS I ELI+ G + L+VP NLPIGC P YL ++  TSN S++DPQ
Sbjct  188   IEELESLVLLVVNKIASVILELIELGVETLMVPSNLPIGCLPVYLEFYKTTSNESQFDPQ  247

Query  664   TGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLE  485
              GC+ WLN F+EYHN+ LQ++L  +R LHPH  +IY DY+NAAMR+Y +P ++G    L+
Sbjct  248   NGCLKWLNQFSEYHNQQLQEQLKRIRVLHPHVHLIYVDYFNAAMRIYNAPKDFGLVEPLQ  307

Query  484   ACC-GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
              CC    G Y   P   CG   + VCD PS Y SWDG+HLTEAAY+ +   ++ G FT P
Sbjct  308   VCCVDKNGSYYFPPP--CGGAGTIVCDDPSKYASWDGLHLTEAAYELMATSIINGEFTFP  365

Query  307   KINGECILSRPKTKI  263
             + +  C+     T++
Sbjct  366   QFSISCLQRNTSTQL  380



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score =   365 bits (938),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 249/388 (64%), Gaps = 11/388 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVL+ +T  V      C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSAKKLISSFL-LVLYSTTIIVVSSESRCRQFKSIISFGDSIADTGNYLHLS-DVNHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               +A LPYGE+FFH PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF  G+NFA
Sbjct  59    PQTAFLPYGESFFHPPTGRASDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEHGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMG  890
             V GATA+D +F   +GI    +NVSL  +L+ FKQ+L + C + SR C+E LE S+ILMG
Sbjct  116   VYGATALDRAFLVGKGIETDFSNVSLSVQLNTFKQILPNLCASSSRDCREMLEDSLILMG  175

Query  889   EIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSY  710
             EIGGNDYNY F +G    E+   VP +I  I+S I +L+  G +  +VPG  P GCS +Y
Sbjct  176   EIGGNDYNYPFFEGKSINEIKELVPLIIKAISSAIVDLVDLGGKTFLVPGGFPAGCSAAY  235

Query  709   LSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMR  530
             L+ F T    ++DP TGCI WLN+F E+HNE L+ EL  L++L+PH  IIYADY+N+  R
Sbjct  236   LTLFQTVAEQDHDPLTGCIPWLNEFGEHHNEQLKTELKRLQKLYPHVNIIYADYHNSLYR  295

Query  529   LYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
              ++ P  YGF+N L ACCG GG YN      CG +    C +PS +++WDG HLTEA YQ
Sbjct  296   FFQEPAKYGFKNPLAACCGVGGQYNFTIDKECGYEGVGYCQNPSEHVNWDGYHLTEATYQ  355

Query  349   WIVDGLLIGPFTSPKINGECILSRPKTK  266
              +   LL GP+ +P  +  C+ S    K
Sbjct  356   KMAQSLLNGPYATPAFDWSCLDSDSVAK  383



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score =   379 bits (973),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/373 (51%), Positives = 246/373 (66%), Gaps = 7/373 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  +I   LF++  +    C   ++I+SFGDS  DTGNL+ +S   N +   A+ PYGET
Sbjct  440   VVSFILSTLFLTMVNSEPECRNLRSIISFGDSTADTGNLLGLS-DPNDHPQVALPPYGET  498

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+S+GRLIIDF+A  +GLP V P++G +   + +F KGVNFAV GATA+  SF
Sbjct  499   FFHHPTGRFSNGRLIIDFIAEFLGLPLVPPFYGSQ---NANFEKGVNFAVGGATALKRSF  555

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI    TNVSLG +L  FK+ L   C +PS C++ +E+++ILMGEIGGNDYNYAF 
Sbjct  556   LEERGIHFPYTNVSLGVQLSSFKESLPKLCGSPSDCRDMIENALILMGEIGGNDYNYAFF  615

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                  EEV   VP VI  I+S I ELI  G +  +VPG  P+GCS  YL+ + T+N  EY
Sbjct  616   VEKSIEEVKELVPLVIRTISSAITELIGMGGKTFLVPGEFPMGCSVVYLTIYHTANMEEY  675

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             DP TGC+  LN F EYHNE LQ ELN L++L+P   IIYADYYN    +++ P  +GF N
Sbjct  676   DPLTGCLKLLNKFGEYHNEQLQVELNRLQKLYPRVNIIYADYYNVLSSIFQEPAKFGFIN  735

Query  493   T-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GGPYN      CG+ +   C  PS Y++WDG+HLTEAAY  I +G+L GP+
Sbjct  736   RPLSACCGFGGPYNDTVGKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPY  795

Query  316   TSPKINGECILSR  278
             T P  +  C+ SR
Sbjct  796   TIPPFDWSCLSSR  808


 Score =   372 bits (955),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 245/363 (67%), Gaps = 6/363 (2%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             F+V +VS+       +K+I+SFGDS++DTGN + +S  +N     A LPYGETFFHHPTG
Sbjct  20    FVVTYVSS-ETKCREFKSIISFGDSVSDTGNFLGLSDPNNLPHF-AFLPYGETFFHHPTG  77

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R+S+GRLIIDF+A  + LP V P++G +   + +F KGVNFAVAGATA++ SF  ERGI 
Sbjct  78    RFSNGRLIIDFIAEFLSLPLVPPFYGSQ---NANFEKGVNFAVAGATALEHSFLEERGID  134

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
                TNVSL  +L  FK+ L + C +PS C + +E+++ILMGEIG NDY Y F  G   +E
Sbjct  135   FFNTNVSLAVQLSSFKESLPNLCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGKSIQE  194

Query  832   VMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCI  653
             V   +P VIT ++S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EYDP TGC+
Sbjct  195   VKELIPLVITTVSSAITELIGMGGKTFLVPGEFPMGCLVAYLTLYQTSNKEEYDPLTGCL  254

Query  652   NWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACC  476
              WLN F E H+  L+ ELN L++L+PH  IIYADYYNA +R Y+ P  +GF +  L ACC
Sbjct  255   TWLNKFGENHDGQLRAELNRLQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLSACC  314

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKING  296
             G GGPYN      CG+ +   C  PS Y++WDG+H+TEAAY+ I DG+L GP+  P  + 
Sbjct  315   GVGGPYNYTSVTQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLISDGILKGPYAVPPFDW  374

Query  295   ECI  287
              C+
Sbjct  375   SCL  377



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 235/349 (67%), Gaps = 7/349 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             YK+I+SFGDS+ DTGN +R+S   N   + A LPYG++FFH P+GR SDGRLIIDF+A  
Sbjct  21    YKSIISFGDSIADTGNYLRLSDVKNLPPV-AFLPYGKSFFHPPSGRASDGRLIIDFIAEF  79

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYF  +     SF +G+NFAV GATA+D +F  ++GI +  TN+SL  +L+ F
Sbjct  80    LGLPYVPPYFRSQNV---SFNQGINFAVYGATALDHAFLVKQGIKSDFTNISLSVQLNTF  136

Query  967   KQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             KQ+L S C + S  CK  LE S+ILMGEIGGNDYNY F       E+   VP VI VI++
Sbjct  137   KQVLPSLCASSSHVCKVMLEDSLILMGEIGGNDYNYPFFGRKSINEIKKLVPLVIKVISA  196

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  G +  +VPGN PIGCS +YL+ F T+   E+DP TGCI WLN F E+HNE L
Sbjct  197   AIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTAKV-EHDPFTGCIPWLNKFAEHHNEQL  255

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYC  434
             + EL  L+ L+PH  IIYADYYN+  R ++ P  YGF N  L ACCG GG YN      C
Sbjct  256   KTELKRLQNLYPHVNIIYADYYNSLYRFFQEPAKYGFRNRPLAACCGVGGQYNFTIGKEC  315

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
             G +  + C +PS Y++WDG HLTEA Y+ +  GLL GP+TSP  +  C+
Sbjct  316   GDKRVSYCQNPSVYVNWDGYHLTEATYRKMAQGLLNGPYTSPAFDWSCL  364



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   365 bits (936),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 241/382 (63%), Gaps = 7/382 (2%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLI----RMSKSSNAYV  1244
             MA  +  +  + I +VL ++   +A  CY +I +FGDSL+D GN I    +M   ++   
Sbjct  1     MALLKTVSFCFAILVVLLLTPLQIASACYTSIYAFGDSLSDAGNYIHIYQQMFPGTHKLP  60

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
               A  PYGET+FHHPTGR SDGR IIDFMA   GLP + PY  G      +F  G+NFAV
Sbjct  61    RYASPPYGETYFHHPTGRTSDGRTIIDFMAEYYGLPLIPPYIRGVNQSSSNFGAGINFAV  120

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEI  884
              GA A+D+ F+ ER I  + +N+S+  +L WFK +L S C++ S C+E   SS+I+MG  
Sbjct  121   VGAPALDVGFYEERRIHFTTSNISMRTQLSWFKGVLPSLCRS-SSCRELFNSSLIVMGPF  179

Query  883   GGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLS  704
             GGNDY ++FLQG   EE  + VP VI  I+ +I ELI  G + ++VPG LP GC P  L+
Sbjct  180   GGNDYGHSFLQGRSLEETKTLVPLVINAISISIQELINLGVKNIMVPGMLPDGCLPISLT  239

Query  703   YFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLY  524
              F      +YD  TGC+ WLNDF++YHNELLQ EL  +R+ H +  ++YA+YY+A M+LY
Sbjct  240   MFKGYKKEDYDRITGCLIWLNDFSKYHNELLQAELTRIRQRHRNAVVMYANYYDALMQLY  299

Query  523   RSPNNYGF-ENTLEACCGGGG-PYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
              SP  YGF    L ACCG GG PYN +  A CG   S  C  PS YISWDG H TEAAY+
Sbjct  300   LSPEQYGFGGEPLTACCGAGGIPYNYDSDAVCGDPPSRACAQPSLYISWDGAHCTEAAYR  359

Query  349   WIVDGLLIGPFTSPKINGECIL  284
             +I   LL GP+T+P IN  C L
Sbjct  360   FITKSLLEGPYTAPHINSSCSL  381



>ref|XP_002457137.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
 gb|EES02257.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
Length=379

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 229/344 (67%), Gaps = 8/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  SN  V     PYG T+FH PTGR SDGRL++DF+A +
Sbjct  41    YTSMFSFGDSLTDTGNLLVSSPLSNHIV--GRYPYGMTYFHRPTGRCSDGRLVVDFLAQA  98

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY   +    +   +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  99    FGLPLLQPYLQSR---GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGW  155

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P +CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V   +  
Sbjct  156   FEQLKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAAAVTD  215

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLPIGCS +YL+     N+S+YD   GC+   NDF ++HN +L
Sbjct  216   ATERLIKAGATHLVVPGNLPIGCSSAYLTLHPGRNSSDYD-AAGCLKTYNDFAQHHNAVL  274

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q+ L  LR  +P  RI+YADYY AAM   ++P  +GF E  L  CCGGGGPYN NP A C
Sbjct  275   QQNLRALRVKYPQARIMYADYYGAAMSFAKNPKQFGFTEGPLRTCCGGGGPYNFNPKASC  334

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  335   GVRGSSVCTDPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  378



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score =   364 bits (935),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 252/375 (67%), Gaps = 7/375 (2%)
 Frame = -1

Query  1405  FSQGTAITYYIFLVLFVSTGHVAG-GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVL  1229
             F + T   + I ++  V +  V   G +K+I+SFGDS+TDTGNL+ +S + N    SA  
Sbjct  9     FKKLTRTFFLITMLTTVVSSQVKQCGKFKSIISFGDSITDTGNLLALSDADNP-PHSAFP  67

Query  1228  PYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATA  1049
             PYGETFFH PTGRYS+GRLIIDF+A  +GLP++ P+ G +   + SF KGVNFAVAGATA
Sbjct  68    PYGETFFHFPTGRYSNGRLIIDFIAEFLGLPYLPPFHGSQ---NASFGKGVNFAVAGATA  124

Query  1048  MDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDY  869
             ++ S    RGI    TNVSLG +   FK+ L + C + + C+E + ++++++GEIGGNDY
Sbjct  125   LEQSVLESRGIYYHYTNVSLGVQFKNFKESLPNICGSLADCREMIGNALLIVGEIGGNDY  184

Query  868   NYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTS  689
             NY FL G   EE+   VP VI+ ++S I +L+  G + ++VP + PIGC  ++L+ +  S
Sbjct  185   NYGFLVGKTVEELKELVPLVISSMSSVITDLVNMGGKTIMVPADFPIGCWSAFLTEYWIS  244

Query  688   NASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNN  509
             N  EYDP TGC+  LN+F EYHN+ LQ+E+N +++L+PH  I+YADYYNA +R++  P  
Sbjct  245   NKEEYDPLTGCLKSLNEFIEYHNKELQEEINRVQKLYPHVTILYADYYNALLRIFLEPAK  304

Query  508   YGFEN--TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDG  335
             +GF +   L ACCG G PYN N  ++CG++    C  PS Y+ WDG HLTE+AY+WI  G
Sbjct  305   FGFTSGRPLSACCGTGEPYNFNSMSWCGTKNVDSCIDPSKYVHWDGFHLTESAYRWIAMG  364

Query  334   LLIGPFTSPKINGEC  290
              L GP+T P  +  C
Sbjct  365   FLKGPYTIPAYDWSC  379



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 244/371 (66%), Gaps = 10/371 (3%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGC---YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFH  1205
             I +VL +++  +   C   + +I SFGDSL DTGNL    +  + +  S   PYGET+FH
Sbjct  14    ILVVLIIASPPLFTACRPSFSSIFSFGDSLADTGNLYFSYQQPSQHCFSP--PYGETYFH  71

Query  1204  HPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTG--DRSFAKGVNFAVAGATAMDMSFF  1031
             HP+ R SDGRLI+DF+  S+G+P V+PY G K  G  DRS  +GVNFAV GATA+D+SFF
Sbjct  72    HPSARCSDGRLILDFICESLGVPTVKPYLGIKNGGLEDRSANEGVNFAVIGATALDVSFF  131

Query  1030  TERGIINSCTNVSLGNELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
              ERGI N  TN SL  +L+WFK++L + C  + + C E LE+S+ L+GEIGGND+NY   
Sbjct  132   EERGIHNVETNYSLTVQLNWFKELLPALCNHSSTNCHEVLENSLFLVGEIGGNDFNYPLF  191

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
                   EV ++VP VI  I S INELI  GA+ LIVPGN P+GC+  YL+ +   + ++Y
Sbjct  192   IQKSISEVKTYVPHVINAITSAINELIYLGARTLIVPGNFPLGCNAIYLTKYEAKDKNQY  251

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             D   GC+ WLN F E++N+ LQ E++ LR +HP   IIYADYYNA + LY  P  YGF  
Sbjct  252   D-SAGCLKWLNAFAEFYNQKLQYEIHRLRGIHPDANIIYADYYNAVLPLYHYPTKYGFTG  310

Query  493   TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              L+ACCG GGPYN N    CG      C+ PS YI WDG+HLTEAAY+ I DGL+ GP+ 
Sbjct  311   -LKACCGIGGPYNYNTSKACGDPDVIACEDPSQYIGWDGIHLTEAAYKLIADGLINGPYC  369

Query  313   SPKINGECILS  281
              P+ +  C ++
Sbjct  370   VPQFSNLCFMN  380



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 249/388 (64%), Gaps = 11/388 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVL+ +T  V      C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSLRKLISSFV-LVLYSTTIIVVSSESHCRRFKSIISFGDSIADTGNYLHLS-DINHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               +A LPYGE+FFH PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFA
Sbjct  59    PQTAFLPYGESFFHPPTGRASDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPS-RCKEYLESSVILMG  890
             V GATA+D +F   +GI    TNVSL  +L+ FKQ+L + C + S  C+E LE S+ILMG
Sbjct  116   VYGATALDRAFLVGKGIETDFTNVSLSVQLNTFKQILPNLCASSSLDCREMLEDSLILMG  175

Query  889   EIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSY  710
             EIGGNDYNY F +G    E+   VP +I  I+S I +L+  G +  +VPG  P GCS +Y
Sbjct  176   EIGGNDYNYPFFEGKSINEIKELVPLIIKAISSAIVDLVDLGGKTFLVPGGFPAGCSAAY  235

Query  709   LSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMR  530
             L+ F T    ++DP TGCI WLN+F E+HNE L+ EL  L++L+PH  IIYADY+N+  R
Sbjct  236   LTLFQTVAEQDHDPLTGCIPWLNEFGEHHNEQLKTELKRLQKLYPHVNIIYADYHNSLYR  295

Query  529   LYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
              ++ P  YGF+N L ACCG GG YN      CG +    C +PS +++WDG HLTEA YQ
Sbjct  296   FFQEPAKYGFKNPLAACCGVGGQYNFTIDKECGYEGVGYCQNPSEHVNWDGYHLTEATYQ  355

Query  349   WIVDGLLIGPFTSPKINGECILSRPKTK  266
              +   LL GP+ +P  +  C+ S    K
Sbjct  356   KMAQSLLNGPYATPAFDWSCLDSDSVAK  383



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score =   363 bits (933),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/364 (49%), Positives = 235/364 (65%), Gaps = 9/364 (2%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGN-LIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             IF++L       A  CY +I+SFGDS+ DTGN L+ + + +      A  PYG T+F  P
Sbjct  28    IFILL---KSKPATSCYNSIISFGDSIADTGNYLVALGEKAGPV---AHPPYGNTYFRRP  81

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERG  1019
             TGR+SDGR+IIDF+A +MG+P V PY     T ++    GVNFAVAG TA+D  FF  +G
Sbjct  82    TGRFSDGRVIIDFIAQAMGMPPVPPYLA--RTSNQDLRNGVNFAVAGVTALDGEFFKAKG  139

Query  1018  IINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPK  839
             +  +    SLG ++ WFK++L SFC   S C+ +L  S++LMGEIGGNDYN  F Q    
Sbjct  140   MALTWPQYSLGTQIQWFKELLPSFCSYKSDCESFLSKSLVLMGEIGGNDYNQPFAQFRTL  199

Query  838   EEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTG  659
             +E+ ++VP VI +    IN LI+ GA+ L+VPG  P+GC  +YL+   +    +YDPQTG
Sbjct  200   DEIRTYVPSVINITGWAINSLIELGAKTLVVPGIFPLGCVSAYLTIHQSQRKEDYDPQTG  259

Query  658   CINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEAC  479
             CI  LN+F+EYHN LL+ E++ LR LHP+T IIYADYY AAM +YR P  YG +  L AC
Sbjct  260   CIKRLNEFSEYHNNLLKAEVDRLRGLHPYTTIIYADYYEAAMDIYRHPLKYGIDAPLAAC  319

Query  478   CGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             CGGGG YN N    CG+   TVC  PS ++ WDGMHLT+A Y+ I  GLL G + +  I 
Sbjct  320   CGGGGRYNFNLAVMCGAPGGTVCSDPSKHVCWDGMHLTDAVYKIIARGLLEGSYATAPIA  379

Query  298   GECI  287
               C+
Sbjct  380   QACL  383



>ref|XP_006844513.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
 gb|ERN06188.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
Length=387

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 228/346 (66%), Gaps = 7/346 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGN-LIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             Y A+ SFGDSL DTGN L+ ++  S+    +  LPYGETFFH PTGR+S+GRL++DF A 
Sbjct  26    YAALFSFGDSLADTGNTLLSLNGGSSP---TGRLPYGETFFHRPTGRFSNGRLVVDFFAQ  82

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             ++G+P + PY      GD  F+KGVNFAV GATA+D S+F  +G     TN SLG +L+W
Sbjct  83    ALGVPLLPPYLSTLDGGD-DFSKGVNFAVGGATALDSSYFISKGFEQHWTNYSLGVQLEW  141

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F Q+L S C+  S CKE+++ S+ L+GEIGGND N+AF QG   EEV +FVP +I  I  
Sbjct  142   FHQLLPSLCKPYSDCKEFMKKSMFLVGEIGGNDCNFAFFQGKSTEEVKAFVPSIINTIMK  201

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
               +E I  G + L++PGNLPIGCS +YL+ F T +  EYDP TGC+   NDF  Y+N  L
Sbjct  202   AASEFINEGVETLVIPGNLPIGCSTAYLTMFQTQDKQEYDPDTGCLKRFNDFAIYYNSKL  261

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYNSNPHAY  437
             Q  +  +R+  PH   IYADYYNAA+R ++SP  +G   E    ACCG G  YN N +  
Sbjct  262   QDAIQVMRQKFPHATTIYADYYNAALRFFKSPEAFGLAKETVHSACCGVGDRYNFNFNRM  321

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             CG+   T C  P+SYISWDGMHLTE AY++I   LL G FT P + 
Sbjct  322   CGTSGVTACSDPASYISWDGMHLTETAYKFITASLLSGEFTDPPLR  367



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score =   361 bits (927),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 242/367 (66%), Gaps = 7/367 (2%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGC-YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             + LV+  S   +   C Y +I SFGDSL DTGNL         + +    PYGETFFHH 
Sbjct  17    VALVIASSAPLLLAACPYTSIFSFGDSLADTGNLYFSPYPPTNHCLFP--PYGETFFHHV  74

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKG-VNFAVAGATAMDMSFFTER  1022
             TGR SDGRLIIDF+A S+G+P V+PY G K  G  S  +G  NFAV GATA+D SFF ER
Sbjct  75    TGRCSDGRLIIDFIAESLGIPRVKPYLGIKNIGRWSVEEGGANFAVIGATALDFSFFEER  134

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             G+    TN SL  +L+WFK++L + C + + C E L +S+ L+GEIGGND+N+ F     
Sbjct  135   GVPVK-TNYSLSAQLNWFKELLPTLCNSSTGCHEVLRNSLFLVGEIGGNDFNHPFSIRKS  193

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
               EV ++VP VI  I+S INELI  GA+ LIVPGN PIGCS SYL+ + T   ++YD Q 
Sbjct  194   IVEVKTYVPYVINAISSAINELIGLGARTLIVPGNFPIGCSASYLTIYETEYKNQYD-QF  252

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEA  482
             GC+ WLN F EY+N  LQ EL+ LR L+P   IIYADY+NAA+  YR P  +GF   L+ 
Sbjct  253   GCLKWLNKFAEYYNNELQSELDKLRRLYPRANIIYADYFNAALLFYRDPTKFGFTG-LKV  311

Query  481   CCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CCG GGPYN N  A CG+   + CD PS +I WD +HLTEAAY+ + +GL+ GP+  P+I
Sbjct  312   CCGMGGPYNYNTSADCGNPGVSACDDPSKHIGWDSVHLTEAAYRIVAEGLIKGPYCLPQI  371

Query  301   NGECILS  281
             N  C+++
Sbjct  372   NTLCLMN  378



>ref|NP_001149156.1| esterase precursor [Zea mays]
 gb|ACG34406.1| esterase precursor [Zea mays]
Length=370

 Score =   360 bits (925),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 228/344 (66%), Gaps = 8/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  SN  V     PYG T+FH PTGR SDGRL++DF+A +
Sbjct  32    YTSMFSFGDSLTDTGNLLVSSPLSNHIV--GRYPYGITYFHRPTGRCSDGRLVVDFLAQA  89

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY   +    +   +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  90    FGLPLLQPYLQSR---GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P  CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V   +  
Sbjct  147   FEQLKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAAAVTD  206

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLP+GCS +YL+     N S+YD   GC+   NDF ++HN +L
Sbjct  207   ATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYD-AAGCLRTYNDFAQHHNAVL  265

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  266   QRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNPKASC  325

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  326   GVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  369



>ref|XP_004134933.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
 ref|XP_004155633.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=397

 Score =   360 bits (925),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/378 (49%), Positives = 243/378 (64%), Gaps = 18/378 (5%)
 Frame = -1

Query  1372  FLVLFVST-----GHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             F++ FV+T      +V   C+ +I +FGDSL+DTGNL     S+N        PYG+TFF
Sbjct  13    FIIFFVATPFSPSTNVLANCFNSIFNFGDSLSDTGNLFINCNSNNPPNF-CFTPYGDTFF  71

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTT--GDRSFAKGVNFAVAGATAMDMSF  1034
             H PTGR+SDGRLIIDF+A S+G+P ++PY G +T       F KG+NFAV GATA++ S+
Sbjct  72    HRPTGRFSDGRLIIDFIAQSLGIPLLQPYLGVETQRMSIDEFEKGLNFAVGGATALNASY  131

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPS--RCKEYLESSVILMGEIGGNDYNYA  860
               E+  +   TN SL  +L+WF++  S  C + S  RC E L+ S+ ++GEIGGNDYNY 
Sbjct  132   LREKVFVEVPTNYSLSVQLEWFRKAYSLACPSSSSTRCTEILKKSLFVVGEIGGNDYNYP  191

Query  859   FLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNAS  680
             F + H  EE+ S VP V+  I STI ELI  GAQ L+VPGNLPIGCS  YL  + TS   
Sbjct  192   FFKQHSFEEIKSLVPLVVKSIGSTITELIHLGAQSLLVPGNLPIGCSSKYLQIYSTSIQ-  250

Query  679   EYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF  500
               D + GC++WLN F+EYHN+ LQ+ELN +R  HP+ +IIYADY+N+AM+ Y  P N+G 
Sbjct  251   --DSKNGCLDWLNQFSEYHNKYLQEELNRIRSRHPNVQIIYADYHNSAMQFYNHPENFGL  308

Query  499   ENTLEACCGGGGPYNSNPHAY-----CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDG  335
             +NTLEAC             Y       ++    CD PS Y+SWDG+HLTEAAY+ I  G
Sbjct  309   KNTLEACLVDRNETLKKDGKYGLGGKTKTKTKIECDDPSKYVSWDGVHLTEAAYRLIAMG  368

Query  334   LLIGPFTSPKINGECILS  281
             LL GP+T P+    CI+S
Sbjct  369   LLQGPYTHPQFTTSCIIS  386



>ref|XP_007148064.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
 gb|ESW20058.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
Length=380

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 236/347 (68%), Gaps = 7/347 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             + ++ SFGDSLTDTGNL  +S   +   +  + PYG+T+FH PTGR SDGRLI+DF+A S
Sbjct  25    FSSLFSFGDSLTDTGNLFFISSPQSPNCL--LPPYGQTYFHRPTGRCSDGRLILDFLADS  82

Query  1147  MGLPFVEPYFGGKTTGDR--SFAKGVNFAVAGATAMDMSFFTERGIINSCT-NVSLGNEL  977
             +GLP++EPY G K    +  +  +G+NFAVAGA+A+D  FF E+G     T N SL  +L
Sbjct  83    LGLPYLEPYLGFKNGALKQGNTEQGMNFAVAGASALDRGFFEEKGFTVDVTGNFSLKVQL  142

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
             DWFK++L S C + S CK  + +S+ ++GEIGGNDY Y   +     +++ ++P+V++VI
Sbjct  143   DWFKKLLPSLCNSSSGCKNLIGNSLFMVGEIGGNDYGYPLSKTTAFGDLVPYIPQVVSVI  202

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
              + I ELI  GA   +VPG LP+GC+ +YL+ F T++  EYD Q GC+ WLN F EYHNE
Sbjct  203   TAVIRELIDLGAVTFMVPGMLPLGCNSAYLTRFETTDKEEYD-QVGCLKWLNTFYEYHNE  261

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHA  440
             LLQ ELN LR L+ HT IIYADY+NAA++LY+SP  +GF  N L+ CCG  G YN N   
Sbjct  262   LLQIELNQLRGLYSHTNIIYADYFNAALQLYKSPEQFGFGGNVLKVCCGVDGSYNYNDTY  321

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
              CG      CD PS YISWDG H+TEAAY+WI   LL G +T PK N
Sbjct  322   KCGEAGVVACDDPSQYISWDGYHMTEAAYRWIAIALLDGSYTIPKFN  368



>ref|NP_174185.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31008.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   360 bits (923),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 189/380 (50%), Positives = 247/380 (65%), Gaps = 11/380 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVL+ +T  VA     C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSLEKLISSFL-LVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               SA LPYGE+FFH P+GRYSDGRLIIDF+A  +GLP+V  YFG +     SF +G+NFA
Sbjct  59    PQSAFLPYGESFFHPPSGRYSDGRLIIDFIAEFLGLPYVPSYFGSQNV---SFDQGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGE  887
             V GATA+D  F   +GI +  TNVSL  +L+ FKQ+L + C + S C+E L  S+ILMGE
Sbjct  116   VYGATALDRVFLVGKGIESDFTNVSLSVQLNIFKQILPNLCTSSSHCREMLGDSLILMGE  175

Query  886   IGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYL  707
             IG NDYNY F +G    E+   VP VI  I+S I +LI  G +  +VPGN P+GC P+YL
Sbjct  176   IGVNDYNYPFFEGKSINEIKQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYL  235

Query  706   SYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRL  527
             + F T+   ++DP TGCI  LN+F EYHNE L+ EL  L+EL+ H  IIYADYYN+  RL
Sbjct  236   TLFQTAAEEDHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFRL  295

Query  526   YRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
             Y+ P  YGF+N  L ACCG GG YN      CG +  + C +PS Y++WDG HLTEA +Q
Sbjct  296   YQEPVKYGFKNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQ  355

Query  349   WIVDGLLIGPFTSPKINGEC  290
              +   +L G + SP  +  C
Sbjct  356   KMAQVILNGTYASPAFDWSC  375



>ref|XP_004968625.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=374

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 228/344 (66%), Gaps = 8/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  SN  V     PYG T+FH PTGR SDGRL++DF+A +
Sbjct  36    YTSMFSFGDSLTDTGNLLVSSPLSNHIV--GRYPYGITYFHRPTGRCSDGRLVVDFLAQA  93

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP + PY   K    +   +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  94    FGLPLLPPYLQSK---GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGW  150

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P +CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V   +  
Sbjct  151   FEQLKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAGAVTD  210

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLP+GCS +YL+     N S+YD   GC+   NDF ++HN +L
Sbjct  211   ATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYD-AAGCLKTYNDFAQHHNAVL  269

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  270   QQKLQALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNPKASC  329

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEAAY  I + +L GP+TSP++
Sbjct  330   GVRGSSVCTDPSAYANWDGVHLTEAAYHAIANSILNGPYTSPRL  373



>ref|XP_007020872.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12397.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=344

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 224/322 (70%), Gaps = 4/322 (1%)
 Frame = -1

Query  1243  MSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
              SA  PYG TFFH PTGR+SDGRL+IDF+A    LPF+ PYFGG+     +F KGVN AV
Sbjct  11    QSAFPPYGRTFFHQPTGRFSDGRLVIDFIAEDFRLPFLPPYFGGENGRSNNFQKGVNLAV  70

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEI  884
             AGATA+D     ERGI N  TNV+LG EL +F+ +LSS C + S C++ L +S+I+MGEI
Sbjct  71    AGATALDDEILKERGITNPATNVTLGVELGFFRDVLSSLCSSSSDCRKLLSNSLIVMGEI  130

Query  883   GGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLS  704
             GGNDYN+AF +G   EE    VP VI  IAS I+ELI+ GA   +VPGNLP GC PS L+
Sbjct  131   GGNDYNFAFEEGKSNEETRELVPLVIDTIASAIHELIELGAVTFLVPGNLPFGCFPSCLT  190

Query  703   YFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLY  524
              F  S+  EYDP TGC+ WLN F+EYHN+LLQ+EL  ++E+HPH  I+YADYY+AA+R Y
Sbjct  191   NFEGSDEEEYDPLTGCLTWLNQFSEYHNQLLQEELARIQEIHPHVNIVYADYYSAAIRFY  250

Query  523   RSPNNYGF--ENTLEACCGGGGPYNSNPHAYCGSQLST-VCDSPSSYISWDGMHLTEAAY  353
              SP  +GF  E   +ACCGGGGPYN N  A CG  L T  CD PSSY+SWDG+H TEAA 
Sbjct  251   LSPKQFGFRKETLTKACCGGGGPYNFNLSAICGYPLVTSCCDDPSSYVSWDGIHYTEAAN  310

Query  352   QWIVDGLLIGPFTS-PKINGEC  290
             + +   +L G  T+ P  N  C
Sbjct  311   RLLSRAILDGLHTNFPISNSLC  332



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score =   359 bits (921),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 185/381 (49%), Positives = 241/381 (63%), Gaps = 10/381 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFL---VLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVM  1241
             MAFS    I+ ++F+    + V +   +   YK+I+SFGDS  DTGN + +S   N    
Sbjct  1     MAFSLKKLISTFLFIFSSTITVDSSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQ  59

Query  1240  SAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVA  1061
             +A  PYGETFFH PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV 
Sbjct  60    AAFPPYGETFFHAPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFKQGINFAVY  116

Query  1060  GATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR--CKEYLESSVILMGE  887
             GATA+D +   E+GI +  TNVSL  +L  FKQ+  S C + S   CKE L  S+ILMG+
Sbjct  117   GATALDCALLIEKGIGSDFTNVSLSVQLSIFKQIFPSLCASSSSHDCKEMLGDSLILMGD  176

Query  886   IGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYL  707
             IG NDY+Y F QG    EV   VP VI  I+S I +LI  G +  +VPG  P GC P+YL
Sbjct  177   IGANDYDYMFFQGKSINEVEELVPLVIKAISSVIVDLINLGGKTFLVPGTFPYGCFPAYL  236

Query  706   SYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRL  527
             + F T+   EYDP TGC++WLN+  + H+E L+ EL  LR+++PH  IIYADYYN+  R 
Sbjct  237   TLFQTAKEEEYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRF  296

Query  526   YRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQ  350
             ++ P  YGF E  L ACCG GG YN      CG Q    C +PS Y++WDG HLTEA +Q
Sbjct  297   FQEPAKYGFKERPLGACCGVGGQYNFTIGEECGGQGVGYCKNPSEYVNWDGYHLTEATHQ  356

Query  349   WIVDGLLIGPFTSPKINGECI  287
              +  GLL GP+ +P  +  C+
Sbjct  357   KMAHGLLNGPYATPAFDWSCL  377



>ref|NP_001149094.1| LOC100282715 precursor [Zea mays]
 gb|ACG34180.1| esterase precursor [Zea mays]
 gb|ACN34799.1| unknown [Zea mays]
 tpg|DAA58332.1| TPA: esterase [Zea mays]
Length=399

 Score =   359 bits (921),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 236/378 (62%), Gaps = 12/378 (3%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GCY  + +FGDSL DTGN   +  + +A +     PYGETFFH  TGR S+GRL++DF
Sbjct  33    AAGCYPRVFNFGDSLADTGNYPFVYGNDSAKLRP---PYGETFFHRATGRASNGRLVVDF  89

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A ++GLPFV PY  G++  D  FA G NFAV GATA+   FF  RG  N    V L  E
Sbjct  90    IADTLGLPFVRPYLSGRSAED--FAGGANFAVGGATALSPDFFRARGFHNMGNRVDLDME  147

Query  979   LDWFKQMLSSFCQ-TPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             + WF+ +L   C    + C + +  S+ L+GEIGGNDYN   L G P EE+ +  P V+ 
Sbjct  148   MKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNGPLLSGVPFEEIRAITPSVVA  207

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+STI+ELI+ GA+ L+VPGNLPIGC P YL  F ++   +YDPQTGC+ W+N+F++YH
Sbjct  208   KISSTISELIQLGAKTLVVPGNLPIGCVPKYLMIFKSNKKEDYDPQTGCLRWMNEFSQYH  267

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N+LL ++L  LR LHP   IIYADYY AAM ++ SP  YG E  L ACCG  GPY  +P 
Sbjct  268   NKLLVEQLKKLRRLHPGVTIIYADYYGAAMEIFLSPERYGIEYPLVACCGAEGPYGVSPT  327

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKI  263
               CG     +CD+P  Y SWDG+H TE+AY+ I  GLL+G +T P I      +   T  
Sbjct  328   TSCGLGEYKLCDNPERYGSWDGLHPTESAYKVIAMGLLLGSYTRPPI------ASTTTSC  381

Query  262   PDS*RLGLSAAQFEIIEL  209
             P    LG SA    + +L
Sbjct  382   PQLMELGSSAEYKRLYDL  399



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score =   358 bits (919),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/355 (51%), Positives = 237/355 (67%), Gaps = 23/355 (6%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   MSA  PYGETFFHHPTGR+SDG LIIDF+A  
Sbjct  36    FESIISFGDSIADTGNLLGLSDRNN-LPMSAFPPYGETFFHHPTGRFSDGHLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAVA ATA++ SF  ERG  +   N+SLG +L  F
Sbjct  95    LGLPYVPPYFGSK---NENFEKGVNFAVASATALESSFLEERGY-HCPHNISLGVQLKIF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS C++ + +++ILMGEIG NDYN+ F +  P +E               
Sbjct  151   KESLPNLCGLPSDCRDMIRNALILMGEIGANDYNFPFFESRPFDE---------------  195

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
               ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP TGC+ W N F EYH+E LQ
Sbjct  196   --ELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQ  253

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYCG  431
              EL  LR+L+PH  IIYADYYNA++ L + P  Y F N TL ACCG G PYN +    CG
Sbjct  254   VELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQSCG  313

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C++PS Y++WDG+H+TEAA++ + DGLL GP+ +P  N  C+ S+ K K
Sbjct  314   SVGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNK  368



>emb|CDM83549.1| unnamed protein product [Triticum aestivum]
Length=389

 Score =   358 bits (920),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 230/346 (66%), Gaps = 5/346 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY  + SFGDSL DTGNL+ +   +++Y  +  LPYGET+FH  TGR S+GRLIIDF+A 
Sbjct  24    CYPRVFSFGDSLADTGNLLYL-YGNDSYEAATRLPYGETYFHKATGRSSNGRLIIDFIAE  82

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN-SCTNVSLGNELD  974
             ++GLPFV PY  G++  D  F  G NFAV GATA+   FF E G+       V L  E+ 
Sbjct  83    ALGLPFVPPYMSGRSAED--FTGGANFAVGGATALSPDFFWENGVPAFRADTVHLDMEMA  140

Query  973   WFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
             WF+ +L   C    + C + +  S+ L+GEIGGNDYN     G P E++ +F P +I  I
Sbjct  141   WFRDLLGLLCPGGVADCMDMMSKSLFLVGEIGGNDYNLPLFYGVPFEKIHTFTPSIIAKI  200

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
             +STI EL++ GA+ L+VPGNLPIGC P+YL+ +M+    +Y+P+TGCI W+N+F++YHN+
Sbjct  201   SSTIAELVELGAKTLLVPGNLPIGCIPAYLTTYMSDKMEDYEPETGCIRWMNEFSQYHNK  260

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAY  437
             LL  EL +LR+LHP   IIYADYY AAM ++ SP  +G E+ L ACCGGGGPY  +  A 
Sbjct  261   LLVDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSATAG  320

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             CG     VCD P  Y SWDG H TEA Y+ I +GLL G +T P I+
Sbjct  321   CGHGDYKVCDDPQEYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  366



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score =   358 bits (919),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 186/355 (52%), Positives = 233/355 (66%), Gaps = 21/355 (6%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +++I+SFGDS+ DTGNL+ +S  +N   ++   PYGETFFHHPTGR SDGRLIIDF+A  
Sbjct  36    FQSIISFGDSIADTGNLLGLSDRNN-LSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAV  ATA++ SF  ERG  +   N+SLG ++  F
Sbjct  95    LGLPYVTPYFGSK---NGNFQKGVNFAVGSATALEASFLEERGY-HCSHNISLGVQVKVF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS              EIGGNDYN  F +     EV   VP VI+ I+S 
Sbjct  151   KESLPNLCGLPS--------------EIGGNDYNGPFFERRLINEVKELVPLVISTISSA  196

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP  GC+ WLN F EYH+E LQ
Sbjct  197   ITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIEEYDP-FGCLKWLNKFGEYHDEQLQ  255

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCG  431
              EL  LR+L+PH  IIYADYYNA +RL + P  YGF N  L ACCG G PYN N    CG
Sbjct  256   AELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPLSACCGVGEPYNFNFSTCCG  315

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
             S     C+ PS Y++WDG+H+TEAAY++I DGLL GP+TSP  N  C+ S+ K K
Sbjct  316   SFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCLTSKIKNK  370



>gb|AFW80395.1| esterase [Zea mays]
Length=367

 Score =   357 bits (917),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 227/344 (66%), Gaps = 8/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  SN  V     PYG T+FH  TGR SDGRL++DF+A +
Sbjct  29    YTSMFSFGDSLTDTGNLLVSSPLSNHIV--GRYPYGITYFHRSTGRCSDGRLVVDFLAQA  86

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY   +    +   +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  87    FGLPLLQPYLQSR---GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGW  143

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P  CKEY   S+ L+GEIGGNDYNYAF +G   ++  ++VP V   +  
Sbjct  144   FEQLKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGKTLDDAKTYVPTVAAAVTD  203

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLP+GCS +YL+     N S+YD   GC+   NDF ++HN +L
Sbjct  204   ATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGSDYD-AAGCLRTYNDFAQHHNAVL  262

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q++L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  263   QRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNPKASC  322

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  323   GVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  366



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score =   358 bits (918),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 186/382 (49%), Positives = 248/382 (65%), Gaps = 12/382 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVL+ +T  VA     C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSLKKLISSFL-LVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               SA LPYGE+FFH P+GR S+GRLIIDF+A  +GLP+V PYFG +     SF +G+NFA
Sbjct  59    PQSAFLPYGESFFHPPSGRASNGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMG  890
             V GATA+D +F   +GI +  TNVSL  +LD FKQ+L + C + +R CKE L  S+ILMG
Sbjct  116   VYGATALDRAFLLGKGIESDFTNVSLSVQLDTFKQILPNLCASSTRDCKEMLGDSLILMG  175

Query  889   EIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSY  710
             EIGGNDYNY F +G    E+   VP ++  I+S I +LI  G +  +VPG  P GCS +Y
Sbjct  176   EIGGNDYNYPFFEGKSINEIKELVPLIVKAISSAIVDLIDLGGKTFLVPGGFPTGCSAAY  235

Query  709   LSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMR  530
             L+ F T    + DP TGC   LN+F E+HNE L+ EL  L++ +PH  IIYADY+N+  R
Sbjct  236   LTLFQTVAEKDQDPLTGCYPLLNEFGEHHNEQLKTELKRLQKFYPHVNIIYADYHNSLYR  295

Query  529   LYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAY  353
              Y+ P  YGF+N  L ACCG GG YN      CG +    C +PS Y++WDG HLTEAAY
Sbjct  296   FYQEPAKYGFKNKPLAACCGVGGKYNFTIGKECGYEGVNYCQNPSEYVNWDGYHLTEAAY  355

Query  352   QWIVDGLLIGPFTSPKINGECI  287
             Q + +G+L GP+ +P  +  C+
Sbjct  356   QKMTEGILNGPYATPAFDWSCL  377



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score =   357 bits (917),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 229/344 (67%), Gaps = 9/344 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  S  + +    PYG T+FH PTGR SDGRL++DF+A +
Sbjct  37    YTSMFSFGDSLTDTGNLVVSSPLS--FSIVGKYPYGMTYFHRPTGRCSDGRLVVDFLAQA  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY     +      +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  95    FGLPLLQPYL----SRGEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGW  150

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V   +A 
Sbjct  151   FEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVAD  210

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLPIGCS +YL+   +SN S+YD  TGC+   NDF ++HN +L
Sbjct  211   ATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHHNAVL  269

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             Q +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  270   QDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASC  329

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  330   GVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>sp|P0C8Z7.1|GDL91_ARATH RecName: Full=GDSL esterase/lipase At1g28640; AltName: Full=Extracellular 
lipase At1g28640; Flags: Precursor [Arabidopsis 
thaliana]
Length=390

 Score =   358 bits (918),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 190/381 (50%), Positives = 248/381 (65%), Gaps = 12/381 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVL+ +T  VA     C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSLEKLISSFL-LVLYSTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               SA LPYGE+FFH P+GRYSDGRLIIDF+A  +GLP+V  YFG +     SF +G+NFA
Sbjct  59    PQSAFLPYGESFFHPPSGRYSDGRLIIDFIAEFLGLPYVPSYFGSQNV---SFDQGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMG  890
             V GATA+D  F   +GI +  TNVSL  +L+ FKQ+L + C + SR C+E L  S+ILMG
Sbjct  116   VYGATALDRVFLVGKGIESDFTNVSLSVQLNIFKQILPNLCTSSSRDCREMLGDSLILMG  175

Query  889   EIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSY  710
             EIG NDYNY F +G    E+   VP VI  I+S I +LI  G +  +VPGN P+GC P+Y
Sbjct  176   EIGVNDYNYPFFEGKSINEIKQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAY  235

Query  709   LSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMR  530
             L+ F T+   ++DP TGCI  LN+F EYHNE L+ EL  L+EL+ H  IIYADYYN+  R
Sbjct  236   LTLFQTAAEEDHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFR  295

Query  529   LYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAY  353
             LY+ P  YGF+N  L ACCG GG YN      CG +  + C +PS Y++WDG HLTEA +
Sbjct  296   LYQEPVKYGFKNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATH  355

Query  352   QWIVDGLLIGPFTSPKINGEC  290
             Q +   +L G + SP  +  C
Sbjct  356   QKMAQVILNGTYASPAFDWSC  376



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 229/344 (67%), Gaps = 9/344 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  S  + +    PYG T+FH PTGR SDGRL++DF+A +
Sbjct  41    YTSMFSFGDSLTDTGNLVVSSPLS--FSIVGKYPYGMTYFHRPTGRCSDGRLVVDFLAQA  98

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY     +      +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  99    FGLPLLQPYL----SRGEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGW  154

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V   +A 
Sbjct  155   FEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVAD  214

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLPIGCS +YL+   +SN S+YD  TGC+   NDF ++HN +L
Sbjct  215   ATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHHNAVL  273

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             Q +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  274   QDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASC  333

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  334   GVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  377



>ref|XP_003565548.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=373

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/352 (50%), Positives = 233/352 (66%), Gaps = 8/352 (2%)
 Frame = -1

Query  1351  TGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRL  1172
              G  AG  Y ++ SFGDSLTDTGNL+  S  S  + +    PYG T+FH PTGR SDGRL
Sbjct  27    AGGGAGQNYTSMFSFGDSLTDTGNLLVSSPLS--FTIVGRFPYGMTYFHRPTGRCSDGRL  84

Query  1171  IIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNV  995
             ++DF+A + GLP ++PY   K    +   +GVNFAV GATAM   FF   G  +   TN+
Sbjct  85    VVDFLAQAFGLPLLQPYLQSK---GKDLRQGVNFAVGGATAMGPPFFEGIGASDKLWTNL  141

Query  994   SLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVP  815
             SL  +LDWF+++  S C +P  CKEY   S+ L+GEIGGNDYNYAF +G   ++  S+VP
Sbjct  142   SLSVQLDWFEKLKPSLCNSPKNCKEYFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVP  201

Query  814   KVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDF  635
              V T I      LIK GA  L+VPGNLP+GCS +YL+     N+S+YD   GC+   N+F
Sbjct  202   TVATAIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGKNSSDYD-SVGCLKTYNEF  260

Query  634   TEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPY  458
              + HN ++Q++L  LR  +P  RI+YADYY AAM   ++P  +GF++  L+ CCGGGGPY
Sbjct  261   AQRHNAMVQQKLQGLRRKYPQARIMYADYYGAAMSFAKNPKQFGFKHGPLKTCCGGGGPY  320

Query  457   NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             N NP   CG + S+VC+ PS+Y +WDG+HLTEAAY  I D +L GP+TSP++
Sbjct  321   NFNPKTSCGVRGSSVCEDPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  372



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 229/344 (67%), Gaps = 9/344 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  S  + +    PYG T+FH PTGR SDGRL++DF+A +
Sbjct  37    YTSMFSFGDSLTDTGNLVVSSPLS--FSIVGKYPYGMTYFHRPTGRCSDGRLVVDFLAQA  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY     +      +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  95    FGLPLLQPYL----SRGEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGW  150

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V   +A 
Sbjct  151   FEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVAD  210

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+VPGNLPIGCS +YL+   +SN S+YD  TGC+   NDF ++HN +L
Sbjct  211   ATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRSDYD-STGCLKTYNDFAQHHNAVL  269

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             Q +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  270   QDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASC  329

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  330   GVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/377 (47%), Positives = 245/377 (65%), Gaps = 10/377 (3%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             I +++     V+       C  +K+I+SFGDS+ DTGN + +S  +N     A  PYGET
Sbjct  13    IIFFLLSTFLVTNVSSKTQCREFKSIISFGDSIADTGNFLGLSDPNNLPHF-AFPPYGET  71

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+S+GR+IIDF+A  + LP V P++G +   + +F KGVNFAV GATA++ SF
Sbjct  72    FFHHPTGRFSNGRVIIDFIAEFLSLPLVPPFYGSQ---NANFEKGVNFAVGGATALEHSF  128

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI    TNVSL  +L  FK+ L + C +PS   + +E+++ILMGEIG NDY Y F 
Sbjct  129   LEERGIDFFNTNVSLAVQLSSFKESLPNLCGSPS---DMMENALILMGEIGLNDYFYLFF  185

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G   +EV   +P VIT ++S I ELI  G +  +VPG  P+GC  +YL+ + TSN  EY
Sbjct  186   VGKSIQEVKELIPLVITTVSSAITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIEEY  245

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLN F E H+  L+ ELN +++L+PH  IIYADYYNA +R Y+ P  +GF +
Sbjct  246   DPLTGCLTWLNKFGENHDSQLRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMD  305

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GGPYN    + CG+ +   C  PS Y++WDG+H+TEAAY+ + +G+L GP+
Sbjct  306   RPLCACCGVGGPYNYTSVSQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPY  365

Query  316   TSPKINGECILSRPKTK  266
               P  +  C+ S  K K
Sbjct  366   AVPPFDWSCLSSEIKDK  382



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score =   357 bits (915),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/370 (50%), Positives = 236/370 (64%), Gaps = 12/370 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG-----CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL++F ST  V         YK+I+SFGDS  DTGN + +S   N    +A  PYGETFF
Sbjct  12    FLLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             H PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV GATA+D +   
Sbjct  71    HTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFKQGINFAVYGATALDCALLI  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAFL  854
             E+GI +  TNVSL  +L+ FKQ L S C + S   CKE L  S+ILMG+IG NDY+Y F 
Sbjct  128   EKGIGSDFTNVSLSVQLNIFKQTLPSLCASSSSHDCKEMLGDSLILMGDIGANDYDYMFF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             QG    EV   VP VI  I+S I +LI  G +  +VPG  P GC P+YL+ F T+   EY
Sbjct  188   QGKSINEVEELVPLVIKAISSAIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEEEY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC++WLN+  + H+E L+ EL  LR+++PH  IIYADYYN+  R ++ P  YGF E
Sbjct  248   DPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGFKE  307

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN      CG Q    C +PS Y++WDG HLTEA +Q +  GLL GP+
Sbjct  308   RPLGACCGVGGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNGPY  367

Query  316   TSPKINGECI  287
              SP  +  C+
Sbjct  368   ASPAFDWSCL  377



>ref|XP_010925696.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   356 bits (913),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 233/348 (67%), Gaps = 14/348 (4%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y +I SFGDSL DTGN +  SKS+  +     LPYG T+F HPTGR SDGRLI+DF+A +
Sbjct  35    YTSIFSFGDSLADTGNALIHSKSNPVF---GRLPYGMTYFMHPTGRCSDGRLIVDFLASA  91

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINS----CTNVSLGNE  980
              GLPF+ PY        ++  +GVNFAV GATA+D +FF  +G++       TN+SL  +
Sbjct  92    FGLPFLPPYLAH----GQNIRQGVNFAVVGATALDPAFF--QGLLADGAFPFTNLSLSTQ  145

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPK-EEVMSFVPKVIT  803
             L WF+++  S C T + C  Y   S+ L+GEIGGNDYNY FL G    EEV S+VPKV+ 
Sbjct  146   LRWFEELKPSLCNTTTACAGYFSKSLFLVGEIGGNDYNYFFLLGGKSLEEVKSYVPKVVG  205

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I +    LIK GA  L+VPGNLP GCS  YL+ F + N  EYDP TGC+ WLN F +YH
Sbjct  206   AIVAASERLIKNGAVNLLVPGNLPFGCSSVYLTVFNSPNKEEYDPTTGCLKWLNAFAKYH  265

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             + LL++ L+ LR  +P  RI+YADYY A++++ RSP  +GF++ L ACCGG GPYN +P 
Sbjct  266   DALLRRALDELRRKYPRARIMYADYYGASIQIGRSPQRFGFDDVLIACCGGDGPYNFSPL  325

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             A+CG   S+VC   SS  +WDG+HLTEAAY +I   LL GP+TSP + 
Sbjct  326   AFCGQPGSSVCSCLSSRANWDGLHLTEAAYHFIATSLLDGPYTSPPLR  373



>ref|NP_001130974.1| uncharacterized protein LOC100192079 [Zea mays]
 gb|ACF79385.1| unknown [Zea mays]
 gb|ACN29020.1| unknown [Zea mays]
 tpg|DAA58329.1| TPA: hypothetical protein ZEAMMB73_195608 [Zea mays]
Length=403

 Score =   357 bits (915),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 231/359 (64%), Gaps = 4/359 (1%)
 Frame = -1

Query  1369  LVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLP-YGETFFHHPTG  1193
             +VL +     A GCY  + SFGDSL DTGN   +  + +    +A+ P YGETFFH  TG
Sbjct  23    VVLILGAVAPAAGCYPRVFSFGDSLADTGNYPFVYGNDSGSGGAALRPPYGETFFHRATG  82

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R S+GRL++DF+A ++GLPFV PY  G++  D  FA G NFAV GATA+   FF  RG  
Sbjct  83    RASNGRLVVDFIADTLGLPFVRPYLSGRSAED--FASGANFAVGGATALSPDFFRARGFD  140

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQ-TPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKE  836
                  V L  E+ WF+ +L   C    + C + +  S+ L+GEIGGNDYN   L G P E
Sbjct  141   TMGNKVDLDMEMKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNGPLLSGVPME  200

Query  835   EVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGC  656
             ++ +  P V+  I+STI+ELI+ GA+ L+VPGNLPIGC P YL  F ++   +Y+PQTGC
Sbjct  201   KIRAITPSVVAKISSTISELIRLGAKTLVVPGNLPIGCIPDYLMIFKSNKEEDYEPQTGC  260

Query  655   INWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACC  476
             + W+N+F++YHN++L ++L  LR+LHP   IIYADYY AAM ++ SP  YG E  L ACC
Sbjct  261   LRWMNEFSQYHNKVLVEQLKKLRKLHPGATIIYADYYGAAMEIFLSPEQYGIEYPLVACC  320

Query  475   GGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             GG GPY  +P   CG     +CD+P  Y SWDG H +E+AY+ I  GLL+G +T P I 
Sbjct  321   GGEGPYGVSPSTGCGFGEYKLCDNPEKYGSWDGFHPSESAYRAIAMGLLLGSYTRPSIT  379



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score =   356 bits (914),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 182/372 (49%), Positives = 244/372 (66%), Gaps = 10/372 (3%)
 Frame = -1

Query  1393  TAITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYG  1220
             + +T  + LV+ VS       C  Y +I SFGDS+ DTGNL   S+  + +      PYG
Sbjct  21    STVTLQLLLVITVSAPLFTAACSSYSSIFSFGDSIADTGNLYLSSQPPSDHCFFP--PYG  78

Query  1219  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGK--TTGDRSFAKGVNFAVAGATAM  1046
             +T+FHHP+GR SDGRLIIDF+A S+G+P V+PY G K     D S  +G NFAV GATA+
Sbjct  79    QTYFHHPSGRCSDGRLIIDFIAESLGIPMVKPYLGIKNGVLEDNSAKEGANFAVIGATAL  138

Query  1045  DMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYN  866
             D+SFF ERG+  S TN SL  +L+WFK++L S C +   C E   +S+ LMGEIGGND+N
Sbjct  139   DVSFFEERGVGFS-TNYSLTVQLNWFKELLPSLCNSSKNCHEVFANSLFLMGEIGGNDFN  197

Query  865   YAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSN  686
             Y         E+ ++VP VI+ I S INELI  GA+ L++PGN P+GC+  YL+ + T++
Sbjct  198   YPLFIRRSIVEIKTYVPHVISAITSAINELIDLGARTLMIPGNFPLGCNVIYLTKYETTD  257

Query  685   ASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNY  506
              S+YD   GC+ WLN+F E++N+ LQ EL+ LR +HPH  IIYADYYNA + LY++P  +
Sbjct  258   KSQYD-SAGCLKWLNEFAEFYNQELQYELHRLRRIHPHATIIYADYYNALLPLYQNPTKF  316

Query  505   GFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLI  326
             GF   L+ CCG GG YN    + CG      CD PS YI WDG+HLTEAAY+ I DG++ 
Sbjct  317   GFTG-LKNCCGMGGSYNFGSGS-CGKPGVFACDDPSQYIGWDGVHLTEAAYRLIADGIIN  374

Query  325   GPFTSPKINGEC  290
             GP + P+ +  C
Sbjct  375   GPCSVPQFSNLC  386



>ref|XP_008777733.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Phoenix dactylifera]
Length=375

 Score =   355 bits (910),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 229/347 (66%), Gaps = 4/347 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+ +I SFGDSL DTGN +  + ++ + V    LPYGET+FH PTGR+SDGR+ +DF+A 
Sbjct  31    CFNSIFSFGDSLADTGNFLSYAGANASNV--GRLPYGETYFHRPTGRFSDGRITLDFIAQ  88

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +GL            G+  F +G NFAV GATA+   FF  +G+  + T  SLG +++W
Sbjct  89    RLGL--PLLPPYLAGPGEHDFGQGANFAVGGATALANDFFRAKGLNVTWTEYSLGIQIEW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C   S C ++L +++ LMGEIGGNDYN  F+QG   EE+ ++VP VI+ I+S
Sbjct  147   FKQLLPSLCSLDSGCHDFLNNTLFLMGEIGGNDYNDPFIQGRTVEEITTYVPSVISAISS  206

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
             +I  LI  GA+ L+VPGN PIGC P YL+ F  S+  +YDPQTGCINWLN F+EYHN LL
Sbjct  207   SIKVLIDLGAKTLVVPGNFPIGCVPLYLALFQNSSKGDYDPQTGCINWLNKFSEYHNRLL  266

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
               ELN LR+LHP   IIYA+YY A + + RSP  YG E T  ACCG  GP N      CG
Sbjct  267   MDELNKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVTSPVLCG  326

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                +TVC  PS YISWDG+HLTEAAY  I  GLL GP+ +P I   C
Sbjct  327   DPAATVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYATPPIARAC  373



>gb|EMT22154.1| GDSL esterase/lipase [Aegilops tauschii]
Length=387

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/349 (49%), Positives = 230/349 (66%), Gaps = 8/349 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY  + SFGDSL DTGNL+ +   +++Y  +  LPYGET+FH  TGR S+GRLI+DF+A 
Sbjct  19    CYPRVFSFGDSLADTGNLLYL-YGNDSYEAATRLPYGETYFHRATGRSSNGRLIVDFIAE  77

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIIN-SCTNVSLGNELD  974
             ++GLPFV PY  G++  D  FA G NFAV GATA+   FF E G+       V L  E++
Sbjct  78    ALGLPFVPPYLSGRSAED--FAGGANFAVGGATALSPDFFWENGVPAFRADTVHLDMEIE  135

Query  973   WFKQMLSSFC----QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
             WF+ +L   C         C + +  S+ L+GEIGGNDYN     G P E++ +F P +I
Sbjct  136   WFRDLLDLLCPGDVADEIDCMDMMSKSLFLVGEIGGNDYNLPLFYGVPFEKIRTFTPSII  195

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               I+STI EL++ GA+ L+VPGNLPIGC P+YL+ + +    +Y+P+TGCI W+N+F++Y
Sbjct  196   AKISSTIAELVELGAKTLLVPGNLPIGCIPAYLTTYKSDMMEDYEPETGCIRWMNEFSQY  255

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  446
             HN+LL  EL +LR+LHP   IIYADYY AAM ++ SP  +G E+ L ACCGGGGPY  + 
Sbjct  256   HNKLLVDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSA  315

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
              A CG     VC+ P  Y SWDG H TEA Y+ I +GLL G +T P I+
Sbjct  316   SAGCGHGDYKVCNDPQKYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  364



>ref|XP_002456052.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
 gb|EES01172.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
Length=399

 Score =   354 bits (909),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/347 (50%), Positives = 225/347 (65%), Gaps = 4/347 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GCY  + SFGDSL DTGN +     +N+       PYGETFFH  TGR S+GRL++DF
Sbjct  31    AAGCYPRVFSFGDSLADTGNCL-FVYGNNSGQAGLRPPYGETFFHRATGRASNGRLVVDF  89

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A ++GLPFV PY  G +  D  FA G NFAV GATA+       RG  N    V L  E
Sbjct  90    IADALGLPFVRPYLSGGSAED--FACGANFAVGGATALSPEEIRARGFDNMGNQVGLDME  147

Query  979   LDWFKQMLSSFCQ-TPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             ++WF+ +L   C    + C + +  S+ L+GEIGGNDYN+  L G P E++ +  P V+ 
Sbjct  148   MEWFRDLLHLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNFPLLSGVPLEKIRTMTPSVVA  207

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+STI+ELI+ GA+ L+VPGNLPIGC P YL  F +    +Y+PQTGC+ W+N+F++YH
Sbjct  208   KISSTISELIQLGAKTLMVPGNLPIGCVPDYLMIFKSDKEEDYEPQTGCLRWMNEFSQYH  267

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N+LL +EL  LR+LHP   IIYADYY AAM ++ SP  YG E+ L ACCGG GPY  +P 
Sbjct  268   NKLLVEELKKLRKLHPGVTIIYADYYGAAMEIFLSPEQYGIEHPLVACCGGEGPYGVSPT  327

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
               CG     +CD+P  Y SWDG H +E+AY+ I  GLL+G +T P I
Sbjct  328   ITCGFGEYKLCDNPEKYGSWDGFHPSESAYRAIATGLLLGSYTRPSI  374



>ref|XP_004969326.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=422

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 224/347 (65%), Gaps = 4/347 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A  CY+ + SFGDSL DTGN  R    +++   +   PYGETFF  PTGR+S+GRL++DF
Sbjct  34    AAACYQRLFSFGDSLADTGNF-RFYYGNSSGEPALRPPYGETFFRRPTGRFSNGRLVLDF  92

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A +MGLPFV PY  G+   D  FA G NFAV GATA+   FF +RG       V L  E
Sbjct  93    IADTMGLPFVRPYLSGRRAED--FACGANFAVGGATALGPDFFRDRGFNIGDGRVHLDTE  150

Query  979   LDWFKQMLSSFCQT-PSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             + WF+ +L   C    S C + +  S+ L+GEIGGNDYN   L   P E++ SF P V+ 
Sbjct  151   MKWFRDLLDLLCPGGRSDCSDMMGQSLFLVGEIGGNDYNLPLLSRLPIEKIRSFTPSVVA  210

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+STI ELI  GA+ L+VPGNLPIGC P YLS F + N  +Y+P++GC+ W+N+F++YH
Sbjct  211   KISSTITELIGLGAKTLVVPGNLPIGCVPRYLSIFRSDNKEDYEPESGCLRWMNEFSKYH  270

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N+LL +EL  LR+LHP   IIYADYY AAM ++  P  +G E  L ACCGG G +  +P 
Sbjct  271   NKLLVEELEKLRKLHPGVSIIYADYYGAAMEIFLFPERFGIEEPLVACCGGEGTHGVSPA  330

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             A CG     VCD+P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  331   AACGYGEYKVCDNPDKYGSWDGFHPSEAAYKAIAMGLLRGTYTQPSI  377



>gb|KCW76155.1| hypothetical protein EUGRSUZ_D00534, partial [Eucalyptus grandis]
Length=362

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 233/345 (68%), Gaps = 7/345 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY++I +FGDSL+DTGN +R   S+  + +    PYG+TFF HPTGRYSDGRLIIDF+A 
Sbjct  21    CYESIFNFGDSLSDTGNYLR---SAGDHAILPTSPYGKTFFGHPTGRYSDGRLIIDFIAE  77

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELD  974
             ++GLP+++PY      G      GVNFAVAGATA+D +FF  RGI + + TN SL  +LD
Sbjct  78    TVGLPYLKPYLE-VVNGSVDARSGVNFAVAGATALDPTFFAARGIPVMTMTNHSLNVQLD  136

Query  973   WFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             WFK++ SS C T   CK Y + S+ L+GEIGGNDYN AF  G   E++   VP V+  IA
Sbjct  137   WFKKLKSSLCTTQQDCKTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVGAIA  196

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
                + LI+ GA  LIVPGNLPIGC  SY++       ++ +  TGC+N  N+F +YHN+ 
Sbjct  197   KATSMLIEQGAVELIVPGNLPIGCLTSYITTAPPFLKNDANATTGCLNRYNEFAKYHNDY  256

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAY  437
             LQ+EL  LR+ + H +IIY DYY   MRL+ SP  YGF ++T  ACCG GGP+N N    
Sbjct  257   LQRELQVLRQKYSHAKIIYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMM  316

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CGS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL  PFTSP++
Sbjct  317   CGST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDSPFTSPRL  360



>emb|CDY15657.1| BnaA07g08280D [Brassica napus]
Length=397

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 231/349 (66%), Gaps = 8/349 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS  DTGNLI +S   +    +A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  36    FKSIISFGDSTADTGNLIGLSDPDD-LPAAAFPPYGETFFHHPTGRFSNGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLPFV P++G +   + +F KGVNFAV GATA++ SF  ERGI  + TNVSLG +L  F
Sbjct  95    LGLPFVPPFYGSQ---NANFEKGVNFAVGGATALEHSFLVERGINLAFTNVSLGVQLQTF  151

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L S C +PS C++ +E+++ILMGEIGGNDYNY    G P +EV   VP V+T I+S 
Sbjct  152   KDALPSLCGSPSDCRDMIENALILMGEIGGNDYNYPLFLGKPIQEVRELVPLVVTTISSA  211

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  P+GCS +YL  + TSNA EYD  TGC+ WLN+F +   + L 
Sbjct  212   ITELISMGGKTFLVPGQFPLGCSTTYLQSYKTSNAEEYD-STGCLKWLNEFGKNQGDQLL  270

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF---ENTLEACCGGGGPYNSNPHAY  437
              EL  L++L+PH  IIYADYYN  +R  + P  YGF    + L  CCG GG Y+S     
Sbjct  271   VELKKLQKLYPHVYIIYADYYNILLRFIQEPAKYGFLSKPSPLPPCCGTGGSYSSVFGRT  330

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              G +    C+ PS Y+ WD  H+TEAAY+ + +G+L GP+  P  +  C
Sbjct  331   FGLKGLKCCNDPSKYVDWDSAHMTEAAYRLMAEGVLKGPYAIPPFDWSC  379



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/370 (49%), Positives = 236/370 (64%), Gaps = 12/370 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG-----CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL++F ST  V         YK+I+SF DS  DTGN + +S   N    +A  PYGETFF
Sbjct  12    FLLMFSSTITVDSSEPSCRSYKSIISFSDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             H PTGR SDGRLIIDF+A  + LP+V PYFG +     SF +G+NFAV GATA+D +F  
Sbjct  71    HAPTGRNSDGRLIIDFIAEFLRLPYVPPYFGSQNV---SFKQGINFAVYGATALDRTFLM  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFC--QTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
             E+GI +  TNVSL  +L+ FK++L S C   +P  CKE L  S+ILMG+IG NDY+Y F 
Sbjct  128   EKGIESDFTNVSLSVQLNIFKKILPSLCASSSPHDCKEMLGDSLILMGDIGANDYDYMFF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             QG    +V   VP VI  I+S + +LI  G +  +VPG+ P GC P+YL+ F TS   EY
Sbjct  188   QGKSINDVEELVPLVIKAISSALVDLIDLGGKTFVVPGSFPYGCFPAYLTLFQTSKEKEY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             D  TGC++WLN+  + H+E L+ EL  LR+L+PH  IIYADYYN+  R ++ P  YGF E
Sbjct  248   DTFTGCLSWLNELGKNHDEQLKTELKRLRKLYPHVNIIYADYYNSMYRFFQEPAKYGFKE  307

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN      CG Q    C +PS Y++WDG HLTEA +Q +  GLL GP+
Sbjct  308   RPLGACCGVGGQYNFTIGEECGYQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLKGPY  367

Query  316   TSPKINGECI  287
              +P  +  C+
Sbjct  368   ATPAFDWSCL  377



>emb|CDX94632.1| BnaC07g10260D [Brassica napus]
Length=382

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/377 (47%), Positives = 243/377 (64%), Gaps = 22/377 (6%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +++++  +  ++  +    C  +K+I+SFGDS+ DTGNL+ +S   N     A  PYGET
Sbjct  14    LSFFLSTLFLLTVVNSETNCRNFKSIISFGDSIADTGNLLGLS-DPNDLPKVAFPPYGET  72

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             FFHHPTGR+S+GRLIIDF+A  +G P V P++G +   + +F +GVNFAV GATA++ S 
Sbjct  73    FFHHPTGRFSNGRLIIDFIAEFLGFPLVPPFYGSQ---NANFEQGVNFAVGGATALEPSI  129

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
               ERGI  + TNVSLG +L  FK    + C +P+ C++ +E+++ILMGEIGGNDYNY   
Sbjct  130   LQERGINFAYTNVSLGVQLKSFKDSFPNLCGSPTDCRDMIENALILMGEIGGNDYNYPLF  189

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G P EE+   VP VIT I+S I ELI  G +  +VPG  P+GCS  YL+ + TSN   Y
Sbjct  190   LGKPIEEIRELVPLVITTISSAITELIGMGGRTFLVPGEFPLGCSVIYLTLYKTSNKEAY  249

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             D  +GC+ WLN+F  YH++ LQ ELN LR+L+PH  IIYADYYNA +RL + P  +GF +
Sbjct  250   D-SSGCLKWLNEFAVYHDDQLQAELNKLRKLYPHVNIIYADYYNALLRLSQEPTKFGFID  308

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG            Q    C  PS Y+SWD +H+TEAAY+ + +G+L GP+
Sbjct  309   KRLPACCGFGG------------QGMECCSDPSKYVSWDSVHMTEAAYRCMAEGVLKGPY  356

Query  316   TSPKINGECILSRPKTK  266
               P     C+   P+TK
Sbjct  357   AIPPFEWSCL--NPETK  371



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 231/348 (66%), Gaps = 14/348 (4%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y +I SFGDSL DTGN +  SKSS+       LPYG TFF HPTGR  DGRLI+DF+A +
Sbjct  25    YTSIFSFGDSLADTGNALIYSKSSSPAF--GRLPYGMTFFRHPTGRCCDGRLIVDFIATA  82

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINS----CTNVSLGNE  980
              GLP + PY        ++  +GVNFAVAGA A+D + F  +G++       TN+SL  +
Sbjct  83    FGLPLLPPYL----AHGQNIQQGVNFAVAGAAALDPAVF--QGLLGGDGFPLTNLSLSTQ  136

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL-QGHPKEEVMSFVPKVIT  803
             L WF+++  S C T + C ++   S+ ++GEIGGNDYNY FL  G   +EV  +VPKVI 
Sbjct  137   LRWFERLKPSLCNTATACADHFSKSLFVVGEIGGNDYNYFFLLGGKSPKEVKPYVPKVIG  196

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I + I  LIK GA  L+VPG LP GCS +YL+ F + N  +YDP+TGC+ WLN F +YH
Sbjct  197   AIVAAIESLIKNGAVNLLVPGILPFGCSSAYLTVFNSPNREDYDPRTGCLRWLNGFAKYH  256

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNP  446
             N LL++ L+ LR  +P  RI+YADYY A+  + RSP ++GF  N   ACCGG GPYN +P
Sbjct  257   NALLRRALDELRRKYPRARIMYADYYGASNPISRSPQHFGFGRNIFVACCGGDGPYNFSP  316

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
              A CG   STVC  PSSY++WDG HLTEAAY +I  GLL GP+T+P +
Sbjct  317   LALCGQPSSTVCSHPSSYVNWDGFHLTEAAYHFIATGLLEGPYTTPPL  364



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 239/374 (64%), Gaps = 11/374 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMS  1238
             MA S+ +A+   +     V      GG   Y ++ SFGDSLTDTGNL+  S  S  + + 
Sbjct  15    MAISRLSALVAALACCCLVRLAQCGGGGQNYTSMFSFGDSLTDTGNLLVSSPLS--FNIV  72

Query  1237  AVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAG  1058
                PYG T+FH PTGR SDGRL++DF+A + GLP ++PY     +  +   +GVNFAV G
Sbjct  73    GRFPYGMTYFHRPTGRCSDGRLVVDFLAQAFGLPLLQPYL----SRGKDVRQGVNFAVGG  128

Query  1057  ATAMDMSFFTERGIINSC-TNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIG  881
             ATAMD  FF   G  +   TN+SL  +LDWF ++  S C +P  CK+Y   S+ L+GEIG
Sbjct  129   ATAMDPPFFQGIGASDKLWTNLSLSVQLDWFDKLKPSLCSSPKNCKKYFSRSLFLVGEIG  188

Query  880   GNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSY  701
             GNDYNYA  +G   ++  S+VP V + I      LIK GA  L+VPGNLP+GCS +YL+ 
Sbjct  189   GNDYNYALFKGKTLDDAKSYVPTVSSAIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTL  248

Query  700   FMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYR  521
                 N+S+YD   GC+   N+F + HN ++Q++L  LR  +P  RI+YADYY AAM   +
Sbjct  249   HPGRNSSDYD-SVGCLKTYNEFAQRHNAMVQQKLQVLRLKYPKARIMYADYYGAAMSFAK  307

Query  520   SPNNYGF-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWI  344
             +P  +GF +  L+ CCGGGGPYN NP A CG + S+VC  PS+Y +WDG+HLTEAAY  I
Sbjct  308   NPKQFGFKQGPLKTCCGGGGPYNFNPTASCGVRGSSVCADPSAYANWDGVHLTEAAYHAI  367

Query  343   VDGLLIGPFTSPKI  302
              D +L GP+TSP++
Sbjct  368   ADSILHGPYTSPRL  381



>ref|XP_003593740.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63991.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=387

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 231/344 (67%), Gaps = 6/344 (2%)
 Frame = -1

Query  1306  GDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVE  1127
             GDSL DTGNL   ++  + + +    PYGET+FHHP+GR SDGRLIIDF+A ++G+  V+
Sbjct  36    GDSLADTGNLYFSNQQPSHHCLFP--PYGETYFHHPSGRCSDGRLIIDFIAEALGIQMVK  93

Query  1126  PYFGGK--TTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLS  953
             PY G K     D S  +GVNFAV GATA+D+SFF ERG+ +  TN S G +L+WFK++L 
Sbjct  94    PYLGIKNGVLKDMSVKEGVNFAVMGATALDISFFEERGVHSVTTNYSFGVQLNWFKELLP  153

Query  952   SFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELI  773
               C +   C E L  S+ L+GEIGGND+NY         ++  +VP VI  I   INELI
Sbjct  154   HICNSSKTCHEVLGKSLFLVGEIGGNDFNYPLHIRQSITKLKEYVPHVINAITLAINELI  213

Query  772   KYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNH  593
               GA+ L+VPGN P+GCS  +L+ + T++ ++YD   GC+ WLN+F+E++N+ LQ E++ 
Sbjct  214   DLGARTLMVPGNFPLGCSAVHLTTYETTDKNQYD-SFGCLKWLNEFSEFYNQKLQHEIHR  272

Query  592   LRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTV  413
             LR +HPH  IIYADYYNAA+ LYR P  YGF   L+ CCG G PYN N    CG      
Sbjct  273   LRVIHPHANIIYADYYNAALPLYRYPKKYGFTG-LKVCCGIGSPYNYNASNMCGKPGVPA  331

Query  412   CDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILS  281
             CD PS YI+WDG+H TEAAY+ I +GL+ GP++ P+++  C ++
Sbjct  332   CDDPSQYITWDGVHFTEAAYRLIANGLIKGPYSVPQLSNLCFMN  375



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 234/368 (64%), Gaps = 11/368 (3%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG-----CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL++F ST  V         YK+I+SFGDS  DTGN + +S   N    +A  PYGETFF
Sbjct  12    FLLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             H PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV GATA+D +   
Sbjct  71    HTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFKQGINFAVYGATALDCALLI  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQG  848
             E+GI +  TNVSL  +L+ FKQ L S C + S   E L  S+ILMG+IG NDY+Y F QG
Sbjct  128   EKGIGSDFTNVSLSVQLNIFKQTLPSLCAS-SSSHEMLGDSLILMGDIGANDYDYMFFQG  186

Query  847   HPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDP  668
                 EV   VP VI  I+S I +LI  G +  +VPG  P GC P+YL+ F T+   EYDP
Sbjct  187   KSINEVEELVPLVIKAISSAIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEEEYDP  246

Query  667   QTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENT  491
              TGC++WLN+  + H+E L+ EL  LR+++PH  IIYADYYN+  R ++ P  YGF E  
Sbjct  247   LTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGFKERP  306

Query  490   LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
             L ACCG GG YN      CG Q    C +PS Y++WDG HLTEA +Q +  GLL GP+ S
Sbjct  307   LGACCGVGGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNGPYAS  366

Query  310   PKINGECI  287
             P  +  C+
Sbjct  367   PAFDWSCL  374



>ref|XP_009102894.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
Length=397

 Score =   352 bits (903),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 230/349 (66%), Gaps = 8/349 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS  DTGNLI +S   +    +A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  36    FKSIISFGDSTADTGNLIGLSDPDD-LPAAAFPPYGETFFHHPTGRFSNGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLPFV P++G +   + +F KGVNFAV GATA++ SF  ERGI    TNVSLG +L  F
Sbjct  95    LGLPFVPPFYGSQ---NANFEKGVNFAVGGATALEHSFLVERGINLDFTNVSLGVQLQSF  151

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L S C +PS C++ +E+++ILMGEIGGNDYNY    G P +EV   VP V+T I+S 
Sbjct  152   KDALPSLCGSPSDCRDMIENALILMGEIGGNDYNYPLFLGKPIQEVRELVPLVVTTISSA  211

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  P+GCS +YL  + TSNA EYD  TGC+ WLN+F +   + L 
Sbjct  212   ITELISMGGKTFLVPGQFPLGCSTTYLQSYKTSNAEEYD-STGCLKWLNEFGKNQGDQLL  270

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF---ENTLEACCGGGGPYNSNPHAY  437
              EL  L++L+PH  IIYADYYN  +R  + P  YGF    + L  CCG GG Y+S     
Sbjct  271   VELKKLQKLYPHVYIIYADYYNILLRFIQEPAKYGFLSKPSPLPPCCGTGGSYSSVFGRT  330

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              G +    C+ PS Y+ WD  H+TEAAY+ + +G+L GP+  P  +  C
Sbjct  331   FGLKGLKCCNDPSKYVDWDSAHMTEAAYRLMAEGVLKGPYAIPPFDWSC  379



>emb|CDX94633.1| BnaC07g10250D [Brassica napus]
Length=396

 Score =   352 bits (902),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 236/366 (64%), Gaps = 10/366 (3%)
 Frame = -1

Query  1375  IFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPT  1196
             +FL +  S  H     +K+I+SFGDS  DTGNLI +S   +    +A  PYGETFFHHPT
Sbjct  21    LFLTIVNSEAHCRN--FKSIISFGDSTADTGNLIGLSDPDD-LPAAAFPPYGETFFHHPT  77

Query  1195  GRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI  1016
             GR+S+GRLIIDF+A  +GLPFV P++G +   + +F KGVNFAV GATA++ SF  ERGI
Sbjct  78    GRFSNGRLIIDFIAEFLGLPFVPPFYGSQ---NANFEKGVNFAVGGATALEHSFLVERGI  134

Query  1015  INSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKE  836
               + TNVSLG +L  FK  + S C +PS C+  +E+++ILMGEIGGNDYNY    G P E
Sbjct  135   DLAFTNVSLGIQLQSFKDAMPSLCGSPSDCRNMIENALILMGEIGGNDYNYPLFLGKPTE  194

Query  835   EVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGC  656
             E+   VP V++ I+S I ELI  G +  +VPG  P+GCS +YL  + TSNA EYD  TGC
Sbjct  195   EIRELVPLVVSTISSAITELISMGGKTFLVPGQFPLGCSTTYLQSYNTSNAEEYD-STGC  253

Query  655   INWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF---ENTLE  485
             + WLN+F +   + L  EL  L++L+PH  IIYADYYN  +R  + P  YGF    + L 
Sbjct  254   LKWLNEFGKNQGDQLLVELKKLQKLYPHVNIIYADYYNILLRFIQEPAKYGFLSKPSPLP  313

Query  484   ACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPK  305
              CCG  G Y+S      G +    C+ PS Y+ WD  H+TEAAY+ + +G+L GP+  P 
Sbjct  314   PCCGTRGSYSSLFGKTFGLKGLKCCNDPSKYVDWDSAHMTEAAYRLMAEGVLKGPYAIPP  373

Query  304   INGECI  287
              +  C+
Sbjct  374   FDWSCL  379



>ref|XP_010455497.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=383

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 234/354 (66%), Gaps = 18/354 (5%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             ++ I+SFGDS+ DTGNL+ +S  +N   ++   PYGETFFHHPTGR SDGRLIIDF+A  
Sbjct  36    FEYIISFGDSIADTGNLLCLSDRNN-LSLNGFPPYGETFFHHPTGRSSDGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP+V PYFG K   + +F KGVNFAV  ATA++ SF  ERG  +   N+SLG ++  F
Sbjct  95    LGLPYVTPYFGSK---NGNFQKGVNFAVGSATALEASFLEERGY-HCPHNISLGVQVKVF  150

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K+ L + C  PS CK  + +++ILMGEIGGND+N  F Q  P +EV   VP VI+ I+S 
Sbjct  151   KESLPNLCGLPSDCKNMIGNALILMGEIGGNDHNGPFFQRRPIDEVKELVPLVISTISSA  210

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGCS +YL+ + TSN  EYDP  GC+ WLN F EYH+E L+
Sbjct  211   ITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNMEEYDP-FGCLKWLNKFGEYHDEQLE  269

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGS  428
              EL  LR+L+ H  IIYADYYNA + L + P  Y            G PYN N    CGS
Sbjct  270   AELKRLRKLNHHVNIIYADYYNALLGLNQEPTKY------------GEPYNFNFSTCCGS  317

Query  427   QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
                  C+ PS Y++WDG+H+TEAAY+++ DG+L GP+TSP  N  C+ S+ K K
Sbjct  318   FGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSPPFNWTCLSSKIKNK  371



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   350 bits (899),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 231/345 (67%), Gaps = 7/345 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y +I SFGDSL DTGN +R    + A+ +   LPYGETFFHH TGR SDGRL++DF A +
Sbjct  30    YDSIFSFGDSLADTGNFLRTG--ALAFPVIERLPYGETFFHHATGRCSDGRLVVDFFADA  87

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP+++PY       D +F  GVNFAVAGATA+D  FF  + +     TN SL  +L W
Sbjct  88    YGLPYLKPYLA--VARDGNFQHGVNFAVAGATALDPEFFYHQKLGPILWTNDSLSVQLGW  145

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ S+ C TP  CK + + S+ L+GEIGGNDYNY F  G   ++V + VP V+  IA+
Sbjct  146   FKKVKSTLCSTPQECKNFFKKSLFLVGEIGGNDYNYPFFIGGTIKQVKATVPVVVEAIAA  205

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
             TI+ LI  GA  L+VPGN PIGCS  YL+ F T N + YD + GC+   N F +YHN  L
Sbjct  206   TISALIDEGAVELVVPGNFPIGCSAVYLTLFETPNKAAYD-EHGCLKVYNAFAKYHNAQL  264

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             +  L  LR+ +P  +IIYADYY AA R   SP +YGF ++ L ACCGGGGPYN N  A C
Sbjct  265   RLGLEKLRQKYPQAKIIYADYYGAAKRFVHSPKHYGFSKDRLVACCGGGGPYNFNNSARC  324

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             G   ST C SPS++ +WDG+HLTEAAY+++  GL+ GPF+SP ++
Sbjct  325   GHTGSTTCTSPSAHANWDGIHLTEAAYRYVAMGLINGPFSSPSLS  369



>ref|XP_009102895.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=382

 Score =   351 bits (900),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 232/348 (67%), Gaps = 18/348 (5%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S  +N   + A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  36    FKSIISFGDSIADTGNLLGLSDPNNLPKV-AFPPYGETFFHHPTGRFSNGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +G P V P++G +   + +F KGVNFAV GATA++ S   ERGI  + TNVSLG +L  F
Sbjct  95    LGFPLVPPFYGSQ---NANFEKGVNFAVGGATALEPSVLEERGIHFAYTNVSLGVQLQSF  151

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L + C +P+ C++ +E+++ILMGEIGGNDYNY    G P EE+   VP VIT I+S 
Sbjct  152   KDSLPNLCGSPTDCRDMIENALILMGEIGGNDYNYPLFLGKPIEEIRELVPLVITTISSA  211

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGC+  YL+ + T N   YD  +GC+ WLN+F  YH++ LQ
Sbjct  212   ITELISMGGRTFLVPGEFPIGCAVIYLTLYKTPNKEAYD-SSGCLKWLNEFAVYHDDQLQ  270

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
              ELN LR+L+PH  IIYADYYNA +RL + P  +GF +  L ACCG             G
Sbjct  271   AELNKLRKLYPHVNIIYADYYNALLRLSQEPTKFGFIDRRLPACCG------------FG  318

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
              +    C  PS Y+SWD +H+TEAAY+++ +G+L GP+  P  +  C+
Sbjct  319   EKGMECCSDPSKYVSWDSVHMTEAAYRFMAEGVLKGPYAIPPFDWSCL  366



>emb|CDY15658.1| BnaA07g08290D [Brassica napus]
Length=386

 Score =   350 bits (899),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 233/348 (67%), Gaps = 18/348 (5%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S  +N   + A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  36    FKSIISFGDSIADTGNLLGLSDPNNLPKV-AFPPYGETFFHHPTGRFSNGRLIIDFIAEF  94

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +G P V P++G +   + +F KGVNFAV GATA++ S   ERGI  + TNVSLG +L  F
Sbjct  95    LGFPLVPPFYGSQ---NANFEKGVNFAVGGATALEPSVLEERGIHFAYTNVSLGVQLQSF  151

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L + C +P+ C++ +E+++ILMGEIGGNDYNY    G P EE+   VP VIT I+S 
Sbjct  152   KDSLPNLCGSPTDCRDVIENALILMGEIGGNDYNYPLFLGKPIEEIRELVPLVITTISSA  211

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             + ELI  G +  +VPG  PIGC+  YL+ + TSN   YD  +GC+ WLN+F  YH++ LQ
Sbjct  212   MTELIGMGGRTFLVPGEFPIGCAVIYLTLYKTSNKEAYD-SSGCLKWLNEFAVYHDDQLQ  270

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
              ELN LR+L+PH  IIYADYYNA +RL + P  +GF +  L ACCG             G
Sbjct  271   AELNKLRKLYPHVNIIYADYYNALLRLSQEPTKFGFIDRRLPACCG------------FG  318

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
              +    C  PS Y+SWD +H+TEAAY+++ +G+L GP+  P  +  C+
Sbjct  319   EKGMECCSDPSKYVSWDSVHMTEAAYRFMAEGVLKGPYAIPPFDWSCL  366



>gb|EMT27195.1| GDSL esterase/lipase [Aegilops tauschii]
Length=403

 Score =   351 bits (900),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 223/353 (63%), Gaps = 5/353 (1%)
 Frame = -1

Query  1354  STGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGR  1175
             + G  A  C   + SFGDSL DTGN   +   +++   +   PYGETFF   TGR+SDGR
Sbjct  31    ARGAPAAPCVPRVFSFGDSLADTGNFPFL-YGNDSREPALRTPYGETFFRRATGRFSDGR  89

Query  1174  LIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNV  995
             LI+DF+A +MGLPFV PY  G+T  D  FA G NFAV GA A+   FF  RG+      +
Sbjct  90    LIVDFIADTMGLPFVRPYLSGRTAED--FASGANFAVGGAMALGPDFFRGRGVPMG-DRM  146

Query  994   SLGNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFV  818
              LG E+ WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F 
Sbjct  147   HLGVEMKWFHDLLDLLCPADRADCMGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFT  206

Query  817   PKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLND  638
             P V+  I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+
Sbjct  207   PSVVAKISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNE  266

Query  637   FTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPY  458
             F++YHN LL  EL  LR+LHP   IIYADYY AAM +YRSP  +G ++ L ACCGGGGPY
Sbjct  267   FSKYHNRLLIDELEKLRKLHPGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPY  326

Query  457   NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
               +  A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  327   GVSMTARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  379



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score =   350 bits (898),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 185/370 (50%), Positives = 235/370 (64%), Gaps = 15/370 (4%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG-----CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL++F ST  V         YK+I+SFGDS  DTGN + +S   N    +A  PYGETFF
Sbjct  12    FLLIFSSTITVESSEPSCRSYKSIISFGDSGADTGNYLHLS-DVNHPPQAAFPPYGETFF  70

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
             H PTGR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV GATA+D +   
Sbjct  71    HTPTGRNSDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFKQGINFAVYGATALDCALLI  127

Query  1027  ERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAFL  854
             E+GI +  TNVSL  +L+ FKQ L S C + S   CKE L  S+ILMG+IG NDY+Y F 
Sbjct  128   EKGIGSDFTNVSLSVQLNIFKQTLPSLCASSSSHDCKEMLGDSLILMGDIGANDYDYMFF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             QG    EV   VP VI  I+S   +LI  G +  +VPG  P GC P+YL+ F T+   EY
Sbjct  188   QGKSINEVEELVPLVIKAISS---DLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEEEY  244

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC++WLN+  + H+E L+ EL  LR+++PH  IIYADYYN+  R ++ P  YGF E
Sbjct  245   DPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGFKE  304

Query  496   NTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCG GG YN      CG Q    C +PS Y++WDG HLTEA +Q +  GLL GP+
Sbjct  305   RPLGACCGVGGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNGPY  364

Query  316   TSPKINGECI  287
              SP  +  C+
Sbjct  365   ASPAFDWSCL  374



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score =   350 bits (898),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 235/361 (65%), Gaps = 7/361 (2%)
 Frame = -1

Query  1369  LVLFVSTGHVAGGC-YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTG  1193
             L+   +T   +  C Y +I SFGDSL DTGNL+R+  ++ ++      PYG T+FHHPTG
Sbjct  17    LLALATTHPTSCSCHYTSIFSFGDSLIDTGNLLRLQHNNASF--ECWFPYGITYFHHPTG  74

Query  1192  RYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGII  1013
             R SDGRLIIDF+A  +GLPFV PY   + +G + F  GVNFAV GATA+D +F    G  
Sbjct  75    RCSDGRLIIDFIAEYLGLPFVPPYLS-RGSGGQDFRHGVNFAVGGATALDYNFNEHGGTH  133

Query  1012  NSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEE  833
             +S  N SL  +L WFK++L S C + S+C++    S+ ++GEIGGNDY+ A  +G   EE
Sbjct  134   DSRINNSLAIQLRWFKELLPSLCDSDSKCRDLFSRSLFIVGEIGGNDYSLALNRGRSLEE  193

Query  832   VMSFVPKVITVIASTINELIKY-GAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGC  656
             + S VP+VI  I+S I   I+  GA  L+VPG+LP GC P +L+ F + N  +Y+ +TGC
Sbjct  194   IKSLVPRVINNISSAIQMFIQENGAVTLLVPGHLPYGCFPVFLTDFKSPNEEDYESETGC  253

Query  655   INWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN--TLEA  482
             + WLN  +E++N LLQ+E++ LR LHPH  IIYAD YNA   ++RSP+ +GF     L  
Sbjct  254   LRWLNQLSEFNNHLLQEEIHRLRHLHPHVTIIYADLYNAVKAIFRSPDKFGFRKGALLLT  313

Query  481   CCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CCGG GPYN N   +CG + + VC  PS Y SWDG H+TEA Y+ I  GL+ GP+  P  
Sbjct  314   CCGGEGPYNYNKSVHCGVRGAKVCQDPSQYGSWDGTHMTEAVYRVIATGLMEGPYAIPPF  373

Query  301   N  299
             N
Sbjct  374   N  374



>ref|NP_001043721.1| Os01g0649900 [Oryza sativa Japonica Group]
 dbj|BAB89190.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05635.1| Os01g0649900 [Oryza sativa Japonica Group]
 gb|EAY75183.1| hypothetical protein OsI_03073 [Oryza sativa Indica Group]
 gb|EAZ12905.1| hypothetical protein OsJ_02826 [Oryza sativa Japonica Group]
Length=400

 Score =   350 bits (898),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 222/345 (64%), Gaps = 5/345 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY  +  FGDSLTDTGN I     +++   S   PYGETFFH  TGR S+GRLIIDF+A 
Sbjct  34    CYPRVFCFGDSLTDTGN-IAFLYGNDSRRPSLWPPYGETFFHRATGRSSNGRLIIDFIAE  92

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             +MGLPFV PY+GG+T G+  FA G NFAV GATA+   FF ERG+      V L  E++W
Sbjct  93    AMGLPFVRPYWGGQTAGN--FASGANFAVGGATALSPDFFRERGVPMDDDTVHLDMEMEW  150

Query  970   FKQMLSSFCQTPSR--CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
             F+ +L   C       CK  +  S+ L+GEIGGNDYN   + G   E++ +F P VI  I
Sbjct  151   FRDLLGMLCTGGDMDGCKGMMNQSLFLVGEIGGNDYNLPLMSGMSIEKIRNFTPSVIAKI  210

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
             +S I ELI  GA+ L+VPGN+PIGC P YL  F +    +Y+P+ GC+ W+N+F++YHN+
Sbjct  211   SSIITELIGLGAKTLVVPGNIPIGCIPMYLMQFESDKKEDYEPKIGCLRWMNEFSQYHNK  270

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAY  437
             LL  EL +LR+LH    IIYADYY AAM ++ SP  +G E+ L ACCGG GPY  +    
Sbjct  271   LLVDELENLRKLHLDVTIIYADYYGAAMEVFLSPERFGIEDPLVACCGGRGPYGVSASVR  330

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CG     VCD P+ Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  331   CGYGEYKVCDDPAKYASWDGFHPSEAAYKGIAIGLLQGSYTQPPI  375



>ref|XP_010068245.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 238/347 (69%), Gaps = 13/347 (4%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y++I +FGDSL+DTGN +R   S+  + +  + PYG+TFF HPTGR+SDGRLIIDF+A +
Sbjct  27    YESIFNFGDSLSDTGNYLR---SAGDHAILPMSPYGKTFFGHPTGRFSDGRLIIDFIAEA  83

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELDW  971
             +GLP+++PY      G      GVNFAVAGATA+D +FF  RGI   + TN SL  +LDW
Sbjct  84    VGLPYLKPYLE-VVNGSVDARSGVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQLDW  142

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+  IA+
Sbjct  143   FKKLKSSLCTTQQDCDTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVGAIAN  202

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSY---FMTSNASEYDPQTGCINWLNDFTEYHN  620
               + LI++GA  L+VPGNLPIGC   Y++    F+ +NA   +  TGC+N  N+F +YHN
Sbjct  203   ATSMLIEHGAVELVVPGNLPIGCLTLYITTAPPFLKNNA---NTTTGCLNRYNEFAKYHN  259

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPH  443
             + LQ+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N N  
Sbjct  260   DYLQRELQVLRQKYNHARIIYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVR  319

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
               CGS+ S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP++
Sbjct  320   MMCGSK-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>gb|KCW63207.1| hypothetical protein EUGRSUZ_G00824, partial [Eucalyptus grandis]
Length=349

 Score =   348 bits (893),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 238/347 (69%), Gaps = 13/347 (4%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y++I +FGDSL+DTGN +R   S+  + +  + PYG+TFF HPTGR+SDGRLIIDF+A +
Sbjct  9     YESIFNFGDSLSDTGNYLR---SAGDHAILPMSPYGKTFFGHPTGRFSDGRLIIDFIAEA  65

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELDW  971
             +GLP+++PY      G      GVNFAVAGATA+D +FF  RGI   + TN SL  +LDW
Sbjct  66    VGLPYLKPYLE-VVNGSVDARSGVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQLDW  124

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+  IA+
Sbjct  125   FKKLKSSLCTTQQDCDTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVGAIAN  184

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSY---FMTSNASEYDPQTGCINWLNDFTEYHN  620
               + LI++GA  L+VPGNLPIGC   Y++    F+ +NA   +  TGC+N  N+F +YHN
Sbjct  185   ATSMLIEHGAVELVVPGNLPIGCLTLYITTAPPFLKNNA---NTTTGCLNRYNEFAKYHN  241

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPH  443
             + LQ+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N N  
Sbjct  242   DYLQRELQVLRQKYNHARIIYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVR  301

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
               CGS+ S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP++
Sbjct  302   MMCGSK-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  347



>ref|XP_010316801.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Solanum 
lycopersicum]
Length=328

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 221/293 (75%), Gaps = 3/293 (1%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             +IFLVL  +   + G C+ +I+SFGDSL DTGN + +S +       ++ PYGETFFHHP
Sbjct  13    FIFLVLNHNFQRIEG-CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHP  71

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR-SFAKGVNFAVAGATAMDMSFFTER  1022
             TGR+SDGRL+IDF+A S+GLP V  Y  GK   +   F +GVNFAV GATA+D ++  ++
Sbjct  72    TGRFSDGRLVIDFIAESLGLPLVPAYLEGKDERNNVKFRQGVNFAVGGATALDSAYLLDK  131

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             GII +  NVSLG ++DWFK M++SFC+ PS C+E+L++S+ILMGEIGGND+NY FL    
Sbjct  132   GIIPN-NNVSLGTQMDWFKDMMTSFCKFPSECEEFLQNSLILMGEIGGNDFNYGFLGNST  190

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
             KEEV S+VP V+  I+S I ELI+ GA  L+VPG+LPIGCS +YL+ FM S+  +YDP+T
Sbjct  191   KEEVESYVPAVVKTISSAIQELIELGASTLLVPGDLPIGCSTAYLTKFMHSDKGQYDPKT  250

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYG  503
             GCINWLN F++ +NELLQKEL+ LR+L+P   IIYADYYNAAM+ Y SP ++G
Sbjct  251   GCINWLNKFSQQYNELLQKELHLLRDLNPAATIIYADYYNAAMQFYASPKSHG  303



>gb|AAX59709.1| lipase 1 [Brassica napus]
Length=373

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 229/348 (66%), Gaps = 18/348 (5%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             +K+I+SFGDS+ DTGNL+ +S  +N   + A  PYGETFFHHPTGR+S+GRLIIDF+A  
Sbjct  27    FKSIISFGDSIADTGNLLGLSDPNNLPKV-AFPPYGETFFHHPTGRFSNGRLIIDFIAEF  85

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +G P V P++G +   + +F KGVNFAV GATA++ S   ERGI  + TNVSLG +L  F
Sbjct  86    LGFPLVPPFYGSQ---NANFEKGVNFAVGGATALEPSVLEERGIHFAYTNVSLGVQLQSF  142

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K  L + C +P+ C+  +E+++ILMGEIGGNDYNY    G P EE+   VP VIT I S 
Sbjct  143   KDSLPNLCGSPTDCRHMIENALILMGEIGGNDYNYPLFLGKPIEEIRELVPLVITTIPSA  202

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I ELI  G +  +VPG  PIGC+  YL+ + T N   YD  +GC+ WLN+F  YH++ LQ
Sbjct  203   ITELIGMGGRTFLVPGEFPIGCAVIYLTLYKTPNKEAYD-SSGCLKWLNEFAVYHDDQLQ  261

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
              ELN LR L+PH  IIYADYYNA +RL + P  +GF +  L ACCG             G
Sbjct  262   AELNKLRRLYPHVNIIYADYYNALLRLSQEPTKFGFIDRALPACCG------------FG  309

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECI  287
              +    C  PS Y+SWD +H+TEAAY+++ +G+L GP+  P  +  C+
Sbjct  310   EKGMECCSGPSKYVSWDSVHMTEAAYRFMAEGVLKGPYAIPPFDWSCL  357



>ref|XP_010316802.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X3 [Solanum 
lycopersicum]
Length=313

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 220/292 (75%), Gaps = 3/292 (1%)
 Frame = -1

Query  1378  YIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHP  1199
             +IFLVL  +   + G C+ +I+SFGDSL DTGN + +S +       ++ PYGETFFHHP
Sbjct  13    FIFLVLNHNFQRIEG-CFDSIISFGDSLADTGNKLHISLNKTPPSHFSLPPYGETFFHHP  71

Query  1198  TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDR-SFAKGVNFAVAGATAMDMSFFTER  1022
             TGR+SDGRL+IDF+A S+GLP V  Y  GK   +   F +GVNFAV GATA+D ++  ++
Sbjct  72    TGRFSDGRLVIDFIAESLGLPLVPAYLEGKDERNNVKFRQGVNFAVGGATALDSAYLLDK  131

Query  1021  GIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHP  842
             GII +  NVSLG ++DWFK M++SFC+ PS C+E+L++S+ILMGEIGGND+NY FL    
Sbjct  132   GIIPN-NNVSLGTQMDWFKDMMTSFCKFPSECEEFLQNSLILMGEIGGNDFNYGFLGNST  190

Query  841   KEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQT  662
             KEEV S+VP V+  I+S I ELI+ GA  L+VPG+LPIGCS +YL+ FM S+  +YDP+T
Sbjct  191   KEEVESYVPAVVKTISSAIQELIELGASTLLVPGDLPIGCSTAYLTKFMHSDKGQYDPKT  250

Query  661   GCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNY  506
             GCINWLN F++ +NELLQKEL+ LR+L+P   IIYADYYNAAM+ Y SP ++
Sbjct  251   GCINWLNKFSQQYNELLQKELHLLRDLNPAATIIYADYYNAAMQFYASPKSH  302



>ref|XP_006643908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=377

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 226/344 (66%), Gaps = 9/344 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y ++ SFGDSLTDTGNL+  S  S  + +    PYG T+FH PTGR SDGRL++DF+A +
Sbjct  40    YTSMFSFGDSLTDTGNLVVSSPLS--FSIVGKYPYGMTYFHRPTGRSSDGRLVVDFLAQA  97

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP ++PY     +  +   +GVNFAV GATAMD  FF E G  +   TN+SL  +L W
Sbjct  98    FGLPLLQPYL----SRGKDVRRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGW  153

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F+Q+  S C +P  CKE+   S+ L+GEIGGNDYNYAF +G   ++  S+VP V   +A 
Sbjct  154   FEQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGKSLDDAKSYVPTVAGAVAD  213

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LIK GA  L+  G LPIGCS +YL+   + N S+YD  TGC+   NDF ++HN +L
Sbjct  214   ATERLIKAGALHLVGRGTLPIGCSSAYLTLHPSGNKSDYD-ATGCLKTYNDFAQHHNAVL  272

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             Q +L  LR  +P  RI+YADYY AAM   ++P  +GF +  L  CCGGGGPYN NP A C
Sbjct  273   QDKLQLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNPKASC  332

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G + S+VC  PS+Y +WDG+HLTEA Y  I + +L GP+TSP++
Sbjct  333   GVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  376



>ref|XP_003569458.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=395

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 224/346 (65%), Gaps = 6/346 (2%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
              CY  + SFGDSL DTGN  R   + ++   +   PYGETFFH+ TGR+S+GRL++DF+A
Sbjct  28    ACYPRVFSFGDSLADTGNY-RFVYADDSREPALRPPYGETFFHNATGRFSNGRLVVDFIA  86

Query  1153  LSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELD  974
              ++GLPFV PY+ G +  D  FA G NFAV GA+A+   FF +RG+  +  NV L  E+ 
Sbjct  87    EALGLPFVRPYWSGSSAED--FAFGANFAVGGASALSAEFFRKRGV-PAADNVHLDMEMG  143

Query  973   WFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
             WF+ +L   C +  + C + +  S+ L+GEIGGNDYN   L   P + + +F P V+  I
Sbjct  144   WFRDLLDLLCPRDLADCIDMMNRSLFLVGEIGGNDYNLPLLSRVPYKTIRAFTPSVVGKI  203

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
             ASTI ELI+ GAQ L+VPGNLPIGC P YL  + ++   +Y+P+TGCI W+N F+ YHN+
Sbjct  204   ASTIAELIELGAQTLVVPGNLPIGCIPMYLMMYKSNKPEDYEPETGCIRWMNKFSRYHNK  263

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGG-GPYNSNPHA  440
             LL  EL  LR+LHP   IIYADYY AAM +Y SP  +  EN L ACCGGG  PY  +  A
Sbjct  264   LLVGELEKLRKLHPGVAIIYADYYGAAMEIYSSPEQFEIENPLVACCGGGEEPYGVSRAA  323

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
              CG     VC  P  Y SWDG H TEA Y+ I DGLL GP+T P I
Sbjct  324   GCGHGEYKVCSDPQKYGSWDGFHPTEAVYKAIADGLLRGPYTQPAI  369



>gb|EAZ12674.1| hypothetical protein OsJ_02589 [Oryza sativa Japonica Group]
 dbj|BAH01546.1| unnamed protein product [Oryza sativa Japonica Group]
Length=408

 Score =   348 bits (894),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 170/347 (49%), Positives = 227/347 (65%), Gaps = 7/347 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C++ I SFGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF A 
Sbjct  39    CFERIFSFGDSLTDTGNFL-LSVPEDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAE  97

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + GLPFV PY  G   GD  F +G NFAV GATA++ SFF +RG+  + T  SL  ++ W
Sbjct  98    AFGLPFVPPYLAG---GD--FRQGANFAVGGATALNGSFFRDRGVEPTWTPHSLDEQMQW  152

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L++   + S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VPKV+  I S
Sbjct  153   FKKLLTTVSSSESELNDIMTKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVGTITS  212

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I ELI  GA+ L+VPGN PIGC P YLS F +     YD +TGCI WLN+FTEYHN LL
Sbjct  213   AITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYHNRLL  272

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR L+P   IIYADYY AA+ ++ +P  +GF   L +CCG   PYN +P   CG
Sbjct  273   QEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  332

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                S VC  PS Y SWDG+H TEA Y+ I+ G+L G + +P ++  C
Sbjct  333   HPGSVVCSDPSKYTSWDGLHFTEATYKIIIQGVL-GSYANPPLSETC  378



>gb|EEE55085.1| hypothetical protein OsJ_02827 [Oryza sativa Japonica Group]
Length=398

 Score =   348 bits (893),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 226/345 (66%), Gaps = 5/345 (1%)
 Frame = -1

Query  1342  VAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIID  1163
             +A  CY  + SFGDSLTDTGN I     +++   +   PYGETFFH  TGR S+GRLIID
Sbjct  35    LAAPCYPRVFSFGDSLTDTGN-IAFLYGNDSRRPTLWPPYGETFFHRATGRASNGRLIID  93

Query  1162  FMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGN  983
             F+A ++GLPFV PY+ G+T GD  FA G NFAV GATA+   F+ ERG+ +    V L  
Sbjct  94    FIADALGLPFVRPYWSGRTAGD--FAHGANFAVGGATALSPDFYRERGV-HVRDTVHLDM  150

Query  982   ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
             E++WF+ +L   C    + C + +  S+ L+GEIGGNDYN+  + G    ++ SF P VI
Sbjct  151   EMNWFRDLLGLLCPDDLADCNDMMNQSLFLVGEIGGNDYNHPLICGVSIRKIRSFTPSVI  210

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               I+STI ELI+ GA+ L+VPGNLPIGC P YL  F +    +Y+P+TGC+ W+N F++Y
Sbjct  211   AEISSTITELIRLGAKTLVVPGNLPIGCIPYYLMIFKSGKKEDYEPETGCLRWMNGFSQY  270

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  446
             HN+LL  EL +LR+LHP   IIYADYY AAM ++ SP  +G EN L ACCGGGGPY  + 
Sbjct  271   HNKLLMDELENLRKLHPDVAIIYADYYGAAMGIFFSPEQFGIENPLAACCGGGGPYGVSE  330

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTS  311
              A CG     VCD P  Y SWD  H +EA ++ I  GLL G +T 
Sbjct  331   TARCGHGEYKVCDDPQLYGSWDDYHPSEAVFKAIAIGLLRGSYTQ  375



>ref|XP_010054333.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=388

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 232/344 (67%), Gaps = 7/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y++I +FGDSL+DTGN +R   S+  + +    PYG+TFF HPTGRYSDGRLIIDF+A +
Sbjct  48    YESIFNFGDSLSDTGNYLR---SAGDHAILPTSPYGKTFFGHPTGRYSDGRLIIDFIAET  104

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELDW  971
             +GLP+++PY      G      GVNFAVAGATA+D +FF  RGI + + TN SL  +LDW
Sbjct  105   VGLPYLKPYLE-VVNGSVDARSGVNFAVAGATALDPTFFAARGIPVMTMTNHSLNVQLDW  163

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ SS C T   CK Y + S+ L+GEIGGNDYN AF  G   E++   VP V+  IA 
Sbjct  164   FKKLKSSLCTTQQDCKTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVGAIAK  223

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
               + LI+ GA  LIVPGNLPIGC  SY++       ++ +  TGC+N  N+F +YHN+ L
Sbjct  224   ATSMLIEQGAVELIVPGNLPIGCLTSYITTAPPFLKNDANATTGCLNRYNEFAKYHNDYL  283

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q+EL  LR+ + H +IIY DYY   MRL+ SP  YGF ++T  ACCG GGP+N N    C
Sbjct  284   QRELQVLRQKYSHAKIIYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMC  343

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             GS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL  PFTSP++
Sbjct  344   GST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDSPFTSPRL  386



>ref|XP_010068248.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   347 bits (889),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/344 (51%), Positives = 232/344 (67%), Gaps = 7/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y++I +FGDSL+DTGN +R   S+  + +  + PYG+TFF HPTGR+SDGRL IDF+A +
Sbjct  27    YESIFNFGDSLSDTGNYLR---SAGDHAILPMSPYGKTFFGHPTGRFSDGRLTIDFIAEA  83

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELDW  971
             +GLP+++PY      G      GVNFAVAGATA+D +FF  RGI   + TN SL  +LDW
Sbjct  84    VGLPYLKPYLE-VVNGSVDARSGVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQLDW  142

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+  IA+
Sbjct  143   FKKLKSSLCTTQQDCNTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVGAIAN  202

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LI++GA  L+VPGNLPIGC  SY++       ++ +  TGC+N  N+F +YHN  L
Sbjct  203   ATGMLIEHGAVELVVPGNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYHNNYL  262

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N N    C
Sbjct  263   QRELQVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMC  322

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             GS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP++
Sbjct  323   GST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>ref|XP_007148066.1| hypothetical protein PHAVU_006G177700g [Phaseolus vulgaris]
 gb|ESW20060.1| hypothetical protein PHAVU_006G177700g [Phaseolus vulgaris]
Length=369

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 227/342 (66%), Gaps = 11/342 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             + +I SFGDS  DTGN    S S          PYG+TFFHH +GR SDGRLIIDF+A S
Sbjct  39    FTSIFSFGDSFADTGNWYLASPSPQHCFFP---PYGQTFFHHVSGRCSDGRLIIDFIAES  95

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
             +GLP V+PY G K   +     G NFAV GATA+D SFF ERG+ +  TN SL  +L+WF
Sbjct  96    LGLPLVKPYLGKKNGKE-----GANFAVVGATALDPSFFEERGV-SIPTNYSLTQQLNWF  149

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K++L S C + + C+E   +S+ LMGEIGGND+NY F + +   EV ++VP VI  IAS 
Sbjct  150   KELLPSLCNSFTDCREVFGNSLFLMGEIGGNDFNYFFFEQNSIAEVKTYVPYVINAIASA  209

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             I+EL+  GA+ LI+PGNLPIGCS  YL+ + T + +EYD Q+GC+ WLN+F EY+N  LQ
Sbjct  210   IHELVGVGARTLIIPGNLPIGCSVIYLTIYETKDENEYD-QSGCLKWLNEFAEYYNHELQ  268

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCGS  428
              EL+ L+ L+ H  II+ADYYNAA+ LYR P  +GF   L+ACCG GGPYN N    CG 
Sbjct  269   SELHKLQALYSHANIIFADYYNAALPLYRDPTKFGFSG-LKACCGMGGPYNFNASVKCGD  327

Query  427   QLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
                  CD PS YI WDG+HLTEAA + I   ++   ++S  I
Sbjct  328   PRVIPCDDPSKYIGWDGIHLTEAANKLIAQAVIKWSYSSSSI  369



>gb|ACN28025.1| unknown [Zea mays]
 tpg|DAA58333.1| TPA: hypothetical protein ZEAMMB73_278814 [Zea mays]
Length=395

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/378 (47%), Positives = 232/378 (61%), Gaps = 16/378 (4%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GCY  + +FGDSL DTGN   +  + +A +     PYGETFFH  TGR S+GRL++DF
Sbjct  33    AAGCYPRVFNFGDSLADTGNYPFVYGNDSAKLRP---PYGETFFHRATGRASNGRLVVDF  89

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A ++GLPFV PY  G++  D  FA G NFAV GATA+   FF  RG  N    V L  E
Sbjct  90    IADTLGLPFVRPYLSGRSAED--FAGGANFAVGGATALSPDFFRARGFHNMGNRVDLDME  147

Query  979   LDWFKQMLSSFCQ-TPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             + WF+ +L   C    + C + +  S+ L+GEIGGNDYN   L G P EE+ +  P V+ 
Sbjct  148   MKWFRGLLDLLCPGNLAGCSDMMNQSLFLVGEIGGNDYNGPLLSGVPFEEIRAITPSVVA  207

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+STI+     GA+ L+VPGNLPIGC P YL  F ++   +YDPQTGC+ W+N+F++YH
Sbjct  208   KISSTIS----LGAKTLVVPGNLPIGCVPKYLMIFKSNKKEDYDPQTGCLRWMNEFSQYH  263

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N+LL ++L  LR LHP   IIYADYY AAM ++ SP  YG E  L ACCG  GPY  +P 
Sbjct  264   NKLLVEQLKKLRRLHPGVTIIYADYYGAAMEIFLSPERYGIEYPLVACCGAEGPYGVSPT  323

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTKI  263
               CG     +CD+P  Y SWDG+H TE+AY+ I  GLL+G +T P I      +   T  
Sbjct  324   TSCGLGEYKLCDNPERYGSWDGLHPTESAYKVIAMGLLLGSYTRPPI------ASTTTSC  377

Query  262   PDS*RLGLSAAQFEIIEL  209
             P    LG SA    + +L
Sbjct  378   PQLMELGSSAEYKRLYDL  395



>ref|XP_002455947.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
 gb|EES01067.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
Length=437

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 226/347 (65%), Gaps = 7/347 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+  + SFGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF A 
Sbjct  68    CFDRVFSFGDSLTDTGNFL-LSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFAE  126

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + G+P+V PY GG   GD  F  G NFAV GATA++ SFF ERG+  + T  SL  ++ W
Sbjct  127   AFGMPYVPPYLGG---GD--FQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQW  181

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L S   + +  KE +  S+  +GE+GGNDYN+  ++    +E+   VP V+  I+S
Sbjct  182   FKKLLPSIASSETEQKEIMSKSLFFVGEVGGNDYNHLIVRQKSLDELHEVVPNVVGAISS  241

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYHN +L
Sbjct  242   AIVDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNEFAEYHNRML  301

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L +CCG   PYN +P   CG
Sbjct  302   QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  361

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  362   RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSETC  407



>ref|NP_001140937.1| hypothetical protein [Zea mays]
 gb|ACF85001.1| unknown [Zea mays]
 tpg|DAA58957.1| TPA: hypothetical protein ZEAMMB73_908344 [Zea mays]
Length=433

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 226/347 (65%), Gaps = 7/347 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+  + SFGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF A 
Sbjct  64    CFDRMFSFGDSLTDTGNFL-LSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFAE  122

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + GLP+V PY GG   GD  F  G NFAV GATA++ SFF ERG+  + T  SL  ++ W
Sbjct  123   AFGLPYVPPYLGG---GD--FQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQW  177

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L+S     +   + +  S+  +GE+GGNDYN+  ++    +E+   VP V+  I+S
Sbjct  178   FKKLLTSIAPLETEQNKIISKSLFFVGEVGGNDYNHLIVRDKSVDELHEVVPNVVGAISS  237

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLNDF EYHN++L
Sbjct  238   AITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEDYYEEQTGCIKWLNDFAEYHNKML  297

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P   CG
Sbjct  298   QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFTVPLNACCGSDAPYNCSPSILCG  357

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  358   RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSETC  403



>ref|XP_003569350.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Brachypodium 
distachyon]
Length=402

 Score =   347 bits (889),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 230/350 (66%), Gaps = 7/350 (2%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
              G C++ I SFGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF
Sbjct  29    GGVCFQRIFSFGDSLTDTGNFV-LSVPDDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDF  87

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
              A + GLP+V PY GG   GD  F  G NFAV GATA++ SFF + G+  + T  SL  +
Sbjct  88    FAEAFGLPYVPPYLGG---GD--FLNGANFAVGGATALNGSFFRDLGVEPTWTPHSLDEQ  142

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             + WFK +LSS   + S  ++ +  S+ L+GE+GGNDYN+  ++G   +E+   VP V+ V
Sbjct  143   IQWFKNLLSSIASSESEHRDVMSKSLFLVGEVGGNDYNHLIVRGKSLDELHKLVPNVVGV  202

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I+S I ELI  GA+ L+VPGN PIGC P YL+ F +     Y+ +TGCI WLN+FTEYHN
Sbjct  203   ISSAITELINLGARKLVVPGNFPIGCVPLYLAIFPSQKEGYYNEKTGCIEWLNEFTEYHN  262

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHA  440
              L+Q+EL+ LR LHP   +IYADYY A + +YR+P  +GF   L +CCG   P+N +P  
Sbjct  263   RLIQEELDKLRNLHPDVSLIYADYYGATLDIYRAPLQFGFTVPLNSCCGSDAPHNCSPSV  322

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              CG+  S VC  PS YISWDG+H TEA Y+ I+ G+L G +  P ++  C
Sbjct  323   MCGNPGSFVCPDPSKYISWDGLHFTEATYKVIIQGVL-GSYAFPPLSETC  371



>emb|CDM83548.1| unnamed protein product [Triticum aestivum]
Length=426

 Score =   347 bits (891),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 222/353 (63%), Gaps = 5/353 (1%)
 Frame = -1

Query  1354  STGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGR  1175
             + G  A  C   + SFGDSL DTGN   +   +++   +   PYGETFF   TGR+SDGR
Sbjct  34    ARGAPAAPCVPRVFSFGDSLADTGNFPFL-YGNDSREPALRTPYGETFFRRATGRFSDGR  92

Query  1174  LIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNV  995
             LI+DF+A +MGLPFV PY  G+T  D  FA G NFAV GA A+   FF  RG+      +
Sbjct  93    LIVDFIADTMGLPFVRPYLSGRTAED--FASGANFAVGGAMALGPDFFRGRGVPMG-DRM  149

Query  994   SLGNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFV  818
              LG E+ WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F 
Sbjct  150   HLGVEMKWFHDLLDLLCPADRADCMGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFT  209

Query  817   PKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLND  638
             P V+  I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+
Sbjct  210   PSVVAKISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNE  269

Query  637   FTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPY  458
             F++YHN LL  EL  LR+LHP   IIYADYY AAM +YRSP  +G ++   ACCGGGGPY
Sbjct  270   FSKYHNRLLIDELEKLRKLHPGMSIIYADYYGAAMEIYRSPEQFGIDHPSAACCGGGGPY  329

Query  457   NSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
               +  A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  330   GVSMTARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  382



>ref|XP_002893540.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1392

 Score =   369 bits (947),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 186/373 (50%), Positives = 245/373 (66%), Gaps = 13/373 (3%)
 Frame = -1

Query  1381  YYIFLVLFVSTGHVAGGC------YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYG  1220
             Y  FL++  ST  V          YK+I+SFGDS+ DTGN +R+S   N    +A LPYG
Sbjct  662   YVSFLLILYSTTIVVASSESRCRRYKSIISFGDSIADTGNYLRLSNVKNL-PQAAFLPYG  720

Query  1219  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDM  1040
             E+FFH P+GRYSDGRL+IDF+A  +GLP+V PYFG +     SF +G+N AV GATA+D 
Sbjct  721   ESFFHPPSGRYSDGRLVIDFIAEFLGLPYVPPYFGSQNV---SFNQGINLAVYGATALDR  777

Query  1039  SFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYNY  863
             +F  ++GI +  TN+SL  +L+ FKQ+L + C + +R C+E L  S+ILMGEIGGNDYNY
Sbjct  778   AFLVKQGIKSDFTNISLSVQLNTFKQILPNLCASSTRDCREMLGDSLILMGEIGGNDYNY  837

Query  862   AFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA  683
              F +G    E+   VP +I  I+S I  LI  G +  +VPGN PIGCS +YL+ F T+  
Sbjct  838   PFFEGKSINEIKELVPLIIKAISSAIMNLIDLGGKTFLVPGNFPIGCSAAYLTLFQTA-I  896

Query  682   SEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYG  503
              E+DP TGCI WLN F E+HNE L+ EL  L++L+PH  IIYADYYN+  R ++ P  YG
Sbjct  897   VEHDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYRFFQEPAKYG  956

Query  502   FENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLI  326
             F+N  L ACCG GG YN      CG    + C +PS Y++WDG HLTEA YQ +   LL 
Sbjct  957   FKNRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQDLLN  1016

Query  325   GPFTSPKINGECI  287
             GP+T+P  +  C+
Sbjct  1017  GPYTTPAFDWSCL  1029


 Score =   361 bits (926),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 187/382 (49%), Positives = 250/382 (65%), Gaps = 12/382 (3%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAY  1247
             MA S    I+ ++ LVL+ +T  VA     C  +K+I+SFGDS+ DTGN + +S   N  
Sbjct  1     MASSLKKLISSFL-LVLYYTTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHL  58

Query  1246  VMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFA  1067
               +A LPYGE+FFH P+GR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFA
Sbjct  59    PQTAFLPYGESFFHLPSGRASDGRLIIDFIAEFLGLPYVMPYFGSQNV---SFEQGINFA  115

Query  1066  VAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMG  890
             V GATA+D +F   +GI +  TNVSL  +LD FKQ+L + C + +R CKE L  S+ILMG
Sbjct  116   VYGATALDRAFLVGKGIESDFTNVSLSVQLDIFKQILPNLCASSTRDCKEILGDSLILMG  175

Query  889   EIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSY  710
             EIGGNDYNY F +G    E+   VP +I  I+S I +LI  G +  +VPG  P GCS +Y
Sbjct  176   EIGGNDYNYPFFEGKSINEIKELVPLIIKAISSAIVDLIALGGKTFLVPGGFPAGCSAAY  235

Query  709   LSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMR  530
             L+ F T    ++DP TGCI WLN+F E+HN+ L+ EL  L++L+PH  IIYADY+N   R
Sbjct  236   LTLFQTVAEKDHDPFTGCIPWLNEFGEHHNKQLKTELERLQKLYPHVNIIYADYHNTLYR  295

Query  529   LYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAY  353
              Y+ P  YGF+   L ACCG GG YN      CG +  + C +PS Y++WDG HLTEAAY
Sbjct  296   FYQEPAKYGFKKRPLAACCGVGGQYNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAY  355

Query  352   QWIVDGLLIGPFTSPKINGECI  287
             + + +G+L GP+  P  +  C+
Sbjct  356   KKMAEGILNGPYAIPSFDWSCL  377


 Score =   355 bits (910),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 177/343 (52%), Positives = 227/343 (66%), Gaps = 6/343 (2%)
 Frame = -1

Query  1312  SFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPF  1133
             +FGDS  DTGN + +S   N    SA LPYGETFFH P+GRYSDGRLIIDF+A  +GLP+
Sbjct  1040  NFGDSSADTGNYLHLS-DVNHLPQSAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPY  1098

Query  1132  VEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLS  953
             V  YFG +     SF +G+NFAV GATA+D +F  E+GI    TNVSL  +++ FKQ+L 
Sbjct  1099  VPYYFGSQNV---SFDQGINFAVYGATALDRAFLVEKGIEFDFTNVSLSVQINNFKQILP  1155

Query  952   SFCQTPSR-CKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINEL  776
             + C + SR C+E L  S+ILMGEIG NDYNY F +G    E+   VP VI  I+S I +L
Sbjct  1156  NLCTSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGKSINEIKELVPLVIKAISSAIVDL  1215

Query  775   IKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELN  596
             I  G +  +VPGN P+GC P+YL+ F T+   +YDP TGC+ WLN+F E+HNE L+ EL 
Sbjct  1216  IDLGGKTFLVPGNFPLGCYPAYLTLFQTTAEEDYDPSTGCLRWLNEFVEHHNEELKTELK  1275

Query  595   HLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENT-LEACCGGGGPYNSNPHAYCGSQLS  419
              L+EL+ H  IIYADYYN+   LY+ P  YGF N  L ACCG GG YN      CG +  
Sbjct  1276  RLQELYDHVNIIYADYYNSLFLLYQEPVKYGFRNRPLAACCGIGGQYNFTISEECGHREV  1335

Query  418   TVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
             + C +PS Y++WDG HLTEA +Q +   LL GP+ +P  +  C
Sbjct  1336  SYCQNPSEYVNWDGYHLTEATHQKMAQVLLNGPYATPAFDWSC  1378


 Score =   223 bits (567),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 178/306 (58%), Gaps = 31/306 (10%)
 Frame = -1

Query  1411  MAFSQGTAITYYIFLV---LFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVM  1241
             MA+S    I+ ++ ++   + V++       +K+I+SFGDS+ DTGN + +S   N    
Sbjct  384   MAYSLKKLISSFLLVLYSTIIVASSESRCRRFKSIISFGDSIADTGNYLHLS-DVNHLPQ  442

Query  1240  SAVLPYGETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVA  1061
             +A  PYGE+FFH P+GR SDGRLIIDF+A  +GLP+V PYFG +     SF +G+NFAV 
Sbjct  443   TAFFPYGESFFHPPSGRASDGRLIIDFIAEFLGLPYVPPYFGSQNV---SFEQGINFAVY  499

Query  1060  GATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEI  884
             GATA+D ++F  +GI    TNVSL  +LD FKQ+L + C + SR C+E L  S+ILMGEI
Sbjct  500   GATALDRAYFVAKGIECDFTNVSLSVQLDIFKQILPNLCASSSRDCREMLGDSLILMGEI  559

Query  883   GGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLS  704
             GGND+ Y   +G   +E       +I  I+S I      GA+    P             
Sbjct  560   GGNDFFYPSFEGKSIDET-KLQDLIIKAISSAI-----VGAKHFWYP-------------  600

Query  703   YFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLY  524
                     +YDP TGCI  LN+  E  NE L+ EL  L++L+P   IIYADY+N+  R Y
Sbjct  601   ----EAEEDYDPLTGCIPRLNELGERDNEQLKTELKRLQKLYPDVNIIYADYHNSLYRFY  656

Query  523   RSPNNY  506
             + P  Y
Sbjct  657   QEPAKY  662



>gb|KCW63215.1| hypothetical protein EUGRSUZ_G00835, partial [Eucalyptus grandis]
Length=345

 Score =   343 bits (880),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 230/342 (67%), Gaps = 7/342 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y++I +FGDSL+DTGN +R   S+  + +  + PYG+TFF HPTGR+SDGRL IDF+A +
Sbjct  9     YESIFNFGDSLSDTGNYLR---SAGDHAILPMSPYGKTFFGHPTGRFSDGRLTIDFIAEA  65

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELDW  971
             +GLP+++PY      G      GVNFAVAGATA+D +FF  RGI   + TN SL  +LDW
Sbjct  66    VGLPYLKPYLE-VVNGSVDARSGVNFAVAGATALDPTFFAARGIPAMTMTNHSLNVQLDW  124

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ SS C T   C  Y + S+ L+GEIGGNDYN AF  G   E++   VP V+  IA+
Sbjct  125   FKKLKSSLCTTQQDCNTYFKKSLFLVGEIGGNDYNLAFALGATFEQLRPIVPNVVGAIAN  184

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LI++GA  L+VPGNLPIGC  SY++       ++ +  TGC+N  N+F +YHN  L
Sbjct  185   ATGMLIEHGAVELVVPGNLPIGCLTSYITTAPPFLKNDANTATGCLNRYNEFAKYHNNYL  244

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYC  434
             Q+EL  LR+ + H RIIYADYY   MRL+ SP  YGF ++T  ACCG GGP+N N    C
Sbjct  245   QRELQVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNVRMMC  304

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
             GS  S+VC  PS+ I WDG+HLTEAAY+ +  GLL GPFTSP
Sbjct  305   GST-SSVCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSP  345



>dbj|BAK06933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   345 bits (885),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 218/348 (63%), Gaps = 5/348 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A  C   + SFGDSL DTGN   +   +++   +   PYGETFF   TGR+SDGRLI+DF
Sbjct  34    AAPCVPRVFSFGDSLADTGNFPFL-YGNDSREPALRTPYGETFFRRATGRFSDGRLIVDF  92

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A +MGLPFV PY  G+T  D  FA G NFAV GA A+   FF  RG+      + LG E
Sbjct  93    IADTMGLPFVRPYLSGRTAED--FASGANFAVGGAMALAPDFFRGRGVPMG-DRMHLGVE  149

Query  979   LDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             + WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F P V+ 
Sbjct  150   MKWFHDLLDLLCPADRADCTGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPSVVA  209

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +YDP+TGC+ W+N+F++YH
Sbjct  210   KISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYDPETGCLRWMNEFSKYH  269

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N LL  EL  LR  H    IIYADYY AAM +YRSP  +G ++ L ACCGGGGPY  +  
Sbjct  270   NRLLIDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMT  329

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  330   ARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>ref|XP_006828273.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
 gb|ERM95689.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
Length=374

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/347 (49%), Positives = 220/347 (63%), Gaps = 5/347 (1%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             G Y ++ SFGDS++DTGNL+      N ++  A  PYG+TFF  PTGR SDGRLI+DF A
Sbjct  26    GRYSSLFSFGDSISDTGNLLL--SGDNPFIGIANPPYGQTFFKKPTGRCSDGRLIVDFFA  83

Query  1153  LSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELD  974
              ++GLPF+ PY   K+   + F KG+NFAVAGATA+  S+F  RG+    TN SL  +L+
Sbjct  84    EALGLPFLPPYLS-KSKSKKDFRKGMNFAVAGATALSYSYFESRGMGLLWTNKSLSVQLE  142

Query  973   WFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             WF+Q L S C   + CK YL++S+ L+GEIGGND+NY  LQ     E  ++VP VI  I 
Sbjct  143   WFQQFLPSLCHPGTDCKRYLKNSLFLVGEIGGNDFNYPLLQARSLHEARTYVPDVIKAIT  202

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
               ++ LI+ GA+ L+VPGN P GCS  YL+ F T+N  EY+P TGC+   N+F  Y+N  
Sbjct  203   EAVSVLIRLGAKTLVVPGNFPTGCSTLYLTVFQTNNKDEYEPSTGCLIRFNEFASYYNSK  262

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF--ENTLEACCGGGGPYNSNPHA  440
             LQ  +  LR+  P   IIYAD YN +MR   +P  +GF  E  L ACCGGGGPYN +   
Sbjct  263   LQDGIQALRKRFPKATIIYADNYNMSMRFVETPTLFGFPKERVLFACCGGGGPYNFDITK  322

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
              CGS     C  P+ Y  WDG+HLTEAAY++I   +L G F  P I 
Sbjct  323   TCGSPRVKACTYPAQYADWDGLHLTEAAYEFIAKAMLNGEFMHPPIK  369



>ref|XP_006844517.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
 gb|ERN06192.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
Length=378

 Score =   343 bits (881),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 224/346 (65%), Gaps = 5/346 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+ A+ SFGDSLTDTGNL  +       + S  LPYGETFFH PTGR SDGRLI+DF+A 
Sbjct  29    CHTALFSFGDSLTDTGNLKYLEHDQFFDIWS--LPYGETFFHRPTGRCSDGRLIVDFLAQ  86

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
              +GLP ++PY  G   G   F KG NFAV GATA+  S   E+G+    TN+SL N+L W
Sbjct  87    GLGLPMLQPYLSG-FHGAVEFRKGANFAVGGATALSPSLLREKGVEKLSTNISLENQLQW  145

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             F Q+L S C   + CKEY++ S+ L+GEIGGNDY +AF  G   +EV +FVP V+T I  
Sbjct  146   FYQLLPSICHPNNDCKEYMKRSIFLVGEIGGNDYYFAFNHGMKIDEVQAFVPDVVTSIMK  205

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
             T+  LI+ GA+ L+VPG +P GC    L+ F + N+S+YDPQTGC+   NDF  +HN  L
Sbjct  206   TVEGLIQKGARTLVVPGGIPFGCWTCVLTVFPSDNSSDYDPQTGCLIPFNDFLSFHNSKL  265

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLE-ACCGGGGPYNSNPHAY  437
             +  +  +R+  P   IIYADYYNA +R + SP  YGF ++T+  ACCG GGPYN +P   
Sbjct  266   EDGIQAMRKKFPQANIIYADYYNALLRFFESPELYGFPKDTVHMACCGVGGPYNFDPART  325

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             CG      C++PS  ++WDG+H TEAA + +V  LL G F  P I 
Sbjct  326   CGQPEVHSCENPSMRVNWDGLHPTEAASKHVVRALLSGEFLHPNIQ  371



>dbj|BAD61220.1| lanatoside 15'-O-acetylesterase-like [Oryza sativa Japonica Group]
 dbj|BAD61510.1| lanatoside 15'-O-acetylesterase-like [Oryza sativa Japonica Group]
Length=386

 Score =   343 bits (881),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 218/332 (66%), Gaps = 6/332 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C++ I SFGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF A 
Sbjct  39    CFERIFSFGDSLTDTGNFL-LSVPEDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDFFAE  97

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + GLPFV PY  G   GD  F +G NFAV GATA++ SFF +RG+  + T  SL  ++ W
Sbjct  98    AFGLPFVPPYLAG---GD--FRQGANFAVGGATALNGSFFRDRGVEPTWTPHSLDEQMQW  152

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L++   + S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VPKV+  I S
Sbjct  153   FKKLLTTVSSSESELNDIMTKSLFLVGEVGGNDYNHLIVRGKSLDELHELVPKVVGTITS  212

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I ELI  GA+ L+VPGN PIGC P YLS F +     YD +TGCI WLN+FTEYHN LL
Sbjct  213   AITELINLGAKKLVVPGNFPIGCVPLYLSIFPSQKEDYYDEKTGCIKWLNEFTEYHNRLL  272

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR L+P   IIYADYY AA+ ++ +P  +GF   L +CCG   PYN +P   CG
Sbjct  273   QEELEKLRNLYPDVSIIYADYYGAALNIFLAPLQFGFTVPLNSCCGSDAPYNCSPSILCG  332

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDG  335
                S VC  PS Y SWDG+H TEA Y+ I+ G
Sbjct  333   HPGSVVCSDPSKYTSWDGLHFTEATYKIIIQG  364



>ref|XP_010232088.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Brachypodium 
distachyon]
Length=404

 Score =   344 bits (882),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 223/354 (63%), Gaps = 5/354 (1%)
 Frame = -1

Query  1360  FVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSD  1181
             F + G  A  C   + SFGDSL DTGN   +   +++   +   PYGETFF   TGR+SD
Sbjct  30    FQARGAPAVACVPRVFSFGDSLADTGNFPFL-YGNDSREPALRRPYGETFFRRATGRFSD  88

Query  1180  GRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCT  1001
             GRLI+DF+A +MGLPFV PY  G +  D  FA G NFAV GA A+   FF  RG+     
Sbjct  89    GRLIVDFIADTMGLPFVRPYLSGGSVED--FAYGANFAVGGAMALSSDFFRGRGVPMG-D  145

Query  1000  NVSLGNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMS  824
              + LG E+ WF+ +L   C    + C+  +  S+ L+GEIGGNDYN   L   P E++ +
Sbjct  146   RMHLGIEMKWFRNLLDLLCPVDRADCRGLMNKSLFLVGEIGGNDYNIPLLSRVPFEKIRT  205

Query  823   FVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWL  644
             F P V+  I+STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+
Sbjct  206   FTPSVVAKISSTITELIGLGAKTLVVPGNLPIGCIPNYLMIFKSDKKEDYEPETGCLRWM  265

Query  643   NDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGG  464
             N+F++YHN+LL  EL  LR+LH    +IYADYY AAM +YRSP  +G E+ L ACCGGGG
Sbjct  266   NEFSQYHNKLLVDELEKLRKLHHGVSLIYADYYGAAMEIYRSPEQFGIEHPLAACCGGGG  325

Query  463   PYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             PY  +  + CG     VC  P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  326   PYGVSITSRCGYGEYKVCHDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSI  379



>dbj|BAJ93079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   345 bits (884),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 218/348 (63%), Gaps = 5/348 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A  C   + SFGDSL DTGN   +   +++   +   PYGETFF   TGR+SDGRLI+DF
Sbjct  34    AAPCVPRVFSFGDSLADTGNFPFL-YGNDSREPALRTPYGETFFRRATGRFSDGRLIVDF  92

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A +MGLPFV PY  G+T  D  FA G NFAV GA A+   FF  RG+      + LG E
Sbjct  93    IADTMGLPFVRPYLSGRTAED--FASGANFAVGGAMALAPDFFRGRGVPMG-DRMHLGVE  149

Query  979   LDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             + WF  +L   C    + C   +  S+ L+GEIGGNDYN   L   P E++ +F P V+ 
Sbjct  150   MKWFHDLLDLLCPADRADCTGMMNQSLFLVGEIGGNDYNIPLLSRVPFEKIRTFTPSVVA  209

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+ST+ ELI  GA+ L+VPGNLPIGC P+YL  F +    +YDP+TGC+ W+N+F++YH
Sbjct  210   KISSTVTELIGLGAKTLVVPGNLPIGCVPNYLMIFKSDKKEDYDPETGCLRWMNEFSKYH  269

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N LL  EL  LR  H    IIYADYY AAM +YRSP  +G ++ L ACCGGGGPY  +  
Sbjct  270   NRLLIDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMT  329

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             A CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I+
Sbjct  330   ARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>ref|XP_010480704.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Camelina sativa]
Length=352

 Score =   342 bits (876),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 220/323 (68%), Gaps = 7/323 (2%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGC--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGET  1214
             +  +I L   V++ +    C  +K+I+SFGDS+ DTGNL+ ++   N    SA  PYGE+
Sbjct  12    LVSFILLAFLVTSLNAQMQCKNFKSIISFGDSIADTGNLLSLA-DPNDLPGSAFPPYGES  70

Query  1213  FFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSF  1034
             F  HPTGR+SDGRLIIDF+A  +GLP V P++G +     +F KGVNFAVAGATA++ SF
Sbjct  71    FLKHPTGRFSDGRLIIDFIAEFLGLPLVPPFYGSQHA---NFEKGVNFAVAGATALESSF  127

Query  1033  FTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
                RGI +S TN SLG +L  FK+ L   C +PS CK+ +E+++ILMGEIGGNDYN+A  
Sbjct  128   LERRGIHSSITNFSLGVQLRSFKESLPCLCVSPSDCKDTIENALILMGEIGGNDYNFALF  187

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
             Q    EEV   VP VI  I+S I EL++ G +  +VPGN P+GCS +YL+ + TS   EY
Sbjct  188   QRKAIEEVKELVPLVIATISSAITELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSTKEEY  247

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-E  497
             DP TGC+ WLNDF +YH+E LQ ELN L+ L+P+  IIYADYYNA +RLY+ P  +GF +
Sbjct  248   DPLTGCLTWLNDFGKYHSEQLQTELNRLKNLYPNVNIIYADYYNALLRLYQEPTKFGFIK  307

Query  496   NTLEACCGGGGPYNSNPHAYCGS  428
               L ACCG GG YN N    CGS
Sbjct  308   RPLPACCGLGGLYNFNFTRKCGS  330



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score =   342 bits (876),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 224/342 (65%), Gaps = 6/342 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y+AI +FGDSL+DTGN +     + A+ +   LPYGETFF   TGR SDGRL++DF+A +
Sbjct  24    YEAIFNFGDSLSDTGNFLL--SGALAFPVIGKLPYGETFFQRATGRCSDGRLVVDFIAEA  81

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
             +GLP + PY     +  +    GVNFAVAGATA+D  FF +R I +   TN SL  +L W
Sbjct  82    LGLPHLPPYLA--LSKGQDVKHGVNFAVAGATALDPQFFYQRKIGSVLWTNDSLSTQLGW  139

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++  S C T   C  Y + ++ L+GEIGGNDYNYAF  G   +++ + VP V+  I  
Sbjct  140   FKKLKPSLCTTKQECDNYFKKALFLVGEIGGNDYNYAFFVGGNIKQLKASVPFVVEAITQ  199

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
               + LI+ GA  L+VPGNLPIGCS  YL+ F + N + YD + GC+   N F++YHN  L
Sbjct  200   ATSALIEEGAVELVVPGNLPIGCSAVYLTLFRSPNEAVYDKRNGCLKAFNGFSKYHNSEL  259

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             ++ L  LR  +PH RIIYADYY AAM  Y +P +YGF++ TL ACCGGGGPYN N  A C
Sbjct  260   KRALGALRLKYPHARIIYADYYGAAMPFYHAPQHYGFKSGTLRACCGGGGPYNFNNSARC  319

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
             G   ST C  PSSY +WDG+HLTEAAY  I  GL+ G F +P
Sbjct  320   GHIGSTACKDPSSYANWDGIHLTEAAYGHIAKGLIHGRFATP  361



>ref|XP_003569457.2| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Brachypodium 
distachyon]
Length=424

 Score =   344 bits (882),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 223/354 (63%), Gaps = 5/354 (1%)
 Frame = -1

Query  1360  FVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSD  1181
             F + G  A  C   + SFGDSL DTGN   +   +++   +   PYGETFF   TGR+SD
Sbjct  30    FQARGAPAVACVPRVFSFGDSLADTGNFPFL-YGNDSREPALRRPYGETFFRRATGRFSD  88

Query  1180  GRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCT  1001
             GRLI+DF+A +MGLPFV PY  G +  D  FA G NFAV GA A+   FF  RG+     
Sbjct  89    GRLIVDFIADTMGLPFVRPYLSGGSVED--FAYGANFAVGGAMALSSDFFRGRGVPMG-D  145

Query  1000  NVSLGNELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMS  824
              + LG E+ WF+ +L   C    + C+  +  S+ L+GEIGGNDYN   L   P E++ +
Sbjct  146   RMHLGIEMKWFRNLLDLLCPVDRADCRGLMNKSLFLVGEIGGNDYNIPLLSRVPFEKIRT  205

Query  823   FVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWL  644
             F P V+  I+STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+
Sbjct  206   FTPSVVAKISSTITELIGLGAKTLVVPGNLPIGCIPNYLMIFKSDKKEDYEPETGCLRWM  265

Query  643   NDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGG  464
             N+F++YHN+LL  EL  LR+LH    +IYADYY AAM +YRSP  +G E+ L ACCGGGG
Sbjct  266   NEFSQYHNKLLVDELEKLRKLHHGVSLIYADYYGAAMEIYRSPEQFGIEHPLAACCGGGG  325

Query  463   PYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             PY  +  + CG     VC  P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  326   PYGVSITSRCGYGEYKVCHDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSI  379



>ref|XP_010052214.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   342 bits (876),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 224/343 (65%), Gaps = 6/343 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI +FGDS +DTGN   +   + AY     LPYGETFFHH TGR S+GRLIIDF+A +
Sbjct  27    YNAIFNFGDSYSDTGNF--LITGALAYPEIKNLPYGETFFHHATGRCSNGRLIIDFIAEA  84

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
              GLP++ PY             GVNFAVAGATA+D SFF+ + I    TN SL  +L WF
Sbjct  85    FGLPYLPPYLA--VAEGPPVRMGVNFAVAGATAIDASFFSAQNI-TLWTNDSLNVQLGWF  141

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             + + SS C T   C EY + S+ L+GEIG NDYN++FL G   E++   VP+++  I   
Sbjct  142   QSLKSSLCTTKQECDEYFKKSLFLVGEIGENDYNFSFLFGRTIEQLRPLVPQIVGAIIRA  201

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YHN  L+
Sbjct  202   VSILIEEGAVNLVVPGQLPTGCISLYLTLFQSANESAYDPKTGCLKAYNALFKYHNNYLK  261

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
             +EL  LRE +PH R++YADYY A++ +YR+P  YGF    L ACCGGGGPYN N  AYCG
Sbjct  262   QELQKLREQYPHARVMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYCG  321

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
                STVC  PS+++ WDG+H TE+AY +I  GL+ G F SP +
Sbjct  322   QPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>ref|XP_010052216.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76154.1| hypothetical protein EUGRSUZ_D00533 [Eucalyptus grandis]
Length=386

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 233/369 (63%), Gaps = 9/369 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGH---VAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYG  1220
             A+   +F +LF  +      + G Y+AI +FGDSL+DTGN +R    + A+ +   LPYG
Sbjct  21    AMKILVFFLLFCLSSDPILSSPGRYEAIFNFGDSLSDTGNFLR--SGALAFPVIGKLPYG  78

Query  1219  ETFFHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDM  1040
             ETFF H TGR SDGRLI+DF+A + GLP + PY             GVNFAVAGATA+D 
Sbjct  79    ETFFRHATGRCSDGRLIVDFIAEAFGLPHLPPYLA--VAKGPHVRTGVNFAVAGATALDS  136

Query  1039  SFFTERGIINSC-TNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNY  863
             SFF  + I     TN SL  +L WFK + SS C T  +C EY   S+ L+GEIGGNDYNY
Sbjct  137   SFFYAKKIGPLMWTNDSLSVQLRWFKNLKSSLCTTKQQCDEYFNRSLFLVGEIGGNDYNY  196

Query  862   AFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNA  683
                 G   +++ + VP V+  I   +  LI+ GA  L+VPGNLP+GCS  YL+ F + + 
Sbjct  197   PSFVGASIKQLHALVPLVVGAITRAVGMLIEEGAVNLVVPGNLPVGCSAVYLTLFHSPDK  256

Query  682   SEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYG  503
             S YDP TGC+   N F +YHN  L++EL +LRE +PH RI+YADYY AA+ +Y +P +YG
Sbjct  257   SAYDPGTGCLKAYNVFAKYHNNYLKQELQNLREQYPHARIMYADYYGAALPIYHTPKHYG  316

Query  502   F-ENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLI  326
             F   TL ACCGGGGP+N N  A CG   ST C  PS++ +WDG+HLTE+AY  I   L+ 
Sbjct  317   FYGGTLRACCGGGGPFNFNNSARCGHTGSTACRDPSAFANWDGIHLTESAYHHIAKRLIY  376

Query  325   GPFTSPKIN  299
             G F SP + 
Sbjct  377   GGFISPPLR  385



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 237/364 (65%), Gaps = 10/364 (3%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             + + + L+  VST H+    Y AI +FGDSL+DTGN   +   + A+ +   LPYGETFF
Sbjct  6     LVFALCLLRSVSTSHLK---YHAIFNFGDSLSDTGNF--LVSGALAFPVIGKLPYGETFF  60

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
              H TGR SDGRL+IDFMA +  LP++ PY   K    ++F  GVNFAVAGATA+  + F 
Sbjct  61    RHATGRCSDGRLVIDFMAEAFRLPYLPPYLALKE--GQNFKHGVNFAVAGATALRSAIFY  118

Query  1027  ERGIINSC-TNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
             ++ I +   TN SL  ++DWFK++ SS C T   C+ Y + S+  +GEIGGNDYNY    
Sbjct  119   KQKIGSRLWTNDSLSVQIDWFKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFV  178

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
             G    ++ + VP V+  I +    LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD
Sbjct  179   GESINQLRASVPLVVKAITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD  238

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-  494
              + GC+   N F  YHN +L+ EL+ LR+ +PH  IIYADYY AAMR Y +P +YGF N 
Sbjct  239   -RNGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNG  297

Query  493   TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              ++ACCGGGGPYN N  A CG   S  C++PS++ +WDG+HLTEAAY+ + +GL+ GPF 
Sbjct  298   AVKACCGGGGPYNFNNSARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFA  357

Query  313   SPKI  302
             +P +
Sbjct  358   TPSL  361



>ref|NP_001149136.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACG34335.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=402

 Score =   342 bits (877),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 224/347 (65%), Gaps = 7/347 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+  +  FGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF A 
Sbjct  33    CFDRMFGFGDSLTDTGNFL-LSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFAE  91

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + GLP+V PY G   +GD  F  G NFAV GATA++ SFF ERG+  + T  SL  ++ W
Sbjct  92    AFGLPYVPPYLG---SGD--FQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQW  146

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L     + +   E +  S++ +GEIGGNDYN+  ++    +E+   VP V+  I+S
Sbjct  147   FKKLLPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVGAISS  206

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYHN +L
Sbjct  207   GITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRML  266

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P   CG
Sbjct  267   QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCG  326

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  327   RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSEAC  372



>ref|XP_010041182.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   340 bits (873),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 221/343 (64%), Gaps = 6/343 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI +FGDS +DTGN   +   +  Y     LPYGETFFHH TGR S+GRLIIDF+A +
Sbjct  27    YNAIFNFGDSHSDTGNF--LITGALVYPEIKNLPYGETFFHHATGRCSNGRLIIDFIAEA  84

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
              GLP++ PY             GVNFAVAGATA+D SFF+ + I    TN SL  +L WF
Sbjct  85    FGLPYLPPYLA--VAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWF  141

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++  I   
Sbjct  142   KSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVGAIIRA  201

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YHN  L+
Sbjct  202   VSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYLK  261

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
             +EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N  AYCG
Sbjct  262   QELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYCG  321

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
                STVC  PS+++ WDG+H TEAAY +I  GL+ G F SP +
Sbjct  322   QSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLIDGGFISPPL  364



>gb|ACL53525.1| unknown [Zea mays]
 gb|AFW83241.1| alpha-L-fucosidase 2 [Zea mays]
Length=432

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 224/347 (65%), Gaps = 7/347 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+  +  FGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF A 
Sbjct  63    CFDRMFGFGDSLTDTGNFL-LSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFAE  121

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + GLP+V PY G   +GD  F  G NFAV GATA++ SFF ERG+  + T  SL  ++ W
Sbjct  122   AFGLPYVPPYLG---SGD--FQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQW  176

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L     + +   E +  S++ +GEIGGNDYN+  ++    +E+   VP V+  I+S
Sbjct  177   FKKLLPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVGAISS  236

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYHN +L
Sbjct  237   GITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRML  296

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P   CG
Sbjct  297   QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCG  356

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  357   RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSEAC  402



>ref|XP_007025435.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY28057.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=343

 Score =   339 bits (869),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/318 (53%), Positives = 209/318 (66%), Gaps = 16/318 (5%)
 Frame = -1

Query  1240  SAVLPYGETFFHHPTGRYSDGRLIIDFMA-LSMGLPFVEPYFGGKTTGDRSFAKGVNFAV  1064
             +A  PYGETFF  PTGR+SDGRL+IDF   +     +    FG     +  F KGVNFAV
Sbjct  33    AAFPPYGETFFKQPTGRFSDGRLVIDFFGNIISDFHWYHHKFGAGNGRNHKFLKGVNFAV  92

Query  1063  AGATAMDMSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEI  884
             AGATA+D +F  ++GIIN  TNVSLG +++               C E LE+S+ILMGEI
Sbjct  93    AGATALDNAFLAQKGIINPATNVSLGVQVE---------------CNELLENSLILMGEI  137

Query  883   GGNDYNYAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLS  704
             GGND+N+AF QG   E +   VP VI  I+S I EL+K GA  ++VPGNLPIGC P YL+
Sbjct  138   GGNDFNFAFFQGITTEVIQGLVPDVINAISSAIQELMKLGAVTILVPGNLPIGCLPIYLT  197

Query  703   YFMTSNASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLY  524
              F TSN  +Y   TGC+ WLNDF++Y+N +L+ ELN +R+LHP   I+YADYY AA+  Y
Sbjct  198   RFQTSNKQDYGRSTGCLTWLNDFSQYYNGMLKNELNKIRKLHPFANIVYADYYQAAIPFY  257

Query  523   RSPNNYGFENTLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWI  344
             RSP  +GF +TL ACCGGGGPYN N    CGS  +T C  PSSY+SWDG+HLTEA Y  I
Sbjct  258   RSPRQFGFNSTLTACCGGGGPYNFNLSLGCGSPGTTSCGDPSSYVSWDGIHLTEATYGLI  317

Query  343   VDGLLIGPFTSPKINGEC  290
                LL G  T P++   C
Sbjct  318   SKALLDGSSTIPRLKILC  335



>ref|XP_004134931.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis sativus]
Length=380

 Score =   340 bits (873),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 235/361 (65%), Gaps = 9/361 (2%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GCY +I +FGDSL+DTGNL     S N    +   PYGETFFH PTGR+S+GRL++DF A
Sbjct  21    GCYTSIFNFGDSLSDTGNLYFTCSSPNP-SHACFFPYGETFFHLPTGRFSNGRLVLDFFA  79

Query  1153  LSMGLPFVEPYFG---GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGN  983
             +S+GLP V+PY     G T  D  F KG+NFAV GATA+D+SFF + GI       SL  
Sbjct  80    MSLGLPPVQPYRSVEQGFTAED--FQKGLNFAVGGATALDLSFFQQSGINLPRAVDSLRI  137

Query  982   ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
             + + F Q  SS C  +P +CK+ L+SSV ++GEIGGNDY Y FL     EE+ S V  VI
Sbjct  138   QFNSFNQSYSSICASSPPKCKDTLKSSVFIVGEIGGNDYAY-FLYDKRIEELKSLVLLVI  196

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               IAS I ELI+ G + L+VP N+P+GC P  +  + TS+ S++DPQ GC+ WLN F+EY
Sbjct  197   NEIASVILELIELGVETLMVPSNIPMGCIPVLIQLYKTSDDSQFDPQNGCLKWLNKFSEY  256

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  446
             HN+ LQ++L  +R LHPH  +IY DY+NAAMR+Y +P ++G    L+ CC       S P
Sbjct  257   HNQQLQQQLKRIRVLHPHVHLIYVDYFNAAMRIYNAPKDFGLIEPLQVCCVDKNGSYSIP  316

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
                CG+  + VCD PS Y+SWDG+HLTEAAY+ +   ++ G FT P+ +  C+     ++
Sbjct  317   TP-CGTAGTIVCDDPSKYVSWDGIHLTEAAYELMATSIVNGSFTFPQFSLSCLQRNTSSQ  375

Query  265   I  263
             +
Sbjct  376   L  376



>ref|XP_010052212.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=392

 Score =   341 bits (874),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 222/343 (65%), Gaps = 6/343 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI +FGDS +DTGN   +   + AY     LPYGETFFHH TGR S+GRLIIDF+A +
Sbjct  27    YNAIFNFGDSHSDTGNF--LITGALAYPEIKNLPYGETFFHHATGRCSNGRLIIDFIAEA  84

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
              GLP++ PY             GVNFAVAGATA+D SFF+ + I    TN SL  +L WF
Sbjct  85    FGLPYLPPYLA--VAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWF  141

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++  I   
Sbjct  142   KSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVGAIIRA  201

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YHN  L+
Sbjct  202   VSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYLK  261

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
             +EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N  AYCG
Sbjct  262   QELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYCG  321

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
                STVC  PS+++ WDG+H TE+AY +I  GL+ G F SP +
Sbjct  322   QSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>ref|XP_006644439.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=405

 Score =   341 bits (874),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 221/346 (64%), Gaps = 4/346 (1%)
 Frame = -1

Query  1342  VAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIID  1163
             +A  CY  + SFGDSL DTGN+  +S +++    S   PYGETFFH  TGR S+GRL+ID
Sbjct  36    LAAPCYPRLFSFGDSLADTGNVAFLS-ANDPGKSSLWPPYGETFFHRATGRCSNGRLVID  94

Query  1162  FMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGN  983
             F+A ++GLP V PY+ G++  D  FA G NFAV GATA+   FF  RG+      V L  
Sbjct  95    FIAEALGLPSVRPYWSGQSVED--FAYGANFAVGGATALGPDFFRARGMPLRNGTVHLDM  152

Query  982   ELDWFKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
             E+ WF+ +L   C    + CK  +  S+ L+GE GGNDYNY  L G    ++ SF P +I
Sbjct  153   EMKWFRDLLDLLCPGDLAGCKGMMNESLFLVGEFGGNDYNYPLLNGVSINKIRSFTPHII  212

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               I+STI ELI  GA+ ++VPGNLPIGC P+YL  F +    +Y+ +TGC+ WLN+F++Y
Sbjct  213   AKISSTITELIGLGAKTMVVPGNLPIGCIPNYLVKFESDEKEDYELETGCLRWLNEFSQY  272

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  446
             HN+ L  EL  LR+LHP   IIYADYY A+M ++ SP  +G E+ L ACCGGGGPY  + 
Sbjct  273   HNKHLTDELEKLRKLHPDVAIIYADYYGASMEIFLSPEQFGIEDPLVACCGGGGPYGVSA  332

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
                CG     VCD P  Y SWDG H +EAAY+ I  GLL G +T P
Sbjct  333   SVRCGHGEYKVCDGPEKYASWDGFHPSEAAYKAITIGLLRGSYTQP  378



>ref|XP_006644440.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=404

 Score =   341 bits (874),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 226/344 (66%), Gaps = 5/344 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY+ + SFGDSLTDTGN   +   +++   +   PYGETFF   TGR+SDGRL++DF+A 
Sbjct  40    CYQRLFSFGDSLTDTGNFPFIF-GNDSREPALRPPYGETFFRRATGRFSDGRLVVDFIAD  98

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             ++GLPFV PY+ G+T GD  FA+G NFAV GATA+   FF  RG+  +   V L  E+ W
Sbjct  99    ALGLPFVRPYWSGRTAGD--FARGANFAVGGATALRPDFFRARGVPMA-DIVHLDMEMKW  155

Query  970   FKQMLSSFCQTP-SRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             F+ +L   C    S C   +  S+ L+GEIGGNDYN   L+G    ++ SF P VI  I+
Sbjct  156   FRDLLGLLCPGDLSGCTGMINQSLFLVGEIGGNDYNLPLLRGVSITKIRSFTPSVIAKIS  215

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
             STI ELI  GA+ L+VPGNLPIGC P+YL  F +    +Y+P+TGC+ W+N+F++YHN+L
Sbjct  216   STITELIGLGAKTLLVPGNLPIGCVPNYLMIFKSDKKEDYEPETGCLRWMNEFSQYHNKL  275

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYC  434
             L  EL  LR+LHP   IIYADYY AAM +Y SP  +G E+ L ACCGGGG Y  +  A C
Sbjct  276   LTDELEKLRKLHPDVAIIYADYYGAAMEIYLSPEQFGIEDPLAACCGGGGQYGVSGTARC  335

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G     VCD P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  336   GYGEYKVCDDPQKYGSWDGFHPSEAAYKAIAIGLLRGSYTQPSI  379



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score =   339 bits (869),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 236/364 (65%), Gaps = 10/364 (3%)
 Frame = -1

Query  1387  ITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             + + + L+  VST H+    Y AI +FGDSL+DTGN   +   + A+ +   LPYGETFF
Sbjct  6     LVFALCLLRSVSTSHLK---YHAIFNFGDSLSDTGNF--LVSGALAFPVIGKLPYGETFF  60

Query  1207  HHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFT  1028
              H TGR SDGRL+IDFMA +  LP++ PY   K    ++F  GVNFAVAGATA+    F 
Sbjct  61    RHATGRCSDGRLVIDFMAEAFRLPYLPPYLALKE--GQNFKHGVNFAVAGATALRSVIFY  118

Query  1027  ERGIINSC-TNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQ  851
             ++ I +   TN SL  ++DWFK++ SS C T   C+ Y + S+  +GEIGGNDYNY    
Sbjct  119   KQKIGSRLWTNDSLSVQIDWFKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFV  178

Query  850   GHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYD  671
             G    ++ + VP V+  I +    LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD
Sbjct  179   GESINQLRASVPLVVKAITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD  238

Query  670   PQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-  494
              + GC+   N F  YHN +L+ EL+ LR+ +PH  IIYADYY AAMR Y +P +YGF N 
Sbjct  239   -RNGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNG  297

Query  493   TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFT  314
              ++ACCGGGGPYN N  A CG   S  C++PS++ +WDG+HLTE+AY+ + +GL+ GPF 
Sbjct  298   AVKACCGGGGPYNFNNSARCGHTGSRACENPSTHANWDGIHLTESAYRHVANGLIHGPFA  357

Query  313   SPKI  302
             +P +
Sbjct  358   TPSL  361



>ref|XP_007148063.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
 gb|ESW20057.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
Length=370

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 236/366 (64%), Gaps = 8/366 (2%)
 Frame = -1

Query  1390  AITYYIFLVLFVSTGHVAGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETF  1211
             AIT+  F        + + G Y AI +FGDSL+DTGN   ++  + +Y +    PYGETF
Sbjct  4     AITFLTFGFHEKVVSNPSPGPYNAIFNFGDSLSDTGNF--LASGALSYPVIGKFPYGETF  61

Query  1210  FHHPTGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFF  1031
             F+  TGR SDGRL+IDF+A +  LP++ PY     T D++   GVNFAVAGATA+D  FF
Sbjct  62    FNRSTGRCSDGRLVIDFIAEAYELPYLPPYLA--LTKDQNIHLGVNFAVAGATALDAKFF  119

Query  1030  TERGIINSC-TNVSLGNELDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFL  854
              E G+     TN SL  +L WFK++  S C T   C  Y E S+ L+GEIGGNDYNYA +
Sbjct  120   IEAGLGRFLWTNSSLNVQLGWFKKLKPSLCSTKQDCGSYFERSLFLVGEIGGNDYNYAAI  179

Query  853   QGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEY  674
              G+   ++ + VP V+  I + INELI  GA+ L+VPGNLPIGCS  YL+ + + N  +Y
Sbjct  180   AGN-ITQLQATVPPVVETITTAINELIAEGARELLVPGNLPIGCSALYLTLYGSGNKEDY  238

Query  673   DPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN  494
             D   GC+   NDF EYHN+ L+  L  LR+ +PH RI+YADYY+ A R + +P +YGF +
Sbjct  239   D-GDGCLKGFNDFAEYHNKELKLALKTLRQKNPHARILYADYYDVAKRFFHAPGHYGFSS  297

Query  493   -TLEACCGGGGPYNSNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPF  317
               L ACCGGGG YN N  A CG   S VC  PS++ +WDG+HLTEAAY++I  GL+ GPF
Sbjct  298   GALRACCGGGGAYNFNMSARCGHIGSKVCADPSTHANWDGIHLTEAAYRYIAKGLIYGPF  357

Query  316   TSPKIN  299
             + P + 
Sbjct  358   SYPPLK  363



>ref|XP_008812188.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=377

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 220/347 (63%), Gaps = 27/347 (8%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+ +I SFGDSL DTGN +  + ++ + V    LPYGET+FH PTGR+SDGR        
Sbjct  32    CFNSIFSFGDSLADTGNFLSYAGANASNV--GRLPYGETYFHRPTGRFSDGR--------  81

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
                                 F +G NFAV GATA+   FF+ +G+  + T  SLG +++ 
Sbjct  82    -----------------KHGFGQGANFAVGGATALANDFFSAKGLNVTWTKYSLGIQIEQ  124

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+L S C + S C ++L +++ LMGEIGGNDYN+ F+QG   EE+ ++VP VI+ I+S
Sbjct  125   FKQLLPSLCSSDSGCHDFLNNTLFLMGEIGGNDYNHPFIQGRTVEEITTYVPSVISAISS  184

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
             +I  LI  GA+ L+VPGN PIGC P YL+ F  S+   YDPQTGCINWLN F+EYHN LL
Sbjct  185   SIKVLIDLGAKTLVVPGNFPIGCVPLYLALFQNSSKGNYDPQTGCINWLNKFSEYHNRLL  244

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
               ELN LR+LHP   IIYA+YY A + + RSP  YG E T  ACCG  GP N      CG
Sbjct  245   MDELNKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVTSPVLCG  304

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                +TVC  PS YISWDG+HLTEAAY  I  GLL GP+T+P +   C
Sbjct  305   DPAATVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYTAPPMIRAC  351



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 226/347 (65%), Gaps = 12/347 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAV--LPYGETFFHHPTGRYSDGRLIIDFMA  1154
             YKAI + GDSL+DTGN +    +S A +   +   PYG+TFF   TGR SDGRL+IDF+A
Sbjct  29    YKAIFNLGDSLSDTGNFL----ASGAILFPVIGKPPYGQTFFKRATGRCSDGRLMIDFIA  84

Query  1153  LSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNEL  977
              +  LP++ PY     T D+   +GVNFAVAGATA+D  FF E G+     TN SL  +L
Sbjct  85    EAYELPYLPPYLA--LTKDKDIQRGVNFAVAGATALDAKFFIEAGLAKYLWTNNSLSIQL  142

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
              WFK++  S C T   C  Y + S+ L+GEIGGNDYNYA + G+   ++ + VP V+  I
Sbjct  143   GWFKKLKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAGN-ITQLQATVPPVVEAI  201

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
              + INELI  GA+ L+VPGN PIGCS  YL+ F + N  +YD  +GC+   N F EYHN+
Sbjct  202   TAAINELIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-DSGCLKTFNGFAEYHNK  260

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHA  440
              L+  L  LR+ +PH RI+YADYY AA R + +P ++GF N  L ACCGGGGPYN N  A
Sbjct  261   ELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPYNFNISA  320

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
              CG   S  C  PS+Y +WDG+HLTEAAY++I  GL+ GPF+ P + 
Sbjct  321   RCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  367



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 229/348 (66%), Gaps = 13/348 (4%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAV--LPYGETFFHHPTGRYSDGRLIIDFMA  1154
             ++AI +FGDSL+DTGN +    +S A +   +  LPYGETFF H TGR SDGRL+IDF+A
Sbjct  29    FEAIFNFGDSLSDTGNFL----ASGAILFPVIGKLPYGETFFQHATGRCSDGRLVIDFIA  84

Query  1153  LSMGLPFVEPYFGGKTTGD-RSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNE  980
              + GLP+++PY   K T D +    GVNFAVAGATA+D+ FF + G+     TN SL  +
Sbjct  85    EAYGLPYLQPYL--KVTKDHQKIYNGVNFAVAGATALDVEFFIQEGLAKLLWTNDSLNIQ  142

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             L WFK++  S C T   C  Y + S+ ++GEIGGNDYNYA   G+   ++ + VP V+  
Sbjct  143   LGWFKKLKPSLCTTKQDCDSYFKKSLFVVGEIGGNDYNYAAFAGN-ISDLQATVPLVVEE  201

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I  TI ELI  GA  L+VPGNLPIGCS  YL+ F + N  +YD + GC+   N F +YHN
Sbjct  202   ITKTITELIAEGAVELLVPGNLPIGCSAVYLTLFRSKNIEDYD-KNGCLKAFNGFAKYHN  260

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPH  443
             + L   L  LR+ +PH RIIYA+Y+ AA R + +P +YGF N    ACCGGGGPYN N  
Sbjct  261   KQLNLALETLRQKNPHARIIYANYFGAANRFFHAPRHYGFTNGASRACCGGGGPYNFNNS  320

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             A CG   S  C  P++Y +WDG+HLTEAAY+ I  GL+ GPFT+P +N
Sbjct  321   ARCGHSNSKACADPTTYANWDGIHLTEAAYRHIAKGLIEGPFTNPPLN  368



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score =   338 bits (868),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 227/342 (66%), Gaps = 6/342 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y+AI +FGDSL+DTGN +     + A+ +   LPYGETFF H TGR SDGRL++DF+  +
Sbjct  29    YQAIFNFGDSLSDTGNFLL--SGALAFPVIGKLPYGETFFQHATGRCSDGRLVVDFIVEA  86

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGI-INSCTNVSLGNELDW  971
              GLP + PY     T D     GVNFAVAGATA+D  FF +R I +   TN SL  +L W
Sbjct  87    FGLPLLPPYLALNKTQD--IQHGVNFAVAGATALDPEFFYQRKIGLAMWTNDSLSTQLGW  144

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++  S C T   C  Y + ++ L+GEIGGNDYNYAF  G   +++ + VP V+  I +
Sbjct  145   FKKLKPSLCSTKQECDNYFKKTLFLVGEIGGNDYNYAFFVGGNIKQLKASVPYVVGAITN  204

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
               + LI+ GA  L+VPGNLPIGCS  YL+ F T N S YD + GC+   N F++YHN  L
Sbjct  205   ATSALIEEGAVELLVPGNLPIGCSAVYLTLFQTPNRSYYDKRNGCLKAFNTFSKYHNSEL  264

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             ++ L  LR+ +PH  IIYADYY AAM  + +P +YGF++ TL ACCGGGGPYN N  A C
Sbjct  265   KRALATLRQKYPHVNIIYADYYGAAMPFFHAPQHYGFKSGTLRACCGGGGPYNFNNSARC  324

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSP  308
             G   ST C  PSSY++WDG+HLTEAAY++I  GL+ G FT P
Sbjct  325   GHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHGQFTKP  366



>ref|XP_004969325.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=399

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 227/347 (65%), Gaps = 5/347 (1%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
             A GCY  + SFGDSL DTGN   +  +++   +   LPYGETFFH PTGR+SDGR+++DF
Sbjct  32    AAGCYPRVFSFGDSLADTGNYAFVYGNNSNPALR--LPYGETFFHRPTGRFSDGRIVVDF  89

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
             +A ++GLPFV PY  G++  D  FA G NFAV GATA+  +FF +RG       V L  E
Sbjct  90    IADTLGLPFVPPYLSGRSAED--FACGANFAVGGATALSPAFFRDRGFDGMGNRVHLDME  147

Query  979   LDWFKQMLSSFCQ-TPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVIT  803
             + WF+++L   C    + C   +  S+ L+GEIGGNDYN   +   P E++ +F P V+ 
Sbjct  148   MKWFRELLDLLCPGNLAGCSNMMNQSLFLIGEIGGNDYNIPLISRVPFEKIRTFTPSVVA  207

Query  802   VIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYH  623
              I+STI ELI+ GA+ L+VPGNLPIGC P YL  F +    +Y+P TGC+ W+N F+ YH
Sbjct  208   KISSTITELIQLGAKTLVVPGNLPIGCVPKYLMMFKSDKEEDYEPHTGCLRWMNKFSRYH  267

Query  622   NELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPH  443
             N+LL KEL  LR+LHP   IIYADYY AAM ++ SP  YG E  L ACCGGGGP+  +P 
Sbjct  268   NKLLMKELKKLRKLHPGVTIIYADYYGAAMEIFLSPEQYGIEYPLVACCGGGGPHGVSPT  327

Query  442   AYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
               CG    TVC++P  Y SWDG H +EAAY+ I  GLL G +T P +
Sbjct  328   GGCGYGEYTVCNNPEKYGSWDGFHPSEAAYRAIAMGLLRGSYTQPPM  374



>ref|XP_004155631.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g28570-like 
[Cucumis sativus]
Length=380

 Score =   338 bits (868),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 234/361 (65%), Gaps = 9/361 (2%)
 Frame = -1

Query  1333  GCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMA  1154
             GCY +I +FGDSL+DTGNL     S N    +   PYGETFFH PTGR+S+GRL++DF A
Sbjct  21    GCYTSIFNFGDSLSDTGNLYFTCSSPNP-SHACFFPYGETFFHLPTGRFSNGRLVLDFFA  79

Query  1153  LSMGLPFVEPYFG---GKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGN  983
             +S+GLP V+PY     G T  D  F KG+NFAV GATA+D+SFF + GI       SL  
Sbjct  80    MSLGLPPVQPYRSVEQGFTAED--FQKGLNFAVGGATALDLSFFQQSGINLPRAVDSLRI  137

Query  982   ELDWFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVI  806
             + + F Q  SS C  +P +CK+ L+SSV ++GEIGGNDY Y FL     EE+ S V  VI
Sbjct  138   QFNSFNQSYSSICASSPPKCKDTLKSSVFIVGEIGGNDYAY-FLYDKRIEELKSLVLLVI  196

Query  805   TVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEY  626
               IAS I ELI+ G + L+VP N+P+GC P  +  + TS+ S++DPQ GC+ WLN F+EY
Sbjct  197   NEIASVILELIELGVETLMVPSNIPMGCIPVLIQLYKTSDDSQFDPQNGCLKWLNKFSEY  256

Query  625   HNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNP  446
             HN+ LQ++L  +R LHPH  +IY DY NAAMR+Y +P ++G    L+ CC       S P
Sbjct  257   HNQQLQQQLKRIRVLHPHVHLIYVDYXNAAMRIYNAPKDFGLIEPLQVCCVDKNGSYSIP  316

Query  445   HAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGECILSRPKTK  266
                CG+  + VCD PS Y+SWDG+HLTEAAY+ +   ++ G FT P+ +  C+     ++
Sbjct  317   TP-CGTAGTIVCDDPSKYVSWDGIHLTEAAYELMATSIVNGSFTFPQFSLSCLQRNTSSQ  375

Query  265   I  263
             +
Sbjct  376   L  376



>ref|XP_008812182.1| PREDICTED: GDSL esterase/lipase At1g28570-like, partial [Phoenix 
dactylifera]
Length=319

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 197/289 (68%), Gaps = 6/289 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY +I SFGDSL DTGN +  +         A LPYGET+F HPTGR+SDGRLIIDF+A 
Sbjct  31    CYTSIFSFGDSLADTGNFLHYANQGP----EARLPYGETYFQHPTGRFSDGRLIIDFIAQ  86

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             ++GLP V PY  G   GD  F +G NFAV GATA+D  FF  RG     T  SL  ++DW
Sbjct  87    AIGLPLVPPYLAGP--GDHGFRRGANFAVGGATALDNDFFRARGFDVYWTEYSLATQIDW  144

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L S C + S C+    SS+  +GEIGGNDYN  F+QG   +E+ +FVP VI+ I S
Sbjct  145   FKKLLPSLCSSDSECEGIFSSSLFFLGEIGGNDYNEPFIQGISVDEIRTFVPDVISTITS  204

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              +  LI+ GA+ L+VPGN PIGC P YL +F +  A +YDP+TGCI WLN+F+EYHN LL
Sbjct  205   ALKVLIELGAKTLVVPGNFPIGCVPLYLMHFQSPTAEDYDPETGCIKWLNEFSEYHNRLL  264

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGG  464
               EL  LR L+PH  I+YADYY A + ++RSP+ +GFE   +ACCGGGG
Sbjct  265   LDELGKLRRLYPHVAIVYADYYEALLSIFRSPHEFGFEKPFDACCGGGG  313



>ref|XP_011027710.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Populus euphratica]
Length=373

 Score =   337 bits (865),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 175/345 (51%), Positives = 227/345 (66%), Gaps = 6/345 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y +I +FGDSL+DTGN +     + A+ + A LPYGETFF H TGR SDGRL++DF++ +
Sbjct  29    YDSIFNFGDSLSDTGNFLL--SGALAFPVIAKLPYGETFFRHATGRCSDGRLVVDFISEA  86

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
              GLP + PY         SF  GVNFAVAGATA+D  FF ++ I     TN SL  +L W
Sbjct  87    SGLPHLPPYLALGKDQLHSF-HGVNFAVAGATALDAKFFYDQRIGKIMWTNDSLSVQLGW  145

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FKQ+ SS C +   C  Y + S+ L+GEIGGNDYNYA+  G   +++ + VP V+  IA 
Sbjct  146   FKQLKSSLCISKQECDNYFKKSLFLVGEIGGNDYNYAYFAGGSIKQLRASVPLVVEAIAK  205

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
               + LI+ GA  L+VPGNLPIGCS  YL+ F + N +EYD + GC+   N F++YHN  L
Sbjct  206   ATSFLIEEGAVELLVPGNLPIGCSAVYLTLFGSPNRTEYD-RNGCLKACNAFSKYHNNQL  264

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFE-NTLEACCGGGGPYNSNPHAYC  434
             +  L  LR+ +PH RIIYADYY AA R Y +P  +GF   TL ACCGGGGPYN N  A C
Sbjct  265   KTALQMLRQKYPHARIIYADYYGAAKRFYHAPQRHGFTGGTLTACCGGGGPYNFNNSARC  324

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
             G   S  C +PSS+ +WDG+HLTEAAY++I  GL+ G FT+P + 
Sbjct  325   GHMGSRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGSFTTPPLR  369



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score =   337 bits (864),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 169/344 (49%), Positives = 227/344 (66%), Gaps = 7/344 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI +FGDSL+DTGN   +   + A+ +   LPYGETFF H TGR SDGRL+IDFMA +
Sbjct  23    YHAIFNFGDSLSDTGNF--LVSGALAFPVIGKLPYGETFFRHATGRCSDGRLVIDFMAEA  80

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNELDW  971
               LP++ PY   K    ++F  GVNFAVAGATA+  + F ++ I +   TN SL  ++DW
Sbjct  81    FRLPYLPPYLALKE--GQNFKHGVNFAVAGATALRSAIFYKQKIGSRLWTNDSLSVQIDW  138

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++ SS C T   C+ Y + S+  +GEIGGNDYNY    G    ++ + VP V+  I +
Sbjct  139   FKKLKSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGGSINQLRASVPLVVKAITN  198

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
                 LI+ GA  L+VPGN PIGCS  YL+ F + N  +YD Q GC+   N F  YHN +L
Sbjct  199   ATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYD-QNGCLKAPNAFARYHNTML  257

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHAYC  434
             + +L+ LR+ +PH  IIYADYY AAMR Y +P +YGF N  ++ACCGGGGPYN N  A C
Sbjct  258   KAQLHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNNSARC  317

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G   S  C++PS++ +WDG+HLTEAAY+ + +GL+ GPF +P +
Sbjct  318   GHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>dbj|BAJ97312.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   338 bits (867),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 223/350 (64%), Gaps = 7/350 (2%)
 Frame = -1

Query  1339  AGGCYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDF  1160
              G C+  I SFGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF
Sbjct  32    GGVCFDRIFSFGDSLTDTGNFL-LSVPDDFPDPARSLPYGQTFFGRPSGRYSDGRNLLDF  90

Query  1159  MALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNE  980
              A +  LPFV PY GG   GD  F  G NFAV GATA++ SFF E G+  + T  SL  +
Sbjct  91    FAEAFRLPFVPPYLGG---GD--FLNGANFAVGGATALNNSFFRELGVEPTWTPHSLDEQ  145

Query  979   LDWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITV  800
             + WFK++L S   T S   + +  S+ L+GE+GGNDYN+  ++G   +E+   VP+V+ V
Sbjct  146   MQWFKKLLPSIASTKSEHSDMMSKSLFLVGEVGGNDYNHLMVRGKSLDELRKLVPQVVGV  205

Query  799   IASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHN  620
             I+  I ELI  GA+  +VPGN PIGC P YLS   +     Y+ +TGCI WLN+FTEYHN
Sbjct  206   ISLAITELINLGAKKFVVPGNFPIGCVPLYLSILPSEEKGYYNEETGCIEWLNEFTEYHN  265

Query  619   ELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHA  440
              LLQ+EL  LR LHP   +IYADYY A + +YR+P  +GF   L +CCG   P+N +   
Sbjct  266   RLLQEELEKLRNLHPDVSVIYADYYGATLNIYRAPLQFGFTVPLNSCCGSDAPHNCSLSV  325

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
              CG+  S VC  PS YISWDG+H TEA Y+ I+ G+L G +  P ++  C
Sbjct  326   MCGNPGSFVCPDPSKYISWDGLHFTEATYKVIIQGVL-GSYAVPPLSEIC  374



>ref|XP_006415634.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
 gb|ESQ33987.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
Length=390

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/375 (47%), Positives = 236/375 (63%), Gaps = 16/375 (4%)
 Frame = -1

Query  1372  FLVLFVSTGHVAGG---C--YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFF  1208
             FL++F ST  +A     C  YK+I+SFGDS  DTGN +R+S   N    +A LPYGETFF
Sbjct  12    FLLIFSSTIIIASSEPPCRHYKSIISFGDSSADTGNYLRLSSDVNHPPQAAFLPYGETFF  71

Query  1207  HHP-----TGRYSDGRLIIDFMALSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMD  1043
             H P     T R+    L    +A  +GLP+V   FG +     SF KG+NFAV GATA+D
Sbjct  72    HSPPAITPTARFRQNHLFSSALAEFLGLPYVPLNFGSQNV---SFEKGINFAVYGATALD  128

Query  1042  MSFFTERGIINSCTNVSLGNELDWFKQMLSSFCQTPSR-CKEYLESSVILMGEIGGNDYN  866
              +F  E+GI +  TNVSL  +L+ FKQ+L + C + SR C+E LE S+ILMGEIG NDY 
Sbjct  129   RAFLVEKGIESDFTNVSLSVQLNIFKQILPNLCASSSRDCREMLEDSLILMGEIGVNDYT  188

Query  865   YAFLQGHPKEEVMSFVPKVITVIASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSN  686
             Y F +G   +++   VP VI  I+S I  LI  G +  +VPG+ P+GC P+YL+ F T+ 
Sbjct  189   YPFFEGKSFDKIKDLVPLVIKAISSAIVNLIDLGGKTFVVPGSFPLGCIPAYLTLFQTAK  248

Query  685   ASEYDPQTGCINWLNDFTEYHNELLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNY  506
               +YDP TGC+ WLN+F E+HNE L+ EL  L++L+PH  IIYAD+YN+  R +R P  +
Sbjct  249   EEDYDPFTGCLPWLNEFGEHHNEQLKTELKRLQQLYPHASIIYADHYNSMYRFFREPAKH  308

Query  505   GFENT-LEACCGGGGPYN-SNPHAYCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGL  332
             GF+N  L A CG GG YN +     CG +  + C +PS Y+ WDG H TEA Y+ +  GL
Sbjct  309   GFKNRPLGASCGVGGKYNFTVSEDQCGYRGVSYCPNPSEYVHWDGYHSTEATYRKMAQGL  368

Query  331   LIGPFTSPKINGECI  287
             L GP+ +P  N  C+
Sbjct  369   LNGPYATPAFNWSCL  383



>ref|XP_011086014.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Sesamum indicum]
Length=373

 Score =   336 bits (861),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 228/346 (66%), Gaps = 9/346 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y +I SFGDSL DTGNL+     +  ++  A LPYG+TFFH+PTGR SDGRLI+DF+A +
Sbjct  25    YDSIFSFGDSLADTGNLLLSGARTFPFI--AKLPYGQTFFHYPTGRCSDGRLIVDFIAEA  82

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC--TNVSLGNELD  974
              GLP++ PY         +F  GVNFAVAGATA+D  FF  R I +    TN SL  +L 
Sbjct  83    SGLPYLPPYLA--VAKGETFEHGVNFAVAGATALDAKFFYSRNIGSQLLLTNDSLSVQLG  140

Query  973   WFKQMLSSF-CQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
             WF ++ S+  C T   C    E S+ L+GEIGGNDYNY F  G   +++ + VP V+  I
Sbjct  141   WFSKLKSTLICSTKQDCARRFEKSLFLVGEIGGNDYNYPFFAGGTIQQLKALVPLVVETI  200

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
             A+  + LI+ GA  L+VPGNLPIGC+  YL+ F T N + YD + GC+   N F++YHN 
Sbjct  201   ANATSVLIEEGAVELMVPGNLPIGCNAVYLTLFRTPNKTAYD-RNGCLKAYNSFSKYHNS  259

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHA  440
              L+  L +LR  +PH +IIYADYY AA++ + +P++YGF N  L ACCGGGGPYN N  A
Sbjct  260   NLKLALENLRHKYPHAKIIYADYYAAAIKFFHAPHHYGFWNGALVACCGGGGPYNFNNSA  319

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
              CGS  S  C  P++Y +WDG+HLTE+AY+ I  GL+ GPFT P +
Sbjct  320   ICGSPGSKTCLDPTTYANWDGIHLTESAYRVITMGLVNGPFTHPPL  365



>dbj|BAJ98364.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/345 (48%), Positives = 220/345 (64%), Gaps = 8/345 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY  + SFGDSL DTGN   +  +         LPYGETFFH  TGR+S+GR+ +DF+A 
Sbjct  28    CYSRVFSFGDSLADTGNYRYVYGNGTG----PRLPYGETFFHRATGRFSNGRIAVDFIAD  83

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTN-VSLGNELD  974
             ++GLPFV PY+ G+++ D  FA G NFAV  ATA+      E G   +  + V L  E+ 
Sbjct  84    ALGLPFVRPYWSGRSSED--FAGGANFAVGAATALSPEALWEHGFAAARADLVHLDMEMS  141

Query  973   WFKQMLSSFC-QTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
             WF+ +L   C +  + C   +  S+ L+GEIGGNDYN       P E++ +F P VI+ I
Sbjct  142   WFRDLLRLLCPRDLADCVGMMNKSLFLVGEIGGNDYNIPLTSSVPVEKIRAFAPSVISKI  201

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
             +STI +LI  GA+ L+VPGNLPIGC P YL+ + T N  +Y+ +TGCI W+N+F+ YHN+
Sbjct  202   SSTITDLIGLGAKTLVVPGNLPIGCLPVYLTMYQTDNMGDYESETGCIRWMNEFSRYHNK  261

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAY  437
             LL  EL  LR+LHP   IIYADYY AAM ++ SP  +G E+ L ACCG  GPY  +    
Sbjct  262   LLVDELEKLRKLHPSASIIYADYYGAAMEIFVSPYKFGIEDPLMACCGVEGPYGVSITTK  321

Query  436   CGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             CG     VCD+P +Y SWDG+H TE +Y+ I DGLL GP+T P I
Sbjct  322   CGHGEYKVCDNPQNYASWDGLHPTETSYRVIADGLLRGPYTQPPI  366



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 225/347 (65%), Gaps = 12/347 (3%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAV--LPYGETFFHHPTGRYSDGRLIIDFMA  1154
             Y AI +FGDSL+DTGN +    +S A +   +  LPYG+TFF   TGR SDGRL+IDF+A
Sbjct  30    YTAIFNFGDSLSDTGNFL----ASGAILFPVIGKLPYGQTFFKRATGRCSDGRLMIDFIA  85

Query  1153  LSMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSC-TNVSLGNEL  977
              +  LP++ PY     T D+   +GVNFAVAGATA+D  FF E G+     TN SL  +L
Sbjct  86    EAYDLPYLPPY--PALTKDQYIQRGVNFAVAGATALDAKFFIEAGLAKYLWTNNSLNIQL  143

Query  976   DWFKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVI  797
              WFK++  S C T   C  Y + S+ L+GEIGGNDYNYA + G+   ++ S VP V+  I
Sbjct  144   GWFKKLKPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAGN-VTQLQSTVPPVVEAI  202

Query  796   ASTINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNE  617
                IN LI  GA+ L+VPGN PIGCS  YL+ F + N  +YD ++GC+   N F EYHN 
Sbjct  203   TMAINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYD-ESGCLKTFNGFAEYHNR  261

Query  616   LLQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFEN-TLEACCGGGGPYNSNPHA  440
              L+  L  LR+ +PH RI+YADYY AA R + +P ++GF N  L ACCGGGGP+N N  A
Sbjct  262   ELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALRACCGGGGPFNFNISA  321

Query  439   YCGSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKIN  299
              CG   S  C  PS+Y +WDG+HLTEAAY++I  GL+ GPF+ P + 
Sbjct  322   RCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPPLK  368



>ref|XP_010052211.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76147.1| hypothetical protein EUGRSUZ_D00523 [Eucalyptus grandis]
Length=367

 Score =   335 bits (858),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 224/343 (65%), Gaps = 4/343 (1%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI S GDS +DTGN  R    + A+ +   LPYGETFF + TGR SDGRLI+DF+A +
Sbjct  26    YHAIFSLGDSHSDTGNYPRTE--AVAFQVIKSLPYGETFFRNATGRCSDGRLIVDFIAEA  83

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
              GLP++ PY            KGVNFAVAGA+A++ SFF+ + I    TN SL  +L WF
Sbjct  84    FGLPYLPPYLAVAKGPHVRIRKGVNFAVAGASAINSSFFSAQKIA-LWTNDSLSVQLGWF  142

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K + SS C T   C EY + S+ L+GEIG NDYN+  L G   +++ + VP V+  I   
Sbjct  143   KNLKSSLCTTEQECDEYFKKSLFLVGEIGENDYNFPALSGQSIKQLRALVPLVVGAITRA  202

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             ++ LI+ GA  L+VPG LP+GC+  +L+ F ++N S YD +TGC+   + F +YHN  L+
Sbjct  203   VSMLIEEGAVDLMVPGQLPVGCTSMFLTVFQSANESAYDNRTGCLKAYDAFFKYHNNYLK  262

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
             +EL +LRE +PH RI+YADYY AAM +YRSP +YGF   T  ACCGGGGP+N N  A CG
Sbjct  263   QELQNLREQYPHARIMYADYYGAAMTIYRSPKHYGFYGGTPRACCGGGGPHNFNTTAVCG  322

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
                +T C  PS+++ WDG+H TE+AY  I  G++ G FTSP +
Sbjct  323   QTGATACKDPSAFMDWDGIHFTESAYHHIAKGMINGGFTSPPL  365



>ref|XP_008654982.1| PREDICTED: alpha-L-fucosidase 2 isoform X1 [Zea mays]
Length=431

 Score =   337 bits (863),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 223/347 (64%), Gaps = 8/347 (2%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             C+  +  FGDSLTDTGN + +S   +    +  LPYG+TFF  P+GRYSDGR ++DF   
Sbjct  63    CFDRMFGFGDSLTDTGNFL-LSVPDDFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFE-  120

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             + GLP+V PY G   +GD  F  G NFAV GATA++ SFF ERG+  + T  SL  ++ W
Sbjct  121   AFGLPYVPPYLG---SGD--FQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQW  175

Query  970   FKQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAS  791
             FK++L     + +   E +  S++ +GEIGGNDYN+  ++    +E+   VP V+  I+S
Sbjct  176   FKKLLPFIAPSETELNEIMSKSLLFVGEIGGNDYNHLIVREKSVDELHEIVPNVVGAISS  235

Query  790   TINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELL  611
              I +LI  GA+ L+VPGN PIGC P YL+ F +     Y+ QTGCI WLN+F EYHN +L
Sbjct  236   GITDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQKEGYYEEQTGCIKWLNEFAEYHNRML  295

Query  610   QKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYCG  431
             Q+EL  LR LHP   IIYADYY AA+ ++R+P  +GF   L ACCG   PYN +P   CG
Sbjct  296   QEELEKLRNLHPDVTIIYADYYGAALNIFRAPLKFGFTVPLNACCGSDAPYNCSPSILCG  355

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKINGEC  290
                STVC  PS YISWDG+H TEA+Y+ ++ G+L G +  P ++  C
Sbjct  356   RPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GGYAKPPLSEAC  401



>gb|KCW44565.1| hypothetical protein EUGRSUZ_L01922, partial [Eucalyptus grandis]
Length=353

 Score =   333 bits (854),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 216/334 (65%), Gaps = 6/334 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI +FGDS +DTGN   +   +  Y     LPYGETFFHH TGR S+GRLIIDF+A +
Sbjct  24    YNAIFNFGDSHSDTGNF--LITGALVYPEIKNLPYGETFFHHATGRCSNGRLIIDFIAEA  81

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
              GLP++ PY             GVNFAVAGATA+D SFF+ + I    TN SL  +L WF
Sbjct  82    FGLPYLPPYLA--VAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWF  138

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++  I   
Sbjct  139   KSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVGAIIRA  198

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YHN  L+
Sbjct  199   VSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYLK  258

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
             +EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N  AYCG
Sbjct  259   QELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYCG  318

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLL  329
                STVC  PS+++ WDG+H TEAAY +I  GL+
Sbjct  319   QSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLI  352



>ref|XP_008675274.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Zea 
mays]
Length=402

 Score =   335 bits (859),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 174/344 (51%), Positives = 221/344 (64%), Gaps = 4/344 (1%)
 Frame = -1

Query  1330  CYKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMAL  1151
             CY  + SFGDSL DTGN  R    +++   +   PYGETFF   TGR+S+GRLI+DF+A 
Sbjct  37    CYPRVFSFGDSLADTGNF-RFYYGNSSGEPALRQPYGETFFRRATGRFSNGRLILDFIAD  95

Query  1150  SMGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDW  971
             +MGLPFV PY  G+   D  FA G NFAV GATA+   FF  RG       V LG E+ W
Sbjct  96    TMGLPFVRPYLSGRRAED--FASGANFAVGGATALGPDFFRSRGFDIGDGRVHLGMEMKW  153

Query  970   FKQMLSSFCQT-PSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIA  794
             F  +L   C++  S C + +  S+ ++GEIGGNDYN   L   P E++ SF P VI  I+
Sbjct  154   FHDLLELLCRSGRSGCSDIMSQSLFIVGEIGGNDYNLPMLSRVPIEKIRSFTPNVIAKIS  213

Query  793   STINELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNEL  614
             STI ELI  GA+ L+VPGNLPIGC P YL  F + +  +Y+P+TGC+ W+N+F+EYHN+L
Sbjct  214   STITELIGLGAKTLVVPGNLPIGCVPKYLLIFKSDDKEDYEPETGCLRWMNEFSEYHNKL  273

Query  613   LQKELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGFENTLEACCGGGGPYNSNPHAYC  434
             L +EL  LR+ +P   IIYADYY AAM ++RSP  +G E  L ACCGG GPY  +    C
Sbjct  274   LLEELEKLRKTNPTVTIIYADYYGAAMEIFRSPERFGIEEPLVACCGGEGPYGVSLSTAC  333

Query  433   GSQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLLIGPFTSPKI  302
             G     VCD+P  Y SWDG H +EAAY+ I  GLL G +T P I
Sbjct  334   GYGDYKVCDNPDKYGSWDGFHPSEAAYKAIAMGLLRGTYTQPSI  377



>gb|KCW76148.1| hypothetical protein EUGRSUZ_D00525 [Eucalyptus grandis]
Length=374

 Score =   334 bits (856),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 217/334 (65%), Gaps = 6/334 (2%)
 Frame = -1

Query  1327  YKAIVSFGDSLTDTGNLIRMSKSSNAYVMSAVLPYGETFFHHPTGRYSDGRLIIDFMALS  1148
             Y AI +FGDS +DTGN   +   + AY     LPYGETFFHH TGR S+GRLIIDF+A +
Sbjct  24    YNAIFNFGDSHSDTGNF--LITGALAYPEIKNLPYGETFFHHATGRCSNGRLIIDFIAEA  81

Query  1147  MGLPFVEPYFGGKTTGDRSFAKGVNFAVAGATAMDMSFFTERGIINSCTNVSLGNELDWF  968
              GLP++ PY             GVNFAVAGATA+D SFF+ + I    TN SL  +L WF
Sbjct  82    FGLPYLPPYLA--VAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWF  138

Query  967   KQMLSSFCQTPSRCKEYLESSVILMGEIGGNDYNYAFLQGHPKEEVMSFVPKVITVIAST  788
             K + SS C T   C EY + S+ L+GEIG NDYN  FL G   E++   VP+++  I   
Sbjct  139   KSLKSSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGRTIEQLRPLVPQIVGAIIRA  198

Query  787   INELIKYGAQILIVPGNLPIGCSPSYLSYFMTSNASEYDPQTGCINWLNDFTEYHNELLQ  608
             ++ LI+ GA  L+VPG LP GC   YL+ F ++N S YDP+TGC+   N   +YHN  L+
Sbjct  199   VSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANESAYDPKTGCLEAYNALFKYHNNYLK  258

Query  607   KELNHLRELHPHTRIIYADYYNAAMRLYRSPNNYGF-ENTLEACCGGGGPYNSNPHAYCG  431
             +EL  LRE +PH RI+YADYY A++ +YR+P  YGF    L ACCGGGGPYN N  AYCG
Sbjct  259   QELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNTSAYCG  318

Query  430   SQLSTVCDSPSSYISWDGMHLTEAAYQWIVDGLL  329
                STVC  PS+++ WDG+H TE+AY +I  GL+
Sbjct  319   QSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLI  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4696885476248