BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23085_g1_i6 len=1410 path=[1451:0-228 2921:229-304 1680:305-424
1800:425-431 @1807@!:432-736 2112:737-1115 2491:1116-1202
2578:1203-1206 2582:1207-1325 2840:1326-1409]

Length=1410
                                                                      Score     E

ref|XP_009616706.1|  PREDICTED: peroxisome biogenesis factor 10 i...    442   9e-149   
ref|XP_009768856.1|  PREDICTED: peroxisome biogenesis factor 10         440   5e-148   
ref|XP_004238310.1|  PREDICTED: peroxisome biogenesis factor 10         440   9e-148   
ref|XP_006341993.1|  PREDICTED: peroxisome biogenesis factor 10-like    437   8e-147   
ref|XP_011081624.1|  PREDICTED: peroxisome biogenesis factor 10         432   1e-144   
ref|XP_007012401.1|  Peroxisome biogenesis factor 10                    421   5e-140   
gb|EYU20307.1|  hypothetical protein MIMGU_mgv1a008076mg                418   2e-139   
ref|XP_010049273.1|  PREDICTED: peroxisome biogenesis factor 10 i...    416   3e-138   
gb|KHG08617.1|  Peroxisome biogenesis factor 10 -like protein           415   5e-138   
emb|CDP13456.1|  unnamed protein product                                415   6e-138   
ref|XP_002279784.2|  PREDICTED: peroxisome biogenesis factor 10         412   7e-137   Vitis vinifera
ref|XP_004303471.1|  PREDICTED: peroxisome biogenesis factor 10-like    407   3e-135   
gb|KFK32514.1|  hypothetical protein AALP_AA6G252600                    406   5e-135   
ref|XP_002880778.1|  hypothetical protein ARALYDRAFT_481492             404   4e-134   
ref|XP_010472664.1|  PREDICTED: peroxisome biogenesis factor 10         402   2e-133   
ref|XP_011019366.1|  PREDICTED: peroxisome biogenesis factor 10 i...    403   3e-133   
ref|XP_009362582.1|  PREDICTED: peroxisome biogenesis factor 10-l...    401   1e-132   
ref|XP_010429658.1|  PREDICTED: peroxisome biogenesis factor 10-like    400   2e-132   
ref|XP_009334688.1|  PREDICTED: peroxisome biogenesis factor 10-l...    399   5e-132   
ref|XP_009334687.1|  PREDICTED: peroxisome biogenesis factor 10-l...    399   5e-132   
ref|XP_010417423.1|  PREDICTED: peroxisome biogenesis factor 10-like    399   6e-132   
ref|XP_008220559.1|  PREDICTED: peroxisome biogenesis factor 10         399   6e-132   
ref|XP_010261939.1|  PREDICTED: peroxisome biogenesis factor 10         399   6e-132   
ref|XP_007223001.1|  hypothetical protein PRUPE_ppa006781mg             399   7e-132   
ref|NP_565621.1|  peroxin 10                                            398   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498856.1|  PREDICTED: peroxisome biogenesis factor 10-like    398   1e-131   
emb|CDY11486.1|  BnaA09g40520D                                          397   2e-131   
ref|XP_008367634.1|  PREDICTED: peroxisome biogenesis factor 10-l...    398   2e-131   
emb|CAB87983.1|  Pex10p                                                 396   6e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544551.1|  PREDICTED: peroxisome biogenesis factor 10-like    396   9e-131   
ref|XP_008377818.1|  PREDICTED: peroxisome biogenesis factor 10         396   9e-131   
ref|XP_011019365.1|  PREDICTED: peroxisome biogenesis factor 10 i...    396   1e-130   
ref|XP_008452775.1|  PREDICTED: peroxisome biogenesis factor 10         395   2e-130   
ref|XP_002308529.2|  hypothetical protein POPTR_0006s23860g             395   2e-130   Populus trichocarpa [western balsam poplar]
ref|XP_009117014.1|  PREDICTED: peroxisome biogenesis factor 10         394   3e-130   
gb|KDP34040.1|  hypothetical protein JCGZ_07611                         395   4e-130   
ref|XP_006408752.1|  hypothetical protein EUTSA_v10002014mg             394   5e-130   
gb|KHN17265.1|  Peroxisome biogenesis factor 10                         394   5e-130   
gb|AAM64667.1|  putative peroxisome assembly protein PER8               393   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004141339.1|  PREDICTED: peroxisome biogenesis factor 10-like    393   2e-129   
emb|CDX76710.1|  BnaC08g32960D                                          392   3e-129   
ref|XP_006466355.1|  PREDICTED: peroxisome biogenesis factor 10-like    391   3e-129   
ref|XP_003550258.1|  PREDICTED: peroxisome biogenesis factor 10-like    391   6e-129   
ref|XP_006426216.1|  hypothetical protein CICLE_v10025877mg             390   2e-128   
gb|KHN37062.1|  Peroxisome biogenesis factor 10                         389   4e-128   
ref|XP_010049274.1|  PREDICTED: peroxisome biogenesis factor 10 i...    385   1e-127   
ref|XP_007161056.1|  hypothetical protein PHAVU_001G039000g             388   1e-127   
gb|AES59180.2|  peroxisome biogenesis factor 10                         387   5e-127   
ref|XP_009362590.1|  PREDICTED: peroxisome biogenesis factor 10-l...    385   1e-126   
gb|AAM14959.1|  putative peroxisome assembly protein PER8               382   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797557.1|  PREDICTED: peroxisome biogenesis factor 10 i...    383   1e-125   
ref|XP_010529040.1|  PREDICTED: peroxisome biogenesis factor 10 i...    382   3e-125   
ref|XP_008367635.1|  PREDICTED: peroxisome biogenesis factor 10-l...    381   5e-125   
ref|XP_010936953.1|  PREDICTED: peroxisome biogenesis factor 10         381   8e-125   
ref|XP_010669329.1|  PREDICTED: peroxisome biogenesis factor 10         380   1e-124   
ref|XP_008797551.1|  PREDICTED: peroxisome biogenesis factor 10 i...    378   9e-124   
dbj|BAJ85007.1|  predicted protein                                      375   2e-122   
ref|XP_009388152.1|  PREDICTED: peroxisome biogenesis factor 10         375   2e-122   
gb|KDO78693.1|  hypothetical protein CISIN_1g017241mg                   369   7e-121   
ref|XP_002461003.1|  hypothetical protein SORBIDRAFT_02g039010          370   1e-120   Sorghum bicolor [broomcorn]
ref|XP_010529041.1|  PREDICTED: peroxisome biogenesis factor 10 i...    362   1e-118   
ref|XP_006658799.1|  PREDICTED: peroxisome biogenesis factor 10-like    362   6e-118   
ref|XP_008667600.1|  PREDICTED: LOC100274236 isoform X1                 363   7e-118   
ref|NP_001060245.1|  Os07g0608800                                       362   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235723.1|  PREDICTED: peroxisome biogenesis factor 10 i...    362   2e-117   
ref|XP_004958285.1|  PREDICTED: peroxisome biogenesis factor 10-like    360   1e-116   
ref|NP_001142078.1|  LOC100274236                                       357   7e-116   Zea mays [maize]
ref|XP_010235725.1|  PREDICTED: peroxisome biogenesis factor 10 i...    342   1e-110   
ref|XP_010098352.1|  Peroxisome biogenesis factor 10                    334   2e-106   
ref|XP_007223000.1|  hypothetical protein PRUPE_ppa006781mg             330   6e-105   
ref|XP_010529037.1|  PREDICTED: peroxisome biogenesis factor 10 i...    319   1e-100   
ref|XP_009616707.1|  PREDICTED: peroxisome biogenesis factor 10 i...    312   5e-99    
ref|XP_008797564.1|  PREDICTED: peroxisome biogenesis factor 10 i...    312   2e-98    
gb|EYU20306.1|  hypothetical protein MIMGU_mgv1a024770mg                304   2e-96    
ref|XP_002516124.1|  peroxisome assembly protein, putative              306   3e-96    Ricinus communis
gb|KDO78695.1|  hypothetical protein CISIN_1g017241mg                   296   6e-93    
dbj|BAG87060.1|  unnamed protein product                                293   3e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006849636.1|  hypothetical protein AMTR_s00024p00220620          291   6e-91    
emb|CAN71793.1|  hypothetical protein VITISV_022107                     285   7e-90    Vitis vinifera
ref|XP_001777562.1|  predicted protein                                  290   2e-89    
ref|XP_006294686.1|  hypothetical protein CARUB_v10023723mg             277   3e-87    
emb|CDY11455.1|  BnaA09g40210D                                          272   1e-84    
ref|XP_004172556.1|  PREDICTED: peroxisome biogenesis factor 10-like    270   1e-84    
ref|XP_008667601.1|  PREDICTED: LOC100274236 isoform X2                 274   2e-84    
gb|AAK55784.1|AC079038_18  Putative zinc-binding peroxisomal inte...    265   5e-81    Oryza sativa [red rice]
gb|ACR35189.1|  unknown                                                 236   6e-71    Zea mays [maize]
gb|EPS69235.1|  hypothetical protein M569_05532                         188   9e-62    
ref|XP_005650096.1|  hypothetical protein COCSUDRAFT_46761              194   6e-55    
gb|EPS67997.1|  peroxisome biogenesis factor 10                         180   2e-50    
emb|CDY70898.1|  BnaAnng35490D                                          143   6e-48    
ref|XP_005850473.1|  hypothetical protein CHLNCDRAFT_16970              173   8e-46    
tpg|DAA41415.1|  TPA: putative RING zinc finger domain superfamil...    166   8e-45    
gb|EMT01296.1|  Peroxisome biogenesis factor 10                         157   1e-40    
ref|XP_003588929.1|  Peroxisome biogenesis factor                       148   4e-36    
gb|EXX54766.1|  ubiquitin-protein ligase peroxin 10                     135   2e-33    
gb|ESA17673.1|  hypothetical protein GLOINDRAFT_148218                  134   3e-32    
ref|XP_004173721.1|  PREDICTED: peroxisome biogenesis factor 10-like    129   2e-31    
gb|KFH64176.1|  hypothetical protein MVEG_10001                         124   8e-31    
ref|XP_011120479.1|  hypothetical protein AOL_s00054g861                128   1e-29    
emb|CEJ02037.1|  hypothetical protein RMCBS344292_16054                 121   2e-28    
emb|CEG71493.1|  hypothetical protein RMATCC62417_07217                 121   4e-28    
emb|CEI88247.1|  hypothetical protein RMCBS344292_02641                 120   7e-28    
ref|XP_009093943.1|  PREDICTED: peroxisome biogenesis factor 10         120   5e-27    
gb|KFO64842.1|  Peroxisome biogenesis factor 10                         118   1e-26    
ref|XP_008639461.1|  PREDICTED: peroxisome biogenesis factor 10         118   2e-26    
ref|XP_010404284.1|  PREDICTED: peroxisome biogenesis factor 10         118   2e-26    
ref|XP_001633055.1|  predicted protein                                  116   2e-26    Nematostella vectensis
gb|KFV43550.1|  Peroxisome biogenesis factor 10                         117   4e-26    
ref|XP_005492713.1|  PREDICTED: peroxisome biogenesis factor 10         117   4e-26    
ref|XP_009973597.1|  PREDICTED: peroxisome biogenesis factor 10         116   5e-26    
ref|NP_001005994.1|  peroxisome biogenesis factor 10                    117   6e-26    Danio rerio [leopard danio]
ref|XP_005427723.1|  PREDICTED: peroxisome biogenesis factor 10         117   6e-26    
ref|XP_006016263.1|  PREDICTED: peroxisome biogenesis factor 10         116   1e-25    
ref|XP_005996642.1|  PREDICTED: peroxisome biogenesis factor 10 i...    116   1e-25    
gb|KFZ58457.1|  Peroxisome biogenesis factor 10                         115   1e-25    
ref|XP_002196935.1|  PREDICTED: peroxisome biogenesis factor 10 i...    115   2e-25    Taeniopygia guttata
ref|XP_005057845.1|  PREDICTED: peroxisome biogenesis factor 10         115   2e-25    
gb|EEH04384.1|  peroxin 10                                              115   3e-25    Histoplasma capsulatum G186AR
ref|XP_005996644.1|  PREDICTED: peroxisome biogenesis factor 10 i...    115   3e-25    
dbj|GAA97940.1|  hypothetical protein E5Q_04620                         114   3e-25    
ref|XP_006161233.1|  PREDICTED: peroxisome biogenesis factor 10         114   3e-25    
ref|XP_001817227.1|  peroxisome biosynthesis protein (Peroxin-10)       115   4e-25    Aspergillus oryzae RIB40
ref|XP_006268067.1|  PREDICTED: peroxisome biogenesis factor 10         114   5e-25    
gb|EGD97002.1|  peroxisome biosynthesis protein                         113   9e-25    
ref|XP_007422618.1|  PREDICTED: peroxisome biogenesis factor 10 i...    113   1e-24    
gb|EGE01320.1|  peroxisome assembly protein 10                          113   1e-24    
ref|XP_010745155.1|  PREDICTED: peroxisome biogenesis factor 10         112   1e-24    
ref|XP_005528418.1|  PREDICTED: peroxisome biogenesis factor 10         113   1e-24    
ref|XP_007422619.1|  PREDICTED: peroxisome biogenesis factor 10 i...    113   1e-24    
ref|XP_001366320.1|  PREDICTED: peroxisome biogenesis factor 10         110   2e-24    Monodelphis domestica
ref|XP_007979115.1|  PREDICTED: peroxisome biogenesis factor 10 i...    110   4e-24    
gb|KFW64667.1|  Peroxisome biogenesis factor 10                         111   4e-24    
ref|XP_008531910.1|  PREDICTED: peroxisome biogenesis factor 10         112   4e-24    
ref|XP_010350891.1|  PREDICTED: peroxisome biogenesis factor 10 i...    110   6e-24    
ref|XP_001261348.1|  peroxisome biosynthesis protein (Peroxin-10)...    112   7e-24    Aspergillus fischeri NRRL 181
ref|XP_003279762.1|  PREDICTED: peroxisome biogenesis factor 10 i...    110   8e-24    
ref|XP_009318833.1|  PREDICTED: peroxisome biogenesis factor 10         110   8e-24    
gb|EHH14244.1|  hypothetical protein EGK_00134                          110   9e-24    
ref|XP_003891043.1|  PREDICTED: peroxisome biogenesis factor 10 i...    109   1e-23    
ref|XP_001083901.2|  PREDICTED: peroxisome biogenesis factor 10 i...    109   1e-23    Macaca mulatta [rhesus macaque]
emb|CAG46874.1|  PEX10                                                  108   1e-23    Homo sapiens [man]
ref|XP_004365772.1|  conserved hypothetical protein                     111   1e-23    
emb|CAF90846.1|  unnamed protein product                                107   2e-23    Tetraodon nigroviridis
ref|NP_002608.1|  peroxisome biogenesis factor 10 isoform 2             108   2e-23    Homo sapiens [man]
gb|KFM56842.1|  Peroxisome biogenesis factor 10                         109   2e-23    
gb|EEQ91881.1|  peroxisome biosynthesis protein                         110   2e-23    Blastomyces dermatitidis ER-3
ref|XP_002621786.1|  peroxisomal integral membrane protein              110   2e-23    Blastomyces gilchristii SLH14081
ref|XP_003807348.1|  PREDICTED: peroxisome biogenesis factor 10         108   2e-23    
ref|XP_004024555.1|  PREDICTED: peroxisome biogenesis factor 10 i...    108   3e-23    
ref|XP_001213484.1|  conserved hypothetical protein                     110   3e-23    Aspergillus terreus NIH2624
gb|KFP08335.1|  Peroxisome biogenesis factor 10                         109   3e-23    
ref|XP_008501816.1|  PREDICTED: peroxisome biogenesis factor 10         109   3e-23    
gb|EGE81192.1|  peroxisome biosynthesis protein                         110   3e-23    
ref|XP_513729.2|  PREDICTED: peroxisome biogenesis factor 10            107   4e-23    Pan troglodytes
gb|EEH21627.1|  hypothetical protein PABG_03843                         108   6e-23    Paracoccidioides brasiliensis Pb03
ref|XP_009211722.1|  PREDICTED: peroxisome biogenesis factor 10 i...    108   8e-23    
emb|CDH49797.1|  fumarylacetoacetate hydrolase family protein           104   1e-22    
ref|NP_001270672.1|  peroxisome biogenesis factor 10                    105   1e-22    
ref|XP_009211821.1|  PREDICTED: peroxisome biogenesis factor 10 i...    107   1e-22    
ref|XP_003793254.1|  PREDICTED: peroxisome biogenesis factor 10         104   1e-22    
ref|XP_004473576.1|  PREDICTED: peroxisome biogenesis factor 10 i...    107   2e-22    
ref|XP_005804908.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisome b...    106   3e-22    
gb|EPS25914.1|  hypothetical protein PDE_00850                          105   3e-22    
dbj|GAA89651.1|  peroxisome biosynthesis protein (Peroxin-10)           106   5e-22    
ref|XP_004351716.1|  RING zinc finger-containing protein                105   8e-22    
ref|XP_006804329.1|  PREDICTED: peroxisome biogenesis factor 10-like    104   1e-21    
gb|EKV05563.1|  Peroxin 10                                              104   1e-21    
ref|XP_004545992.1|  PREDICTED: peroxisome biogenesis factor 10-l...    104   2e-21    
ref|XP_008316784.1|  PREDICTED: peroxisome biogenesis factor 10         104   2e-21    
ref|XP_005745920.1|  PREDICTED: peroxisome biogenesis factor 10-like    103   2e-21    
ref|XP_003279763.1|  PREDICTED: peroxisome biogenesis factor 10 i...    101   3e-21    
ref|XP_749083.1|  peroxisome biosynthesis protein (Peroxin-10)          104   3e-21    Aspergillus fumigatus Af293
emb|CDS04176.1|  hypothetical protein LRAMOSA07131                      103   3e-21    
gb|EDP48266.1|  peroxisome biosynthesis protein (Peroxin-10), put...    103   3e-21    Aspergillus fumigatus A1163
ref|XP_007577017.1|  PREDICTED: peroxisome biogenesis factor 10         103   4e-21    
ref|XP_008411142.1|  PREDICTED: peroxisome biogenesis factor 10         103   4e-21    
ref|XP_003454310.1|  PREDICTED: peroxisome biogenesis factor 10-l...    103   4e-21    
gb|KEY77453.1|  peroxisome biosynthesis protein Peroxin 10              103   4e-21    
ref|XP_001396221.1|  peroxisome biosynthesis protein (Peroxin-10)       103   9e-21    Aspergillus niger CBS 513.88
ref|XP_003725095.1|  PREDICTED: peroxisome biogenesis factor 10-like    101   1e-20    
ref|XP_663285.1|  hypothetical protein AN5681.2                         102   1e-20    Aspergillus nidulans FGSC A4
ref|XP_010762805.1|  hypothetical protein PADG_07284                    101   2e-20    
ref|XP_002789421.1|  peroxisome assembly protein                        101   3e-20    Paracoccidioides lutzii Pb01
gb|KGO40923.1|  Zinc finger, RING-type                                99.4    4e-20    
emb|CDM30956.1|  peroxin 10                                           99.8    5e-20    
gb|KGO77493.1|  Zinc finger, RING-type                                97.4    1e-19    
ref|XP_002567494.1|  peroxisomal integral membrane protein Pex10-...  98.6    1e-19    Penicillium rubens Wisconsin 54-1255
ref|XP_003588927.1|  Peroxisome biogenesis factor                     92.8    2e-19    
gb|ESU13272.1|  hypothetical protein FGSG_07078                       95.9    3e-19    
ref|XP_004473575.1|  PREDICTED: peroxisome biogenesis factor 10 i...  98.2    3e-19    
ref|XP_001024158.1|  Pex2 / Pex12 amino terminal region family pr...  94.7    3e-19    Tetrahymena thermophila
gb|ABG78603.1|  RING-1                                                94.0    4e-19    Fusarium graminearum
ref|XP_010350890.1|  PREDICTED: peroxisome biogenesis factor 10 i...  94.0    4e-19    
ref|XP_007292671.1|  putative peroxisome biosynthesis protein (Pe...  95.5    4e-19    
ref|XP_005545088.1|  PREDICTED: peroxisome biogenesis factor 10 i...  93.6    5e-19    
gb|EXX54768.1|  ubiquitin-protein ligase peroxin 10                   95.5    6e-19    
ref|XP_002679102.1|  predicted protein                                92.0    2e-18    Naegleria gruberi strain NEG-M
gb|KFM23149.1|  Peroxisome biogenesis factor 10                       94.7    5e-18    
ref|XP_005098492.1|  PREDICTED: peroxisome biogenesis factor 10-like  93.6    6e-18    
gb|ELU12268.1|  hypothetical protein CAPTEDRAFT_174511                93.6    8e-18    
ref|XP_009211767.1|  PREDICTED: peroxisome biogenesis factor 10 i...  92.8    2e-17    
ref|XP_004545993.1|  PREDICTED: peroxisome biogenesis factor 10-l...  90.5    3e-17    
ref|XP_003015161.1|  hypothetical protein ARB_06284                   92.8    3e-17    
gb|KHJ36180.1|  putative peroxisome biosynthesis protein (peroxin...  92.0    3e-17    
ref|XP_003237037.1|  peroxisome biosynthesis protein                  92.8    3e-17    
gb|EZF35829.1|  hypothetical protein H101_00654                       92.4    4e-17    
gb|EZF13248.1|  hypothetical protein H100_06408                       92.4    5e-17    
ref|XP_005458836.1|  PREDICTED: peroxisome biogenesis factor 10-l...  89.4    8e-17    
ref|XP_009045062.1|  hypothetical protein LOTGIDRAFT_237439           87.8    9e-17    
ref|XP_001538776.1|  conserved hypothetical protein                   89.7    2e-16    Histoplasma capsulatum NAm1
emb|CCX32313.1|  Similar to Peroxisome biogenesis factor 10; acc....  89.4    3e-16    
ref|XP_003024411.1|  hypothetical protein TRV_01374                   89.7    3e-16    
ref|XP_008615780.1|  hypothetical protein SDRG_11517                  89.0    5e-16    
ref|XP_003172271.1|  peroxisome assembly protein 10                   88.6    1e-15    
ref|XP_008866558.1|  hypothetical protein H310_04140                  88.2    1e-15    
ref|XP_002113781.1|  hypothetical protein TRIADDRAFT_57553            87.0    1e-15    Trichoplax adhaerens
gb|KID90311.1|  RING-1 like protein                                   78.6    2e-15    
gb|EXV03081.1|  Pex2/Pex12 and RING finger domain protein             77.8    2e-15    
ref|XP_002146363.1|  peroxisome biosynthesis protein (Peroxin-10)...  87.0    3e-15    Talaromyces marneffei ATCC 18224
gb|KFG87461.1|  RING-1 like protein                                   77.8    3e-15    
ref|XP_001644639.1|  hypothetical protein Kpol_526p34                 86.3    3e-15    Vanderwaltozyma polyspora DSM 70294
gb|KDD73393.1|  hypothetical protein H632_c2224p0                     68.6    4e-15    
ref|XP_007820549.1|  RING-1 like protein                              76.6    5e-15    
gb|KIE03414.1|  RING-1 like protein                                   76.6    5e-15    
gb|KID76860.1|  RING-1 like protein                                   76.3    7e-15    
ref|XP_009831959.1|  hypothetical protein, variant 2                  84.3    7e-15    
dbj|GAM43046.1|  hypothetical protein TCE0_044f17549                  85.5    1e-14    
ref|XP_008938320.1|  PREDICTED: peroxisome biogenesis factor 10       83.6    1e-14    
ref|XP_009831960.1|  hypothetical protein, variant 1                  84.0    1e-14    
ref|XP_003295009.1|  hypothetical protein DICPUDRAFT_44226            83.6    1e-14    
gb|KFQ18569.1|  Peroxisome biogenesis factor 10                       83.6    2e-14    
gb|KFP58746.1|  Peroxisome biogenesis factor 10                       82.4    3e-14    
ref|XP_006934380.1|  PREDICTED: peroxisome biogenesis factor 10       83.2    3e-14    
ref|XP_003059759.1|  peroxisomal protein importer family              84.0    4e-14    
ref|XP_001273266.1|  peroxisome biosynthesis protein (Peroxin-10)...  83.6    5e-14    Aspergillus clavatus NRRL 1
gb|KFU99108.1|  Peroxisome biogenesis factor 10                       82.0    6e-14    
gb|EGU75261.1|  hypothetical protein FOXB_14223                       82.8    6e-14    
gb|EKC27741.1|  Peroxisome biogenesis factor 10                       81.3    6e-14    
gb|EWY98939.1|  hypothetical protein FOYG_03205                       82.8    7e-14    
ref|XP_005514432.1|  PREDICTED: peroxisome biogenesis factor 10       82.0    7e-14    
gb|EXA50295.1|  hypothetical protein FOVG_03078                       82.8    8e-14    
gb|EMC79373.1|  Peroxisome biogenesis factor 10                       81.6    8e-14    
ref|XP_001240364.1|  hypothetical protein CIMG_07527                  75.9    8e-14    Coccidioides immitis RS
gb|EWZ45022.1|  hypothetical protein FOZG_05545                       82.8    8e-14    
ref|XP_003068101.1|  Pex2 / Pex12 amino terminal region family pr...  75.9    8e-14    
gb|EXM08304.1|  hypothetical protein FOIG_03007                       82.4    9e-14    
gb|EFW14430.1|  peroxisome biosynthesis protein Peroxin-10            75.9    9e-14    
ref|XP_004071127.1|  PREDICTED: peroxisome biogenesis factor 10-like  81.6    9e-14    
ref|XP_009699661.1|  PREDICTED: peroxisome biogenesis factor 10       80.9    1e-13    
ref|NP_001060246.1|  Os07g0608900                                     77.0    1e-13    Oryza sativa Japonica Group [Japonica rice]
gb|EMT65288.1|  Peroxisome biogenesis factor 10                       82.4    1e-13    
ref|XP_007407847.1|  hypothetical protein MELLADRAFT_84453            74.7    1e-13    
ref|XP_006687275.1|  hypothetical protein CANTEDRAFT_106736           81.3    1e-13    
gb|EYE93251.1|  putative peroxisome biosynthesis protein              81.6    2e-13    
emb|CCT65800.1|  related to C3HC4 zinc-binding integral peroxisom...  81.6    2e-13    
dbj|GAD94071.1|  peroxisome biosynthesis protein (Peroxin-10), pu...  78.6    2e-13    
ref|XP_001700133.1|  predicted protein                                79.3    2e-13    Chlamydomonas reinhardtii
ref|XP_010075918.1|  PREDICTED: peroxisome biogenesis factor 10       80.5    2e-13    
ref|XP_011112627.1|  hypothetical protein H072_6848                   82.4    2e-13    
ref|XP_005143707.1|  PREDICTED: peroxisome biogenesis factor 10       80.5    2e-13    
gb|KFP47876.1|  Peroxisome biogenesis factor 10                       79.7    3e-13    
ref|XP_007078380.1|  PREDICTED: peroxisome biogenesis factor 10       79.7    3e-13    
gb|EWG48262.1|  hypothetical protein FVEG_08096                       80.5    4e-13    
gb|KFU95407.1|  Peroxisome biogenesis factor 10                       79.3    4e-13    
gb|KFO05646.1|  Peroxisome biogenesis factor 10                       79.0    5e-13    
ref|XP_010003579.1|  PREDICTED: peroxisome biogenesis factor 10       79.3    6e-13    
ref|XP_011104918.1|  pex10p                                           79.3    6e-13    
gb|KFQ50456.1|  Peroxisome biogenesis factor 10                       79.0    6e-13    
ref|XP_009646434.1|  PREDICTED: peroxisome biogenesis factor 10       79.3    6e-13    
ref|XP_007754973.1|  hypothetical protein A1O7_02753                  74.3    6e-13    
gb|KFP10536.1|  Peroxisome biogenesis factor 10                       78.6    7e-13    
emb|CCL98403.1|  predicted protein                                    79.0    7e-13    
gb|KHN96448.1|  RING-1 like protein                                   69.7    8e-13    
ref|XP_007265820.1|  hypothetical protein FOMMEDRAFT_167453           79.0    8e-13    
ref|XP_009478763.1|  PREDICTED: peroxisome biogenesis factor 10       78.6    8e-13    
gb|KFV41606.1|  Peroxisome biogenesis factor 10                       78.2    9e-13    
ref|XP_008717474.1|  hypothetical protein HMPREF1541_04909            75.5    9e-13    
gb|KFO89696.1|  Peroxisome biogenesis factor 10                       78.2    9e-13    
gb|KFP23755.1|  Peroxisome biogenesis factor 10                       78.2    1e-12    
ref|XP_010207435.1|  PREDICTED: peroxisome biogenesis factor 10       78.2    1e-12    
ref|XP_007763209.1|  hypothetical protein CONPUDRAFT_114617           78.6    1e-12    
emb|CDW86965.1|  peroxisome biogenesis factor 10                      73.2    1e-12    
ref|XP_010134373.1|  PREDICTED: peroxisome biogenesis factor 10       77.8    1e-12    
gb|EGA75512.1|  Pex10p                                                78.2    1e-12    
ref|XP_008728172.1|  hypothetical protein G647_05623                  73.2    1e-12    
ref|NP_010551.1|  ubiquitin-protein ligase peroxin 10                 78.6    1e-12    
gb|EGA83387.1|  Pex10p                                                78.6    1e-12    
ref|XP_006681841.1|  hypothetical protein BATDEDRAFT_91452            66.2    2e-12    
gb|KGL96986.1|  Peroxisome biogenesis factor 10                       77.4    2e-12    
ref|XP_006044713.1|  PREDICTED: peroxisome biogenesis factor 10 i...  72.4    2e-12    
ref|NP_001185583.1|  peroxisome biogenesis factor 10                  77.8    2e-12    
ref|XP_002843579.1|  peroxisome assembly protein 10                   71.6    2e-12    
gb|KEQ98025.1|  hypothetical protein AUEXF2481DRAFT_37600             78.2    2e-12    
ref|XP_010848282.1|  PREDICTED: peroxisome biogenesis factor 10 i...  72.0    2e-12    
ref|XP_005217172.1|  PREDICTED: peroxisome biogenesis factor 10 i...  72.0    2e-12    
gb|KFV94544.1|  Peroxisome biogenesis factor 10                       77.0    2e-12    
ref|XP_009580959.1|  PREDICTED: peroxisome biogenesis factor 10       77.0    2e-12    
ref|XP_009887977.1|  PREDICTED: peroxisome biogenesis factor 10       77.0    2e-12    
gb|KFW96331.1|  Peroxisome biogenesis factor 10                       77.0    2e-12    
gb|KFP70283.1|  Peroxisome biogenesis factor 10                       76.6    3e-12    
ref|XP_010304897.1|  PREDICTED: peroxisome biogenesis factor 10       76.6    3e-12    
gb|EGC43982.1|  peroxin 10                                            75.9    3e-12    
emb|CDR39707.1|  CYFA0S03e06304g1_1                                   77.4    3e-12    
gb|KFQ80028.1|  Peroxisome biogenesis factor 10                       76.3    4e-12    
gb|AAS56114.1|  YDR265W                                               77.0    5e-12    
ref|XP_010575768.1|  PREDICTED: peroxisome biogenesis factor 10       76.6    5e-12    
ref|XP_009807340.1|  PREDICTED: peroxisome biogenesis factor 10       76.6    6e-12    
gb|EMD41598.1|  hypothetical protein CERSUDRAFT_146687                76.3    7e-12    
ref|XP_007376688.1|  hypothetical protein SPAPADRAFT_72602            76.3    7e-12    
ref|XP_009541570.1|  peroxisome biogenesis factor Pex10               75.9    8e-12    
ref|XP_007749432.1|  hypothetical protein A1O5_10666                  70.5    8e-12    
ref|XP_002811639.1|  PREDICTED: peroxisome biogenesis factor 10       69.3    8e-12    
ref|XP_005969964.1|  PREDICTED: peroxisome biogenesis factor 10       75.5    9e-12    
gb|KFQ43077.1|  Peroxisome biogenesis factor 10                       75.1    9e-12    
ref|XP_009500963.1|  PREDICTED: peroxisome biogenesis factor 10       75.5    9e-12    
ref|XP_010016316.1|  PREDICTED: peroxisome biogenesis factor 10       75.1    1e-11    
ref|XP_010223786.1|  PREDICTED: peroxisome biogenesis factor 10       75.5    1e-11    
gb|KFZ46154.1|  Peroxisome biogenesis factor 10                       75.1    1e-11    
gb|KGL84693.1|  Peroxisome biogenesis factor 10                       75.1    1e-11    
gb|KFM04079.1|  Peroxisome biogenesis factor 10                       74.7    1e-11    
emb|CDK24859.1|  unnamed protein product                              75.5    1e-11    
ref|XP_010161276.1|  PREDICTED: peroxisome biogenesis factor 10       74.7    1e-11    
ref|XP_006124777.1|  PREDICTED: peroxisome biogenesis factor 10       74.7    2e-11    
dbj|GAA22490.1|  K7_Pex10p                                            75.1    2e-11    
gb|EPS93794.1|  hypothetical protein FOMPIDRAFT_1135534               75.1    2e-11    
gb|EDN60598.1|  C3HC4 zinc-binding integral peroxisomal membrane ...  75.1    2e-11    
ref|XP_009272504.1|  PREDICTED: peroxisome biogenesis factor 10       74.7    2e-11    
emb|CCH41269.1|  Peroxisome assembly protein 10                       75.1    2e-11    
ref|XP_009072466.1|  PREDICTED: peroxisome biogenesis factor 10       74.3    2e-11    
ref|XP_007861568.1|  hypothetical protein GLOTRDRAFT_102715           75.1    2e-11    
ref|XP_005292814.1|  PREDICTED: peroxisome biogenesis factor 10       74.7    2e-11    
ref|XP_005011145.1|  PREDICTED: peroxisome biogenesis factor 10       74.3    2e-11    
gb|EDK37412.2|  hypothetical protein PGUG_01510                       73.6    2e-11    
gb|KFV17068.1|  Peroxisome biogenesis factor 10                       73.9    2e-11    
gb|KFQ25058.1|  Peroxisome biogenesis factor 10                       73.9    2e-11    
ref|XP_010721164.1|  PREDICTED: peroxisome biogenesis factor 10       75.1    2e-11    
gb|KDN52756.1|  hypothetical protein K437DRAFT_220124                 65.5    3e-11    
ref|XP_010188584.1|  PREDICTED: peroxisome biogenesis factor 10       73.9    3e-11    
ref|XP_001422663.1|  predicted protein                                75.1    3e-11    
ref|XP_009983213.1|  PREDICTED: peroxisome biogenesis factor 10       73.9    3e-11    
ref|XP_004639654.1|  PREDICTED: peroxisome biogenesis factor 10       67.8    3e-11    
emb|CCU74878.1|  peroxisome biosynthesis protein (Peroxin-10)         74.7    3e-11    
ref|XP_003481979.1|  PREDICTED: peroxisome biogenesis factor 10-l...  66.2    4e-11    
ref|XP_002738322.1|  PREDICTED: peroxisome biogenesis factor 10-like  73.6    4e-11    
ref|XP_005437799.1|  PREDICTED: peroxisome biogenesis factor 10       73.9    4e-11    
gb|KDE05759.1|  hypothetical protein MVLG_03850                       68.2    4e-11    
ref|XP_007247990.1|  PREDICTED: peroxisome biogenesis factor 10       65.9    4e-11    
emb|CCE44474.1|  hypothetical protein CPAR2_402760                    73.9    4e-11    
gb|ETS64789.1|  hypothetical protein PaG_00752                        57.4    4e-11    
gb|KGU25903.1|  peroxin-10                                            73.6    4e-11    
gb|KFQ93751.1|  Peroxisome biogenesis factor 10                       73.2    4e-11    
ref|XP_005238066.1|  PREDICTED: peroxisome biogenesis factor 10       73.6    4e-11    
gb|KEY70672.1|  hypothetical protein S7711_02272                      74.3    4e-11    
ref|XP_005823740.1|  hypothetical protein GUITHDRAFT_155144           72.8    4e-11    
gb|KGQ97001.1|  peroxin-10                                            73.6    4e-11    
ref|XP_001485839.1|  hypothetical protein PGUG_01510                  72.4    5e-11    
gb|KHC34918.1|  peroxin-10                                            73.2    5e-11    
ref|XP_010848280.1|  PREDICTED: peroxisome biogenesis factor 10 i...  66.2    5e-11    
gb|KGR09808.1|  peroxin-10                                            73.2    5e-11    
gb|KGU09024.1|  peroxin-10                                            73.2    5e-11    
gb|KFA71913.1|  hypothetical protein S40288_08747                     73.9    6e-11    
ref|XP_006903978.1|  PREDICTED: peroxisome biogenesis factor 10       68.6    6e-11    
emb|CDR36773.1|  RHTO0S02e06678g1_1                                   68.6    6e-11    
emb|CCF52861.1|  related to PEX10-peroxisomal assembly protein-pe...  59.3    6e-11    
ref|XP_004607248.1|  PREDICTED: peroxisome biogenesis factor 10       71.2    6e-11    
ref|XP_003307729.2|  hypothetical protein PGTG_00679                  67.0    6e-11    
ref|XP_002582984.1|  conserved hypothetical protein                   73.9    7e-11    
gb|KFO76649.1|  Peroxisome biogenesis factor 10                       72.8    7e-11    
gb|KHC86834.1|  peroxin-10                                            72.8    7e-11    
gb|KGQ86304.1|  peroxin-10                                            72.8    7e-11    
ref|XP_010295254.1|  PREDICTED: peroxisome biogenesis factor 10       72.8    7e-11    
gb|KFP36233.1|  Peroxisome biogenesis factor 10                       72.0    8e-11    
gb|ETR97346.1|  RING-1 like protein                                   65.1    8e-11    
ref|XP_003356175.1|  PREDICTED: peroxisome biogenesis factor 10-l...  65.1    8e-11    
ref|XP_009559868.1|  PREDICTED: peroxisome biogenesis factor 10       72.8    8e-11    
ref|NP_001133453.1|  peroxisome biogenesis factor 10                  64.3    8e-11    
gb|KFV63520.1|  Peroxisome biogenesis factor 10                       72.4    9e-11    
emb|CEG84951.1|  Putative Pex2/pex12 amino terminal region domain...  70.1    9e-11    
ref|XP_006044712.1|  PREDICTED: peroxisome biogenesis factor 10 i...  66.2    1e-10    
emb|CBN76471.1|  peroxisome biogenesis factor 10                      73.6    1e-10    
ref|XP_004349596.1|  Pex2 / Pex12 amino terminal region protein       73.9    1e-10    
ref|XP_005888958.1|  PREDICTED: peroxisome biogenesis factor 10       72.0    1e-10    
gb|EMG47488.1|  Peroxisome assembly protein, putative                 72.0    1e-10    
ref|XP_005339285.1|  PREDICTED: peroxisome biogenesis factor 10       65.5    2e-10    
emb|CEG02006.1|  Zinc finger, RING/FYVE/PHD-type                      72.4    2e-10    
ref|XP_009459277.1|  PREDICTED: peroxisome biogenesis factor 10       72.8    2e-10    
gb|EMS19156.1|  peroxisomal biogenesis factor 10                      66.6    2e-10    
ref|XP_003082884.1|  Pex10p (ISS)                                     72.8    2e-10    
gb|KFH48021.1|  Peroxisome biogenesis factor-like protein             72.4    2e-10    
ref|NP_001069801.1|  peroxisome biogenesis factor 10                  64.3    2e-10    
ref|XP_006992455.1|  PREDICTED: peroxisome biogenesis factor 10 i...  71.6    2e-10    
ref|XP_009831961.1|  hypothetical protein H257_07940                  72.4    2e-10    
ref|XP_006871842.1|  PREDICTED: peroxisome biogenesis factor 10       71.6    2e-10    
dbj|BAO41384.1|  peroxisome biogenesis factor 10                      71.2    2e-10    
ref|XP_010997646.1|  PREDICTED: peroxisome biogenesis factor 10       65.9    2e-10    
gb|KHC41514.1|  peroxin-10                                            71.2    2e-10    
ref|XP_007851738.1|  peroxisome assembly protein per8 (peroxin-10)    71.6    2e-10    
ref|XP_010119267.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    2e-10    
ref|XP_005079302.1|  PREDICTED: peroxisome biogenesis factor 10       71.6    2e-10    
ref|XP_005368709.1|  PREDICTED: peroxisome biogenesis factor 10 i...  71.6    2e-10    
ref|NP_001035866.1|  peroxisome biogenesis factor 10                  71.6    3e-10    
ref|XP_006695996.1|  putative peroxin-10 protein                      70.9    3e-10    
gb|KFR10572.1|  Peroxisome biogenesis factor 10                       70.9    3e-10    
ref|XP_003461551.1|  PREDICTED: peroxisome biogenesis factor 10 i...  71.6    3e-10    
ref|XP_003509336.1|  PREDICTED: peroxisome biogenesis factor 10       71.2    3e-10    
gb|EHK40948.1|  hypothetical protein TRIATDRAFT_24897                 61.2    3e-10    
ref|XP_005368708.1|  PREDICTED: peroxisome biogenesis factor 10 i...  71.6    3e-10    
ref|XP_009954513.1|  PREDICTED: peroxisome biogenesis factor 10       70.5    3e-10    
ref|XP_009877045.1|  PREDICTED: peroxisome biogenesis factor 10       70.5    3e-10    
ref|XP_005404229.1|  PREDICTED: peroxisome biogenesis factor 10 i...  64.3    3e-10    
ref|XP_007900302.1|  PREDICTED: peroxisome biogenesis factor 10       70.5    3e-10    
ref|XP_003869999.1|  Pex10 protein                                    71.2    3e-10    
ref|XP_004880455.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    3e-10    
ref|XP_006197048.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    3e-10    
ref|XP_007917292.1|  putative ring-1 protein                          66.6    3e-10    
gb|EPB86242.1|  hypothetical protein HMPREF1544_06970                 71.6    3e-10    
ref|XP_004272347.1|  PREDICTED: peroxisome biogenesis factor 10       67.0    3e-10    
ref|XP_004325628.1|  PREDICTED: peroxisome biogenesis factor 10       67.0    3e-10    
ref|XP_004999714.1|  PREDICTED: peroxisome biogenesis factor 10 i...  62.8    3e-10    
gb|KFQ14497.1|  Peroxisome biogenesis factor 10                       70.1    4e-10    
ref|XP_009910390.1|  PREDICTED: peroxisome biogenesis factor 10       70.5    4e-10    
ref|XP_004784166.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    4e-10    
ref|NP_001102875.1|  peroxisome biogenesis factor 10                  70.9    4e-10    
ref|XP_005404230.1|  PREDICTED: peroxisome biogenesis factor 10 i...  63.9    4e-10    
ref|XP_008850863.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    4e-10    
gb|EOB07532.1|  Peroxisome assembly protein 10                        70.5    4e-10    
ref|XP_006885885.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.9    4e-10    
ref|XP_004863853.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.9    4e-10    
ref|XP_007070295.1|  PREDICTED: peroxisome biogenesis factor 10       71.6    4e-10    
ref|XP_004657778.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    4e-10    
ref|XP_008575571.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    4e-10    
gb|KFP83111.1|  Peroxisome biogenesis factor 10                       70.1    5e-10    
ref|XP_002545227.1|  hypothetical protein CTRG_00008                  70.9    5e-10    
ref|XP_004384513.1|  PREDICTED: peroxisome biogenesis factor 10       70.5    5e-10    
ref|XP_006885884.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.9    5e-10    
ref|XP_006187397.1|  PREDICTED: peroxisome biogenesis factor 10       70.1    5e-10    
gb|KFQ64095.1|  Peroxisome biogenesis factor 10                       70.1    5e-10    
gb|EHB00346.1|  Peroxisome biogenesis factor 10                       70.5    5e-10    
ref|XP_009909605.1|  PREDICTED: peroxisome biogenesis factor 10       70.9    5e-10    
ref|XP_009669895.1|  PREDICTED: peroxisome biogenesis factor 10       70.1    6e-10    
dbj|BAP72830.1|  peroxisome biogenesis factor 10                      70.1    6e-10    
ref|XP_010348631.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.5    6e-10    
ref|XP_010773332.1|  PREDICTED: peroxisome biogenesis factor 10       70.1    6e-10    
ref|XP_007336643.1|  hypothetical protein AURDEDRAFT_147853           70.1    6e-10    
ref|XP_007814471.1|  RING-1 like protein                              59.7    6e-10    
ref|XP_002750252.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.5    6e-10    
ref|XP_009534224.1|  hypothetical protein PHYSODRAFT_288411           68.6    6e-10    
ref|XP_003939691.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.1    7e-10    
ref|XP_007598664.1|  Pex2/Pex12 amino terminal region                 70.9    7e-10    
ref|XP_007929228.1|  hypothetical protein MYCFIDRAFT_166575           66.6    7e-10    
ref|XP_004196807.1|  Piso0_004033                                     70.5    7e-10    
ref|XP_002936605.1|  PREDICTED: peroxisome biogenesis factor 10       70.1    7e-10    
ref|XP_006969945.1|  predicted protein                                65.1    7e-10    
gb|EPQ65578.1|  hypothetical protein BGT96224_A21151                  70.5    8e-10    
gb|EDL14990.1|  mCG3937, isoform CRA_a                                58.9    8e-10    
ref|XP_004863854.1|  PREDICTED: peroxisome biogenesis factor 10 i...  62.0    8e-10    
dbj|GAC93577.1|  hypothetical protein PHSY_001142                     55.1    9e-10    
ref|XP_010955940.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.1    9e-10    
ref|XP_005545086.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.1    9e-10    
ref|XP_001084009.2|  PREDICTED: peroxisome biogenesis factor 10 i...  70.1    9e-10    
ref|XP_009211931.1|  PREDICTED: peroxisome biogenesis factor 10 i...  70.1    1e-09    
ref|XP_005545090.1|  PREDICTED: peroxisome biogenesis factor 10 i...  68.9    1e-09    
ref|XP_010626194.1|  PREDICTED: peroxisome biogenesis factor 10       70.1    1e-09    
ref|NP_722540.1|  peroxisome biogenesis factor 10 isoform 1           69.7    1e-09    
ref|XP_010591473.1|  PREDICTED: peroxisome biogenesis factor 10 i...  68.9    1e-09    
ref|XP_007979117.1|  PREDICTED: peroxisome biogenesis factor 10 i...  68.6    1e-09    
ref|XP_004024556.1|  PREDICTED: peroxisome biogenesis factor 10 i...  69.7    1e-09    
gb|KFO31774.1|  Peroxisome biogenesis factor 10                       69.7    1e-09    
gb|KDO35275.1|  hypothetical protein SPRG_00122                       69.7    1e-09    
gb|EQB58634.1|  Pex2/Pex12 amino terminal region                      69.7    1e-09    
ref|XP_003978917.1|  PREDICTED: peroxisome biogenesis factor 10-like  69.3    1e-09    
ref|XP_004596211.1|  PREDICTED: peroxisome biogenesis factor 10       68.9    1e-09    
ref|XP_001933069.1|  peroxisome assembly protein 10                   69.7    2e-09    
ref|XP_009932761.1|  PREDICTED: peroxisome biogenesis factor 10       70.1    2e-09    
ref|XP_002419710.1|  C3HC4 zinc-binding integral peroxisomal memb...  68.6    2e-09    
ref|XP_004768835.1|  PREDICTED: peroxisome biogenesis factor 10       69.7    2e-09    
ref|XP_007943624.1|  PREDICTED: peroxisome biogenesis factor 10       68.9    2e-09    
emb|CBQ73022.1|  related to PEX10-peroxisomal assembly protein-pe...  54.3    2e-09    
ref|XP_003765134.1|  PREDICTED: peroxisome biogenesis factor 10       69.3    2e-09    
ref|XP_001517927.2|  PREDICTED: peroxisome biogenesis factor 10       68.6    2e-09    
ref|XP_001495136.1|  PREDICTED: peroxisome biogenesis factor 10       68.6    2e-09    
ref|XP_008706017.1|  PREDICTED: peroxisome biogenesis factor 10       68.6    2e-09    
ref|XP_002924434.1|  PREDICTED: peroxisome biogenesis factor 10-like  68.9    2e-09    
gb|KFV79551.1|  Peroxisome biogenesis factor 10                       67.8    2e-09    
ref|XP_002912144.1|  peroxisome assembly protein per8                 68.6    2e-09    
ref|XP_002505486.1|  peroxisomal protein importer family              69.3    2e-09    
ref|XP_010891521.1|  PREDICTED: peroxisome biogenesis factor 10 i...  59.7    2e-09    
ref|XP_004407421.1|  PREDICTED: peroxisome biogenesis factor 10       68.6    2e-09    
ref|XP_005665007.1|  PREDICTED: peroxisome biogenesis factor 10-l...  58.9    2e-09    
ref|XP_007378356.1|  hypothetical protein PUNSTDRAFT_56754            68.6    2e-09    
ref|XP_010891519.1|  PREDICTED: peroxisome biogenesis factor 10 i...  59.7    2e-09    
ref|XP_010891520.1|  PREDICTED: peroxisome biogenesis factor 10 i...  59.7    3e-09    
ref|XP_001794244.1|  hypothetical protein SNOG_03692                  59.3    3e-09    
ref|XP_010151653.1|  PREDICTED: peroxisome biogenesis factor 10       67.8    3e-09    
gb|KFV93875.1|  Peroxisome biogenesis factor 10                       67.8    3e-09    
ref|XP_006642033.1|  PREDICTED: peroxisome biogenesis factor 10-like  59.3    3e-09    
ref|XP_004426121.1|  PREDICTED: uncharacterized protein LOC101398181  69.3    3e-09    
ref|XP_007979116.1|  PREDICTED: peroxisome biogenesis factor 10 i...  60.1    3e-09    
gb|KFW84963.1|  Peroxisome biogenesis factor 10                       67.4    3e-09    
ref|XP_001985426.1|  GH17052                                          67.8    4e-09    



>ref|XP_009616706.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Nicotiana 
tomentosiformis]
 gb|ACB59354.1| peroxisome biogenesis factor 10 [Nicotiana tabacum]
Length=397

 Score =   442 bits (1137),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 262/334 (78%), Positives = 283/334 (85%), Gaps = 2/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQMLY++LTTGAGKQTLGEEYCD TQVAGPYGL PTPARRALFIF
Sbjct  66    GTRVAVAYQNEAKLLGQMLYYMLTTGAGKQTLGEEYCDITQVAGPYGLSPTPARRALFIF  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+AVPY+AERVSSR+AS+GITL D     Y F     SS+  EAS   EI SSSTS   
Sbjct  126   YQSAVPYIAERVSSRVASRGITLTDSM-AGYIFGDVRTSSNEAEASATVEIQSSSTSTPS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K KIR+ WL+AV+RWPSVLPLARE+LQLVIR NLMFFYFEG YYH+SKRA+GI
Sbjct  185   ISALSRLKAKIRDFWLYAVRRWPSVLPLAREVLQLVIRTNLMFFYFEGFYYHISKRAAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCI  A    RRSSLSSI+AS QQ PFGTYQTS+G
Sbjct  245   RYVFIGKPMNQRPRYQILGVFLLIQLCI-LAAEGLRRSSLSSISASVQQAPFGTYQTSTG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLITA +EK   V+E +STSESQ S  SKC+LCLSSRQ PTATPCGHVFC
Sbjct  304   RGLPVLNEEGNLITAETEKYGLVAESTSTSESQGSSSSKCTLCLSSRQDPTATPCGHVFC  363

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSP THSSLVCLYHSDF
Sbjct  364   WNCIMEWCNEKPECPLCRSPITHSSLVCLYHSDF  397


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MGL EP+R S N   SS+         G V+ FPLA QPEIMRAAEKD+QY  FVYEACR
Sbjct  1    MGLEEPARISANVGNSSDG--GGASTSGSVKRFPLAAQPEIMRAAEKDDQYASFVYEACR  58

Query  209  DAFRHLFGSYFSINLFFFAKLWPSFTFLFL  298
            DAFRHLFG+  ++     AKL     +  L
Sbjct  59   DAFRHLFGTRVAVAYQNEAKLLGQMLYYML  88



>ref|XP_009768856.1| PREDICTED: peroxisome biogenesis factor 10 [Nicotiana sylvestris]
Length=396

 Score =   440 bits (1132),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 261/334 (78%), Positives = 282/334 (84%), Gaps = 3/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQMLY++LTTGAGKQTLGEEYCD TQVAGPYGL PTPARRALFIF
Sbjct  66    GTRVAVAYQNEAKLLGQMLYYMLTTGAGKQTLGEEYCDITQVAGPYGLSPTPARRALFIF  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+AVPY+AERVSSR+AS+GITL D   D Y F     SS+  EAS   EI SSSTS   
Sbjct  126   YQSAVPYIAERVSSRVASRGITLADSMAD-YTFGDVRSSSNEAEASATVEIQSSSTSTPS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K KIR+ WL+AV+RWPSVLPLARE+LQLVIR NLMFFYFEG YYH+SKR +GI
Sbjct  185   ISALSRLKAKIRDFWLYAVRRWPSVLPLAREVLQLVIRTNLMFFYFEGFYYHISKRTAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCI  A    RRSSLSSI+AS QQ PFGTYQTS+G
Sbjct  245   RYVFIGKPMNQRPRYQILGVFLLIQLCI-LAAEGLRRSSLSSISASVQQAPFGTYQTSTG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLITA + K S + E +STSESQ S  SKC+LCLSSRQ PTATPCGHVFC
Sbjct  304   RGLPVLNEEGNLITAETGK-SGLVESTSTSESQGSSPSKCTLCLSSRQDPTATPCGHVFC  362

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSP THSSLVCLYHSDF
Sbjct  363   WNCIMEWCNEKPECPLCRSPITHSSLVCLYHSDF  396


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MGL EP+R S NA  SS          G V+ FPLA QPEIMRAAEKD+QY  FVY+ACR
Sbjct  1    MGLEEPARTSANAGNSSHG--GGASTSGSVKRFPLAAQPEIMRAAEKDDQYASFVYDACR  58

Query  209  DAFRHLFGSYFSINLFFFAKLWPSFTFLFL  298
            DAFRHLFG+  ++     AKL     +  L
Sbjct  59   DAFRHLFGTRVAVAYQNEAKLLGQMLYYML  88



>ref|XP_004238310.1| PREDICTED: peroxisome biogenesis factor 10 [Solanum lycopersicum]
Length=397

 Score =   440 bits (1131),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 259/334 (78%), Positives = 280/334 (84%), Gaps = 2/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAV YQNE KLLGQMLY++LTTGAGKQTLGEEYCD TQVAGPYGL PTPARR LFIF
Sbjct  66    GTRVAVTYQNEAKLLGQMLYYMLTTGAGKQTLGEEYCDITQVAGPYGLSPTPARRTLFIF  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+AVPY+AERVSSR AS GITL D   D Y F     SS+  EAS   EI SSSTS   
Sbjct  126   YQSAVPYIAERVSSRAASHGITLADSMVD-YAFRDDPTSSNEAEASPTFEIRSSSTSTPS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S  SR K KIR+ WL+ V+RWPS+LPLAREILQLVIRANLMFFYFEGLYYH+SKRA+GI
Sbjct  185   ISAFSRLKAKIRDFWLYTVRRWPSMLPLAREILQLVIRANLMFFYFEGLYYHISKRAAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
              YVFIGKP NQRPRYQILG FLL+QLCI  A    RRSSLSS++ SAQQ PFGTYQTS+G
Sbjct  245   HYVFIGKPMNQRPRYQILGVFLLIQLCI-LAAEGLRRSSLSSVSTSAQQAPFGTYQTSAG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLITA +EK   V+E +STSESQ +  SKC+LCLSSRQHPTATPCGHVFC
Sbjct  304   RGLPVLNEEGNLITAETEKYGLVAESTSTSESQGNSPSKCTLCLSSRQHPTATPCGHVFC  363

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSP THSSLVCLYHSDF
Sbjct  364   WNCIMEWCNEKPECPLCRSPVTHSSLVCLYHSDF  397


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MG GEPSR S NA   + D G +   G  V+ FPLA QPEIMRAAEKD+QY  FVYEACR
Sbjct  1    MGSGEPSRTSTNA--GNSDGGGASTSGSSVKRFPLAAQPEIMRAAEKDDQYASFVYEACR  58

Query  209  DAFRHLFGSYFSINLFFFAKLWPSFTFLFL  298
            DAFRHLFG+  ++     AKL     +  L
Sbjct  59   DAFRHLFGTRVAVTYQNEAKLLGQMLYYML  88



>ref|XP_006341993.1| PREDICTED: peroxisome biogenesis factor 10-like [Solanum tuberosum]
Length=397

 Score =   437 bits (1124),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 257/334 (77%), Positives = 280/334 (84%), Gaps = 2/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAV YQNE KLLGQMLY++LTTGAGKQTLGEEYCD TQVAGPYGL PTPARRALFIF
Sbjct  66    GTRVAVTYQNEAKLLGQMLYYMLTTGAGKQTLGEEYCDITQVAGPYGLSPTPARRALFIF  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+AVPY+AERVSSR AS  ITL D   D Y F     SS+  EAS   EI SSSTS   
Sbjct  126   YQSAVPYIAERVSSRAASHDITLADSMAD-YAFGDDPTSSNEAEASPTFEIHSSSTSAPS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K KIR+ WL+ ++RWPS+LPLAREILQLVIR NLMFFYFEGLYYH+SKRA+GI
Sbjct  185   ISALSRLKAKIRDFWLYTIRRWPSMLPLAREILQLVIRTNLMFFYFEGLYYHISKRAAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
              YVFIGKP NQRPRYQILG FLL+QLCI  A    RRSSLSS++ SAQQ PFGTY+TS+G
Sbjct  245   HYVFIGKPMNQRPRYQILGVFLLIQLCI-LAAEGLRRSSLSSVSTSAQQAPFGTYRTSAG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLITA +EK   V+E +STSESQ +  SKC+LCLSSRQHPTATPCGHVFC
Sbjct  304   RGLPVLNEEGNLITAETEKYGLVAESTSTSESQGNSPSKCTLCLSSRQHPTATPCGHVFC  363

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSP THSSLVCLYHSDF
Sbjct  364   WNCIMEWCNEKPECPLCRSPVTHSSLVCLYHSDF  397


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MGLGE SR S N    + D G +   G  V+ FPLA QPEIMRAAEKD+QY  FVYEACR
Sbjct  1    MGLGEASRTSTNV--GNSDGGGASTSGSSVKRFPLAAQPEIMRAAEKDDQYASFVYEACR  58

Query  209  DAFRHLFGSYFSINLFFFAKLWPSFTFLFL  298
            DAFRHLFG+  ++     AKL     +  L
Sbjct  59   DAFRHLFGTRVAVTYQNEAKLLGQMLYYML  88



>ref|XP_011081624.1| PREDICTED: peroxisome biogenesis factor 10 [Sesamum indicum]
 ref|XP_011081625.1| PREDICTED: peroxisome biogenesis factor 10 [Sesamum indicum]
Length=398

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 252/334 (75%), Positives = 283/334 (85%), Gaps = 2/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKLLGQMLYF+LTTGAGKQTLGEEYCD TQVAGPYGLPPTPARR+LFIF
Sbjct  67    GTRVAVAYQSETKLLGQMLYFVLTTGAGKQTLGEEYCDITQVAGPYGLPPTPARRSLFIF  126

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA PY+AER+SSRIASQGIT+ D   D       + S+S++++S ++E++SS  S   
Sbjct  127   YQTAFPYIAERISSRIASQGITMADLLSDDI-IDNETISNSQIQSSASAEMSSSFNSGVP  185

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K +I   WL+AV+RWPSVLP ARE   LV+RANLMFFYFEGLYYHLSKRA+GI
Sbjct  186   LSALSRLKARITGVWLYAVRRWPSVLPFARECFMLVLRANLMFFYFEGLYYHLSKRAAGI  245

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKPTNQRPRYQILG FLLVQLCI  A    RRS+LS+ A S QQT  G YQTS+G
Sbjct  246   RYVFIGKPTNQRPRYQILGVFLLVQLCI-IAAEGLRRSNLSTFATSFQQTSHGAYQTSAG  304

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLIT  S K S+V E + TSESQASG+SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  305   RGLPVLNEEGNLITEDSGKSSWVHESTPTSESQASGVSKCTLCLSNRQNPTATPCGHVFC  364

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF
Sbjct  365   WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  398


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 5/75 (7%)
 Frame = +2

Query  29   MGLGEPS--RESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEA  202
            MGL E +  +E+G    S+ ++     G GGVR FPLA QPEIMRAAEKD+QY  FVY+A
Sbjct  1    MGLREATAVKEAGT---SNSNLDEGPSGSGGVRRFPLAAQPEIMRAAEKDDQYASFVYDA  57

Query  203  CRDAFRHLFGSYFSI  247
            CRDAFRHLFG+  ++
Sbjct  58   CRDAFRHLFGTRVAV  72



>ref|XP_007012401.1| Peroxisome biogenesis factor 10 [Theobroma cacao]
 gb|EOY30020.1| Peroxisome biogenesis factor 10 [Theobroma cacao]
Length=421

 Score =   421 bits (1082),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 276/334 (83%), Gaps = 5/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGP+GL PTPARRALFI 
Sbjct  93    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPHGLSPTPARRALFIV  152

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSRIAS+GITL +   D + +S  +   ++VE+ST  EI+ S  SR  
Sbjct  153   YQTAVPYIAERISSRIASRGITLAELQSDEF-YSNNASDRNQVESSTGIEISLSPESRDS  211

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K K+   WLHAVQRWP+VLP+ARE+LQL++RANLMFFYFEGLYYH+SKRA+GI
Sbjct  212   VSALSRLKEKLNGMWLHAVQRWPAVLPIAREVLQLLLRANLMFFYFEGLYYHISKRAAGI  271

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S  QT  G++Q ++G
Sbjct  272   RYVFIGKPSNQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSIASSIHQTSLGSHQNTTG  330

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEG LI   +++G   S    ++     G+SKC+LCLS RQHPTATPCGHVFC
Sbjct  331   RGLPVLNEEGILIPVEADQG---SWVGESTSESTGGVSKCTLCLSHRQHPTATPCGHVFC  387

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  388   WNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  421


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 4/75 (5%)
 Frame = +2

Query  26   EMGLG-EPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEA  202
            EMGLG   S  SG+   S E            R FPLA QPEIMRAAEKD+QY  FVY+A
Sbjct  27   EMGLGRNDSPGSGDPGRSGES---EPSTTTEPRRFPLAAQPEIMRAAEKDDQYASFVYDA  83

Query  203  CRDAFRHLFGSYFSI  247
            CRDAFRHLFG+  ++
Sbjct  84   CRDAFRHLFGTRVAV  98



>gb|EYU20307.1| hypothetical protein MIMGU_mgv1a008076mg [Erythranthe guttata]
Length=385

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 264/334 (79%), Gaps = 15/334 (4%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKLLGQMLY++LTTGAGKQTLGEEYCD TQVA P+GLPPTPARR+LFIF
Sbjct  67    GTRVAVAYQSETKLLGQMLYYVLTTGAGKQTLGEEYCDITQVARPHGLPPTPARRSLFIF  126

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA PY+AER+SSRIAS GIT+DD   D             +E ++  +I SS+ S A 
Sbjct  127   YQTAFPYIAERISSRIASLGITMDDSLSDD-----------IIENTSNIQIQSSTNSGAR  175

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K +    WL+AVQRWPS++P+ARE   L++R NLMFFYFEGLYYHLSKRA+G+
Sbjct  176   VSTLSRLKYRFSGLWLYAVQRWPSMVPIAREFFTLILRTNLMFFYFEGLYYHLSKRAAGV  235

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLLVQLCI  A    RRS+LSS+A S QQT  GTYQTS G
Sbjct  236   RYVFIGKPNNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSLATSFQQTSLGTYQTSGG  294

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEG+L    S K    +     + +  S +SKC+LCLS+RQHPTATPCGHVFC
Sbjct  295   RGLPVLNEEGSLAADDSGKS---TWVPEATSTSESQVSKCTLCLSNRQHPTATPCGHVFC  351

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF
Sbjct  352   WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  385


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            VR FPLA QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++
Sbjct  29   VRRFPLAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGTRVAV  72



>ref|XP_010049273.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Eucalyptus 
grandis]
 gb|KCW81793.1| hypothetical protein EUGRSUZ_C03149 [Eucalyptus grandis]
Length=394

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 229/334 (69%), Positives = 275/334 (82%), Gaps = 2/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ET+LLGQMLY++LTTG+G+QTLGEEYCD TQVAGP+GLPPTPARRALFI 
Sbjct  63    GTRVAVAYQSETQLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPHGLPPTPARRALFII  122

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA PYL ER+SSR+AS+GI L +    S  +   +  +++ + S A+   SSS SR +
Sbjct  123   YQTAFPYLTERISSRVASRGIMLAET-PSSELYENTAFENNQGQTSLATGNPSSSVSRGN  181

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S+ +R+K ++   WL AVQRWP+VLP+AREILQLVIR NLMFFYFEG YYH+SKRA+GI
Sbjct  182   GSIFARWKRRLNALWLDAVQRWPAVLPVAREILQLVIRTNLMFFYFEGFYYHISKRAAGI  241

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             +YVFIG P+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S  QT  GT+QTSSG
Sbjct  242   KYVFIGNPSNQRPRYQILGIFLLIQLCI-LAAEGLRRSNLSSIASSVHQTSLGTHQTSSG  300

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGN+I+    KGS++++ S++     +G SKC+LCLS RQHPTATPCGHVFC
Sbjct  301   RGLPVLNEEGNVISLDHNKGSWLTDSSTSEPQGMTGTSKCTLCLSHRQHPTATPCGHVFC  360

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  361   WNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  394


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MGL   +  SG+  AS+       GG    R F  A QPEIMRAAEKD+QY  F+Y+ACR
Sbjct  1    MGLRRMTGRSGDPGASTSG-----GGAESPRRFAPAAQPEIMRAAEKDDQYASFLYDACR  55

Query  209  DAFRHLFGSYFSI  247
            DA RHLFG+  ++
Sbjct  56   DAIRHLFGTRVAV  68



>gb|KHG08617.1| Peroxisome biogenesis factor 10 -like protein [Gossypium arboreum]
Length=394

 Score =   415 bits (1066),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 233/334 (70%), Positives = 272/334 (81%), Gaps = 5/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGP+GL PTPARRALFI 
Sbjct  66    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPHGLSPTPARRALFIV  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSRIAS+GITL D   D + +S +    S+VE+ST  EI+  S S A 
Sbjct  126   YQTAVPYIAERISSRIASRGITLADLQSDEF-YSNSGSERSQVESSTGVEISLPSESTAS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K K+R  WL AVQRWP+VLP+ARE LQ V+RANLMFFYFEG YYH+SKRA+GI
Sbjct  185   VSALSRLKEKLRGMWLRAVQRWPAVLPIAREFLQWVLRANLMFFYFEGFYYHISKRAAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S  QT  G++Q  +G
Sbjct  245   RYVFIGKPSNQRPRYQILGIFLLIQLCI-IAAEGLRRSNLSSITSSIHQTSLGSHQNPTG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             +G+P+LNEEGNLI   +++G   S    ++      +SKC+LCLS+RQHPTATPCGHVFC
Sbjct  304   QGLPLLNEEGNLIPMEADQG---SWVGESTSESTGVVSKCTLCLSNRQHPTATPCGHVFC  360

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  361   WNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  394


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +2

Query  29   MGLG-EPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEAC  205
            MG G   S  SGN   S E + S        R FPLA QPEIMRAAEKD+QY  FVY+AC
Sbjct  1    MGSGRNDSPGSGNPGPSGESIPSPPMEP---RRFPLAAQPEIMRAAEKDDQYASFVYDAC  57

Query  206  RDAFRHLFGSYFSI  247
            RDAFRHLFG+  ++
Sbjct  58   RDAFRHLFGTRVAV  71



>emb|CDP13456.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   415 bits (1066),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 242/334 (72%), Positives = 272/334 (81%), Gaps = 7/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVA+AYQNETKLLGQMLY++LTTGAG QTLGEEYCD  QVAGPYGL PTPARRALFIF
Sbjct  74    GTRVAMAYQNETKLLGQMLYYVLTTGAGLQTLGEEYCDIIQVAGPYGLSPTPARRALFIF  133

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AERVSSRIAS+GI+L D   D      AS+ +            S       
Sbjct  134   YQTAVPYIAERVSSRIASRGISLADSLSDDLLLDDASQITHIQPHDNDEVAVSLL-----  188

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S  SR+K K+   W +AVQRWPSVLP AREILQLV+R NLMFFYFEGLYYH+SKRA+GI
Sbjct  189   -SAFSRWKAKVVGLWSYAVQRWPSVLPFAREILQLVLRTNLMFFYFEGLYYHVSKRAAGI  247

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFI K T+QRPRYQILG FLLVQLCI+AAEGLRR +  S  ++  Q +P GTYQTS+G
Sbjct  248   RYVFISKTTSQRPRYQILGVFLLVQLCIIAAEGLRRSNLSSIASSVHQASP-GTYQTSAG  306

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI+  +EK S+VS+ +STSES A+G+SKC+LCLSSRQHPTATPCGHVFC
Sbjct  307   RGLPVLNEEGNLISGDTEKSSWVSDLASTSESSATGVSKCTLCLSSRQHPTATPCGHVFC  366

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCRSP THSSLVCLYHSDF
Sbjct  367   WNCIMEWCNEKPECPLCRSPVTHSSLVCLYHSDF  400


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 6/79 (8%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggg------gggVRSFPLAQQPEIMRAAEKDEQYTFF  190
            M L E  R+SG+  +S E+ G SG           VR FPLA QPEIMRAAEKD+QY  F
Sbjct  1    MRLAESLRDSGDVRSSREEAGPSGTSGSAPDSTARVRRFPLAAQPEIMRAAEKDDQYASF  60

Query  191  VYEACRDAFRHLFGSYFSI  247
            VYEACRDAFR LFG+  ++
Sbjct  61   VYEACRDAFRQLFGTRVAM  79



>ref|XP_002279784.2| PREDICTED: peroxisome biogenesis factor 10 [Vitis vinifera]
 emb|CBI20709.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   412 bits (1059),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 240/334 (72%), Positives = 277/334 (83%), Gaps = 3/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPYGL PTPARRALFI 
Sbjct  70    GTRVAVAYQSETKLLGQMLYYILTTGSGQQTLGEEYCDITQVAGPYGLSPTPARRALFIL  129

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AERVSSR+A++GI + D   D   +      SS+V++S  +EI SSS S A 
Sbjct  130   YQTAVPYIAERVSSRVAARGIAIADAQADEL-YGNNVPGSSQVQSSAITEIPSSSASGAS  188

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVLSR K K  + WL+AVQRWP VLPLARE LQLV+R NLMFFYFEGLYYH+SKRA+GI
Sbjct  189   LSVLSRLKEKFNQSWLYAVQRWPVVLPLAREFLQLVLRTNLMFFYFEGLYYHISKRAAGI  248

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLL+QLCI  A    RR +LSSIA+S  +TP G +QT++G
Sbjct  249   RYVFIGKSLNQRPRYQILGVFLLIQLCI-IAAEGLRRRNLSSIASSVHRTPLGAHQTATG  307

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             +G+PVLNEEGNLI A ++KG      S+  ESQASG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  308   QGLPVLNEEGNLIAADADKG-SWVSDSTYVESQASGVSKCTLCLSNRQHPTATPCGHVFC  366

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  367   WSCIMEWCNEKPECPLCRTPLTHSSLVCLYHSDF  400


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +2

Query  29   MGLGEPSRESGNAT---ASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYE  199
            MGLG P   SG+      + E   ++     G R FPLA QPEIMRAAEKD+QY   VYE
Sbjct  1    MGLGRP-ETSGSVDPRDTTGEVGRTTAAEPSGSRRFPLAAQPEIMRAAEKDDQYASHVYE  59

Query  200  ACRDAFRHLFGSYFSI  247
            ACRDAFRHLFG+  ++
Sbjct  60   ACRDAFRHLFGTRVAV  75



>ref|XP_004303471.1| PREDICTED: peroxisome biogenesis factor 10-like [Fragaria vesca 
subsp. vesca]
Length=396

 Score =   407 bits (1047),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 236/334 (71%), Positives = 275/334 (82%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAG YGLPPTPARRALFI 
Sbjct  69    GTRIAVAYQNETKLLGQMLYYILTTGSGQQTLGEEYCDITQVAGAYGLPPTPARRALFIV  128

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++G+ L D   D   +S+++  S+  ++S+ S   SSS     
Sbjct  129   YQTALPYIAERISSRAANRGLLLADSQSDEV-YSISALMSNDAQSSSISRGVSSSAPLES  187

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R K ++   WL AV+RWP+VLP+ARE LQLVIRANLMFFYFEGLYYH+SKRA+GI
Sbjct  188   VSAFKRLKQRLNGLWLSAVRRWPTVLPIAREFLQLVIRANLMFFYFEGLYYHISKRAAGI  247

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA SAQQT FGT+QTSSG
Sbjct  248   RYVFIGKPSNQRPRYQILGIFLLIQLCI-IAAEGLRRSNLSSIATSAQQT-FGTHQTSSG  305

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEGNLI+    KG   S  S +S S+ SG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  306   RDLPVLNEEGNLISVNGAKG---SSFSDSSSSEVSGISKCTLCLSNRQHPTATPCGHVFC  362

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  363   WSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  396


 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +2

Query  2    GITIHTG*EMGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQY  181
            G+   TG     G    E+G +T+S+             R FPLA QPE+MRAAEKD+QY
Sbjct  2    GLNEATGSGQQAGPGVDEAGPSTSSNPS---------SARRFPLAAQPEVMRAAEKDDQY  52

Query  182  TFFVYEACRDAFRHLFGSYFSI  247
              FVY+ACRDAFRHLFG+  ++
Sbjct  53   ASFVYDACRDAFRHLFGTRIAV  74



>gb|KFK32514.1| hypothetical protein AALP_AA6G252600 [Arabis alpina]
Length=377

 Score =   406 bits (1044),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 255/334 (76%), Gaps = 12/334 (4%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVA+AYQ E KLLGQMLYF+LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  56    GTRVALAYQKEMKLLGQMLYFVLTTGSGQQTLGEEYCDIIQVAGPYGLTPTPARRALFIL  115

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR A+Q +T  +   D +                  ++  SS     
Sbjct  116   YQTAVPYIAERLSSRAATQAVTFAESQSDEF--------FGDSTVERIMDLPGSSEMETS  167

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSRFK + +  W  AVQRWP VLP+ARE+LQL++RANLM FYFEGLYYH+SKRASG+
Sbjct  168   ASALSRFKDRFKRLWHRAVQRWPVVLPVAREVLQLILRANLMLFYFEGLYYHISKRASGV  227

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  228   RYVFIGKQLNQRPRYQILGVFLLIQLCI-LASEALRRSNLSSITSSVQQASIGSYQTSGG  286

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLIT+ +EKG   +  +S S S    + KC+LCLS+RQHPTATPCGHVFC
Sbjct  287   RGLPVLNEEGNLITSEAEKG---NWSTSDSSSTLEAVGKCTLCLSNRQHPTATPCGHVFC  343

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  344   WSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  377


 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FP+A QPEIMRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  18   IRKFPVAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRVAL  61



>ref|XP_002880778.1| hypothetical protein ARALYDRAFT_481492 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57037.1| hypothetical protein ARALYDRAFT_481492 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   404 bits (1039),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 224/334 (67%), Positives = 263/334 (79%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  61    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+S+R A+Q +T D+   D +    A ES S + +    ++ SSS     
Sbjct  121   YQTAVPYIAERISTRAATQAVTFDE--SDEFLGHSALESGSHIHSPRMIDLPSSSQIETS  178

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SV+ R K +++  W  A+QRWP VLP+ARE+LQLV+RANLM FYFEGLYYH+SKRASG+
Sbjct  179   ASVVPRLKDRLKRLWHRAIQRWPVVLPVAREVLQLVLRANLMLFYFEGLYYHISKRASGV  238

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLLVQLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  239   RYVFIGKQLNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSITSSIQQASIGSYQTSGG  297

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLIT+ +EKG   +  +S S S    + KC+LCLS+RQHPTATPCGHVFC
Sbjct  298   RGLPVLNEEGNLITSEAEKG---NWSTSDSSSTLEAVGKCTLCLSTRQHPTATPCGHVFC  354

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  355   WNCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  388


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   RESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLF  229
            R SG+ +   +D   S G  GG+R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLF
Sbjct  2    RLSGD-SGPGQDEPGSSGFHGGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLF  60

Query  230  GSYFSI  247
            G+  ++
Sbjct  61   GTRIAL  66



>ref|XP_010472664.1| PREDICTED: peroxisome biogenesis factor 10 [Camelina sativa]
Length=385

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 265/334 (79%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL PTPARRALFI 
Sbjct  58    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVSGPYGLSPTPARRALFIL  117

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+A+R+S+R A+Q +T D+   D +      ES S +++ T  ++ SSS     
Sbjct  118   YQTAVPYIADRISTRAATQAVTFDE--SDEFFGDSPRESGSHIQSLTMIDLPSSSQLETS  175

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SV+SR K +++  W  ++QRWP VLP+ARE+LQLV+RANLM FYFEGLYYH+SKRASG+
Sbjct  176   ASVVSRLKDRLKRLWYRSIQRWPVVLPVAREVLQLVLRANLMLFYFEGLYYHISKRASGV  235

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLLVQLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  236   RYVFIGKQLNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSITSSVQQASIGSYQTSGG  294

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLIT+ +EKG   +  +S S S    + KC+LCLS+RQHPTATPCGHVFC
Sbjct  295   RGLPVLNEEGNLITSEAEKG---NWSTSDSASTMEAVGKCTLCLSNRQHPTATPCGHVFC  351

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  352   WSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  385


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPE+MRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  20   IRQFPLAAQPEVMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  63



>ref|XP_011019366.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Populus 
euphratica]
Length=404

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 272/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGP+GL PTPARRALFI 
Sbjct  74    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDVTQVAGPHGLAPTPARRALFIV  133

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS  I LDD   D  P+      +S+ ++    E+ SSS++   
Sbjct  134   YQTAVPYIAERISSRVASHAIALDDSLSDE-PYRDIGSGTSQAQSPVIIELPSSSSAGTS  192

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVLSR + K     + A+QRWP+VLP+ARE LQLV+R NLMFFYFEG+YYH+SKRASGI
Sbjct  193   VSVLSRLRQKFNGLRMQAIQRWPTVLPVAREFLQLVLRTNLMFFYFEGMYYHISKRASGI  252

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S  QT   ++QT +G
Sbjct  253   RYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHQTSLVSHQT-AG  310

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI   S  G++VS+ +STSES A   SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  311   RGLPVLNEEGNLIPLESGNGNWVSDSTSTSESNAISSSKCTLCLSNRQYPTATACGHVFC  370

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  371   WNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  404


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+QY  F+Y+ACRDA RHLFG+  ++
Sbjct  37   RRFPPAAQPEIMRAAEKDDQYASFIYDACRDAIRHLFGTRVAV  79



>ref|XP_009362582.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X1 [Pyrus 
x bretschneideri]
Length=396

 Score =   401 bits (1030),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 234/334 (70%), Positives = 277/334 (83%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  69    GTRVSVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  128

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  +    + V++  S+  ++S+    ++ STS   
Sbjct  129   YQTALPYIAERISSRAANRGIALADSEE---LYGVSASLSNDAQSSSTIHNSTGSTSGPS  185

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L R K K    W+   +RWP+VLP+ARE LQLV+RANLMFFYFEGL+YH+SKRA+GI
Sbjct  186   VSALRRLKEKFNGLWISLARRWPTVLPIAREFLQLVVRANLMFFYFEGLFYHISKRAAGI  245

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+SAQQT FGT+QTS+G
Sbjct  246   RYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSAQQT-FGTHQTSAG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEGNLI+A + KG      SSTSESQASG SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  304   RDLPVLNEEGNLISADATKG-SWVSESSTSESQASGTSKCTLCLSNRQYPTATPCGHVFC  362

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+  THSSLVCLYHSDF
Sbjct  363   WSCIMEWCNEKPECPLCRTSITHSSLVCLYHSDF  396


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FPLA QPEIMRAAEKD+QY  FVY+ACRDA RHL G+  S+
Sbjct  32   RQFPLAAQPEIMRAAEKDDQYASFVYDACRDAVRHLLGTRVSV  74



>ref|XP_010429658.1| PREDICTED: peroxisome biogenesis factor 10-like [Camelina sativa]
Length=385

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 264/334 (79%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL PTPARRALFI 
Sbjct  58    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVSGPYGLSPTPARRALFIL  117

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+A+R+S+R A+Q +T D+   D +      ES S++++ T  ++ SSS     
Sbjct  118   YQTAVPYIADRISTRAATQAVTFDE--SDDFFGDSPRESGSQIQSLTMIDLPSSSQLETS  175

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SV+SR K + +  W  ++QRWP VLP+ARE+LQLV+RANLM FYFEGLYYH+SKRASG+
Sbjct  176   ASVVSRLKDRFKRLWHRSIQRWPVVLPVAREVLQLVLRANLMLFYFEGLYYHISKRASGV  235

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLLVQLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  236   RYVFIGKQLNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSITSSVQQASIGSYQTSGG  294

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI + +EKG   +  +S S S    + KC+LCLS+RQHPTATPCGHVFC
Sbjct  295   RGLPVLNEEGNLIASEAEKG---NWSTSDSASTMEAVGKCTLCLSNRQHPTATPCGHVFC  351

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  352   WSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  385


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPE+MRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  20   IRQFPLAAQPEVMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  63



>ref|XP_009334688.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X2 [Pyrus 
x bretschneideri]
Length=395

 Score =   399 bits (1026),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 228/334 (68%), Positives = 275/334 (82%), Gaps = 8/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  70    GTRVSVAYQNETKLLGQVLYYVLTTGSGRQTLGEEYCDITQVAGPYGLPPTPARRALFIV  129

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  +  Y +S +  + ++  ++  +  AS+S   A 
Sbjct  130   YQTALPYIAERISSRAANRGIALADS-EVLYGYSASLSNDAQSSSTIHASTASTSGPSA-  187

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L R K K    W+  V+RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKR +GI
Sbjct  188   -SALRRLKEKFNGLWISLVRRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRTAGI  246

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S  +++ Q   FGT+QTS+G
Sbjct  247   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSISSSARQT--FGTHQTSAG  304

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEGNLI+A + KG   S  S +S S+ASG SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  305   RDLPVLNEEGNLISADAAKG---SWVSESSASEASGTSKCTLCLSNRQYPTATPCGHVFC  361

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  362   WSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  395


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 8/70 (11%)
 Frame = +2

Query  38   GEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAF  217
            G    E G ++ SS+         G  R FP A QPEIMRAAEKD+QY  FVY+ACRDA 
Sbjct  14   GPSGGEPGPSSISSDP--------GAARRFPPAAQPEIMRAAEKDDQYASFVYDACRDAV  65

Query  218  RHLFGSYFSI  247
            RHL G+  S+
Sbjct  66   RHLLGTRVSV  75



>ref|XP_009334687.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X1 [Pyrus 
x bretschneideri]
Length=397

 Score =   399 bits (1026),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 230/334 (69%), Positives = 275/334 (82%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  70    GTRVSVAYQNETKLLGQVLYYVLTTGSGRQTLGEEYCDITQVAGPYGLPPTPARRALFIV  129

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  +  Y +S +  + ++  ++  +  AS+S   A 
Sbjct  130   YQTALPYIAERISSRAANRGIALADS-EVLYGYSASLSNDAQSSSTIHASTASTSGPSA-  187

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L R K K    W+  V+RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKR +GI
Sbjct  188   -SALRRLKEKFNGLWISLVRRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRTAGI  246

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S  +++ Q   FGT+QTS+G
Sbjct  247   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSISSSARQT--FGTHQTSAG  304

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEGNLI+A + KG      SS SESQASG SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  305   RDLPVLNEEGNLISADAAKG-SWVSESSASESQASGTSKCTLCLSNRQYPTATPCGHVFC  363

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  364   WSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  397


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 8/70 (11%)
 Frame = +2

Query  38   GEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAF  217
            G    E G ++ SS+         G  R FP A QPEIMRAAEKD+QY  FVY+ACRDA 
Sbjct  14   GPSGGEPGPSSISSDP--------GAARRFPPAAQPEIMRAAEKDDQYASFVYDACRDAV  65

Query  218  RHLFGSYFSI  247
            RHL G+  S+
Sbjct  66   RHLLGTRVSV  75



>ref|XP_010417423.1| PREDICTED: peroxisome biogenesis factor 10-like [Camelina sativa]
Length=385

 Score =   399 bits (1025),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 265/334 (79%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL PTPARRALFI 
Sbjct  58    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVSGPYGLSPTPARRALFIL  117

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+A+R+S+R A+Q +T D+   D +      ES S +++ T  ++ SSS  +  
Sbjct  118   YQTAVPYIADRISTRAATQAVTFDE--SDEFFGDSPRESGSHIQSLTMIDLPSSSQLQTS  175

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SV+SR K +++  W  ++QRWP VLP+ARE+LQLV+RANLM FYFEGLYYH+SKRASG+
Sbjct  176   ASVVSRLKDRLKRLWHRSIQRWPVVLPVAREVLQLVLRANLMLFYFEGLYYHISKRASGV  235

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLLVQLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  236   RYVFIGKQLNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSITSSVQQASIGSYQTSGG  294

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEG LIT+ +EKG   +  +S S S    + KC+LCLS+RQHPTATPCGHVFC
Sbjct  295   RGLPVLNEEGILITSEAEKG---NWSTSDSASTMEAVGKCTLCLSNRQHPTATPCGHVFC  351

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  352   WSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  385


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPE+MRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  20   IRQFPLAAQPEVMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  63



>ref|XP_008220559.1| PREDICTED: peroxisome biogenesis factor 10 [Prunus mume]
Length=395

 Score =   399 bits (1025),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 277/334 (83%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR AVAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  68    GTRTAVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  127

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  D+ Y     +  S+ V++S+ +  +++STS A 
Sbjct  128   YQTALPYIAERISSRAANRGIVLADS-DELY--GNNASLSNDVQSSSVTPTSTASTSGAS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S + R K K    WL  V+RWP+VLP+ARE LQLVIRANLMFFYFEGLYYH+SKR +GI
Sbjct  185   ASAIRRLKEKFNGLWLSLVRRWPTVLPIAREFLQLVIRANLMFFYFEGLYYHISKRTAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S   ++ Q   FGT+QTS G
Sbjct  245   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIAGSAHQT--FGTHQTSGG  302

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEG+LI+A + KG      SSTSESQASG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  303   RDLPVLNEEGHLISADTAKG-SWVPDSSTSESQASGMSKCTLCLSNRQHPTATPCGHVFC  361

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  362   WSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  395


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 7/64 (11%)
 Frame = +2

Query  56   SGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
             G A  SS D        G  R FPLA QPEIMRAAEKD+QY  FVY+ACRDA RHL G+
Sbjct  17   GGEAGPSSSD-------PGAARRFPLAAQPEIMRAAEKDDQYASFVYDACRDAVRHLLGT  69

Query  236  YFSI  247
              ++
Sbjct  70   RTAV  73



>ref|XP_010261939.1| PREDICTED: peroxisome biogenesis factor 10 [Nelumbo nucifera]
Length=396

 Score =   399 bits (1026),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 275/336 (82%), Gaps = 6/336 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKLLGQMLY++LTTGAG+QTLGEEYCD TQVAGP+ L PTPARRALFI 
Sbjct  65    GTRVAVAYQSETKLLGQMLYYILTTGAGQQTLGEEYCDITQVAGPHSLSPTPARRALFII  124

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPYLAE++SSR+A++GI L D   D   +   S   ++ ++S  +E +S+ST+ + 
Sbjct  125   YQTAVPYLAEKISSRMAARGIILADSQSDEL-YGEISARRNQTQSSVTTEGSSNSTTVSS  183

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S  SR K KI   WL+AVQRW +VLP ARE LQLV+R NLMFFYFEGLYYH+SKRA+GI
Sbjct  184   MSSFSRLKQKIYGLWLYAVQRWHTVLPFAREFLQLVLRTNLMFFYFEGLYYHISKRAAGI  243

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA S  QT  G + TS+ 
Sbjct  244   RYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIAGSIHQTSLGPHHTSA-  301

Query  1026  RGVPVLNEEGNLITA--VSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
              G+PVLNEEGNL+T+    +KGS+ S+ ++ SESQ SG+SKC+LCLSSRQHPTATPCGHV
Sbjct  302   -GLPVLNEEGNLVTSNLNLDKGSWASDSTTISESQTSGVSKCTLCLSSRQHPTATPCGHV  360

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCWNCIMEWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  361   FCWNCIMEWCNEKPECPLCRTPVTHSSLVCIYHSDF  396


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  56   SGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SG+   +  +V S+       R FPLA QPEIMRAAEKDEQY  + Y+ACRDAFRHLFG+
Sbjct  7    SGSVNPNHGEVDSASSQPPPARRFPLAAQPEIMRAAEKDEQYASYAYDACRDAFRHLFGT  66

Query  236  YFSI  247
              ++
Sbjct  67   RVAV  70



>ref|XP_007223001.1| hypothetical protein PRUPE_ppa006781mg [Prunus persica]
 gb|EMJ24200.1| hypothetical protein PRUPE_ppa006781mg [Prunus persica]
Length=395

 Score =   399 bits (1025),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 277/334 (83%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR AVAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  68    GTRTAVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  127

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  D+ Y     +  S+ V++S+ +  +++STS A 
Sbjct  128   YQTALPYIAERISSRAANRGIVLADS-DELY--GNNASLSNDVQSSSVTPTSTASTSGAS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S + R K K    WL  V+RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKR +GI
Sbjct  185   ASAIRRLKEKFNGLWLSLVRRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRTAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S   +S Q   FGT+QTS G
Sbjct  245   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIAGSSHQT--FGTHQTSGG  302

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEG+LI+A + KG      SSTSESQASG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  303   RDLPVLNEEGHLISADAAKG-SWVSDSSTSESQASGMSKCTLCLSNRQHPTATPCGHVFC  361

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  362   WSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  395


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MG  E +     A  S  + G S    G  R FPLA QPEIMRAAEKD+QY  FVY+ACR
Sbjct  1    MGWNEVTGSGQQAGPSGVEAGPSSSDPGEARRFPLAAQPEIMRAAEKDDQYASFVYDACR  60

Query  209  DAFRHLFGSYFSI  247
            DA RHL G+  ++
Sbjct  61   DAVRHLLGTRTAV  73



>ref|NP_565621.1| peroxin 10 [Arabidopsis thaliana]
 sp|Q9SYU4.1|PEX10_ARATH RecName: Full=Peroxisome biogenesis factor 10; AltName: Full=PER10; 
AltName: Full=Peroxin-10; AltName: Full=Peroxisomal biogenesis 
factor 10; Short=AtPEX10; Short=AthPEX10; AltName: 
Full=Peroxisome assembly protein 10; AltName: Full=Pex10p [Arabidopsis 
thaliana]
 gb|AAD18035.1| zinc-binding peroxisomal integral membrane protein [Arabidopsis 
thaliana]
 gb|AAC14514.2| putative peroxisome assembly protein PER8 [Arabidopsis thaliana]
 dbj|BAC42519.1| putative zinc-binding peroxisomal integral membrane protein PEX10 
[Arabidopsis thaliana]
 gb|AAO63404.1| At2g26350 [Arabidopsis thaliana]
 gb|AEC07828.1| peroxin 10 [Arabidopsis thaliana]
Length=381

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 258/337 (77%), Gaps = 19/337 (6%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  61    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDP---FDDSYPFsvasesssrveastaseiasssts  656
             YQTAVPY+AER+S+R A+Q +T D+    F DS+           + +    ++ SSS  
Sbjct  121   YQTAVPYIAERISTRAATQAVTFDESDEFFGDSH-----------IHSPRMIDLPSSSQV  169

Query  657   RAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRA  836
                 SV+SR   ++   W  A+QRWP VLP+ARE+LQLV+RANLM FYFEG YYH+SKRA
Sbjct  170   ETSTSVVSRLNDRLMRSWHRAIQRWPVVLPVAREVLQLVLRANLMLFYFEGFYYHISKRA  229

Query  837   SGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             SG+RYVFIGK  NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQT
Sbjct  230   SGVRYVFIGKQLNQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSIQQASIGSYQT  288

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             S GRG+PVLNEEGNLIT+ +EKG      S++  +    + KC+LCLS+RQHPTATPCGH
Sbjct  289   SGGRGLPVLNEEGNLITSEAEKG----NWSTSDSTSTEAVGKCTLCLSTRQHPTATPCGH  344

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCW+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  345   VFCWSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  381


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  23   IRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  66



>ref|XP_004498856.1| PREDICTED: peroxisome biogenesis factor 10-like [Cicer arietinum]
Length=397

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 231/335 (69%), Positives = 269/335 (80%), Gaps = 4/335 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY+LLTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  66    GTRVAVAYQNETKLLGQMLYYLLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  125

Query  486   YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
             YQTA+PY+AER+SSR+ASQGI L D  + +SY       SS RV A++     S+S   A
Sbjct  126   YQTAIPYIAERISSRMASQGIVLADSEYAESYGEISQGRSSFRVSATSELSPLSASGRSA  185

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               S L+R K K+   WLH VQRWP++LP  RE+LQL++RANLM FYFEGLYYH+SKRA+G
Sbjct  186   --SRLTRLKEKLGGFWLHMVQRWPTMLPFVRELLQLLLRANLMLFYFEGLYYHISKRAAG  243

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGK +NQRPRYQILG FLL+QLC+  A    RR   +SIA+S  Q  F T+ TS+
Sbjct  244   IRYVFIGKASNQRPRYQILGVFLLIQLCV-IAAEALRRRHFTSIASSVHQASFATHNTSA  302

Query  1023  GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             G G+PVLNEEGNL T  ++KGS+VSE SS+  +  SG SKC+LCLS+RQHPTAT CGHVF
Sbjct  303   GHGLPVLNEEGNLATPDADKGSWVSESSSSEHNATSGASKCTLCLSNRQHPTATSCGHVF  362

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  363   CWNCITEWCNEKPECPLCRTPLTHSSLVCVYHSDF  397


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = +2

Query  35   LGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDA  214
            LG+   +SGN   +     ++       R FP A QPE+MRAAEKD+QY  FVYEACRDA
Sbjct  6    LGKHGSDSGNDGDAGPSTSTAEP-----RQFPSAAQPEMMRAAEKDDQYASFVYEACRDA  60

Query  215  FRHLFGSYFSI  247
            FR LFG+  ++
Sbjct  61   FRQLFGTRVAV  71



>emb|CDY11486.1| BnaA09g40520D [Brassica napus]
Length=372

 Score =   397 bits (1020),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 216/334 (65%), Positives = 253/334 (76%), Gaps = 25/334 (7%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KL+GQMLYF+LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  64    GTRIALAYQKEMKLVGQMLYFVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  123

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR A+Q  T D+  DD  P                          + 
Sbjct  124   YQTAVPYIAERISSRAATQAFTFDE--DDQSP-------------------RMVDLPSSA  162

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVL+RFK +++  W  A++RWP VLP+ARE+LQ+++RANLM FYFEGLYYH+SKRASG+
Sbjct  163   SSVLTRFKDRVQRLWHRAIRRWPVVLPVAREVLQVLLRANLMLFYFEGLYYHISKRASGV  222

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  223   RYVFIGKQLNQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSVQQASLGSYQTSGG  281

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLIT  +EKG   +   S + S    + KC+LCLSSRQHPTATPCGHVFC
Sbjct  282   RGLPVLNEEGNLITPEAEKG---NWSPSDATSTTEAVGKCTLCLSSRQHPTATPCGHVFC  338

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEK ECPLCR+P THSSLVCLY+SDF
Sbjct  339   WSCIMEWCNEKQECPLCRTPNTHSSLVCLYNSDF  372


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  56   SGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SG  +  S D   S G  GG+R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+
Sbjct  6    SGGDSGPSPDEPGSSGTHGGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGT  65

Query  236  YFSI  247
              ++
Sbjct  66   RIAL  69



>ref|XP_008367634.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X1 [Malus 
domestica]
Length=396

 Score =   398 bits (1022),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 275/336 (82%), Gaps = 10/336 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPP PARR LFI 
Sbjct  69    GTRVSVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPMPARRVLFIV  128

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  ++ Y  S +  + ++  ++  +   S+    + 
Sbjct  129   YQTALPYIAERISSRAANRGIALADS-EELYGISASLSNDAQSSSTIHNSAGST----SG  183

Query  666   PSV--LSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
             PSV  L R K K    W+   +RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKRA+
Sbjct  184   PSVSALRRLKEKFNGLWISLARRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRAA  243

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GIRYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+SAQQT FGT+QTS
Sbjct  244   GIRYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSAQQT-FGTHQTS  301

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             +GR +PVLNEEGNLI+A + +G      SSTSESQASG SKC+LCLS+R +PTATPCGHV
Sbjct  302   AGRDLPVLNEEGNLISADATRG-SWVSESSTSESQASGSSKCTLCLSNRHYPTATPCGHV  360

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCW+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  361   FCWSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  396


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FPLA QPEIMRAAEKD+QY  FVY+ACRDA RHL G+  S+
Sbjct  32   RQFPLAAQPEIMRAAEKDDQYASFVYDACRDAVRHLLGTRVSV  74



>emb|CAB87983.1| Pex10p [Arabidopsis thaliana]
Length=381

 Score =   396 bits (1017),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 258/337 (77%), Gaps = 19/337 (6%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  61    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDP---FDDSYPFsvasesssrveastaseiasssts  656
             YQTAVPY+AER+S+R A+Q +T D+    F DS+           + +    ++ SSS  
Sbjct  121   YQTAVPYIAERISTRAATQAVTFDESDEFFGDSH-----------IHSPRMIDLPSSSQV  169

Query  657   RAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRA  836
                 SV+SR   +++  W  A+QRWP VL +ARE+LQLV+RANLM FYFEG YYH+SKRA
Sbjct  170   ETSTSVVSRLNDRLKRSWHRAIQRWPVVLLVAREVLQLVLRANLMLFYFEGFYYHISKRA  229

Query  837   SGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             SG+RYVFIGK  NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQT
Sbjct  230   SGVRYVFIGKQLNQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSIQQASIGSYQT  288

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             S GRG+PVLNEEGNLIT+ +EKG      S++  +    + KC+LCLS+RQHPTATPCGH
Sbjct  289   SGGRGLPVLNEEGNLITSEAEKG----NWSTSDSTSTEAVGKCTLCLSTRQHPTATPCGH  344

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCW+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  345   VFCWSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  381


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  23   IRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  66



>ref|XP_003544551.1| PREDICTED: peroxisome biogenesis factor 10-like [Glycine max]
Length=394

 Score =   396 bits (1017),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 226/334 (68%), Positives = 264/334 (79%), Gaps = 5/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALF+ 
Sbjct  66    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFVV  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSRIAS+GI L D ++ +  F   +  S   + S  S  +SS  S   
Sbjct  126   YQTAIPYIAERISSRIASRGIVLAD-YESAEGFGENAHRSHSAQISGTSPSSSSGQS---  181

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + LSR K K+   WLH VQRWP++LP  RE+LQLV+RANLM FYFEGLYYH+SKRA+GI
Sbjct  182   VTTLSRLKGKMSAFWLHLVQRWPTMLPFVRELLQLVLRANLMLFYFEGLYYHISKRAAGI  241

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK +NQRPRYQILG FLL+QLCI  A    RR +L+SI  S  Q  F T+  S+G
Sbjct  242   RYVFIGKASNQRPRYQILGVFLLIQLCI-IAAEGLRRRNLTSITGSVHQASFATHDRSAG  300

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
              G+PVLNEEGNL T   +K S+VSE SS+     SG+SKC+LCLS+RQHPTAT CGHVFC
Sbjct  301   HGLPVLNEEGNLATPDIDKRSWVSESSSSEYHATSGVSKCTLCLSNRQHPTATSCGHVFC  360

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  361   WNCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  394


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MG G   R   ++   +  V          R FPLA QPE+MRAAEKD+QY  FVYEACR
Sbjct  1    MGWGHLGRHGSDSVDGA--VAGPSTSATEPRRFPLAAQPEMMRAAEKDDQYASFVYEACR  58

Query  209  DAFRHLFGSYFSI  247
            DAFRHLFG+  ++
Sbjct  59   DAFRHLFGTRVAV  71



>ref|XP_008377818.1| PREDICTED: peroxisome biogenesis factor 10 [Malus domestica]
Length=397

 Score =   396 bits (1018),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 227/334 (68%), Positives = 273/334 (82%), Gaps = 6/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  70    GTRVSVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  129

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  +    +  ++   +  ++S+    +++STS   
Sbjct  130   YQTALPYIAERISSRAANRGIALADSEE---LYGHSASLXNDAQSSSTIHASTASTSGPS  186

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L R K K    W+  V+RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKR +GI
Sbjct  187   VSALRRLKEKFNGLWISLVRRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRTAGI  246

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S  +++ Q   FGT+QTS+G
Sbjct  247   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSISSSAHQT--FGTHQTSAG  304

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEGNLI+A + KG      SS SESQASG SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  305   RDLPVLNEEGNLISADAAKG-SWVSESSASESQASGTSKCTLCLSNRQYPTATPCGHVFC  363

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+C MEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  364   WSCXMEWCNEKPECPLCRTPITHSSLVCLYHSDF  397


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            FP A QPEIMRAAEKD+QY  FVY+ACRDA RHL G+  S+
Sbjct  35   FPPAAQPEIMRAAEKDDQYASFVYDACRDAVRHLLGTRVSV  75



>ref|XP_011019365.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Populus 
euphratica]
Length=405

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/335 (67%), Positives = 266/335 (79%), Gaps = 4/335 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGP+GL PTPARRALFI 
Sbjct  74    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDVTQVAGPHGLAPTPARRALFIV  133

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS  I LDD   D  P+      +S+ ++    E+ SSS++   
Sbjct  134   YQTAVPYIAERISSRVASHAIALDDSLSDE-PYRDIGSGTSQAQSPVIIELPSSSSAGTS  192

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVLSR + K     + A+QRWP+VLP+ARE LQLV+R NLMFFYFEG+YYH+SKRASGI
Sbjct  193   VSVLSRLRQKFNGLRMQAIQRWPTVLPVAREFLQLVLRTNLMFFYFEGMYYHISKRASGI  252

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S  QT   ++QT +G
Sbjct  253   RYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHQTSLVSHQT-AG  310

Query  1026  RGVPVLNEEGNLITAVSEKGs-fvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             RG+PVLNEEGNLI   S  G+      S++  +  S  SKC+LCLS+RQ+PTAT CGHVF
Sbjct  311   RGLPVLNEEGNLIPLESGNGNWVSDSTSTSESNAISSSSKCTLCLSNRQYPTATACGHVF  370

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  371   CWNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  405


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+QY  F+Y+ACRDA RHLFG+  ++
Sbjct  37   RRFPPAAQPEIMRAAEKDDQYASFIYDACRDAIRHLFGTRVAV  79



>ref|XP_008452775.1| PREDICTED: peroxisome biogenesis factor 10 [Cucumis melo]
Length=393

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 261/334 (78%), Gaps = 3/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R+AVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL P PARRALFI 
Sbjct  63    GARLAVAYQSETKLLGQMLYYVLTTGSGQQTLGEEYCDINQVSGPYGLSPNPARRALFIV  122

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GI L D   D   F   + S   +  S  +     S++   
Sbjct  123   YQTAVPYIAERISSRVASRGIMLADSLSDE--FYGETASGDALSQSLLTTEIQPSSTPGS  180

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S + R + KI   WL  V+ WPSVLPL RE LQL +R NLMFFYFEGLYYH+SKRA+GI
Sbjct  181   ASYIRRLRAKISRLWLRTVRSWPSVLPLVREFLQLALRTNLMFFYFEGLYYHISKRAAGI  240

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR S  S  ++    + FG   +SSG
Sbjct  241   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSSLSSVSSSINPAS-FGANPSSSG  299

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI+   + G++VS+PS+   +  SG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  300   RGLPVLNEEGNLISVDGDSGNWVSDPSNFESNTGSGISKCTLCLSNRQHPTATPCGHVFC  359

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P  HSSLVCLYHSDF
Sbjct  360   WNCIMEWCNEKPECPLCRTPINHSSLVCLYHSDF  393


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            FPLA QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++
Sbjct  28   FPLAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGARLAV  68



>ref|XP_002308529.2| hypothetical protein POPTR_0006s23860g [Populus trichocarpa]
 gb|EEE92052.2| hypothetical protein POPTR_0006s23860g [Populus trichocarpa]
Length=404

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 273/334 (82%), Gaps = 3/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQMLY++LTTG+G+QTLGEEYCD TQVAGP+GL PTPARRALFI 
Sbjct  74    GTRVAVAYQNEAKLLGQMLYYVLTTGSGQQTLGEEYCDVTQVAGPHGLAPTPARRALFIV  133

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+ I LDD   D  P+   +  +S+ ++    E+ SSS+S   
Sbjct  134   YQTAVPYIAERISSRVASRAIALDDSLSDE-PYRDIASGTSQAQSPIIIELPSSSSSGTS  192

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVLSR + K     + A+QRWP+VLP+ARE LQLV+R NLMFFYFEG+YYH+SKRASGI
Sbjct  193   VSVLSRLRQKFNGIRMQAIQRWPTVLPVAREFLQLVLRTNLMFFYFEGMYYHISKRASGI  252

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S  QT   ++QT +G
Sbjct  253   RYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHQTSLVSHQT-AG  310

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI   +  G++VS+ +STSES A   SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  311   RGLPVLNEEGNLIPLEAGNGNWVSDSTSTSESNAISSSKCTLCLSNRQYPTATACGHVFC  370

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  371   WNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  404


 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINLFFFAKLWPSFTFLFL  298
            R FPLA QPEIMRAAEKD+QY  F+Y+ACRDA RHLFG+  ++     AKL     +  L
Sbjct  37   RRFPLAAQPEIMRAAEKDDQYASFIYDACRDAIRHLFGTRVAVAYQNEAKLLGQMLYYVL  96



>ref|XP_009117014.1| PREDICTED: peroxisome biogenesis factor 10 [Brassica rapa]
Length=380

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 251/339 (74%), Gaps = 27/339 (8%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KL+GQMLYF+LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  64    GTRIALAYQKEMKLVGQMLYFVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  123

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR A+Q  T D+  DD  P                          + 
Sbjct  124   YQTAVPYIAERISSRAATQAFTFDE--DDQSP-------------------RMVDLPSSA  162

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVL+RFK +++  W  A++RWP VLP+ARE+LQ+++RANLM FYFEGLYYH+SKRASG+
Sbjct  163   SSVLTRFKDRVQRLWHRAIRRWPVVLPVAREVLQVLLRANLMLFYFEGLYYHISKRASGV  222

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQTS G
Sbjct  223   RYVFIGKQLNQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSVQQASLGSYQTSGG  281

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslcl-----ssRQHPTATPC  1190
             RG+PVLNEEGNLIT  +EKG++    ++++      L   ++       SSRQHPTATPC
Sbjct  282   RGLPVLNEEGNLITPEAEKGNWSPSDATSTTEFVMYLWLRAVGKCPLCLSSRQHPTATPC  341

Query  1191  GHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             GHVFCW+CIMEWCNEK ECPLCR+P THSSLVCLY+SDF
Sbjct  342   GHVFCWSCIMEWCNEKQECPLCRTPNTHSSLVCLYNSDF  380


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  56   SGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SG  +  S D   S G  GG+R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+
Sbjct  6    SGGDSGPSPDEPGSSGTHGGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGT  65

Query  236  YFSI  247
              ++
Sbjct  66   RIAL  69



>gb|KDP34040.1| hypothetical protein JCGZ_07611 [Jatropha curcas]
Length=402

 Score =   395 bits (1014),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 226/335 (67%), Positives = 270/335 (81%), Gaps = 4/335 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD  QVAG +GLPPTPARRALFI 
Sbjct  71    GTRVAVAYQSETKLLGQMLYYVLTTGSGQQTLGEEYCDINQVAGSHGLPPTPARRALFIL  130

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             Y TAVPY+AER+SSR+AS+GITL D   D  P+S  +  SS++ +S   ++ SSSTS A 
Sbjct  131   YHTAVPYIAERISSRVASRGITLADSLADD-PYSNFASDSSQIHSSVMIDLPSSSTSGAS  189

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K K    WLH V  WPS+LP+ARE+LQL++R NLMFFYFEGLYYH+SKRA+GI
Sbjct  190   VSFLSRLKQKFNGLWLHVVHLWPSMLPIAREVLQLILRTNLMFFYFEGLYYHISKRAAGI  249

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RY+FIGKP+NQRPRYQILG FLL+QLCI  A    RRS+++SIA+S QQT    +QT +G
Sbjct  250   RYIFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNITSIASSVQQTSLEPHQT-AG  307

Query  1026  RGVPVLNEEGNLITAVSEKGs-fvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             RG+PVLNEEG+LI   + +G       S++  +  SG SKC+LCLS+RQ+PTAT CGHVF
Sbjct  308   RGLPVLNEEGSLIPMEAGRGGWVSDSASTSESNMISGASKCTLCLSNRQYPTATACGHVF  367

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  368   CWNCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  402


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+QY  FVY+ACRDA RHLFG+  ++
Sbjct  34   RRFPPAAQPEIMRAAEKDDQYASFVYDACRDALRHLFGTRVAV  76



>ref|XP_006408752.1| hypothetical protein EUTSA_v10002014mg [Eutrema salsugineum]
 gb|ESQ50205.1| hypothetical protein EUTSA_v10002014mg [Eutrema salsugineum]
Length=382

 Score =   394 bits (1011),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 215/334 (64%), Positives = 255/334 (76%), Gaps = 10/334 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVA+AYQ E KLLGQMLYF+LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  59    GTRVALAYQKEMKLLGQMLYFVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  118

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR A+Q +  D+   D +         + +++    ++ S+S     
Sbjct  119   YQTAVPYIAERISSRAATQAVAFDESQSDDF------FGDNHIQSPRMIDLPSASHLGTS  172

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +SRFK +++  W  A++RWP VLP+ARE+LQL++RANLM FYFEGLYYH+SKRASG+
Sbjct  173   GSAVSRFKDRVKRLWHKAIRRWPMVLPVAREVLQLILRANLMLFYFEGLYYHISKRASGV  232

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK  N RPRYQILG FLL+QLCI  A    RRS+LSSI  S QQ   G+YQ   G
Sbjct  233   RYVFIGKQLNHRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITNSIQQASIGSYQAPGG  291

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLIT   EKG   +  +S S S    + KC+LCLS+RQHPTATPCGHVFC
Sbjct  292   RGLPVLNEEGNLITQEVEKG---NWSTSDSTSTLEAVGKCTLCLSNRQHPTATPCGHVFC  348

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  349   WSCIMEWCNEKQECPLCRTPNTHSSLVCLYHSDF  382


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  21   IRQFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRVAL  64



>gb|KHN17265.1| Peroxisome biogenesis factor 10 [Glycine soja]
Length=385

 Score =   394 bits (1012),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 225/333 (68%), Positives = 263/333 (79%), Gaps = 5/333 (2%)
 Frame = +3

Query  309   TRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFY  488
             TRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALF+ Y
Sbjct  58    TRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFVVY  117

Query  489   QTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHP  668
             QTA+PY+AER+SSRIAS+GI L D ++ +  F   +  S   + S  S  +SS  S    
Sbjct  118   QTAIPYIAERISSRIASRGIVLAD-YESAEGFGENAHRSHSAQISGTSPSSSSGQS---V  173

Query  669   SVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIR  848
             + LSR K K+   WLH VQRWP++LP  RE+LQLV+RANLM FYFEGLYYH+SKRA+GIR
Sbjct  174   TTLSRLKGKMSAFWLHLVQRWPTMLPFVRELLQLVLRANLMLFYFEGLYYHISKRAAGIR  233

Query  849   YVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGR  1028
             YVFIGK +NQRPRYQILG FLL+QLCI  A    RR +L+SI  S  Q  F T+  S+G 
Sbjct  234   YVFIGKASNQRPRYQILGVFLLIQLCI-IAAEGLRRRNLTSITGSVHQASFATHDRSAGH  292

Query  1029  GVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCW  1208
             G+PVLNEEGNL T   +K S+VSE SS+     SG+SKC+LCLS+RQHPTAT CGHVFCW
Sbjct  293   GLPVLNEEGNLATPDIDKRSWVSESSSSEYHATSGVSKCTLCLSNRQHPTATSCGHVFCW  352

Query  1209  NCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             NCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  353   NCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  385


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 33/59 (56%), Gaps = 2/59 (3%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEAC  205
            MG G   R   ++   +  V          R FPLA QPE+MRAAEKD+QY  FVYEAC
Sbjct  1    MGWGHLGRHGSDSVDGA--VAGPSTSATEPRRFPLAAQPEMMRAAEKDDQYASFVYEAC  57



>gb|AAM64667.1| putative peroxisome assembly protein PER8 [Arabidopsis thaliana]
Length=381

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 256/337 (76%), Gaps = 19/337 (6%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  61    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDP---FDDSYPFsvasesssrveastaseiasssts  656
             YQTAVPY+AER+S+R A+Q +T D+    F DS+           + +    ++ SSS  
Sbjct  121   YQTAVPYIAERISTRAATQAVTFDESDEFFGDSH-----------IHSPRMIDLPSSSQV  169

Query  657   RAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRA  836
                 SV+SR   +++  W  A QRWP VLP+ARE+LQLV+RANLM FY EG YYH+SKRA
Sbjct  170   ETSTSVVSRLNDRLKRXWHRAXQRWPVVLPVAREVLQLVLRANLMLFYSEGFYYHISKRA  229

Query  837   SGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             SG+RYVFIGK  NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQT
Sbjct  230   SGVRYVFIGKQLNQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSIQQASIGSYQT  288

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             S GRG+PVLNEEGNLIT+ +EKG      S++  +    + KC+LCLS+RQHPTATPCGH
Sbjct  289   SGGRGLPVLNEEGNLITSEAEKG----NWSTSDSTSTEAVGKCTLCLSTRQHPTATPCGH  344

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCW+CIMEWCNE  ECPLCR+P THSSLVCLYHSDF
Sbjct  345   VFCWSCIMEWCNENQECPLCRTPNTHSSLVCLYHSDF  381


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  23   IRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  66



>ref|XP_004141339.1| PREDICTED: peroxisome biogenesis factor 10-like [Cucumis sativus]
 gb|KGN55374.1| hypothetical protein Csa_4G647470 [Cucumis sativus]
Length=397

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 258/334 (77%), Gaps = 3/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R+AVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL P PARRALFI 
Sbjct  67    GARLAVAYQSETKLLGQMLYYVLTTGSGQQTLGEEYCDINQVSGPYGLSPNPARRALFIV  126

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GI L D   D   F     S      S  +     S++   
Sbjct  127   YQTAVPYIAERISSRVASRGIMLADSLSDE--FYGEIASGDASSQSLLTMEIQPSSTPGS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R + KI   WL  V+ WPSVLPL RE LQL +R NLMFFYFEGLYYH+SKRA+GI
Sbjct  185   ASYTMRLRAKISRLWLRTVRCWPSVLPLVREFLQLALRTNLMFFYFEGLYYHISKRAAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR S  S  ++    + FG   +SSG
Sbjct  245   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSSLSSVSSSINPAS-FGANPSSSG  303

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI+   + G++VS+PS +  +  SG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  304   RGLPVLNEEGNLISVDGDSGNWVSDPSHSEFNTGSGISKCTLCLSNRQHPTATPCGHVFC  363

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P  HSSLVCLYHSDF
Sbjct  364   WNCIMEWCNEKPECPLCRTPINHSSLVCLYHSDF  397


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            FPLA QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++
Sbjct  32   FPLAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGARLAV  72



>emb|CDX76710.1| BnaC08g32960D [Brassica napus]
Length=375

 Score =   392 bits (1006),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 217/339 (64%), Positives = 252/339 (74%), Gaps = 34/339 (10%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KL+GQMLYF+LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  66    GTRIALAYQKEMKLVGQMLYFVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR A+Q  T D+  DD  P                           H
Sbjct  126   YQTAVPYIAERISSRAATQAFTFDE--DDQSP-----------------------RMTDH  160

Query  666   PS----VLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKR  833
             PS    VLSRFK ++   W  A++RWP VLP+ARE+LQ+++RANLM FYFEGLYYH+SKR
Sbjct  161   PSSASSVLSRFKDRLERFWHRAIRRWPVVLPVAREVLQVLLRANLMLFYFEGLYYHISKR  220

Query  834   ASGIRYVFIGKPTNQRP-RYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTY  1010
             ASG+RYVFIGK  NQRP RYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+Y
Sbjct  221   ASGVRYVFIGKQLNQRPSRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSVQQASLGSY  279

Query  1011  QTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPC  1190
             QTS GRG+PVLNEEGNLIT  ++KG   +   S + S    +  C+LCLSSRQHPTATPC
Sbjct  280   QTSGGRGLPVLNEEGNLITPEADKG---NWSPSDATSTTEAVGNCTLCLSSRQHPTATPC  336

Query  1191  GHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             GHVFCW+CIMEWCNEK ECPLCR+P THSSLVCLY+SDF
Sbjct  337   GHVFCWSCIMEWCNEKQECPLCRTPNTHSSLVCLYNSDF  375


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  28   IRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  71



>ref|XP_006466355.1| PREDICTED: peroxisome biogenesis factor 10-like [Citrus sinensis]
Length=375

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 262/335 (78%), Gaps = 4/335 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKL+GQMLY++LTTG+G+QTLGEEYCD TQV GP  LPPTPARRALFI 
Sbjct  44    GTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIV  103

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GI L +   D +    A+ SS      T    +SS+   A 
Sbjct  104   YQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGSSRDQSLETMESPSSSAPRVA-  162

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +SR K K+    L+ ++RWP VLP+ RE LQLV+RANLMFFYFEGLYYH+SKR +GI
Sbjct  163   -SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGI  221

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKPTNQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S   T  G  Q S+G
Sbjct  222   RYVFIGKPTNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHHTSLGFQQASTG  280

Query  1026  RGVPVLNEEGNLITAVSEKGs-fvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             RG+PVLNEEG+LI + S+KG   +   S++    A G+SKC+LCLS+RQ PTATPCGHVF
Sbjct  281   RGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVF  340

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  341   CWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF  375


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
             R FP A QPEIMRAAEKDEQY  F+Y+ACRDAFR LFG+  ++
Sbjct  6    TRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAV  49



>ref|XP_003550258.1| PREDICTED: peroxisome biogenesis factor 10-like [Glycine max]
Length=394

 Score =   391 bits (1005),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 225/335 (67%), Positives = 263/335 (79%), Gaps = 7/335 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  66    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  125

Query  486   YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
             YQTA+PY+AER+SSRIASQGI L D  F + +      E++    +S  S+ + SS+S  
Sbjct  126   YQTAIPYIAERISSRIASQGIVLTDSEFAEGF-----GENAHSSHSSQISDASLSSSSGQ  180

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               + LSR K K+   WLH VQRWP++LP  RE+LQLV+RANLM FYFEGLYYH+ KRA+ 
Sbjct  181   SVTTLSRLKGKLSAFWLHLVQRWPTMLPFVRELLQLVLRANLMLFYFEGLYYHIPKRAAS  240

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGK +NQRPRYQILG FLL+QLCI  A    RR + +SIA S  Q  F  +  S+
Sbjct  241   IRYVFIGKASNQRPRYQILGVFLLIQLCI-LAAEGLRRRNFTSIAGSVHQASFTNHDRSA  299

Query  1023  GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             G G+PVLNEEG L T   +KGS+VSE SS+     SG+SKC+LCLS+RQHPTAT CGHVF
Sbjct  300   GHGLPVLNEEGTLATPDIDKGSWVSESSSSEYHATSGVSKCTLCLSNRQHPTATSCGHVF  359

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  360   CWNCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  394


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = +2

Query  35   LGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDA  214
            LG    +SG+   +     S+       R FPLA QPEIMRAAEKD+QY  FVYEACRDA
Sbjct  6    LGRHGSDSGDGAVAGPSTSSTEP-----RRFPLAAQPEIMRAAEKDDQYASFVYEACRDA  60

Query  215  FRHLFGSYFSI  247
            FRHLFG+  ++
Sbjct  61   FRHLFGTRVAV  71



>ref|XP_006426216.1| hypothetical protein CICLE_v10025877mg [Citrus clementina]
 gb|ESR39456.1| hypothetical protein CICLE_v10025877mg [Citrus clementina]
 gb|KDO78694.1| hypothetical protein CISIN_1g017241mg [Citrus sinensis]
Length=375

 Score =   390 bits (1001),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 264/335 (79%), Gaps = 4/335 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKL+GQMLY++LTTG+G+QTLGEEYCD TQV GP  LPPTPARRALFI 
Sbjct  44    GTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIV  103

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GI L +   D +     +  SSR ++    E  SSS  R +
Sbjct  104   YQTAVPYIAERISSRVASRGIALAESQSDEFD-RYNAAGSSRDQSLETIESPSSSAPRVY  162

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +SR K K+    L+ ++RWP VLP+ RE LQLV+RANLMFFYFEGLYYH+SKR +GI
Sbjct  163   -SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGI  221

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKPTNQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S   T  G  Q S+G
Sbjct  222   RYVFIGKPTNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHHTSLGFQQASTG  280

Query  1026  RGVPVLNEEGNLITAVSEKGs-fvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             RG+PVLNEEG+LI + S+KG   +   S++    A G+SKC+LCLS+RQ PTATPCGHVF
Sbjct  281   RGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVF  340

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  341   CWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF  375


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
             R FP A QPEIMRAAEKDEQY  F+Y+ACRDAFR LFG+  ++
Sbjct  6    TRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAV  49



>gb|KHN37062.1| Peroxisome biogenesis factor 10 [Glycine soja]
Length=394

 Score =   389 bits (1000),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 262/335 (78%), Gaps = 7/335 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  66    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  125

Query  486   YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
             YQTA+PY+ ER+SSRIASQGI L D  F + +      E++    +S  S+ + SS+S  
Sbjct  126   YQTAIPYITERISSRIASQGIVLTDSEFAEGF-----GENAHSSHSSQISDASLSSSSGQ  180

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               + LSR K K+   WLH VQRWP++LP  RE+LQLV+RANLM FYFEGLYYH+ KRA+ 
Sbjct  181   SVTTLSRLKGKLSAFWLHLVQRWPTMLPFVRELLQLVLRANLMLFYFEGLYYHIPKRAAS  240

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGK +NQRPRYQILG FLL+QLCI  A    RR + +SIA S  Q  F  +  S+
Sbjct  241   IRYVFIGKASNQRPRYQILGVFLLIQLCI-LAAEGLRRRNFTSIAGSVHQASFTNHDRSA  299

Query  1023  GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             G G+PVLNEEG L T   +KGS+VSE SS+     SG+SKC+LCLS+RQHPTAT CGHVF
Sbjct  300   GHGLPVLNEEGTLATPDIDKGSWVSESSSSEYHTTSGVSKCTLCLSNRQHPTATSCGHVF  359

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  360   CWNCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  394


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = +2

Query  35   LGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDA  214
            LG    +SG+   +     S+       R FPLA QPEIMRAAEKD+QY  FVYEACRDA
Sbjct  6    LGRHGSDSGDGAVAGPSTSSTEP-----RRFPLAAQPEIMRAAEKDDQYASFVYEACRDA  60

Query  215  FRHLFGSYFSI  247
            FRHLFG+  ++
Sbjct  61   FRHLFGTRVAV  71



>ref|XP_010049274.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Eucalyptus 
grandis]
Length=315

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 258/317 (81%), Gaps = 2/317 (1%)
 Frame = +3

Query  357   MLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAVPYLAERVSSRIA  536
             MLY++LTTG+G+QTLGEEYCD TQVAGP+GLPPTPARRALFI YQTA PYL ER+SSR+A
Sbjct  1     MLYYVLTTGSGQQTLGEEYCDITQVAGPHGLPPTPARRALFIIYQTAFPYLTERISSRVA  60

Query  537   SQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSRFKTKIRECWLH  716
             S+GI L +    S  +   +  +++ + S A+   SSS SR + S+ +R+K ++   WL 
Sbjct  61    SRGIMLAET-PSSELYENTAFENNQGQTSLATGNPSSSVSRGNGSIFARWKRRLNALWLD  119

Query  717   AVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRPRYQI  896
             AVQRWP+VLP+AREILQLVIR NLMFFYFEG YYH+SKRA+GI+YVFIG P+NQRPRYQI
Sbjct  120   AVQRWPAVLPVAREILQLVIRTNLMFFYFEGFYYHISKRAAGIKYVFIGNPSNQRPRYQI  179

Query  897   LGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVS  1076
             LG FLL+QLCI  A    RRS+LSSIA+S  QT  GT+QTSSGRG+PVLNEEGN+I+   
Sbjct  180   LGIFLLIQLCI-LAAEGLRRSNLSSIASSVHQTSLGTHQTSSGRGLPVLNEEGNVISLDH  238

Query  1077  EKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLC  1256
              KGS++++ S++     +G SKC+LCLS RQHPTATPCGHVFCWNCIMEWCNEKPECPLC
Sbjct  239   NKGSWLTDSSTSEPQGMTGTSKCTLCLSHRQHPTATPCGHVFCWNCIMEWCNEKPECPLC  298

Query  1257  RSPATHSSLVCLYHSDF  1307
             R+P THSSLVCLYHSDF
Sbjct  299   RTPITHSSLVCLYHSDF  315



>ref|XP_007161056.1| hypothetical protein PHAVU_001G039000g [Phaseolus vulgaris]
 gb|ESW33050.1| hypothetical protein PHAVU_001G039000g [Phaseolus vulgaris]
Length=394

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 268/334 (80%), Gaps = 5/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAG YGLPPTPARRALFI 
Sbjct  66    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGTYGLPPTPARRALFIV  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+A+PY+AER+SSRIAS+GI L D  + +  F   +  S   + S +  ++SS  S   
Sbjct  126   YQSAIPYMAERISSRIASRGIVLADS-ESAEGFGENAHRSPGSQISDSGPLSSSGQS---  181

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + LSR K K+   WLH VQRWP++LP  RE+LQL +RANLM FYFEGLYYH+SKRA+GI
Sbjct  182   VTTLSRLKGKLSAFWLHLVQRWPTMLPFVRELLQLALRANLMLFYFEGLYYHISKRAAGI  241

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK +NQRPRYQILG FLL+QLCI+AAE LRRR+  S  A+  Q + F ++  S+G
Sbjct  242   RYVFIGKASNQRPRYQILGVFLLIQLCIIAAESLRRRNFTSIAASVNQAS-FASHDRSAG  300

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
              G+PVLNEEG L T  +++G++VS+ SS+    ASG+SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  301   HGLPVLNEEGTLATPDTDRGNWVSDSSSSEHHAASGVSKCTLCLSNRQYPTATSCGHVFC  360

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  361   WNCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  394


 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 11/65 (17%)
 Frame = +2

Query  53   ESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFG  232
            E+G +TA++E            R FPLA QPE+MRAAEKD+QY  FVYEACRDAFRHLFG
Sbjct  18   EAGPSTAATEP-----------RRFPLAAQPEMMRAAEKDDQYASFVYEACRDAFRHLFG  66

Query  233  SYFSI  247
            +  ++
Sbjct  67   TRVAV  71



>gb|AES59180.2| peroxisome biogenesis factor 10 [Medicago truncatula]
Length=420

 Score =   387 bits (995),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 265/334 (79%), Gaps = 5/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAG YGLPPTPARRALFI 
Sbjct  92    GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGSYGLPPTPARRALFIV  151

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+A+PY+AER+SSRIAS+GI L D ++ +  +   +  SS    S  S  ++S  S   
Sbjct  152   YQSAIPYIAERISSRIASRGIILSD-YESAEIYGENAHGSSSSRVSEISPASASGQS---  207

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L R K K+   WLH VQRWP++LP  RE+LQL++RANLM FYFEGLYYH+SKRA+GI
Sbjct  208   TSTLMRLKHKLGGFWLHMVQRWPTMLPFVRELLQLLLRANLMLFYFEGLYYHISKRAAGI  267

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK +NQRPRYQILG FLL+QLC+  A    RR + SSIAAS  Q  F T+ TS+G
Sbjct  268   RYVFIGKASNQRPRYQILGVFLLIQLCV-IAAEGLRRRNFSSIAASVHQASFATHHTSAG  326

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
              G+PVLNEEGNL +  ++KGS+V   SS+  +  +G+SKC+LCLS+RQHPTAT CGHVFC
Sbjct  327   HGLPVLNEEGNLASPEADKGSWVPGSSSSEHNATNGVSKCTLCLSNRQHPTATSCGHVFC  386

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  387   WNCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  420


 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MG G   R +G+ + +  D   S       R FP A QPE+MRAAEKD+QY  FVYEACR
Sbjct  26   MGWGHLER-NGSDSVTDADAAPSTSTAPESRRFPPAAQPEMMRAAEKDDQYASFVYEACR  84

Query  209  DAFRHLFGSYFSI  247
            DAFRHLFG+  ++
Sbjct  85   DAFRHLFGTRVAV  97



>ref|XP_009362590.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X2 [Pyrus 
x bretschneideri]
Length=389

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 267/334 (80%), Gaps = 13/334 (4%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  69    GTRVSVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  128

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  +    + V++  S+  ++S+    ++ STS   
Sbjct  129   YQTALPYIAERISSRAANRGIALADSEE---LYGVSASLSNDAQSSSTIHNSTGSTSGPS  185

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L R K K    W+   +RWP+VLP+ARE LQLV+RANLMFFYFEGL+YH+SKRA+GI
Sbjct  186   VSALRRLKEKFNGLWISLARRWPTVLPIAREFLQLVVRANLMFFYFEGLFYHISKRAAGI  245

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S  +         + Q + G
Sbjct  246   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIAS---------SAQQTFG  296

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEGNLI+A + KG      SSTSESQASG SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  297   RDLPVLNEEGNLISADATKG-SWVSESSTSESQASGTSKCTLCLSNRQYPTATPCGHVFC  355

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+  THSSLVCLYHSDF
Sbjct  356   WSCIMEWCNEKPECPLCRTSITHSSLVCLYHSDF  389


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FPLA QPEIMRAAEKD+QY  FVY+ACRDA RHL G+  S+
Sbjct  32   RQFPLAAQPEIMRAAEKDDQYASFVYDACRDAVRHLLGTRVSV  74



>gb|AAM14959.1| putative peroxisome assembly protein PER8 [Arabidopsis thaliana]
Length=310

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 209/325 (64%), Positives = 248/325 (76%), Gaps = 19/325 (6%)
 Frame = +3

Query  342   KLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAVPYLAERV  521
             KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI YQTAVPY+AER+
Sbjct  2     KLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFILYQTAVPYIAERI  61

Query  522   SSRIASQGITLDDP---FDDSYPFsvasesssrveastaseiassstsRAHPSVLSRFKT  692
             S+R A+Q +T D+    F DS+           + +    ++ SSS      SV+SR   
Sbjct  62    STRAATQAVTFDESDEFFGDSH-----------IHSPRMIDLPSSSQVETSTSVVSRLND  110

Query  693   KIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPT  872
             ++   W  A+QRWP VLP+ARE+LQLV+RANLM FYFEG YYH+SKRASG+RYVFIGK  
Sbjct  111   RLMRSWHRAIQRWPVVLPVAREVLQLVLRANLMLFYFEGFYYHISKRASGVRYVFIGKQL  170

Query  873   NQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEE  1052
             NQRPRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQTS GRG+PVLNEE
Sbjct  171   NQRPRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSIQQASIGSYQTSGGRGLPVLNEE  229

Query  1053  GNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCN  1232
             GNLIT+ +EKG      S++  +    + KC+LCLS+RQHPTATPCGHVFCW+CIMEWCN
Sbjct  230   GNLITSEAEKG----NWSTSDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCN  285

Query  1233  EKPECPLCRSPATHSSLVCLYHSDF  1307
             EK ECPLCR+P THSSLVCLYHSDF
Sbjct  286   EKQECPLCRTPNTHSSLVCLYHSDF  310



>ref|XP_008797557.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Phoenix 
dactylifera]
Length=395

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 211/337 (63%), Positives = 262/337 (78%), Gaps = 8/337 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQ+E KLLGQ LY+LLTTGAG+QTLGEEYCD +Q+A  +GLPPTPARRALFI 
Sbjct  64    GTRIAVAYQSEIKLLGQTLYYLLTTGAGQQTLGEEYCDISQIASSHGLPPTPARRALFIV  123

Query  486   YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
             Y+T +PY+AER+SSR+A++GI L D  F + Y       +  +   +  S  ++S     
Sbjct  124   YETIIPYVAERISSRMAARGIILADSQFGELYGSDHPRRNQVQSSDAAESSTSTSVPI--  181

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               S LS+F+ ++   WL AVQ+WP+VLP AREILQL +R NLMFFYFEGLYYH+SKRA+G
Sbjct  182   --SALSKFRERLHGLWLQAVQKWPTVLPYAREILQLALRTNLMFFYFEGLYYHISKRAAG  239

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGKP NQRPRYQILG FLL+QLCIL AEGLRR +  S  ++  Q +P G++Q+S+
Sbjct  240   IRYVFIGKPLNQRPRYQILGVFLLIQLCILGAEGLRRSNLSSITSSVHQTSP-GSHQSST  298

Query  1023  GRGVPVLNEEGNLITAVS-EKGs-fvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             G G+PVLNE+GN +T  S +KGS      ++     + G+SKC+LCLS+RQHPTATPCGH
Sbjct  299   GPGLPVLNEDGNPVTNYSPDKGSWAADSLAAPEPQGSGGMSKCTLCLSTRQHPTATPCGH  358

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCWNCIMEWCNEKPECPLCR+P THSSLVC+YH+DF
Sbjct  359   VFCWNCIMEWCNEKPECPLCRNPITHSSLVCIYHADF  395


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y  FV++ACRDAFRHLFG+  ++
Sbjct  27   RRFPAAAQPEIMRAAEKDDHYAAFVHDACRDAFRHLFGTRIAV  69



>ref|XP_010529040.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Tarenaya 
hassleriana]
Length=395

 Score =   382 bits (980),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 214/334 (64%), Positives = 260/334 (78%), Gaps = 5/334 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQNE KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGP+GL PTPARRALFI 
Sbjct  67    GTRIALAYQNEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPHGLSPTPARRALFIV  126

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AE++SSR ++Q ++  +   D +  ++A +S    +  T  ++ SS  +   
Sbjct  127   YQTAVPYIAEKLSSRASAQAMSFAESHSDEFYGNIALQSGGHNQPPTMIDLPSSPETATS  186

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +S+ K K +  W  A++RWP VLP+ARE+LQL +RANLMFFYFEGLYYH+SKRA+GI
Sbjct  187   ASAVSKLKDKFKRLWYCAIRRWPVVLPVAREVLQLFLRANLMFFYFEGLYYHISKRAAGI  246

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGK TN RPRYQILG FLL+QLCI  A    RRS+LSSI++S QQT  G+YQTS G
Sbjct  247   RYVFIGKQTNHRPRYQILGIFLLIQLCI-LAAEGLRRSNLSSISSSVQQTSLGSYQTSGG  305

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNEEGNLI   +E G       S S S + G+ KC+LCLS+R+HPTAT CGHVFC
Sbjct  306   RGLPVLNEEGNLIPPEAETG----NWVSDSTSTSEGVGKCTLCLSNRRHPTATTCGHVFC  361

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  362   WACIMEWCNEKQECPLCRTPITHSSLVCLYHSDF  395


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R F  A QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++
Sbjct  29   IRRFQPAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGTRIAL  72



>ref|XP_008367635.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X2 [Malus 
domestica]
Length=389

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 220/336 (65%), Positives = 265/336 (79%), Gaps = 17/336 (5%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV+VAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPP PARR LFI 
Sbjct  69    GTRVSVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPMPARRVLFIV  128

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  ++ Y  S +  + ++  ++  +   S+    + 
Sbjct  129   YQTALPYIAERISSRAANRGIALADS-EELYGISASLSNDAQSSSTIHNSAGST----SG  183

Query  666   PSV--LSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
             PSV  L R K K    W+   +RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKRA+
Sbjct  184   PSVSALRRLKEKFNGLWISLARRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRAA  243

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GIRYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S  +         + Q +
Sbjct  244   GIRYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIAS---------SAQQT  294

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
              GR +PVLNEEGNLI+A + +G      SSTSESQASG SKC+LCLS+R +PTATPCGHV
Sbjct  295   FGRDLPVLNEEGNLISADATRG-SWVSESSTSESQASGSSKCTLCLSNRHYPTATPCGHV  353

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCW+CIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  354   FCWSCIMEWCNEKPECPLCRTPITHSSLVCLYHSDF  389


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FPLA QPEIMRAAEKD+QY  FVY+ACRDA RHL G+  S+
Sbjct  32   RQFPLAAQPEIMRAAEKDDQYASFVYDACRDAVRHLLGTRVSV  74



>ref|XP_010936953.1| PREDICTED: peroxisome biogenesis factor 10 [Elaeis guineensis]
Length=395

 Score =   381 bits (978),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 213/337 (63%), Positives = 260/337 (77%), Gaps = 8/337 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQ+E KLLGQ LY+LLTTGAG+QTLGEEYCD +QVA  +GLPPTPARRALFI 
Sbjct  64    GTRMAVAYQSEIKLLGQTLYYLLTTGAGQQTLGEEYCDISQVASSHGLPPTPARRALFIV  123

Query  486   YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
             Y+T +PYLAER+SSR+A++GI L D  F + Y       +  +   +  S  ++S +  A
Sbjct  124   YETIIPYLAERISSRMAARGIILADSQFGELYGSDHPRRNQVQSSDAAESSNSTSVSISA  183

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
                 LS+F+ ++   WL AVQ+WP+VLP AREILQL  R NLMFFYFEGLYYH+SKRA+G
Sbjct  184   ----LSKFRERLHGLWLQAVQKWPTVLPYAREILQLAFRTNLMFFYFEGLYYHISKRAAG  239

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGKP NQRPRYQILG FLL+QLCIL AEGLRR +  S  ++  Q +P G + +S+
Sbjct  240   IRYVFIGKPLNQRPRYQILGVFLLIQLCILGAEGLRRSNLSSITSSVHQTSP-GGHHSST  298

Query  1023  GRGVPVLNEEGNLITAVS-EKGs-fvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             GRG+PVLNE+GN +T  S +KGS      +      + G+SKC+LCLS+RQHPTATPCGH
Sbjct  299   GRGMPVLNEDGNPVTNYSPDKGSWAADSLAVPEPQGSGGMSKCTLCLSTRQHPTATPCGH  358

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCWNCIMEWCNEKPECPLCR+P THSSLVC+YH+DF
Sbjct  359   VFCWNCIMEWCNEKPECPLCRTPITHSSLVCIYHADF  395


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y  FV++ACRDAFRHLFG+  ++
Sbjct  27   RRFPAAAQPEIMRAAEKDDHYAAFVHDACRDAFRHLFGTRMAV  69



>ref|XP_010669329.1| PREDICTED: peroxisome biogenesis factor 10 [Beta vulgaris subsp. 
vulgaris]
Length=395

 Score =   380 bits (977),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 212/334 (63%), Positives = 264/334 (79%), Gaps = 9/334 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R+ VAY ++TKLLGQMLY++LTTGAG+QTLGEEYCD  Q+AG YGLPPTPARRAL+I 
Sbjct  71    GARLTVAYHSQTKLLGQMLYYILTTGAGQQTLGEEYCDIVQIAGSYGLPPTPARRALYIL  130

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSRIAS+G+ L +   D +      +SSS   +   S   SSSTS+  
Sbjct  131   YQTAVPYIAERMSSRIASRGMFLAESHSDEF-----GDSSSPRNSQLGSGTPSSSTSQIS  185

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S L+R K + R   ++ + +WP+VLP+AREILQL++R NLM FYFEGLYYH+SKR SGI
Sbjct  186   TSSLARLKGRFRRLRMYIIHQWPTVLPVAREILQLILRTNLMLFYFEGLYYHISKRTSGI  245

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RY+FIGKP+NQRPRYQILG FLL+QLC+  A    RR++LS++ +S +    GTYQ S+G
Sbjct  246   RYMFIGKPSNQRPRYQILGVFLLIQLCV-IAAEALRRTNLSTLGSSTRLASLGTYQHSAG  304

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
              G+PVLNEEG+LIT+ S+K   VS  S ++ ++A G +KC+LCL +R+HPTATPCGHVFC
Sbjct  305   TGLPVLNEEGDLITSDSDK---VSFLSESTSAEAKGATKCTLCLGNREHPTATPCGHVFC  361

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  362   WNCIMEWCNEKPECPLCRTPLTHSSLVCLYHSDF  395


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINLFFFAKLWPSFTFLF  295
            VR FP A QPEIMRAAEKD+ Y  FV +ACRDAFRHLFG+  ++      KL     +  
Sbjct  33   VRGFPAAAQPEIMRAAEKDDHYASFVSDACRDAFRHLFGARLTVAYHSQTKLLGQMLYYI  92

Query  296  L  298
            L
Sbjct  93   L  93



>ref|XP_008797551.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Phoenix 
dactylifera]
Length=396

 Score =   378 bits (971),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 262/338 (78%), Gaps = 9/338 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQ+E KLLGQ LY+LLTTGAG+QTLGEEYCD +Q+A  +GLPPTPARRALFI 
Sbjct  64    GTRIAVAYQSEIKLLGQTLYYLLTTGAGQQTLGEEYCDISQIASSHGLPPTPARRALFIV  123

Query  486   YQTAVPYLAERVSS-RIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsR  659
             Y+T +PY+AER+SS R+A++GI L D  F + Y       +  +   +  S  ++S    
Sbjct  124   YETIIPYVAERISSSRMAARGIILADSQFGELYGSDHPRRNQVQSSDAAESSTSTSVPI-  182

Query  660   AHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
                S LS+F+ ++   WL AVQ+WP+VLP AREILQL +R NLMFFYFEGLYYH+SKRA+
Sbjct  183   ---SALSKFRERLHGLWLQAVQKWPTVLPYAREILQLALRTNLMFFYFEGLYYHISKRAA  239

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GIRYVFIGKP NQRPRYQILG FLL+QLCIL AEGLRR +  S  ++  Q +P G++Q+S
Sbjct  240   GIRYVFIGKPLNQRPRYQILGVFLLIQLCILGAEGLRRSNLSSITSSVHQTSP-GSHQSS  298

Query  1020  SGRGVPVLNEEGNLITAVS-EKGs-fvsepsstsesqasglskcslclssRQHPTATPCG  1193
             +G G+PVLNE+GN +T  S +KGS      ++     + G+SKC+LCLS+RQHPTATPCG
Sbjct  299   TGPGLPVLNEDGNPVTNYSPDKGSWAADSLAAPEPQGSGGMSKCTLCLSTRQHPTATPCG  358

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             HVFCWNCIMEWCNEKPECPLCR+P THSSLVC+YH+DF
Sbjct  359   HVFCWNCIMEWCNEKPECPLCRNPITHSSLVCIYHADF  396


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y  FV++ACRDAFRHLFG+  ++
Sbjct  27   RRFPAAAQPEIMRAAEKDDHYAAFVHDACRDAFRHLFGTRIAV  69



>dbj|BAJ85007.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 205/334 (61%), Positives = 252/334 (75%), Gaps = 8/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  64    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRMLFIL  123

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI S+GI +DD   D++  S          ++  +E + S +    
Sbjct  124   YQTTVPYLAERISSRIVSRGIYMDDSQLDNHHESDNPSRGITESSTNTNESSRSLSF---  180

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S+LSR ++K +  WL  VQ+WPS+LPL ++ +QL IR NLMFFYFEGLYYHLSKR +GI
Sbjct  181   -SMLSRLRSKAQAFWLWVVQKWPSMLPLGQDFIQLAIRTNLMFFYFEGLYYHLSKRGAGI  239

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
              YVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G+Y +S+G
Sbjct  240   HYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNLSSIASSINQISS-GSYPSSTG  298

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R VPVLNE+GN+I+ +       +   ++    +S  SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  299   RSVPVLNEDGNIISDIRRG---KAVDLASGSEASSSKSKCTLCLSTRQNPTATTCGHVFC  355

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  356   WNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  389


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            M  G+P+ ++G ++      G +       R FP A QPE+MRAAEKD+ Y   V EACR
Sbjct  1    MSAGDPAGDAGPSSRGGARAGVAARP----RRFPTAAQPEVMRAAEKDDSYAAHVTEACR  56

Query  209  DAFRHLFGSYFSI  247
            DAFRHLFG+  ++
Sbjct  57   DAFRHLFGTRVAV  69



>ref|XP_009388152.1| PREDICTED: peroxisome biogenesis factor 10 [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 256/337 (76%), Gaps = 8/337 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+E KLLGQ LY++LTTG+G+QTLGEEYCD  QVA  YGL PTPARR LFI 
Sbjct  63    GTRVAVAYQSEIKLLGQTLYYILTTGSGQQTLGEEYCDVCQVASSYGLSPTPARRMLFIV  122

Query  486   YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
             YQTAVPYLAER+SSR+A++GI L +  FD+ Y     + +  R +   +    SSS++  
Sbjct  123   YQTAVPYLAERISSRMAARGIILAESHFDEIY----GNNNPRRAQVQISDTPESSSSATM  178

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               S +SR +  I   WL  +Q+WPSVLP ARE+LQL +R NLMFFYFEGLYYH+SKRA+G
Sbjct  179   SLSTISRLRENIHGLWLWILQKWPSVLPFAREVLQLALRTNLMFFYFEGLYYHVSKRAAG  238

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGKP+NQRPRYQILG FLL+QLCI       RRS+LSSI  S   T  G++Q+SS
Sbjct  239   IRYVFIGKPSNQRPRYQILGVFLLIQLCI-LGAEGLRRSNLSSITTSVHHTSLGSHQSSS  297

Query  1023  GRGVPVLNEEGNLI-TAVSEKGs-fvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             GR +PVLNE+GN I    S KGS      + +    + G+SKC+LCLSSRQHPTATPCGH
Sbjct  298   GRDLPVLNEDGNPIPDNNSNKGSWATDSFALSEPQSSGGMSKCTLCLSSRQHPTATPCGH  357

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCWNCIMEWCNEKPECPLCR+P THSSLVC+YH+DF
Sbjct  358   VFCWNCIMEWCNEKPECPLCRTPITHSSLVCIYHADF  394


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R F  A QPEIMRAAEKD+ Y  +V++ACRDAFRHLFG+  ++
Sbjct  26   RRFTPAAQPEIMRAAEKDDHYAAYVHDACRDAFRHLFGTRVAV  68



>gb|KDO78693.1| hypothetical protein CISIN_1g017241mg [Citrus sinensis]
Length=355

 Score =   369 bits (948),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 215/335 (64%), Positives = 251/335 (75%), Gaps = 24/335 (7%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKL+GQMLY++LTTG+G+QTLGEEYCD TQV GP  LPPTPARRALFI 
Sbjct  44    GTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIV  103

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+  R  + G + D   +                     E  SSS  R +
Sbjct  104   YQTAVPYIAERI--RYNAAGSSRDQSLE-------------------TIESPSSSAPRVY  142

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +SR K K+    L+ ++RWP VLP+ RE LQLV+RANLMFFYFEGLYYH+SKR +GI
Sbjct  143   -SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGI  201

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKPTNQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S   T  G  Q S+G
Sbjct  202   RYVFIGKPTNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHHTSLGFQQASTG  260

Query  1026  RGVPVLNEEGNLITAVSEKGs-fvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             RG+PVLNEEG+LI + S+KG   +   S++    A G+SKC+LCLS+RQ PTATPCGHVF
Sbjct  261   RGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVF  320

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSLVCLYHSDF
Sbjct  321   CWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF  355


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
             R FP A QPEIMRAAEKDEQY  F+Y+ACRDAFR LFG+  ++
Sbjct  6    TRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAV  49



>ref|XP_002461003.1| hypothetical protein SORBIDRAFT_02g039010 [Sorghum bicolor]
 gb|EER97524.1| hypothetical protein SORBIDRAFT_02g039010 [Sorghum bicolor]
Length=389

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 204/334 (61%), Positives = 252/334 (75%), Gaps = 8/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD TQVA  +GLPPTPARR LFI 
Sbjct  64    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDITQVATLHGLPPTPARRILFIL  123

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI ++ I L++   D +P S  S S      +     ++S +    
Sbjct  124   YQTTVPYLAERISSRIVARSIALNESQFDDHPESDNSSSDIAQSVTNNGIPSTSLSV---  180

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR + ++   W   +Q+WPS+LP A++++QL IR NLMFFYFEGLYYHL KRA+GI
Sbjct  181   -SALSRLRGRVHALWQWVLQKWPSMLPYAQDVIQLAIRTNLMFFYFEGLYYHLPKRAAGI  239

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G+Y +S+G
Sbjct  240   RYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQIS-SGSYPSSTG  298

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNE+GN+I+ +       +   ++    +SG SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  299   RGIPVLNEDGNIISDIRSG---KAADIASHSEASSGKSKCTLCLSTRQNPTATTCGHVFC  355

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  356   WNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  389


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            M  G P+ ++G ++ +              R FP A QPEIMRAAEKD+ Y   V EACR
Sbjct  1    MRAGAPAGDAGPSSGAGAG----SSTPARPRRFPGAAQPEIMRAAEKDDSYAAHVTEACR  56

Query  209  DAFRHLFGSYFSI  247
            DAFRHLFG+  ++
Sbjct  57   DAFRHLFGTRVAV  69



>ref|XP_010529041.1| PREDICTED: peroxisome biogenesis factor 10 isoform X3 [Tarenaya 
hassleriana]
Length=330

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 205/324 (63%), Positives = 250/324 (77%), Gaps = 5/324 (2%)
 Frame = +3

Query  336   ETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAVPYLAE  515
             + KLLGQMLY++LTTG+G+QTLGEEYCD  QVAGP+GL PTPARRALFI YQTAVPY+AE
Sbjct  12    QMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVAGPHGLSPTPARRALFIVYQTAVPYIAE  71

Query  516   RVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSRFKTK  695
             ++SSR ++Q ++  +   D +  ++A +S    +  T  ++ SS  +    S +S+ K K
Sbjct  72    KLSSRASAQAMSFAESHSDEFYGNIALQSGGHNQPPTMIDLPSSPETATSASAVSKLKDK  131

Query  696   IRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTN  875
              +  W  A++RWP VLP+ARE+LQL +RANLMFFYFEGLYYH+SKRA+GIRYVFIGK TN
Sbjct  132   FKRLWYCAIRRWPVVLPVAREVLQLFLRANLMFFYFEGLYYHISKRAAGIRYVFIGKQTN  191

Query  876   QRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEG  1055
              RPRYQILG FLL+QLCI  A    RRS+LSSI++S QQT  G+YQTS GRG+PVLNEEG
Sbjct  192   HRPRYQILGIFLLIQLCI-LAAEGLRRSNLSSISSSVQQTSLGSYQTSGGRGLPVLNEEG  250

Query  1056  NLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNE  1235
             NLI   +E G       S S S + G+ KC+LCLS+R+HPTAT CGHVFCW CIMEWCNE
Sbjct  251   NLIPPEAETG----NWVSDSTSTSEGVGKCTLCLSNRRHPTATTCGHVFCWACIMEWCNE  306

Query  1236  KPECPLCRSPATHSSLVCLYHSDF  1307
             K ECPLCR+P THSSLVCLYHSDF
Sbjct  307   KQECPLCRTPITHSSLVCLYHSDF  330



>ref|XP_006658799.1| PREDICTED: peroxisome biogenesis factor 10-like, partial [Oryza 
brachyantha]
Length=358

 Score =   362 bits (929),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 201/334 (60%), Positives = 248/334 (74%), Gaps = 10/334 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  35    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILFIL  94

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSR+ ++GI L D   D +P S +S   +  ++S     + S      
Sbjct  95    YQTTVPYLAERISSRMVARGIALTDSQLDDHPESDSSSRGTSAQSSINPSRSLSF-----  149

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR + ++   W   + +WPS+LP A++ +QL IRANLM FYFEGLYYHL KRA+GI
Sbjct  150   -SYLSRLRGRVHTMWQWVLLKWPSMLPFAQDFIQLSIRANLMLFYFEGLYYHLPKRAAGI  208

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  +  ++  Q +  G+Y + +G
Sbjct  209   RYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNLSTIASSINQISS-GSYPSFTG  267

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RGVPVLNE+GN+I   S+     +   ++    +S  SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  268   RGVPVLNEDGNII---SDTRHGKTADLASGSEASSSKSKCTLCLSTRQNPTATTCGHVFC  324

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W CIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  325   WGCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  358


 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  PLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            P A QPE+MRAAEKD+ Y   V EACRDAFRHLFG+  ++
Sbjct  1    PGAAQPEVMRAAEKDDGYAAHVTEACRDAFRHLFGTRVAV  40



>ref|XP_008667600.1| PREDICTED: LOC100274236 isoform X1 [Zea mays]
 tpg|DAA41414.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=387

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 201/334 (60%), Positives = 249/334 (75%), Gaps = 8/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  62    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATLHGLPPTPARRILFIL  121

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI ++ I L++   D +P S  S S      + +   + S +    
Sbjct  122   YQTTVPYLAERISSRIVARSIVLNESQFDDHPESDNSSSDIAQSTTNSDIPSRSLSV---  178

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LS F+ ++   W   +Q+WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+GI
Sbjct  179   -SALSGFRGRVHALWQWVLQKWPSMLPYAQDFIQLAIRTNLMFFYFEGLYYHLPKRAAGI  237

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G Y +++G
Sbjct  238   RYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQIS-SGGYPSTTG  296

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RG+PVLNE+GN+I+ +       +   ++    ++G SKC+LCLS RQ+PTAT CGHVFC
Sbjct  297   RGIPVLNEDGNIISDIRSG---KAADIASHSETSNGKSKCTLCLSIRQNPTATTCGHVFC  353

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             WNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  354   WNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  387


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +2

Query  38   GEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAF  217
            G P+ ++G ++ +  +  +        R FP A QPEIMRAAEKD+ Y   V EACRDAF
Sbjct  4    GAPTGDAGPSSGAGSNPPTRP------RRFPGAAQPEIMRAAEKDDSYAAHVTEACRDAF  57

Query  218  RHLFGSYFSI  247
            RHLFG+  ++
Sbjct  58   RHLFGTRVAV  67



>ref|NP_001060245.1| Os07g0608800 [Oryza sativa Japonica Group]
 dbj|BAC84638.1| putative Peroxisome assembly protein 10 [Oryza sativa Japonica 
Group]
 dbj|BAF22159.1| Os07g0608800 [Oryza sativa Japonica Group]
 gb|EEC82427.1| hypothetical protein OsI_26824 [Oryza sativa Indica Group]
 gb|EEE67564.1| hypothetical protein OsJ_25076 [Oryza sativa Japonica Group]
Length=389

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 252/334 (75%), Gaps = 7/334 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  63    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILFIL  122

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI ++GI L+D   D +  S +S   +  + S      S S S +H
Sbjct  123   YQTTVPYLAERISSRIVARGIALEDSQLDDHSESDSSSIGTAAQPSPIRNSPSRSLSFSH  182

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                LSR + ++   W   +++WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+GI
Sbjct  183   ---LSRLRGRVHTLWEWVLRKWPSMLPFAQDFIQLTIRTNLMFFYFEGLYYHLPKRAAGI  239

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  +  ++  Q +  G Y +S G
Sbjct  240   RYVFIGKPLNQRPRYQILGIFLLIQLCILGAERLRRSNLSTIASSINQISS-GGYPSSRG  298

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RGVPVLNE+GN+I+ +       +   +TS   +SG SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  299   RGVPVLNEDGNIISDIRHG---KTADLATSSEASSGKSKCTLCLSTRQNPTATTCGHVFC  355

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             W+CIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  356   WSCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  389


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y   V EACRDAFRHLFG+  ++
Sbjct  26   RRFPEAAQPEIMRAAEKDDGYAAHVTEACRDAFRHLFGTRVAV  68



>ref|XP_010235723.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Brachypodium 
distachyon]
Length=390

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/343 (59%), Positives = 241/343 (70%), Gaps = 26/343 (8%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  65    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILFIL  124

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSR+ S+GI LDD   D +                 +     + +  +
Sbjct  125   YQTTVPYLAERISSRMVSRGIYLDDSQLDYH-------------HEIDNSSRGIAQTSTN  171

Query  666   PSVLSRFKTKIREC---------WLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYY  818
              S  SR  T              WL  VQ+WPS+LPLA++ +QL +R NLMFFYFEGLYY
Sbjct  172   TSDFSRIMTSSSLSRLRSRAHAFWLWVVQKWPSMLPLAQDFIQLAMRTNLMFFYFEGLYY  231

Query  819   HLSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTP  998
             HLSKR +GI YVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S   +  Q + 
Sbjct  232   HLSKRGAGIHYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNLSSIATSINQISS  291

Query  999   FGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPT  1178
              G+Y +S+GR VPVLNE+GN+I+ +       +   ++     S  SKC+LCLS+RQ+PT
Sbjct  292   -GSYPSSTGRSVPVLNEDGNIISDIRHG---KAVDLASGSEAPSSKSKCTLCLSTRQNPT  347

Query  1179  ATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             AT CGHVFCWNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  348   ATTCGHVFCWNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  390


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPE+MRAAEKD+ Y   V EACRDAFRHLFG+  ++
Sbjct  28   RRFPTAAQPEVMRAAEKDDSYAAHVTEACRDAFRHLFGTRVAV  70



>ref|XP_004958285.1| PREDICTED: peroxisome biogenesis factor 10-like [Setaria italica]
Length=393

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/335 (60%), Positives = 248/335 (74%), Gaps = 10/335 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  68    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATLHGLPPTPARRILFIL  127

Query  486   YQTAVPYLAERVSSRIASQGITLDDP-FDDSYPFsvasesssrveastaseiassstsRA  662
             YQT VPYLAER+SSRI ++ I L++  FDD      +S   ++   +      S S    
Sbjct  128   YQTTVPYLAERISSRIVARSIALNESQFDDHLESDNSSSGIAQSTTNNHVPSRSLSV---  184

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               S LSR + ++   W   +Q+WPS+LP A++ +QL IR NLM FYFEGLYYHL KRA+G
Sbjct  185   --SALSRLRGRVHALWQWVLQKWPSMLPFAQDFIQLAIRTNLMLFYFEGLYYHLPKRAAG  242

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G+Y +S+
Sbjct  243   IRYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQIS-SGSYPSST  301

Query  1023  GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             GRGVPVLNE+G++I+ +       +   ++    +SG SKC+LCL +RQ+PTAT CGHVF
Sbjct  302   GRGVPVLNEDGHVISDIC---GGKAADVASHSEASSGKSKCTLCLGTRQNPTATTCGHVF  358

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  359   CWNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  393


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            M  G P+ ++G ++      GS        R FP A QPEIMRAAEKD+ Y   V EACR
Sbjct  1    MRAGTPAGDAGPSSHGGAGFGSGSRAPALPRRFPGAAQPEIMRAAEKDDSYAAHVTEACR  60

Query  209  DAFRHLFGSYFSI  247
            DAFRHLFG+  ++
Sbjct  61   DAFRHLFGTRVAV  73



>ref|NP_001142078.1| LOC100274236 [Zea mays]
 gb|ACF87592.1| unknown [Zea mays]
 tpg|DAA41413.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=359

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 241/335 (72%), Gaps = 38/335 (11%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  62    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATLHGLPPTPARRILFIL  121

Query  486   YQTAVPYLAERVSSRIASQGITLDDP-FDDSYPFsvasesssrveastaseiassstsRA  662
             YQT VPYLAER+SSRI ++ I L++  FDD                              
Sbjct  122   YQTTVPYLAERISSRIVARSIVLNESQFDD------------------------------  151

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
             HP    RF+ ++   W   +Q+WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+G
Sbjct  152   HPE---RFRGRVHALWQWVLQKWPSMLPYAQDFIQLAIRTNLMFFYFEGLYYHLPKRAAG  208

Query  843   IRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             IRYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G Y +++
Sbjct  209   IRYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQIS-SGGYPSTT  267

Query  1023  GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVF  1202
             GRG+PVLNE+GN+I+ +       +   ++    ++G SKC+LCLS RQ+PTAT CGHVF
Sbjct  268   GRGIPVLNEDGNIISDIRSG---KAADIASHSETSNGKSKCTLCLSIRQNPTATTCGHVF  324

Query  1203  CWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             CWNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  325   CWNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  359


 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +2

Query  38   GEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAF  217
            G P+ ++G ++ +  +  +        R FP A QPEIMRAAEKD+ Y   V EACRDAF
Sbjct  4    GAPTGDAGPSSGAGSNPPTRP------RRFPGAAQPEIMRAAEKDDSYAAHVTEACRDAF  57

Query  218  RHLFGSYFSI  247
            RHLFG+  ++
Sbjct  58   RHLFGTRVAV  67



>ref|XP_010235725.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Brachypodium 
distachyon]
Length=344

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 192/337 (57%), Positives = 233/337 (69%), Gaps = 26/337 (8%)
 Frame = +3

Query  324   AYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAVP  503
             A Q + KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI YQT VP
Sbjct  25    AAQRKIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILFILYQTTVP  84

Query  504   YLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSR  683
             YLAER+SSR+ S+GI LDD   D +                 +     + +  + S  SR
Sbjct  85    YLAERISSRMVSRGIYLDDSQLDYH-------------HEIDNSSRGIAQTSTNTSDFSR  131

Query  684   FKTKIREC---------WLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRA  836
               T              WL  VQ+WPS+LPLA++ +QL +R NLMFFYFEGLYYHLSKR 
Sbjct  132   IMTSSSLSRLRSRAHAFWLWVVQKWPSMLPLAQDFIQLAMRTNLMFFYFEGLYYHLSKRG  191

Query  837   SGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             +GI YVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S   +  Q +  G+Y +
Sbjct  192   AGIHYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNLSSIATSINQISS-GSYPS  250

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             S+GR VPVLNE+GN+I+ +       +   ++     S  SKC+LCLS+RQ+PTAT CGH
Sbjct  251   STGRSVPVLNEDGNIISDIRHG---KAVDLASGSEAPSSKSKCTLCLSTRQNPTATTCGH  307

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             VFCWNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  308   VFCWNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  344



>ref|XP_010098352.1| Peroxisome biogenesis factor 10 [Morus notabilis]
 gb|EXB74876.1| Peroxisome biogenesis factor 10 [Morus notabilis]
Length=407

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 237/303 (78%), Gaps = 8/303 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPY LPPTPARRALF+ 
Sbjct  65    GTRIAVAYQSETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVAGPYKLPPTPARRALFVV  124

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GI L D   D   F   +  S+RV +S   E  ++S S   
Sbjct  125   YQTAVPYIAERISSRVASRGIVLADSQSDDV-FGDDAFGSNRVNSSVVMESPTTSASEQP  183

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S ++R K KI   W++AVQRWP+VLP+ARE LQLVIRANLMFFYFEGLYYH+SKRA+GI
Sbjct  184   VSAMTRLKQKINRLWVYAVQRWPAVLPVAREFLQLVIRANLMFFYFEGLYYHISKRAAGI  243

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI  A    RRS+LSSIA S  QT  G +Q S+G
Sbjct  244   RYVFIGKPSNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIARSVHQTSLGPHQASTG  302

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
              G+PV+NEEGNL++  ++ G         + S +  +SKC+LCLS+RQ+PTATPCGHVFC
Sbjct  303   GGLPVINEEGNLVS--TDTG----SLVYDASSSSESISKCTLCLSNRQNPTATPCGHVFC  356

Query  1206  WNC  1214
             W C
Sbjct  357   WYC  359


 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FPLA QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++
Sbjct  28   RRFPLAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGTRIAV  70



>ref|XP_007223000.1| hypothetical protein PRUPE_ppa006781mg [Prunus persica]
 gb|EMJ24199.1| hypothetical protein PRUPE_ppa006781mg [Prunus persica]
Length=392

 Score =   330 bits (845),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 206/303 (68%), Positives = 246/303 (81%), Gaps = 6/303 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR AVAYQNETKLLGQ+LY++LTTG+G+QTLGEEYCD TQVAGPYGLPPTPARRALFI 
Sbjct  68    GTRTAVAYQNETKLLGQVLYYVLTTGSGQQTLGEEYCDITQVAGPYGLPPTPARRALFIV  127

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTA+PY+AER+SSR A++GI L D  D+ Y     +  S+ V++S+ +  +++STS A 
Sbjct  128   YQTALPYIAERISSRAANRGIVLADS-DELY--GNNASLSNDVQSSSVTPTSTASTSGAS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S + R K K    WL  V+RWP+VLP+ARE LQLVIRANLMFFYFEGL+YH+SKR +GI
Sbjct  185   ASAIRRLKEKFNGLWLSLVRRWPTVLPIAREFLQLVIRANLMFFYFEGLFYHISKRTAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLCI+AAEGLRR +  S   +S Q   FGT+QTS G
Sbjct  245   RYVFIGKPSNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIAGSSHQT--FGTHQTSGG  302

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             R +PVLNEEG+LI+A + KG      SSTSESQASG+SKC+LCLS+RQHPTATPCGHVFC
Sbjct  303   RDLPVLNEEGHLISADAAKG-SWVSDSSTSESQASGMSKCTLCLSNRQHPTATPCGHVFC  361

Query  1206  WNC  1214
             W C
Sbjct  362   WYC  364


 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MG  E +     A  S  + G S    G  R FPLA QPEIMRAAEKD+QY  FVY+ACR
Sbjct  1    MGWNEVTGSGQQAGPSGVEAGPSSSDPGEARRFPLAAQPEIMRAAEKDDQYASFVYDACR  60

Query  209  DAFRHLFGSYFSI  247
            DA RHL G+  ++
Sbjct  61   DAVRHLLGTRTAV  73



>ref|XP_010529037.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529039.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Tarenaya 
hassleriana]
Length=403

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 238/342 (70%), Gaps = 13/342 (4%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQV--------AGPYGLPPTP  461
             GTR+A+AYQNE   L         + A      ++    T +         GP+GL PTP
Sbjct  67    GTRIALAYQNERVSLSSWFLADEASRANALLRSDDRFRATNIRRRILRHYTGPHGLSPTP  126

Query  462   ARRALFIFYQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseia  641
             ARRALFI YQTAVPY+AE++SSR ++Q ++  +   D +  ++A +S    +  T  ++ 
Sbjct  127   ARRALFIVYQTAVPYIAEKLSSRASAQAMSFAESHSDEFYGNIALQSGGHNQPPTMIDLP  186

Query  642   ssstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYH  821
             SS  +    S +S+ K K +  W  A++RWP VLP+ARE+LQL +RANLMFFYFEGLYYH
Sbjct  187   SSPETATSASAVSKLKDKFKRLWYCAIRRWPVVLPVAREVLQLFLRANLMFFYFEGLYYH  246

Query  822   LSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
             +SKRA+GIRYVFIGK TN RPRYQILG FLL+QLCI  A    RRS+LSSI++S QQT  
Sbjct  247   ISKRAAGIRYVFIGKQTNHRPRYQILGIFLLIQLCI-LAAEGLRRSNLSSISSSVQQTSL  305

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
             G+YQTS GRG+PVLNEEGNLI   +E G       S S S + G+ KC+LCLS+R+HPTA
Sbjct  306   GSYQTSGGRGLPVLNEEGNLIPPEAETG----NWVSDSTSTSEGVGKCTLCLSNRRHPTA  361

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             T CGHVFCW CIMEWCNEK ECPLCR+P THSSLVCLYHSDF
Sbjct  362   TTCGHVFCWACIMEWCNEKQECPLCRTPITHSSLVCLYHSDF  403


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 66/112 (59%), Gaps = 15/112 (13%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINLFFFAKLWPSFTFLF  295
            +R F  A QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++    +     S +  F
Sbjct  29   IRRFQPAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGTRIALA---YQNERVSLSSWF  85

Query  296  LFLRYTGCCSIPE*DKTSWPNALLFTHNRCWKANIRRRILRHYSGCRTIWPS  451
            L             D+ S  NALL + +R    NIRRRILRHY+G   + P+
Sbjct  86   LA------------DEASRANALLRSDDRFRATNIRRRILRHYTGPHGLSPT  125



>ref|XP_009616707.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 198/239 (83%), Gaps = 2/239 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQMLY++LTTGAGKQTLGEEYCD TQVAGPYGL PTPARRALFIF
Sbjct  66    GTRVAVAYQNEAKLLGQMLYYMLTTGAGKQTLGEEYCDITQVAGPYGLSPTPARRALFIF  125

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQ+AVPY+AERVSSR+AS+GITL D     Y F     SS+  EAS   EI SSSTS   
Sbjct  126   YQSAVPYIAERVSSRVASRGITLTDSM-AGYIFGDVRTSSNEAEASATVEIQSSSTSTPS  184

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LSR K KIR+ WL+AV+RWPSVLPLARE+LQLVIR NLMFFYFEG YYH+SKRA+GI
Sbjct  185   ISALSRLKAKIRDFWLYAVRRWPSVLPLAREVLQLVIRTNLMFFYFEGFYYHISKRAAGI  244

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             RYVFIGKP NQRPRYQILG FLL+QLCI  A    RRSSLSSI+AS QQ PFGTYQTS+
Sbjct  245   RYVFIGKPMNQRPRYQILGVFLLIQLCI-LAAEGLRRSSLSSISASVQQAPFGTYQTST  302


 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MGL EP+R S N   SS+         G V+ FPLA QPEIMRAAEKD+QY  FVYEACR
Sbjct  1    MGLEEPARISANVGNSSDG--GGASTSGSVKRFPLAAQPEIMRAAEKDDQYASFVYEACR  58

Query  209  DAFRHLFGSYFSINLFFFAKLWPSFTFLFL  298
            DAFRHLFG+  ++     AKL     +  L
Sbjct  59   DAFRHLFGTRVAVAYQNEAKLLGQMLYYML  88



>ref|XP_008797564.1| PREDICTED: peroxisome biogenesis factor 10 isoform X3 [Phoenix 
dactylifera]
Length=366

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 235/338 (70%), Gaps = 39/338 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQ+E                              +A  +GLPPTPARRALFI 
Sbjct  64    GTRIAVAYQSE------------------------------IASSHGLPPTPARRALFIV  93

Query  486   YQTAVPYLAERVSS-RIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsR  659
             Y+T +PY+AER+SS R+A++GI L D  F + Y       +  +   +  S  ++S    
Sbjct  94    YETIIPYVAERISSSRMAARGIILADSQFGELYGSDHPRRNQVQSSDAAESSTSTSVPI-  152

Query  660   AHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
                S LS+F+ ++   WL AVQ+WP+VLP AREILQL +R NLMFFYFEGLYYH+SKRA+
Sbjct  153   ---SALSKFRERLHGLWLQAVQKWPTVLPYAREILQLALRTNLMFFYFEGLYYHISKRAA  209

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GIRYVFIGKP NQRPRYQILG FLL+QLCIL AEGLRR +  S  ++  Q +P G++Q+S
Sbjct  210   GIRYVFIGKPLNQRPRYQILGVFLLIQLCILGAEGLRRSNLSSITSSVHQTSP-GSHQSS  268

Query  1020  SGRGVPVLNEEGNLITAVS-EKGs-fvsepsstsesqasglskcslclssRQHPTATPCG  1193
             +G G+PVLNE+GN +T  S +KGS      ++     + G+SKC+LCLS+RQHPTATPCG
Sbjct  269   TGPGLPVLNEDGNPVTNYSPDKGSWAADSLAAPEPQGSGGMSKCTLCLSTRQHPTATPCG  328

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             HVFCWNCIMEWCNEKPECPLCR+P THSSLVC+YH+DF
Sbjct  329   HVFCWNCIMEWCNEKPECPLCRNPITHSSLVCIYHADF  366


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y  FV++ACRDAFRHLFG+  ++
Sbjct  27   RRFPAAAQPEIMRAAEKDDHYAAFVHDACRDAFRHLFGTRIAV  69



>gb|EYU20306.1| hypothetical protein MIMGU_mgv1a024770mg, partial [Erythranthe 
guttata]
Length=280

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 196/256 (77%), Gaps = 12/256 (5%)
 Frame = +3

Query  315   VAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQT  494
             VAVAYQ+ETKLL QMLY++LTTGAGKQTLGEEYCD TQVA P+GLPPTPARR+LFI YQT
Sbjct  24    VAVAYQSETKLLRQMLYYVLTTGAGKQTLGEEYCDITQVARPHGLPPTPARRSLFIVYQT  83

Query  495   AVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSV  674
             A PY+AER+SSRIAS GIT+DD   D              E ++  +I SS+ S A  S 
Sbjct  84    AFPYIAERISSRIASLGITMDDSLSDE-----------ITENTSNIQIQSSANSGARVSA  132

Query  675   LSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYV  854
             LSR K++    WL+AVQRWPS++P+ARE   L++R NLMFFYFEGL+YHLSKRA+ +RYV
Sbjct  133   LSRLKSRFSGLWLYAVQRWPSMVPIAREFFTLILRTNLMFFYFEGLFYHLSKRAARVRYV  192

Query  855   FIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGV  1034
             FIGKP NQRPRYQILG FLLVQLCI  A    RRS+LSS+A S QQT  GTYQTS GRG+
Sbjct  193   FIGKPNNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSLATSFQQTSLGTYQTSGGRGL  251

Query  1035  PVLNEEGNLITAVSEK  1082
             PVLNEEG+L    S K
Sbjct  252   PVLNEEGSLAADDSGK  267



>ref|XP_002516124.1| peroxisome assembly protein, putative [Ricinus communis]
 gb|EEF46126.1| peroxisome assembly protein, putative [Ricinus communis]
Length=358

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/260 (65%), Positives = 210/260 (81%), Gaps = 5/260 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD TQV+GP+GLPPTPARRALFI 
Sbjct  80    GTRLAVAYQSETKLLGQMLYYVLTTGSGQQTLGEEYCDITQVSGPHGLPPTPARRALFIL  139

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GITL D   D  P++  +  S  +++S   ++ S+S S A 
Sbjct  140   YQTAVPYMAERISSRVASRGITLADSIPDE-PYTNTATESRGIQSSVMVDLPSTSGSGA-  197

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S+++R +      WL AV+RWP+VLP+ARE LQL++R NLMFFYFEGLYYH+SKRA+GI
Sbjct  198   -SIVTRLRQNFSGLWLTAVRRWPTVLPVAREFLQLILRTNLMFFYFEGLYYHISKRAAGI  256

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP+NQRPRYQILG FLL+QLC+  A    RRS+LSS+A+S  QT    +Q SSG
Sbjct  257   RYVFIGKPSNQRPRYQILGVFLLIQLCV-IAAEGLRRSNLSSLASSVHQTSLEPHQ-SSG  314

Query  1026  RGVPVLNEEGNLITAVSEKG  1085
             RG+PVLNEEGNLI   + +G
Sbjct  315   RGLPVLNEEGNLIATEAGRG  334


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +2

Query  20   G*EMGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYE  199
            G +MG+   + ESG+    SE V S+      +R FP A QPEIMRAAEKD+QY  FVY+
Sbjct  16   GADMGITR-NTESGSG---SEGVQSAANNE--LRRFPPAAQPEIMRAAEKDDQYASFVYD  69

Query  200  ACRDAFRHLFGSYFSI  247
            ACRDAFRHLFG+  ++
Sbjct  70   ACRDAFRHLFGTRLAV  85



>gb|KDO78695.1| hypothetical protein CISIN_1g017241mg [Citrus sinensis]
 gb|KDO78696.1| hypothetical protein CISIN_1g017241mg [Citrus sinensis]
Length=322

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 202/260 (78%), Gaps = 3/260 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKL+GQMLY++LTTG+G+QTLGEEYCD TQV GP  LPPTPARRALFI 
Sbjct  44    GTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIV  103

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AER+SSR+AS+GI L +   D +     +  SSR ++    E  SSS  R +
Sbjct  104   YQTAVPYIAERISSRVASRGIALAESQSDEFD-RYNAAGSSRDQSLETIESPSSSAPRVY  162

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +SR K K+    L+ ++RWP VLP+ RE LQLV+RANLMFFYFEGLYYH+SKR +GI
Sbjct  163   -SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGI  221

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKPTNQRPRYQILG FLL+QLCI  A    RRS+LSSIA+S   T  G  Q S+G
Sbjct  222   RYVFIGKPTNQRPRYQILGVFLLIQLCI-IAAEGLRRSNLSSIASSVHHTSLGFQQASTG  280

Query  1026  RGVPVLNEEGNLITAVSEKG  1085
             RG+PVLNEEG+LI + S+KG
Sbjct  281   RGLPVLNEEGSLIPSESDKG  300


 Score = 70.1 bits (170),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
             R FP A QPEIMRAAEKDEQY  F+Y+ACRDAFR LFG+  ++
Sbjct  6    TRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAV  49



>dbj|BAG87060.1| unnamed protein product [Oryza sativa Japonica Group]
Length=357

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 221/302 (73%), Gaps = 7/302 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  63    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILFIL  122

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI ++GI L+D   D +  S +S   +  + S      S S S +H
Sbjct  123   YQTTVPYLAERISSRIVARGIALEDSQLDDHSESDSSSIGTAAQPSPIRNSPSRSLSFSH  182

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                LSR + ++   W   +++WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+GI
Sbjct  183   ---LSRLRGRVHTLWEWVLRKWPSMLPFAQDFIQLTIRTNLMFFYFEGLYYHLPKRAAGI  239

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  +  ++  Q +  G Y +S G
Sbjct  240   RYVFIGKPLNQRPRYQILGIFLLIQLCILGAERLRRSNLSTIASSINQISS-GGYPSSRG  298

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
             RGVPVLNE+GN+I+ +       +   +TS   +SG SKC+LCLS+RQ+PTAT CGHVFC
Sbjct  299   RGVPVLNEDGNIISDIRHG---KTADLATSSEASSGKSKCTLCLSTRQNPTATTCGHVFC  355

Query  1206  WN  1211
             W+
Sbjct  356   WS  357


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y   V EACRDAFRHLFG+  ++
Sbjct  26   RRFPEAAQPEIMRAAEKDDGYAAHVTEACRDAFRHLFGTRVAV  68



>ref|XP_006849636.1| hypothetical protein AMTR_s00024p00220620 [Amborella trichopoda]
 gb|ERN11217.1| hypothetical protein AMTR_s00024p00220620 [Amborella trichopoda]
Length=369

 Score =   291 bits (745),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 221/311 (71%), Gaps = 14/311 (5%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRV++A+QNETKLLGQMLY++LTTG+G+QTLGEEYCD TQV+   GLPPTPARR LF+ 
Sbjct  62    GTRVSIAFQNETKLLGQMLYYVLTTGSGQQTLGEEYCDLTQVSSSSGLPPTPARRVLFVV  121

Query  486   YQTAVPYLAERVSSRIASQGITL-----DDPFDDSYPFsvasesssrveastaseiasss  650
               +AVPYLAER+SSR A++G+ L     ++ +D+ +P      SS    + ++      S
Sbjct  122   LHSAVPYLAERISSRAAARGMLLANSQPEELYDNYHPGRGEGHSSGTSGSYSSLPGTGES  181

Query  651   tsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSK  830
               R         + KIR  WL A+++WPSVLP ARE+ QLV+RANLM FYFEGLYYH+SK
Sbjct  182   VIRPLG-----MRDKIRLLWLRALEKWPSVLPFAREVSQLVLRANLMLFYFEGLYYHMSK  236

Query  831   RASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTY  1010
             RA+GIRYVFIGKP +QRPRYQILG FLL+QLCI+  EGLRR S  S   +   QT  G+ 
Sbjct  237   RAAGIRYVFIGKPLHQRPRYQILGVFLLIQLCIIGFEGLRRSSLSSIANSV--QTSLGSQ  294

Query  1011  QTSSGRGVPVLNEEGNLITAV-SEKGs-fvsepsstsesqasglskcslclssRQHPTAT  1184
              T +G+G+PVLNE+G+LI+ + + KG       +     ++   SKC+LCLS RQ+PTAT
Sbjct  295   PTPTGQGMPVLNEDGSLISDLGAGKGDWTSHAATVPESQKSGNFSKCTLCLSPRQNPTAT  354

Query  1185  PCGHVFCWNCI  1217
             PCGHVFCW C+
Sbjct  355   PCGHVFCWACV  365


 Score = 72.4 bits (176),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            V  FPLA QPEIMRAAEKD+ Y  +VY+ACRDAFRHLFG+  SI
Sbjct  24   VVGFPLAAQPEIMRAAEKDDHYASYVYDACRDAFRHLFGTRVSI  67



>emb|CAN71793.1| hypothetical protein VITISV_022107 [Vitis vinifera]
Length=1334

 Score =   285 bits (729),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 192/239 (80%), Gaps = 2/239 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD TQVAGPYGL PTPARRALFI 
Sbjct  70    GTRVAVAYQSETKLLGQMLYYILTTGSGQQTLGEEYCDITQVAGPYGLSPTPARRALFIL  129

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+AERVSSR+A++GI + D   D   +      SS+V++S  +EI SSS S A 
Sbjct  130   YQTAVPYIAERVSSRVAARGIAIADAQADEL-YGNNVPGSSQVQSSAITEIPSSSASGAS  188

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SVLSR K K    WL+AVQRWP VLPLARE LQLV+R NLMFFYFEGLYYH+SKRA+GI
Sbjct  189   LSVLSRLKEKFNRSWLYAVQRWPVVLPLAREFLQLVLRTNLMFFYFEGLYYHISKRAAGI  248

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSS  1022
             RYVFIGK  NQRPRYQILG FLL+QLCI  A    RR +LSSIA+S  +TP G +QT++
Sbjct  249   RYVFIGKSLNQRPRYQILGVFLLIQLCI-IAAEGLRRRNLSSIASSVHRTPLGAHQTAT  306


 Score = 75.1 bits (183),  Expect(2) = 7e-90, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 48/84 (57%), Gaps = 20/84 (24%)
 Frame = +2

Query  29   MGLGEP-----------SRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDE  175
            MGLG P           + E G  TA+            G R FPLA QPEIMRAAEKD+
Sbjct  1    MGLGRPETSGSVDPRDTTGEVGRTTAAEPS---------GSRRFPLAAQPEIMRAAEKDD  51

Query  176  QYTFFVYEACRDAFRHLFGSYFSI  247
            QY   VYEACRDAFRHLFG+  ++
Sbjct  52   QYASHVYEACRDAFRHLFGTRVAV  75



>ref|XP_001777562.1| predicted protein [Physcomitrella patens]
 gb|EDQ57605.1| predicted protein [Physcomitrella patens]
Length=392

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 220/336 (65%), Gaps = 7/336 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+AVAYQNETKL G++LY+LLTTGAG QTLGEEYCD +QVA    LP TPARR L +F
Sbjct  62    GTRLAVAYQNETKLAGRVLYYLLTTGAGLQTLGEEYCDISQVAVNSKLPATPARRTLLVF  121

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT +PYL ER+S+R A++G  L +  +           +    +    E    S  R+ 
Sbjct  122   YQTVLPYLTERLSARAAARGNALANAEE-----LRGIGFTQESTSEIGGEDIVLSQRRSI  176

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
               +   +  ++ + +  A+Q+WP++LP  +E L LV+RA+LM FYFEG+YYHL+KR +GI
Sbjct  177   IQIWQSWSQRMSQRYNAALQQWPTILPSVKEALLLVLRAHLMLFYFEGVYYHLAKRFAGI  236

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             +Y+F+GKP  QRPRY +LG FLL+QL I+  + LRR    +   +   +    +  +S  
Sbjct  237   QYIFMGKPAQQRPRYHMLGMFLLIQLSIVGGDWLRRSVLPALATSMRSRIRDPSAVSSGR  296

Query  1026  RGVPVLNEEG--NLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             + + +L+ +G       +   G   +  ++T +++  G  KC LCLS RQHPTATPCGHV
Sbjct  297   QSIAILDVDGTNTFKKEMKSVGDDWTLAANTGDAEGGGRRKCPLCLSPRQHPTATPCGHV  356

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCWNC+ EWCNEKPECPLCRSP TH  LVCLYH+DF
Sbjct  357   FCWNCVAEWCNEKPECPLCRSPVTHPQLVCLYHTDF  392



>ref|XP_006294686.1| hypothetical protein CARUB_v10023723mg [Capsella rubella]
 gb|EOA27584.1| hypothetical protein CARUB_v10023723mg [Capsella rubella]
Length=301

 Score =   277 bits (708),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 186/238 (78%), Gaps = 3/238 (1%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+A+AYQ E KLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL PTPARRALFI 
Sbjct  61    GTRIALAYQKEMKLLGQMLYYVLTTGSGQQTLGEEYCDIIQVSGPYGLSPTPARRALFIL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQTAVPY+ ER+S+R A+Q +T D+   D +    + ES S  ++ +  +++SSS     
Sbjct  121   YQTAVPYIVERISTRAATQAVTFDE--SDEFFGGSSRESGSHDQSLSMIDLSSSSQLETS  178

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              SV+SR K +++  W  A+QRWP VLP+ARE+LQLV+RANLM FYFEGLYYH+SKRASGI
Sbjct  179   ASVVSRLKDRVKRFWHRAIQRWPVVLPVAREVLQLVLRANLMLFYFEGLYYHISKRASGI  238

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVFIGK  NQRPRYQILG FLLVQLCI  A    RRS+LSSIA+S QQ   G+YQTS
Sbjct  239   RYVFIGKQLNQRPRYQILGVFLLVQLCI-LAAEGLRRSNLSSIASSVQQASIGSYQTS  295


 Score = 74.3 bits (181),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            +R FPLA QPE+MRAAEKD+QY  F++EACRDAFRHLFG+  ++
Sbjct  23   IRQFPLAAQPEVMRAAEKDDQYASFIHEACRDAFRHLFGTRIAL  66



>emb|CDY11455.1| BnaA09g40210D [Brassica napus]
Length=245

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 187/262 (71%), Gaps = 25/262 (10%)
 Frame = +3

Query  522   SSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSRFKTKIR  701
             SSR A+Q  T D+  DD  P                          +  SVL+RFK +++
Sbjct  9     SSRAATQAFTFDE--DDQSP-------------------RMVDLPSSASSVLTRFKDRVQ  47

Query  702   ECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQR  881
               W  A++RWP VLP+ARE+LQ+++RANLM FYFEGLYYH+SKRASG+RYVFIGK  NQR
Sbjct  48    RLWHRAIRRWPVVLPVAREVLQVLLRANLMLFYFEGLYYHISKRASGVRYVFIGKQLNQR  107

Query  882   PRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNL  1061
             PRYQILG FLL+QLCI  A    RRS+LSSI +S QQ   G+YQTS GRG+PVLNEEGNL
Sbjct  108   PRYQILGVFLLIQLCI-LAAEGLRRSNLSSITSSVQQASLGSYQTSGGRGLPVLNEEGNL  166

Query  1062  ITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKP  1241
             IT  +EKG   +   S + S    + KC+LCLSSRQHPTATPCGHVFCW+CIMEWCNEK 
Sbjct  167   ITPEAEKG---NWSPSDATSTTEAVGKCTLCLSSRQHPTATPCGHVFCWSCIMEWCNEKQ  223

Query  1242  ECPLCRSPATHSSLVCLYHSDF  1307
             ECPLCR+P THSSLVCLY+SDF
Sbjct  224   ECPLCRTPNTHSSLVCLYNSDF  245



>ref|XP_004172556.1| PREDICTED: peroxisome biogenesis factor 10-like, partial [Cucumis 
sativus]
Length=302

 Score =   270 bits (690),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 156/208 (75%), Gaps = 2/208 (1%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+AVAYQ+ETKLLGQMLY++LTTG+G+QTLGEEYCD  QV+GPYGL P PARRALFI 
Sbjct  67   GARLAVAYQSETKLLGQMLYYVLTTGSGQQTLGEEYCDINQVSGPYGLSPNPARRALFIV  126

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
            YQTAVPY+AER+SSR+AS+GI L D   D   F     S      S  +     S++   
Sbjct  127  YQTAVPYIAERISSRVASRGIMLADSLSDE--FYGEIASGDASSQSLLTMEIQPSSTPGS  184

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             S   R + KI   WL  V+ WPSVLPL RE LQL +R NLMFFYFEGLYYH+SKRA+GI
Sbjct  185  ASYTMRLRAKISRLWLRTVRCWPSVLPLVREFLQLALRTNLMFFYFEGLYYHISKRAAGI  244

Query  846  RYVFIGKPTNQRPRYQILGFFLLVQLCI  929
            RYVFIGKP+NQRPRYQILG FLL+QLCI
Sbjct  245  RYVFIGKPSNQRPRYQILGVFLLIQLCI  272


 Score = 72.8 bits (177),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            FPLA QPEIMRAAEKD+QY  FVY+ACRDAFRHLFG+  ++
Sbjct  32   FPLAAQPEIMRAAEKDDQYASFVYDACRDAFRHLFGARLAV  72



>ref|XP_008667601.1| PREDICTED: LOC100274236 isoform X2 [Zea mays]
Length=361

 Score =   274 bits (700),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 189/256 (74%), Gaps = 5/256 (2%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  62    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATLHGLPPTPARRILFIL  121

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI ++ I L++   D +P S  S S      + +   + S +    
Sbjct  122   YQTTVPYLAERISSRIVARSIVLNESQFDDHPESDNSSSDIAQSTTNSDIPSRSLSV---  178

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S LS F+ ++   W   +Q+WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+GI
Sbjct  179   -SALSGFRGRVHALWQWVLQKWPSMLPYAQDFIQLAIRTNLMFFYFEGLYYHLPKRAAGI  237

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G Y +++G
Sbjct  238   RYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQIS-SGGYPSTTG  296

Query  1026  RGVPVLNEEGNLITAV  1073
             RG+PVLNE+GN+I+ +
Sbjct  297   RGIPVLNEDGNIISDI  312


 Score = 68.2 bits (165),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +2

Query  38   GEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAF  217
            G P+ ++G ++ +  +  +        R FP A QPEIMRAAEKD+ Y   V EACRDAF
Sbjct  4    GAPTGDAGPSSGAGSNPPTRP------RRFPGAAQPEIMRAAEKDDSYAAHVTEACRDAF  57

Query  218  RHLFGSYFSI  247
            RHLFG+  ++
Sbjct  58   RHLFGTRVAV  67



>gb|AAK55784.1|AC079038_18 Putative zinc-binding peroxisomal integral membrane protein [Oryza 
sativa]
Length=382

 Score =   265 bits (677),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 175/256 (68%), Gaps = 26/256 (10%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTRVAVAYQNE KLLGQ LY+LLTTG+G+QTLGEEYCD +QVA  +GLPPTPARR LFI 
Sbjct  63    GTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILFIL  122

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             YQT VPYLAER+SSRI ++GI L+D   D +  S +S   +  + S      S S S +H
Sbjct  123   YQTTVPYLAERISSRIVARGIALEDSQLDDHSESDSSSIGTAAQPSPIRNSPSRSLSFSH  182

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                LSR + ++   W   +++WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+GI
Sbjct  183   ---LSRLRGRVHTLWEWVLRKWPSMLPFAQDFIQLTIRTNLMFFYFEGLYYHLPKRAAGI  239

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVFIGKP NQRPRYQILG FLL+QLCI                        G  +    
Sbjct  240   RYVFIGKPLNQRPRYQILGIFLLIQLCI-----------------------LGAERLRRS  276

Query  1026  RGVPVLNEEGNLITAV  1073
             RGVPVLNE+GN+I+ +
Sbjct  277   RGVPVLNEDGNIISDI  292


 Score = 65.5 bits (158),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            R FP A QPEIMRAAEKD+ Y   V EACRDAFRHLFG+  ++
Sbjct  26   RRFPEAAQPEIMRAAEKDDGYAAHVTEACRDAFRHLFGTRVAV  68



>gb|ACR35189.1| unknown [Zea mays]
Length=232

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 166/216 (77%), Gaps = 6/216 (3%)
 Frame = +3

Query  666   PSVL--SRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
             P++L  S F+ ++   W   +Q+WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+
Sbjct  21    PTLLNGSGFRGRVHALWQWVLQKWPSMLPYAQDFIQLAIRTNLMFFYFEGLYYHLPKRAA  80

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GIRYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G Y ++
Sbjct  81    GIRYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQIS-SGGYPST  139

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             +GRG+PVLNE+GN+I+ +       +   ++    ++G SKC+LCLS RQ+PTAT CGHV
Sbjct  140   TGRGIPVLNEDGNIISDIRSG---KAADIASHSETSNGKSKCTLCLSIRQNPTATTCGHV  196

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCWNCIMEWCNEKPECPLCR+P THSSL+C+YHSDF
Sbjct  197   FCWNCIMEWCNEKPECPLCRTPITHSSLICIYHSDF  232



>gb|EPS69235.1| hypothetical protein M569_05532, partial [Genlisea aurea]
Length=231

 Score =   188 bits (478),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            GTRVAV YQ ETKLLGQMLY++LTTGAG QTLGEEYCD  QV+GPY LPPTPARR+LFIF
Sbjct  65   GTRVAVDYQGETKLLGQMLYYVLTTGAGMQTLGEEYCDINQVSGPYTLPPTPARRSLFIF  124

Query  486  YQTAVPYLAERVSSRIASQGITL-DDPFDDSYPFsvasesssrveastaseiassstsRA  662
            YQTA PY+AER+S+R++SQG+TL D P DD       +    +   S    +     SR 
Sbjct  125  YQTAFPYIAERISARLSSQGVTLSDSPPDDIARSEPTATIQPQSSTSNRGSLPLHLNSRF  184

Query  663  HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEG  809
                LSR K ++    LH+++RWPS+LP ARE   L++R NLMFFYFEG
Sbjct  185  L--FLSRLKARVATLCLHSIRRWPSMLPSAREFFTLLLRTNLMFFYFEG  231


 Score = 78.2 bits (191),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  116  VRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSIN  250
            VR FPLA QPEIMRAAEKD+QY  FVYEACRDAFRHLFG+  +++
Sbjct  27   VRPFPLAAQPEIMRAAEKDDQYASFVYEACRDAFRHLFGTRVAVD  71



>ref|XP_005650096.1| hypothetical protein COCSUDRAFT_46761 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25552.1| hypothetical protein COCSUDRAFT_46761 [Coccomyxa subellipsoidea 
C-169]
Length=388

 Score =   194 bits (493),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 176/336 (52%), Gaps = 10/336 (3%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A+ Y  E KL+ ++LY  LTTG G QTLGEEYCD  QVAGP G+ P+ ARR L + 
Sbjct  61    GPRQALKYSREVKLVAELLYAGLTTGVGLQTLGEEYCDIIQVAGPVGVAPSVARRTLLVL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
              +   PYLAE +S   A+ G T D     S   +    + S           +S+     
Sbjct  121   LEKMAPYLAEHLSH--AAIGGT-DGALGTSSAETPRFATDSPPSREDPRPSGASAEGEGS  177

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + +  +    R+  +    +W     +      + +R +L  FYF G+YYH +KRA+G 
Sbjct  178   WNRVGAWAAAARQEAVSIAFKWRPAWAVLASYAPVAVRLHLALFYFYGVYYHWAKRATGT  237

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaa--eglrrrsslssiaasaQQTPFGTYQTS  1019
             RY+F+GK   +RP Y +LG  L VQL I A         +SL   A   +    G + + 
Sbjct  238   RYIFVGKLFERRPSYHLLGVLLFVQLGISAGSWALSNLTASLGQTAGLDRNADVGAHTSK  297

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             + R   VL + G+      E     +  ++    +     KC+LCL +R  PTATPCGHV
Sbjct  298   AMRAAVVLQDFGD-----GEMAPMEAMATAGDVGEVPPHKKCALCLGARTSPTATPCGHV  352

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCW CI +W N+KPECPLCRSP T S LVC+Y+SDF
Sbjct  353   FCWQCIADWHNQKPECPLCRSPFTTSGLVCVYNSDF  388


 Score = 49.3 bits (116),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  119  RSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFG  232
            R FP+A QP+I+RAA+KDE Y   + +AC DA R L G
Sbjct  24   RLFPVAAQPDIVRAAQKDESYLQHLTDACHDAVRRLLG  61



>gb|EPS67997.1| peroxisome biogenesis factor 10, partial [Genlisea aurea]
Length=177

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 129/171 (75%), Gaps = 4/171 (2%)
 Frame = +3

Query  795   FYFEGLYYHLSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssi  974
              +  GLYYHLSKRA+GIRYV+IGKP+NQRPRYQILG FLLVQLC++AAEGLRR    S  
Sbjct  11    MFSAGLYYHLSKRAAGIRYVYIGKPSNQRPRYQILGVFLLVQLCVIAAEGLRRSGLSSVA  70

Query  975   aasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslc  1154
             A+  Q +    YQ  +G G PVL+++GN I   S+K   +S  S +  S  S + KC+LC
Sbjct  71    ASFQQASAA-AYQHRTGGGFPVLDKDGNPIDDESDK---ISGISESFTSSTSNVRKCTLC  126

Query  1155  lssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             L +R+HPTATPCGHVFCWNCIMEWCNEKPECPLCRSP  HS LVCLYHS F
Sbjct  127   LGNRRHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPVAHSRLVCLYHSGF  177



>emb|CDY70898.1| BnaAnng35490D, partial [Brassica napus]
Length=155

 Score =   143 bits (360),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 2/92 (2%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            GTR+A+AYQ E KL+GQMLYF+LTTG+G+QTLGEEYCD  QVAGPYGL PTPARRALFI 
Sbjct  64   GTRIALAYQKEMKLVGQMLYFVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFIL  123

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYP  581
            YQTAVPY+AER+SSR A+Q  T D+  DD  P
Sbjct  124  YQTAVPYIAERISSRAATQAFTFDE--DDQSP  153


 Score = 77.4 bits (189),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  56   SGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SG  ++   D   S G  GG+R FPLA QPEIMRAAEKD+QY  F++EACRDAFRHLFG+
Sbjct  6    SGGDSSPGPDEPGSSGTHGGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGT  65

Query  236  YFSI  247
              ++
Sbjct  66   RIAL  69



>ref|XP_005850473.1| hypothetical protein CHLNCDRAFT_16970, partial [Chlorella variabilis]
 gb|EFN58371.1| hypothetical protein CHLNCDRAFT_16970, partial [Chlorella variabilis]
Length=369

 Score =   173 bits (439),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 126/348 (36%), Positives = 181/348 (52%), Gaps = 28/348 (8%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G   A+ +  ET+ L ++LY+ LTTG G QT GEEYCD  QVAG  G PP   RR L + 
Sbjct  36    GPHRALRWAGETRALAELLYYSLTTGTGLQTPGEEYCDVLQVAGTAGAPPGAMRRGLLVV  95

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssr-veastaseiassstsRA  662
               +  PYLA+R+++           P DD +     +++ +     + A +     T   
Sbjct  96    LHSLGPYLADRLAA-----------PEDDGFAAWQQAQADAHPNATAVALQHHEQQTVTT  144

Query  663   HPSVLSRFKTKIRECWLHAVQRWP----SVLPLAREILQL----VIRANLMFFYFEGLYY  818
               ++L R  +  R+    AVQR      + LP A   L++    V+R +L  FY  GLYY
Sbjct  145   GAALLQRLASAGRQV-AGAVQRASQPVTTHLPAATAFLKVHGTTVMRIHLALFYMYGLYY  203

Query  819   HLSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTP  998
                KR +G+RY+F+G+    RP Y+ LG  L+ QL I     L RR        ++ +  
Sbjct  204   QPVKRVAGVRYLFLGRAFEGRPSYRFLGVLLVAQLGISGLLWLLRRHGGPLQLWASPRAE  263

Query  999   FGTYQTSSGRGVPVLNEEG----NLITAVSE-KGsfvsepsstsesqasglskcslclss  1163
               T +  +  G+    E+G    N I A++   G      +  + ++     KC LCLS+
Sbjct  264   DATARRQAHAGLQA--EDGKPLPNTIAALAGGSGRPTGSATGDASTEVPSRRKCPLCLSA  321

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             R HPTATPCGH+FCW CI +WCN+KPECPLCR+    S LVC+ H+DF
Sbjct  322   RAHPTATPCGHIFCWQCITDWCNQKPECPLCRADFNPSWLVCVRHADF  369


 Score = 39.7 bits (91),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSI  247
            FP A QP ++RA +KDE Y   + + C D  R + G + ++
Sbjct  1    FPAAAQPNLIRAQQKDELYLQHLTDGCHDVVRRVLGPHRAL  41



>tpg|DAA41415.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=199

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 134/183 (73%), Gaps = 6/183 (3%)
 Frame = +3

Query  666   PSVL--SRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
             P++L  S F+ ++   W   +Q+WPS+LP A++ +QL IR NLMFFYFEGLYYHL KRA+
Sbjct  21    PTLLNGSGFRGRVHALWQWVLQKWPSMLPYAQDFIQLAIRTNLMFFYFEGLYYHLPKRAA  80

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GIRYVFIGKP NQRPRYQILG FLL+QLCIL AE LRR +  S  ++  Q +  G Y ++
Sbjct  81    GIRYVFIGKPMNQRPRYQILGIFLLIQLCILGAERLRRSNISSIASSINQISS-GGYPST  139

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             +GRG+PVLNE+GN+I+ +       +   ++    ++G SKC+LCLS RQ+PTAT CGHV
Sbjct  140   TGRGIPVLNEDGNIISDIRSG---KAADIASHSETSNGKSKCTLCLSIRQNPTATTCGHV  196

Query  1200  FCW  1208
             FCW
Sbjct  197   FCW  199



>gb|EMT01296.1| Peroxisome biogenesis factor 10 [Aegilops tauschii]
Length=277

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 151/237 (64%), Gaps = 14/237 (6%)
 Frame = +3

Query  525   SRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSRFKTKIRE  704
             SRI S+GI +DD   D++  S          ++  +E + S +     S+LSR ++K   
Sbjct  12    SRIVSRGIYMDDSQLDNHHESDNPSRGITESSTNTNESSRSLSF----SMLSRLRSKAHA  67

Query  705   CWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRP  884
              WL  VQ+WPS+LPL ++ +QL IR NLMFFYFEGLYYH SKR +GI YVFIGKP NQRP
Sbjct  68    FWLWVVQKWPSMLPLGQDFIQLAIRTNLMFFYFEGLYYHFSKRGAGIHYVFIGKPMNQRP  127

Query  885   RYQILGFF----LLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEE  1052
             R +IL       L +QLCIL AE LRR +  S  ++  Q +  G+Y +S+GR VPV+NE+
Sbjct  128   RSKILQMIKFNSLHLQLCILGAERLRRSNLSSIASSINQISS-GSYPSSTGRSVPVVNED  186

Query  1053  GNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIME  1223
             GN+I+ +       +   ++    +S  SKC+LCLS+RQ+PTAT CGHVFC  C+ E
Sbjct  187   GNIISDIRHG---KAVDLASGSEASSSKSKCTLCLSTRQNPTATTCGHVFC--CVEE  238



>ref|XP_003588929.1| Peroxisome biogenesis factor [Medicago truncatula]
Length=411

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 113/180 (63%), Gaps = 32/180 (18%)
 Frame = +3

Query  429  VAGPYGLPPTPARRALFIFYQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesss  608
            VAG YGLPPTPARRALFI YQ+A+PY+AER+SSRIAS+GI L D ++ +  +   +  SS
Sbjct  200  VAGSYGLPPTPARRALFIVYQSAIPYIAERISSRIASRGIILSD-YESAEIYGENAHGSS  258

Query  609  rveastaseiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANL  788
                S  S  ++S  S    S L R K K+   WLH VQRWP++LP  RE+LQL++RANL
Sbjct  259  SSRVSEISPASASGQS---TSTLMRLKHKLGGFWLHMVQRWPTMLPFVRELLQLLLRANL  315

Query  789  MFFYFEG----------------------------LYYHLSKRASGIRYVFIGKPTNQRP  884
            M FYFEG                            LYYH+SKRA+GIRYVFIGK +NQRP
Sbjct  316  MLFYFEGDPLLNTLIVVIRHVKESFLNLAIISSVGLYYHISKRAAGIRYVFIGKASNQRP  375


 Score = 80.5 bits (197),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQ  428
            GTRVAVAYQNETKLLGQMLY++LTTG+G+QTLGEEYCD TQ
Sbjct  92   GTRVAVAYQNETKLLGQMLYYVLTTGSGQQTLGEEYCDITQ  132


 Score = 75.5 bits (184),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +2

Query  29   MGLGEPSRESGNATASSEDVgssggggggVRSFPLAQQPEIMRAAEKDEQYTFFVYEACR  208
            MG G   R +G+ + +  D   S       R FP A QPE+MRAAEKD+QY  FVYEACR
Sbjct  26   MGWGHLER-NGSDSVTDADAAPSTSTAPESRRFPPAAQPEMMRAAEKDDQYASFVYEACR  84

Query  209  DAFRHLFGSYFSI  247
            DAFRHLFG+  ++
Sbjct  85   DAFRHLFGTRVAV  97



>gb|EXX54766.1| ubiquitin-protein ligase peroxin 10 [Rhizophagus irregularis 
DAOM 197198w]
Length=348

 Score =   135 bits (339),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 147/334 (44%), Gaps = 64/334 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+   YQ E  ++  + YF LT   G QTLGEEYCD  Q++ P    P+ ++RA  IF
Sbjct  75    GTRLQHQYQKEVNVISDLFYFCLTALLGTQTLGEEYCDIMQISEPTKQFPSASKRATLIF  134

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             +    PYL  R  S +  +                            + + +   T + H
Sbjct  135   WHVIFPYLFTRGISELRKR-------------------------TKPSWKKSLQRTQQIH  169

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRA-NLMFFYFEGLYYHLSKRASG  842
              +   R +  I             +LP  + +L+  + + +L  FYF G YY +SKRA+G
Sbjct  170   NTKYDRLRDSIYR-----------LLPKLQILLKNNVHSVHLAIFYFYGAYYFISKRATG  218

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             IRY+F  +  P  QR  Y+ILGF L+VQ  I A    +     +        + F   + 
Sbjct  219   IRYIFTRQLGPHEQRIGYEILGFLLVVQFIIQAYRFQKSLIKGT------DDSLFNEVEE  272

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
                  + V + EG     ++ +   +                       R++ TATPCGH
Sbjct  273   EEESDLMVTSTEGLTPQEIAARKCILCLSP-------------------RKNTTATPCGH  313

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +FCW CI++ CN KPECPLCR     S L+ +Y+
Sbjct  314   LFCWTCIVDCCNNKPECPLCRQYVNISHLLPIYN  347


 Score = 36.2 bits (82),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 0/38 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SFP A QP+I+RA +KD  Y   + E   + FR  FG+
Sbjct  39   SFPYAAQPDIIRANQKDVYYQQILGEQMTNTFRMFFGT  76



>gb|ESA17673.1| hypothetical protein GLOINDRAFT_148218 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX54767.1| ubiquitin-protein ligase peroxin 10 [Rhizophagus irregularis 
DAOM 197198w]
Length=283

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 147/334 (44%), Gaps = 64/334 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+   YQ E  ++  + YF LT   G QTLGEEYCD  Q++ P    P+ ++RA  IF
Sbjct  10    GTRLQHQYQKEVNVISDLFYFCLTALLGTQTLGEEYCDIMQISEPTKQFPSASKRATLIF  69

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             +    PYL  R  S +  +                            + + +   T + H
Sbjct  70    WHVIFPYLFTRGISELRKR-------------------------TKPSWKKSLQRTQQIH  104

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRA-NLMFFYFEGLYYHLSKRASG  842
              +   R +  I             +LP  + +L+  + + +L  FYF G YY +SKRA+G
Sbjct  105   NTKYDRLRDSIYR-----------LLPKLQILLKNNVHSVHLAIFYFYGAYYFISKRATG  153

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             IRY+F  +  P  QR  Y+ILGF L+VQ  I A    +     +        + F   + 
Sbjct  154   IRYIFTRQLGPHEQRIGYEILGFLLVVQFIIQAYRFQKSLIKGT------DDSLFNEVEE  207

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
                  + V + EG     ++ +   +                       R++ TATPCGH
Sbjct  208   EEESDLMVTSTEGLTPQEIAARKCILCLSP-------------------RKNTTATPCGH  248

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +FCW CI++ CN KPECPLCR     S L+ +Y+
Sbjct  249   LFCWTCIVDCCNNKPECPLCRQYVNISHLLPIYN  282



>ref|XP_004173721.1| PREDICTED: peroxisome biogenesis factor 10-like [Cucumis sativus]
Length=196

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             +GRG+PVLNEEGNLI+   + G++VS+PS +  +  SG+SKC+LCLS+RQHPTATPCGHV
Sbjct  101   AGRGLPVLNEEGNLISVDGDSGNWVSDPSHSEFNTGSGISKCTLCLSNRQHPTATPCGHV  160

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             FCWNCIMEWCNEKPECPLCR+P  HSSLVCLYHSDF
Sbjct  161   FCWNCIMEWCNEKPECPLCRTPINHSSLVCLYHSDF  196



>gb|KFH64176.1| hypothetical protein MVEG_10001 [Mortierella verticillata NRRL 
6337]
Length=383

 Score =   124 bits (311),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 104/333 (31%), Positives = 152/333 (46%), Gaps = 39/333 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R    YQ E ++   + Y+ LTT  G QTLGEEYCD  Q+       P+  RR+  +F
Sbjct  83    GSRTQHMYQTEVEVFSDLCYYSLTTLLGMQTLGEEYCDIMQIRNSTNTFPSLPRRSALVF  142

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             +   VPYL  + S  +  +                  +   +       +   S   +  
Sbjct  143   WHVLVPYLYSKGSLELRKRA---------------RPQHHQQHRPGHRLDANLSEEPKKE  187

Query  666   PS-VLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
             PS  L R K  +   WL  +Q +      +         A+L  FYF G YY  SKR +G
Sbjct  188   PSQALVRLKGFVHN-WLPTLQNFFKTHGHS---------AHLAVFYFFGAYYSFSKRVTG  237

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             IRY+F  K  P  +R  Y++LG  +++QL I   +  R+ +  +    +++    G+   
Sbjct  238   IRYIFNRKLSPGEERSGYEVLGVLIVIQLVIQFYQWRRQVAVEAQEKKASELLVAGS---  294

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
                    VL E+ N      E+     E   T  +    + KC+LCL  R + TATPCGH
Sbjct  295   -------VLGEK-NTAVEEEEEEEEEMEDDFTQTTAEINVRKCTLCLDPRTNTTATPCGH  346

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLY  1295
             +FCW CI EWC  KPECPLCR     S+L+ +Y
Sbjct  347   LFCWTCIREWCQNKPECPLCRQHVQLSALLPIY  379


 Score = 38.5 bits (88),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            + P A QP+I+RA +KD  Y   + +  +DA R +FGS
Sbjct  47   ALPSASQPDIIRANQKDSYYQQILNDQVKDAVREIFGS  84



>ref|XP_011120479.1| hypothetical protein AOL_s00054g861 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50775.1| hypothetical protein AOL_s00054g861 [Arthrobotrys oligospora 
ATCC 24927]
Length=352

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 142/332 (43%), Gaps = 50/332 (15%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R+   +  E K+L  +LY  +TT  G +TLGEEYCD   V       P   +RA +I 
Sbjct  65    GARILHKFNTEAKVLADLLYLGITTLVGSRTLGEEYCDIVHVDADSRRLPHLFQRAGYII  124

Query  486   YQTAVPYLAERVSSRI-ASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRA  662
                 +PY+  + + ++ A   + LD                                +R 
Sbjct  125   SVVILPYITSKFAPKLRARMRMNLD-----------------------------RRAARR  155

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
               +  +     ++E +   + R       A  +    I  +L FFYF G YYH+SKR  G
Sbjct  156   ALTKTTNNDDSMKERFFRFLHRNLDAFTGAESL----IAVHLAFFYFTGAYYHVSKRIWG  211

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             ++Y+F  K  P  QR  Y++LG  LL+Q+ +     +    +          T     Q 
Sbjct  212   MKYIFTKKLQPHEQRVGYEVLGVLLLLQIVVQTYSKMSEYLA--------DGTEDQGVQG  263

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             S G   P      N+ T   E    +  P   +        KC+LCL + + PT TPCGH
Sbjct  264   SKGMVSP------NIATGDEEANVDLDNPEIMAFVNGEMARKCTLCLENMKDPTLTPCGH  317

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             +FCW CI EWC  KPECPLCR+ +    L+ L
Sbjct  318   MFCWTCITEWCRNKPECPLCRASSLPQHLLVL  349



>emb|CEJ02037.1| hypothetical protein RMCBS344292_16054 [Rhizopus microsporus]
Length=315

 Score =   121 bits (303),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 141/333 (42%), Gaps = 70/333 (21%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR    +Q E   L  + Y+ LTT  G QTLGEEYCD  Q+       P    RA  +F
Sbjct  50    GTRFQHLWQKEINTLSDVCYYSLTTLLGSQTLGEEYCDIVQINNSTLTYPRWMHRACLVF  109

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PY        I S+GIT                                     H
Sbjct  110   AHCLLPY--------IYSKGIT------------------------------ELKKRSRH  131

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                 SR K K       A+Q    +  +A + +Q +   +L  FYF G YY+ SKR +GI
Sbjct  132   EEEGSR-KEK-------AIQLLSKLHEIASKYIQPI---HLAIFYFIGAYYNFSKRMTGI  180

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RY+F  +     QR  Y++LG  + +QL I A   +R+                   +  
Sbjct  181   RYIFTRRLGAFEQRAGYEVLGALIFIQLGIQAFLAIRK-------------------RVE  221

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             + + V   +E+  ++                   +   L KC+LCL  RQ  T+TPCGH+
Sbjct  222   NNKQVNQDDEKQVIVAEDDFDFMDDIIEEKNLTYEELQLLKCALCLEKRQSTTSTPCGHL  281

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             FCWNCI+EWC  KPECPLCRS    S +  L++
Sbjct  282   FCWNCIIEWCENKPECPLCRSHVNISHVFPLHN  314


 Score = 33.9 bits (76),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYF  241
            SFP   QP+I+RA +KD  YT  + E      +   G+ F
Sbjct  14   SFPYGGQPDIIRANQKDIYYTTIIKEQLSTIIQQFLGTRF  53



>emb|CEG71493.1| hypothetical protein RMATCC62417_07217 [Rhizopus microsporus]
Length=314

 Score =   121 bits (304),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/333 (30%), Positives = 135/333 (41%), Gaps = 71/333 (21%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+   +Q E   L  + Y+ LTT  G QTLGEEYCD  Q+       P    RA  +F
Sbjct  50    GTRLQHLWQKEINTLSDVCYYSLTTLLGSQTLGEEYCDIVQINNSTLTYPRWMHRACLVF  109

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PY        I S+GIT                                     H
Sbjct  110   AHCLLPY--------IYSKGIT------------------------------ELKKRSRH  131

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                 SR K         AVQ    +   A + +Q +   +L  FYF G YY+ SKR +GI
Sbjct  132   EEEGSRKKK--------AVQLLSKLHETASKYIQPI---HLAIFYFIGAYYNFSKRMTGI  180

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RY+F  +     QR  Y++LG  + +QL I                    Q      +  
Sbjct  181   RYIFTRRLGAFEQRAGYEVLGALIFIQLGI--------------------QAFLAIRKRM  220

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
                 V   +E+  ++                   +   L KC+LCL  RQ  T+TPCGH+
Sbjct  221   ENNKVSQDDEKQVIVAEDDFDFMDDIIEEKDLTYEELQLLKCALCLEKRQSTTSTPCGHL  280

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             FCW+CI+EWC  KPECPLCRS    S +  L++
Sbjct  281   FCWSCIIEWCENKPECPLCRSHVNISHVFPLHN  313


 Score = 32.7 bits (73),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 20/38 (53%), Gaps = 0/38 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SFP   QP+I+RA +KD  YT  + E      +   G+
Sbjct  14   SFPYGGQPDIIRANQKDIYYTTIIKEQLSTIIQQFLGT  51



>emb|CEI88247.1| hypothetical protein RMCBS344292_02641 [Rhizopus microsporus]
Length=313

 Score =   120 bits (301),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 99/333 (30%), Positives = 136/333 (41%), Gaps = 72/333 (22%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR+   +Q E   L  + Y+ LTT  G QTLGEEYCD  Q+       P    RA  +F
Sbjct  50    GTRLQHLWQKEINTLSDVCYYSLTTLLGSQTLGEEYCDIVQINNSTLTYPRWMHRACLVF  109

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PY        I S+GIT                                   R+ 
Sbjct  110   AHCLLPY--------IYSKGIT-------------------------------ELKKRSR  130

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                 +R K         AVQ    +   A + +Q +   +L  FYF G YY+ SKR +GI
Sbjct  131   HEEGTRKKK--------AVQLLSKLHETASKYIQPI---HLAIFYFIGAYYNFSKRMTGI  179

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RY+F  +     QR  Y++LG  + +QL I                    Q      +  
Sbjct  180   RYIFTRRLGAFEQRAGYEVLGALIFIQLGI--------------------QAFLAIRKRM  219

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
                 V   +E+  ++                   +   L KC+LCL  RQ  T+TPCGH+
Sbjct  220   ENNKVSQDDEKQVIVAEDDFDFMDDIIEEKDLTYEELQLLKCALCLEKRQSTTSTPCGHL  279

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             FCW+CI+EWC  KPECPLCRS    S +  L++
Sbjct  280   FCWSCIIEWCENKPECPLCRSHVNISHVFPLHN  312


 Score = 32.7 bits (73),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 20/38 (53%), Gaps = 0/38 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            SFP   QP+I+RA +KD  YT  + E      +   G+
Sbjct  14   SFPYGGQPDIIRANQKDIYYTTIIKEQLSTIIQQFLGT  51



>ref|XP_009093943.1| PREDICTED: peroxisome biogenesis factor 10, partial [Serinus 
canaria]
Length=324

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 92/342 (27%), Positives = 139/342 (41%), Gaps = 67/342 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  +A++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  36    GARPWLAWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  95

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  + ++P    +P                     
Sbjct  96    LHTVVPYCLEKALLHLQHELQMEAEESRSPENPPALGFP---------------------  134

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ E      +R   V+ + ++ + L+ R +L  FY +G +YHL
Sbjct  135   -----SRSFIRSWIRRQVGELSEQQKKRASQVVDVLKQSIPLLHRLHLAVFYIQGTFYHL  189

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             + 
Sbjct  190   SKRVTGISYLHFGGLQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  249

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                 T+Q S  R       +      + E                            R+H
Sbjct  250   HRNLTHQKS--RSQEAAGRQSRCTLCLEE----------------------------RRH  279

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WC+ + ECPLCR       L+ L H
Sbjct  280   STATPCGHLFCWECITAWCSTRAECPLCREKFHPQKLIYLRH  321



>gb|KFO64842.1| Peroxisome biogenesis factor 10, partial [Corvus brachyrhynchos]
Length=291

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 90/342 (26%), Positives = 138/342 (40%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  2     GARPWLEWRKEVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  61

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  T ++P    +P                     
Sbjct  62    LHTVVPYCLEKALLHLEHELQMEAEESRTPENPPAPGFP---------------------  100

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ E      +     + + ++ + L+ R +L  FY +G++YHL
Sbjct  101   -----SRTLIRSWIRKQVGELTEQQKKTASQAVYVLKQSIPLLHRLHLAVFYIQGMFYHL  155

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             + 
Sbjct  156   SKRITGISYLHFGGLQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  215

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                  +Q S+ +  P    +      + E                            R+H
Sbjct  216   HRNLAHQKSTSKE-PAPGRQSRCTLCLEE----------------------------RRH  246

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  247   STATPCGHLFCWECITAWCNTRAECPLCREKFHPQKLIYLRH  288



>ref|XP_008639461.1| PREDICTED: peroxisome biogenesis factor 10 [Corvus brachyrhynchos]
Length=305

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/342 (26%), Positives = 138/342 (40%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  16    GARPWLEWRKEVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  75

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  T ++P    +P                     
Sbjct  76    LHTVVPYCLEKALLHLEHELQMEAEESRTPENPPAPGFP---------------------  114

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ E      +     + + ++ + L+ R +L  FY +G++YHL
Sbjct  115   -----SRTLIRSWIRKQVGELTEQQKKTASQAVYVLKQSIPLLHRLHLAVFYIQGMFYHL  169

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             + 
Sbjct  170   SKRITGISYLHFGGLQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  229

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                  +Q S+ +  P    +      + E                            R+H
Sbjct  230   HRNLAHQKSTSKE-PAPGRQSRCTLCLEE----------------------------RRH  260

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  261   STATPCGHLFCWECITAWCNTRAECPLCREKFHPQKLIYLRH  302



>ref|XP_010404284.1| PREDICTED: peroxisome biogenesis factor 10 [Corvus cornix cornix]
Length=332

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/342 (26%), Positives = 138/342 (40%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  43    GARPWLEWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVEPSKKKVPSFLRRALFIS  102

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  T ++P    +P                     
Sbjct  103   LHTVVPYCLEKALLHLEHELQMEAEESRTPENPPAPGFP---------------------  141

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ E      +     + + ++ + L+ R +L  FY +G++YHL
Sbjct  142   -----SRTLIRSWIRKQVGELTEQQKKTASQAVYVLKQSIPLLHRLHLAVFYIQGMFYHL  196

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             + 
Sbjct  197   SKRITGISYLHFGGLQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  256

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                  +Q S+ +  P    +      + E                            R+H
Sbjct  257   HRNLAHQKSTSKE-PAPGRQSRCTLCLEE----------------------------RRH  287

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  288   STATPCGHLFCWECITAWCNTRAECPLCREKFHPQKLIYLRH  329



>ref|XP_001633055.1| predicted protein [Nematostella vectensis]
 gb|EDO40992.1| predicted protein [Nematostella vectensis]
Length=295

 Score =   116 bits (291),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/331 (27%), Positives = 133/331 (40%), Gaps = 76/331 (23%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G    + ++ E  +L  + YF+LTT  G QTLGEEYC+  QV       P+   RA  +F
Sbjct  37    GVHSWIKWKKELDVLADVCYFVLTTICGFQTLGEEYCNIVQVDQSKRAIPSTTARAAQVF  96

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T  PYL  ++  R+ S   +      + +P                            
Sbjct  97    LHTITPYLLNKLLMRLGSLAQS-----QEQWP----------------------------  123

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                   F ++    WL         +P+ ++ +  + RA+L  FY  G++YH++KR +G+
Sbjct  124   -----PFASEGLRIWL------KDNVPVIQQSILFLHRAHLAVFYLTGVFYHIAKRVTGV  172

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
              Y    K +  RP Y++LG+   VQL +                       F  YQ S  
Sbjct  173   SYTL--KDSASRPTYRLLGYLSAVQLAVTLL--------------------FKVYQKSKD  210

Query  1026  RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFC  1205
               V    E   L     +          T +      +         +H T+T CGH+FC
Sbjct  211   SSVVDQWELSELPRKEEQPSVVPQSMPGTLKCSLCLENV--------KHITSTSCGHLFC  262

Query  1206  WNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             W+CI EWC+ K  CPLCR P   S LV L+H
Sbjct  263   WHCITEWCSSK--CPLCREPLQMSRLVYLHH  291


 Score = 31.2 bits (69),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 22/38 (58%), Gaps = 0/38 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSY  238
            F  A QPE++RA +KD  Y+ ++ E     FR+  G +
Sbjct  2    FACAGQPELVRANQKDVHYSSYLRENIGQVFRNFKGVH  39



>gb|KFV43550.1| Peroxisome biogenesis factor 10, partial [Tyto alba]
Length=286

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 136/338 (40%), Gaps = 70/338 (21%)
 Frame = +3

Query  324   AYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAVP  503
              ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRA+FI   T VP
Sbjct  3     GWRKELELLSDVAYFVLTTLSGYQTLGEEYVNIVQVDSTKKRIPSFLRRAIFISLHTVVP  62

Query  504   YLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSR  683
             Y  E+    +  +     D    S                           ++ P++   
Sbjct  63    YCLEKGLLHLEHELQIEADELRAS---------------------------QSSPALGLS  95

Query  684   FKTKIRECWLHA---------VQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRA  836
              +T IR  W+            +R   ++ L ++ + L+ R +L  FY  G +YHLSKR 
Sbjct  96    SRTLIRN-WIQKQAGELTEQQKKRLLQIVYLLKQCIPLLHRLHLAIFYIRGTFYHLSKRI  154

Query  837   SGIRYV----FIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFG  1004
             +GI Y+      G+  + R  Y+ LG   L  L +     +             +     
Sbjct  155   TGITYLCFGGLHGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWKLHRNL  214

Query  1005  TYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTAT  1184
              +Q +  +G     E  +  T   E+                           R+H TAT
Sbjct  215   AHQKNMTKGQT--TEHHSRCTLCLEE---------------------------RRHTTAT  245

Query  1185  PCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             PCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  246   PCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  283



>ref|XP_005492713.1| PREDICTED: peroxisome biogenesis factor 10 [Zonotrichia albicollis]
Length=311

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/342 (27%), Positives = 138/342 (40%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  +A++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  22    GARPWLAWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  81

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  + + P    +P                     
Sbjct  82    LHTLVPYCLEKALLHLQHELQVEAEECRSPESPPALGFP---------------------  120

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ +      +R   V+ + ++ + L+ R +L  FY +G +YHL
Sbjct  121   -----SRSFIRSWIRRQVGQLSEQQKKRASQVVDVLKQSIPLLHRLHLAVFYIQGTFYHL  175

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             + 
Sbjct  176   SKRVTGISYLHFGGLQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  235

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                 T+Q S  R       +      + E                            R+H
Sbjct  236   HRNLTHQKSRSREAAA-GRQSRCTLCLEE----------------------------RRH  266

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WC+ + ECPLCR       L+ L H
Sbjct  267   STATPCGHLFCWECITAWCSTRAECPLCREKFHPQKLIYLRH  308



>ref|XP_009973597.1| PREDICTED: peroxisome biogenesis factor 10, partial [Tyto alba]
Length=291

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 92/338 (27%), Positives = 136/338 (40%), Gaps = 70/338 (21%)
 Frame = +3

Query  324   AYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAVP  503
              ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRA+FI   T VP
Sbjct  8     GWRKELELLSDVAYFVLTTLSGYQTLGEEYVNIVQVDSTKKRIPSFLRRAIFISLHTVVP  67

Query  504   YLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLSR  683
             Y  E+    +  +     D    S                           ++ P++   
Sbjct  68    YCLEKGLLHLEHELQIEADELRAS---------------------------QSSPALGLS  100

Query  684   FKTKIRECWLHA---------VQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRA  836
              +T IR  W+            +R   ++ L ++ + L+ R +L  FY  G +YHLSKR 
Sbjct  101   SRTLIRN-WIQKQAGELTEQQKKRLLQIVYLLKQCIPLLHRLHLAIFYIRGTFYHLSKRI  159

Query  837   SGIRYV----FIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFG  1004
             +GI Y+      G+  + R  Y+ LG   L  L +     +             +     
Sbjct  160   TGITYLCFGGLHGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWKLHRNL  219

Query  1005  TYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTAT  1184
              +Q +  +G     E  +  T   E+                           R+H TAT
Sbjct  220   AHQKNMTKGQT--TEHHSRCTLCLEE---------------------------RRHTTAT  250

Query  1185  PCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             PCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  251   PCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  288



>ref|NP_001005994.1| peroxisome biogenesis factor 10 [Danio rerio]
 gb|AAH83412.1| Peroxisome biogenesis factor 10 [Danio rerio]
Length=318

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 96/340 (28%), Positives = 141/340 (41%), Gaps = 74/340 (22%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R  + ++ E +LL  + Y++LTT +G QTLGEEY    QV       P+  RR   I 
Sbjct  38    GSRRWLQWRKEIELLSDLTYYILTTLSGYQTLGEEYVSIIQVDPSKRRIPSRIRRTALIC  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             + T VPYL ++V        I +++  +   P                     ++    +
Sbjct  98    FHTFVPYLLDKVL-------ICVENELEAEAP--------------------QNTRRTWN  130

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQ---LVIRANLMFFYFEGLYYHLSKRA  836
             P    RF  +     L   QR  S++PL   + Q   L+ R ++  FY  G +YH++KRA
Sbjct  131   PLSHMRFWIQRAVGLLTESQR-KSLIPLVFALQQGITLLYRLHVALFYTTGAFYHIAKRA  189

Query  837   SGIRYVFIGKPTNQRPR----YQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ----  992
             +G+RY+ +G  +   PR    Y++LG   ++QL I                   +Q    
Sbjct  190   AGVRYLRVGNASGDDPRISHSYRLLGGLSVLQLAITLTLQFNNLRQRQRARHEWKQHRNL  249

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
              P      SS R           I  + E                            R++
Sbjct  250   LPSHQVSQSSSRT-------SRCILCLEE----------------------------RRN  274

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              T+TPCGH+FCW CI EWCN K ECPLCR       LV L
Sbjct  275   TTSTPCGHLFCWECITEWCNTKNECPLCREKFQPHRLVYL  314



>ref|XP_005427723.1| PREDICTED: peroxisome biogenesis factor 10 [Geospiza fortis]
Length=350

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 89/342 (26%), Positives = 139/342 (41%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
               R+ +A++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  61    SARLWLAWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  120

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  + ++P    +P                     
Sbjct  121   LHTLVPYCLEKALLHLQHELQVEAEESRSPENPPALGFP---------------------  159

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ +      +R   V+ + ++ + L+ R +L  FY +G +YHL
Sbjct  160   -----SRSFIRSWVRKQVGQLSEQQKKRTSQVVDVLKQSIPLLHRLHLAVFYIQGTFYHL  214

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             + 
Sbjct  215   SKRVTGISYLHFGGLQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  274

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                 T+Q S  +       +      + E                            R+H
Sbjct  275   HRNLTHQKSRSKEAAA-GRQSRCTLCLEE----------------------------RRH  305

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WC+ + ECPLCR       L+ L H
Sbjct  306   STATPCGHLFCWECITAWCSTRAECPLCREKFHPQKLIYLRH  347



>ref|XP_006016263.1| PREDICTED: peroxisome biogenesis factor 10 [Alligator sinensis]
Length=326

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/333 (27%), Positives = 132/333 (40%), Gaps = 52/333 (16%)
 Frame = +3

Query  312   RVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQ  491
             R  + ++ E +LL  + YF LTT AG QTLGEEY +  QV       P+   RA+ I   
Sbjct  40    RTWLGWRKELELLSDVAYFSLTTLAGYQTLGEEYVNIVQVDSSKKRVPSLLHRAVLISLH  99

Query  492   TAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPS  671
               VPYL ++    +  +     D +                      + +    +R   S
Sbjct  100   AVVPYLLDKGLVHLEHELQAEADGWRTG-------------------QSSLGLGARGRTS  140

Query  672   VLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRY  851
             V S  + +I     +        + + ++ + L  R +L  FY  G++YHLSKR +GI Y
Sbjct  141   VRSWLQKRITRLTENQKNVLLQTVYILKQCIPLFRRLHLAIFYINGIFYHLSKRITGITY  200

Query  852   VFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             + +    G   + R  Y++LG   L+ L +     +             +     +YQ +
Sbjct  201   LRVAGLPGDDQSVRSSYKLLGIVSLLHLVLTVGIQIYSFQQRQRARQEWKLHRNLSYQKN  260

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
                  P L         + E                            R+H TATPCGH+
Sbjct  261   LTEEKP-LGRRSRCTLCLEE----------------------------RRHATATPCGHL  291

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             FCW CI EWCN K ECPLCR       L+ L H
Sbjct  292   FCWECITEWCNTKAECPLCREKFPPQKLIYLQH  324



>ref|XP_005996642.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Latimeria 
chalumnae]
 ref|XP_005996643.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Latimeria 
chalumnae]
Length=326

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 140/337 (42%), Gaps = 56/337 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT +G QTLGEEY +  QV       P+  RR + I 
Sbjct  38    GAKKWLVWRKEFELLCDLAYFCLTTISGYQTLGEEYVNIIQVDPSNRRVPSWFRRIMLIS  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T+VPYL E+    +  +   L    D S PF     S                  R  
Sbjct  98    LHTSVPYLVEKGLVHLEHE---LYPERDGSQPFLNTQVS------------------RLQ  136

Query  666   PSVLSRFKTKIRECWLHAVQR--WPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
                  R   +   C +   Q+      + + R  +  + R +L FF+  G +YH++KR +
Sbjct  137   ERSFLRDWIQRGVCNVTETQKKTLAQAVFILRHTITFLHRLHLAFFFINGTFYHIAKRIT  196

Query  840   GIRYVFI-GKPTNQR---PRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGT  1007
             GI Y+ + G P + R     Y+ LG   L+QL ++    L             +Q    +
Sbjct  197   GITYLRVRGLPRDDRGIRSIYKFLGLVSLLQLVLMTFLQLNSFHQRQRARQEWKQHRNLS  256

Query  1008  YQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATP  1187
             Y  S  +    L                                +CSLCL  R+H TATP
Sbjct  257   YHRSPSQNSATLRSS-----------------------------RCSLCLEERRHSTATP  287

Query  1188  CGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             CGH+FCW CI EWCN K ECPLCR       L+ L H
Sbjct  288   CGHLFCWECITEWCNTKTECPLCREKFQSHRLIYLRH  324



>gb|KFZ58457.1| Peroxisome biogenesis factor 10, partial [Podiceps cristatus]
Length=289

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/343 (27%), Positives = 142/343 (41%), Gaps = 69/343 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF L+T +G QTLGEEY +  QV       P+  +RA F+F
Sbjct  1     GAKTWLEWRKEIELLSDVAYFGLSTLSGYQTLGEEYVNIVQVDSTKKRVPSFLQRAAFVF  60

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T VPY  E+    +  +   L    D+S                         TS+++
Sbjct  61    LHTVVPYCLEKGLLHLERE---LQAEADES------------------------RTSQSN  93

Query  666   PSVLSRFKTKIRECWLH------AVQRWPSVLPLA---REILQLVIRANLMFFYFEGLYY  818
             P+     +T IR  W+         Q+  +VL +    ++ + L+ R +L  FY  G +Y
Sbjct  94    PASGLSSRTLIRN-WIQKQVGDLTEQQRKTVLQIVYGLKQCIPLLHRLHLAVFYVRGTFY  152

Query  819   HLSKRASGIRYVFIG---KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQ  989
             HLSKR +GIRY+  G   +  + +  Y+ LG   L  L +     +             +
Sbjct  153   HLSKRITGIRYLHFGGLQEDQSIQSSYKFLGIISLFHLLLTMGVQMYSFKQKQRARQEWK  212

Query  990   QTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQ  1169
                  ++Q +  +G             + E                            R+
Sbjct  213   LHRNLSHQKNMTKG-KTTGRHSRCTLCLEE----------------------------RR  243

Query  1170  HPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H TATPCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  244   HTTATPCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  286



>ref|XP_002196935.1| PREDICTED: peroxisome biogenesis factor 10 isoform 1 [Taeniopygia 
guttata]
Length=323

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/339 (26%), Positives = 134/339 (40%), Gaps = 63/339 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  +A++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  37    GARPWLAWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  96

Query  486   YQTAVPYLAER----VSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassst  653
               T VPY  E+    +   +  +      P    +P                        
Sbjct  97    LHTVVPYCLEKALLHLEHELQMEAEESRAPPALGFP------------------------  132

Query  654   sRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKR  833
               +  S+ S  + ++ E      +    V+ + ++ + L+ R +L  FY +G +YHLSKR
Sbjct  133   --SRSSIRSWIRKQVGELTEQQKKTASQVVYVLKQSIPLLHRLHLAVFYIQGTFYHLSKR  190

Query  834   ASGIRYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              +GI YV  G    +    R  Y+ LG   L  L +     +             +    
Sbjct  191   ITGISYVHFGGQQGEDQSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRLHRN  250

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
               +Q S  +       +      + E+                            +H TA
Sbjct  251   LAHQKSRSKEAAA-GRQSRCTLCLEER----------------------------RHSTA  281

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             TPCGH+FCW CI  WC+ + ECPLCR       L+ L H
Sbjct  282   TPCGHLFCWECITAWCSTRAECPLCREKFHPQKLIYLRH  320



>ref|XP_005057845.1| PREDICTED: peroxisome biogenesis factor 10, partial [Ficedula 
albicollis]
Length=317

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/342 (26%), Positives = 136/342 (40%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRALFI 
Sbjct  28    GARPWLQWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLRRALFIS  87

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
                 VPY  E+    +       A +  + ++P    +P                     
Sbjct  88    LHAVVPYCLEKALLHLEHELQMEAEESRSPENPPALGFP---------------------  126

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                  +   + S  + ++ E      +    ++ + ++ + L+ R +L  FY +G +YHL
Sbjct  127   -----SRTLIRSWIRKQVGELTEQQKKTASQIVYVLKQSIPLLHRLHLAVFYIQGTFYHL  181

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  N R  Y+ LG   L  L +     +             + 
Sbjct  182   SKRITGISYLHFGGLQGEDQNIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEWRL  241

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                  +Q S+ +       +      + E                            R+H
Sbjct  242   HRNLAHQKSTSKEAAA-GRQSRCTLCLEE----------------------------RRH  272

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  273   STATPCGHLFCWECITAWCNTRAECPLCREKFHPQKLIYLRH  314



>gb|EEH04384.1| peroxin 10 [Histoplasma capsulatum G186AR]
Length=362

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 95/332 (29%), Positives = 153/332 (46%), Gaps = 28/332 (8%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LYF LTT  G +TLGEEYCD  Q+       P+  RR  +I 
Sbjct  54    GARFAHSHTDAIKNLTDLLYFSLTTLVGNRTLGEEYCDVVQLEDDSLRLPSLVRRVGYIL  113

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  +R+   +  +                  + S     + A+ ++    + + 
Sbjct  114   SSILLPWTLQRLLPALRQK-------------MRAKLQRSVARLQAKAALLSLKQKTPSK  160

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             P +  RF+  +    L  +    S+ P        +   NL  FYF G YYH+SKR  G+
Sbjct  161   PGLTLRFQIYV----LDHLDSLTSLSP--------IFALNLAAFYFSGAYYHISKRIWGL  208

Query  846   RYVFIGKPTNQRPR--YQILGFFLLVQLCIlaaeglrrrssl-ssiaasaQQTPFGTYQT  1016
             RYVF  +  +   R  Y++LG  L++Q+ +     ++   S  ++  A  QQ   G+ Q 
Sbjct  209   RYVFTKRIEDNEARIGYEVLGVLLVLQIAVQGILHVKNTISSFTAETAEGQQQQEGSDQK  268

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
             ++ + +       +L  + +         +S +        KC+LCL   + P+AT CGH
Sbjct  269   TALKSIYTPPSIQSLPASEARYDLANPTNASLAWVPPGQQRKCTLCLEPYKDPSATTCGH  328

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             +FCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  329   IFCWTCIRDWVREKPECPLCRQEALGSKILPL  360



>ref|XP_005996644.1| PREDICTED: peroxisome biogenesis factor 10 isoform X3 [Latimeria 
chalumnae]
Length=315

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 136/337 (40%), Gaps = 67/337 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT +G QTLGEEY +  QV       P+  RR + I 
Sbjct  38    GAKKWLVWRKEFELLCDLAYFCLTTISGYQTLGEEYVNIIQVDPSNRRVPSWFRRIMLIS  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T+VPYL E+    +  +   L    D S PF     S                  R  
Sbjct  98    LHTSVPYLVEKGLVHLEHE---LYPERDGSQPFLNTQVS------------------RLQ  136

Query  666   PSVLSRFKTKIRECWLHAVQR--WPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
                  R   +   C +   Q+      + + R  +  + R +L FF+  G +YH++KR +
Sbjct  137   ERSFLRDWIQRGVCNVTETQKKTLAQAVFILRHTITFLHRLHLAFFFINGTFYHIAKRIT  196

Query  840   GIRYVFI-GKPTNQR---PRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGT  1007
             GI Y+ + G P + R     Y+ LG   L+QL ++    L             +Q    +
Sbjct  197   GITYLRVRGLPRDDRGIRSIYKFLGLVSLLQLVLMTFLQLNSFHQRQRARQEWKQHRNLS  256

Query  1008  YQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATP  1187
             Y +S  R    L E                                      R+H TATP
Sbjct  257   YHSS--RCSLCLEE--------------------------------------RRHSTATP  276

Query  1188  CGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             CGH+FCW CI EWCN K ECPLCR       L+ L H
Sbjct  277   CGHLFCWECITEWCNTKTECPLCREKFQSHRLIYLRH  313



>dbj|GAA97940.1| hypothetical protein E5Q_04620 [Mixia osmundae IAM 14324]
 gb|KEI37802.1| hypothetical protein L969DRAFT_65735 [Mixia osmundae IAM 14324]
Length=439

 Score =   114 bits (286),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 152/358 (42%), Gaps = 52/358 (15%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR   ++  E  +  ++ YF LTT  G QTLGEEYCD  Q        P+  RRA  + 
Sbjct  106   GTRWLQSFAGEVTVASKLSYFSLTTLLGSQTLGEEYCDIMQYGADDHRFPSTRRRATLVM  165

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                  PYL  ++ + +  Q                             ++ A+S  +R  
Sbjct  166   LHVLAPYLVAKLYTSLRRQ---------------------LNATREALAQRAASDGARTQ  204

Query  666   PSVLSRFKTKIRECWLHAVQRWPS-----VLPLAREILQLVIRA-NLMFFYFEGLYYHLS  827
                 + F +  R   +    RWPS      LP   ++    IRA +L FFY  G YYHL+
Sbjct  205   EQTATLFASTSRPQNVPVRTRWPSWLLKNELPTFEDLTGKHIRAVHLTFFYLFGRYYHLA  264

Query  828   KRASGIRYVFI--------GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaas  983
             KR + +RY+          G P    P Y++LG  + +Q+ I       RR    + + +
Sbjct  265   KRLTRVRYLSTQSRQPLSGGSP----PSYEVLGVLMALQISIRLGMMTLRRMRAPAESET  320

Query  984   aQQTPFGTYQ-------------TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesq  1124
                    T +             T  GR   ++  + +      +     +E  + +E +
Sbjct  321   QAALQAATKEKALEARKAKREPSTVDGRPASIMTFDPDADNQAEKAEEAQTEEDADAEPE  380

Query  1125  asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              S   +C+LCL  R+ P +T CGH FCW CI+ W  EKPECPLCR   T S L+ +Y+
Sbjct  381   DSHARRCTLCLGPRRDPASTECGHTFCWECIVGWAREKPECPLCRQSVTLSRLLPVYN  438


 Score = 29.6 bits (65),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            FP   QPEI+RA +KD  Y   + E   +  R + G+
Sbjct  71   FPRGAQPEIIRANQKDLYYLAELKEQVDNVVRTVMGT  107



>ref|XP_006161233.1| PREDICTED: peroxisome biogenesis factor 10 [Tupaia chinensis]
 gb|ELV14240.1| Peroxisome biogenesis factor 10 [Tupaia chinensis]
Length=326

 Score =   114 bits (286),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 142/337 (42%), Gaps = 56/337 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + I 
Sbjct  38    GAKKWLEWRKEIELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQRRVPSRFRRGVLIA  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T +PYL ++    +  +   L    D + P      S   +   +     +    R H
Sbjct  98    LHTVLPYLLDKALLPLEQE---LQADGDSTRP------SQGSLVPGSRGRSGARRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +        +QR   VL   R+ L  + R ++ +FY  G +YHL+KR +GI
Sbjct  149   VATLTEQQRR-------TLQRAAFVL---RQGLTCLQRLHIAWFYINGAFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  YQ+LGF  L  L +     L             +     +++
Sbjct  199   TYLRVSHLPGEDLRARTSYQLLGFISLFHLALSVGLQLYSFRQRQRARKEWRLHRNLSHR  258

Query  1014  TSS--GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATP  1187
              SS   R VP       L T   E+                           R+H TATP
Sbjct  259   RSSLEERAVP----RNPLCTLCLEE---------------------------RRHSTATP  287

Query  1188  CGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             CGH+FCW CI EWC+ K ECPLCR       LV L H
Sbjct  288   CGHLFCWECITEWCSTKTECPLCREKFPPQKLVYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYCGGLRSAAGGALHSLAGA  39



>ref|XP_001817227.1| peroxisome biosynthesis protein (Peroxin-10) [Aspergillus oryzae 
RIB40]
 ref|XP_002372271.1| peroxisome biosynthesis protein (Peroxin-10), putative [Aspergillus 
flavus NRRL3357]
 dbj|BAE55225.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED56659.1| peroxisome biosynthesis protein (Peroxin-10), putative [Aspergillus 
flavus NRRL3357]
 gb|EIT79675.1| putative E3 ubiquitin ligase, integral peroxisomal membrane protein 
[Aspergillus oryzae 3.042]
 gb|KDE78393.1| putative E3 ubiquitin ligase, integral peroxisomal membrane protein 
[Aspergillus oryzae 100-8]
Length=373

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 105/351 (30%), Positives = 154/351 (44%), Gaps = 60/351 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  Y    K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  59    GARFAHTYSETIKNLTEILYFSLTTLIGNRTLGEEYCDLVQLEDDTLQLPSFIRRAGYIV  118

Query  486   YQTAVPYLAERV------------SSRIASQGITLDDPFDDSYPFsvasesssrveasta  629
                 VP++ +R+               IA Q +      + + P                
Sbjct  119   SSIIVPWILQRILPAFRQRLRAKLERSIARQQLKAQQAREGTKP----------------  162

Query  630   seiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQL--VIRANLMFFYF  803
                     SR   S    F TK+R      +Q++  +L     I  L  +   ++  FYF
Sbjct  163   --------SRKETSKAPSFFTKLR------IQKY--ILEHLDSITSLSPIYAVSIATFYF  206

Query  804   EGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssia  977
              G YYHLSKR  G+RYVF  K     QR  Y++LG  L++Q+ + +   +++        
Sbjct  207   TGAYYHLSKRFWGLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQSVLHVKKVGLSL---  263

Query  978   asaQQTPFGTYQTSS-GRGVPVLNEEGN-----LITAVSEKGsfvsepsstsesqasgls  1139
                QQ    T  T S G    +++   N     L+ A   +     + ++     +   S
Sbjct  264   ---QQEDLETEATHSRGPDDTLIHSIENPPTLPLLPASDARYDLSEDSTAIPWIPSGQQS  320

Query  1140  kcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             +C+LCL   + P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  321   RCTLCLEPFKDPSVTTCGHVFCWTCVRDWVREKPECPLCRQDVLLSKILPL  371



>ref|XP_006268067.1| PREDICTED: peroxisome biogenesis factor 10 [Alligator mississippiensis]
Length=326

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 94/342 (27%), Positives = 135/342 (39%), Gaps = 70/342 (20%)
 Frame = +3

Query  312   RVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQ  491
             R  + ++ E +LL  + YF LTT AG QTLGEEY +  QV       P+   RA+ I   
Sbjct  40    RTWLGWRKELELLSDVAYFSLTTLAGYQTLGEEYVNIVQVDSSKKRVPSLLHRAVLISLH  99

Query  492   TAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPS  671
               VPYL ++    +        D +  S                           ++ P 
Sbjct  100   AVVPYLLDKGLVHLEHTLQAEADRWRTS---------------------------QSSPG  132

Query  672   VLSRFKTKIRECWLHA-----VQRWPSVLPLAREILQLVI----RANLMFFYFEGLYYHL  824
             + +R +T +R  WL        +   +VL     IL+  I    R +L  FY  G++YHL
Sbjct  133   LGARGRTSVRS-WLQKRITRLTENQKNVLLQTVYILKQCIPLFRRLHLAIFYINGIFYHL  191

Query  825   SKRASGIRYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+ +    G   + R  Y++LG   L+ L +     +             + 
Sbjct  192   SKRITGITYLRVAGLPGDDQSVRSSYKLLGIVSLLHLVLTVGIQIYSFQQRQRARQEWKL  251

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                 +YQ +     P L         + E+                            +H
Sbjct  252   HRNLSYQKNLTEEKP-LGRCSRCTLCLEER----------------------------RH  282

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI EWCN K ECPLCR       L+ L H
Sbjct  283   ATATPCGHLFCWECITEWCNTKAECPLCREKFPPQKLIYLQH  324



>gb|EGD97002.1| peroxisome biosynthesis protein [Trichophyton tonsurans CBS 112818]
Length=373

 Score =   113 bits (283),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 91/341 (27%), Positives = 136/341 (40%), Gaps = 42/341 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A A+ +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+ +RRA +I 
Sbjct  61    GQRYAHAHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLSRRAGYIV  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VP + +R+                    F     +      +              
Sbjct  121   SSILVPSILQRLLP-----------------SFRRKLRAKLERSIARKQARLELEKGNTK  163

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                 S F  +++   L  +    S+ P            NL  FYF G YYHLSKR  G+
Sbjct  164   KRKESGFSLRVQRYILENLNSITSLSPF--------FAVNLAAFYFSGAYYHLSKRVWGL  215

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF  +   + +R  Y++LG  L++Q+ + A    +       +  + Q +   +    
Sbjct  216   RYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEVIESIQLEEAGQVSATDSGAKG  275

Query  1020  SG----------RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQ  1169
             +G           G+P+L  E        EK +           +   L          +
Sbjct  276   TGTPGLKSISMPDGMPMLAPEEARYDMSVEKDALAMSWIPAGPQRKCTLCLDPF-----K  330

Query  1170  HPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  331   DPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  371


 Score = 29.3 bits (64),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRAHEKDNYITSTLSTQAQSIIRTLRGQRYA  65



>ref|XP_007422618.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Python 
bivittatus]
Length=326

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/333 (28%), Positives = 137/333 (41%), Gaps = 53/333 (16%)
 Frame = +3

Query  312   RVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQ  491
             +V + +Q E +LL  + YF LTT +G QTLGEEY +  QV       P+  RRA+ +   
Sbjct  41    KVWLEWQKEIELLADVAYFALTTLSGNQTLGEEYVNVIQVDPSKRKVPSLTRRAILVSLH  100

Query  492   TAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPS  671
             T +PYL ++  ++       L+   + +       +S +     + + + S    R    
Sbjct  101   TVLPYLLDKGLAQ-------LEQELEANSSGLQTLQSRNLGGFQSRTLLRSWMQRR----  149

Query  672   VLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRY  851
              +SR     R     AV+     LP+ R       R +L  FY  G++YHLSKR +GI Y
Sbjct  150   -VSRLMEWQRVFLGRAVRIVKQSLPVLR-------RLHLAVFYMNGIFYHLSKRTTGITY  201

Query  852   V----FIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             +    F       R  Y++LG   L+ L ++ +                +     +YQ  
Sbjct  202   LRSVGFSEDDQAIRSSYKLLGIISLLHLGLMLSIYAYNFQHRQRARKEWKLHHNLSYQIQ  261

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
                   +LN        + E                            R+H TATPCGH+
Sbjct  262   PEE--RILNRSSRCALCLEE----------------------------RRHATATPCGHL  291

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             FCW CI  WCN K ECPLCR       L+ L H
Sbjct  292   FCWECIAAWCNTKAECPLCREKFHPQKLIYLRH  324



>gb|EGE01320.1| peroxisome assembly protein 10 [Trichophyton equinum CBS 127.97]
Length=373

 Score =   113 bits (282),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/341 (27%), Positives = 136/341 (40%), Gaps = 42/341 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A A+ +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+ +RRA +I 
Sbjct  61    GQRYAHAHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLSRRAGYIV  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VP + +R+                    F     +      +              
Sbjct  121   SSILVPSILQRLLP-----------------SFRRKLRAKLERSIARKQARLELEKGNTK  163

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                 S F  +++   L  +    S+ P            NL  FYF G YYHLSKR  G+
Sbjct  164   KRKESGFSLRVQRYILEHLNSITSLSPF--------FAVNLAAFYFSGAYYHLSKRVWGL  215

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF  +   + +R  Y++LG  L++Q+ + A    +       +  + Q +   +    
Sbjct  216   RYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEVIESIQLEEAGQVSATDSGAKG  275

Query  1020  SG----------RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQ  1169
             +G           G+P+L  E        EK +           +   L          +
Sbjct  276   TGTPGLKSISMPDGMPMLAPEEARYDMSVEKDALAMSWIPAGPQRKCTLCLDPF-----K  330

Query  1170  HPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  331   DPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  371


 Score = 29.3 bits (64),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRAHEKDNYITSTLSTQAQSIIRTLRGQRYA  65



>ref|XP_010745155.1| PREDICTED: peroxisome biogenesis factor 10 [Larimichthys crocea]
Length=291

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 145/348 (42%), Gaps = 83/348 (24%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G++  + ++ E +LL  + Y+ LTT +G QTLGEEY +  QV       P+  RR LF+F
Sbjct  4     GSKRWLDWRREIELLSDLAYYGLTTFSGYQTLGEEYVNIVQVDPTKRQIPSWTRRGLFVF  63

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                  PYL  +V        + L++  +                     E  S    R  
Sbjct  64    CHAYFPYLLGKVL-------VCLENELEGG------------------QESRSGVGRRQA  98

Query  666   PSVLSRFKTKIRECWLHAV------QR---WPSVLPLAREILQLVIRANLMFFYFEGLYY  818
              S L   ++ +R   L AV      QR    P+V  L ++ L L+ R ++  FY  G +Y
Sbjct  99    ASGLWSLESWLRRWMLRAVGLLSESQRKACLPAVFVL-QQSLTLLHRLHVALFYISGSFY  157

Query  819   HLSKRASGIRYVFIGKPTNQ----RPRYQILG----FFLLVQLCIlaaeglrrrsslssi  974
             HLSKRA+GI Y+ +  P +     R  Y++LG      LL+ +C+      +R+ +    
Sbjct  158   HLSKRAAGISYLRVTGPNSDDGTIRSTYRLLGAVSLLQLLITVCLQLNNFRQRQRARQEW  217

Query  975   aasaQQTPFGTYQTSS--GRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcs  1148
                   +P  T    S   R +  L E                                 
Sbjct  218   KLYRNLSPQRTQSLRSRVSRCILCLEE---------------------------------  244

Query  1149  lclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                  R+H T+TPCGH+FCW CI EWCN K ECPLCR       LV L
Sbjct  245   -----RRHSTSTPCGHLFCWECITEWCNTKAECPLCREKFQPHRLVYL  287



>ref|XP_005528418.1| PREDICTED: peroxisome biogenesis factor 10 [Pseudopodoces humilis]
Length=326

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/342 (26%), Positives = 136/342 (40%), Gaps = 66/342 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+   RALFI 
Sbjct  37    GARPWLEWRREVELLSDVAYFVLTTLSGYQTLGEEYVNIIQVDPSKKKVPSFLSRALFIS  96

Query  486   YQTAVPYLAERVSSRI-------ASQGITLDDPFDDSYPFsvasesssrveastaseias  644
               T VPY  E+    +       A +  T ++P    +P                     
Sbjct  97    LHTVVPYCLEKALLHLEHELHMEAEESRTPENPPAICFPRRTL-----------------  139

Query  645   sstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHL  824
                      + +    ++ E      +    V+ + ++ + L+ R +L  FY +G +YH+
Sbjct  140   ---------IRTWIWKQVGELTEQQKKTASQVVSVLKQSIPLLHRLHLAVFYIQGTFYHM  190

Query  825   SKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQ  992
             SKR +GI Y+  G    +  + +  YQ LG   L  L +     +             + 
Sbjct  191   SKRIAGISYLHFGGLQGEDQSIQSSYQFLGIISLFHLLLTVGVQMYSFKQKQRARQEWRL  250

Query  993   TPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQH  1172
                 T+Q S+ + V     +      + E                            R+H
Sbjct  251   YRNLTHQKSTSKEVAA-GRQSRCTLCLEE----------------------------RRH  281

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
              TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  282   STATPCGHLFCWECITAWCNTRAECPLCREKFHPQKLIYLRH  323



>ref|XP_007422619.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Python 
bivittatus]
Length=326

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/333 (28%), Positives = 137/333 (41%), Gaps = 53/333 (16%)
 Frame = +3

Query  312   RVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQ  491
             +V + +Q E +LL  + YF LTT +G QTLGEEY +  QV       P+  RRA+ +   
Sbjct  41    KVWLEWQKEIELLADVAYFALTTLSGHQTLGEEYVNVIQVDPSKRKVPSLTRRAILVSLH  100

Query  492   TAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPS  671
             T +PYL ++  ++       L+   + +       +S +     + + + S    R    
Sbjct  101   TVLPYLLDKGLAQ-------LEQELEANSSGLQTLQSRNLGGFQSRTLLRSWMQRR----  149

Query  672   VLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRY  851
              +SR     R     AV+     LP+ R       R +L  FY  G++YHLSKR +GI Y
Sbjct  150   -VSRLMEWQRVFLGRAVRIVKQSLPVLR-------RLHLAVFYMNGIFYHLSKRTTGITY  201

Query  852   V----FIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             +    F       R  Y++LG   L+ L ++ +                +     +YQ  
Sbjct  202   LRSVGFSEDDQAIRSSYKLLGIISLLHLGLMLSIYAYNFQHRQRARKEWKLHHNLSYQIQ  261

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
                   +LN        + E                            R+H TATPCGH+
Sbjct  262   PEE--RILNRSSRCALCLEE----------------------------RRHATATPCGHL  291

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             FCW CI  WCN K ECPLCR       L+ L H
Sbjct  292   FCWECIAAWCNTKAECPLCREKFHPQKLIYLRH  324



>ref|XP_001366320.1| PREDICTED: peroxisome biogenesis factor 10 [Monodelphis domestica]
Length=326

 Score =   110 bits (275),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 145/347 (42%), Gaps = 76/347 (22%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT +G QTLGEEY +  QV       P+  RRA  + 
Sbjct  38    GAKKWLEWRKEVELLSDIAYFTLTTFSGYQTLGEEYVNIIQVDPSKRKVPSWFRRATLVS  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T VPY  ++    +  +   L    + +     +                        
Sbjct  98    LHTLVPYALDKALVHLEHE---LQAEVESARHLQNSLVLGV-------------------  135

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVL--PLAREILQLVI----------RANLMFFYFEG  809
                  R ++ +R  W+H   RW   L  P  + +L++V           R ++  FY +G
Sbjct  136   -----RSRSAVRR-WVH---RWVHHLSEPQKKTLLRVVNFLKHSITCLRRLHVAMFYIDG  186

Query  810   LYYHLSKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssia  977
             ++YHL+KR +GI Y+ +        N R  Y++LG   L+ L +  +  +          
Sbjct  187   IFYHLAKRLTGITYLRVRSLPRDDHNVRWSYRLLGMVSLLHLTLSVSVQI----------  236

Query  978   asaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslcl  1157
                    +G  Q    R      +E  L  ++S + S   E S    S  +   +     
Sbjct  237   -------YGFSQRQRAR------KEWKLHRSLSHRKSHTEEKSVGRSSVCTLCLEE----  279

Query  1158  ssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
               R+H TATPCGH+FCW CI EWCN K ECPLCR       L+ L H
Sbjct  280   --RRHATATPCGHLFCWECITEWCNTKTECPLCREKFHPQKLIYLRH  324


 Score = 31.6 bits (70),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A QPE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ANQPEVIRAAQKDEYYRGGLRSAAGAALHSLAGA  39



>ref|XP_007979115.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Chlorocebus 
sabaeus]
Length=326

 Score =   110 bits (276),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 103/335 (31%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR SGI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLSGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRCGLRSAAGGALHSLAGA  39



>gb|KFW64667.1| Peroxisome biogenesis factor 10, partial [Pygoscelis adeliae]
Length=290

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 140/344 (41%), Gaps = 70/344 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRA+F+ 
Sbjct  1     GAKKWLEWRREIELLSDVAYFVLTTLSGYQTLGEEYVNIVQVDSTKKRVPSFLRRAIFVS  60

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T VPY  E+    +  +   L    D+S                         TS++ 
Sbjct  61    LHTVVPYCLEKGLLHLEHE---LQIEPDES------------------------RTSQSS  93

Query  666   PSVLSRFKTKIRECWLHA---------VQRWPSVLPLAREILQLVIRANLMFFYFEGLYY  818
             P++    +T IR  W+            +R    + + ++ + L+ R +L  FY  G +Y
Sbjct  94    PALGLASRTLIRN-WIQKQVGELTEQQKKRVLQTVYVLKQCIPLLHRLHLAVFYIRGTFY  152

Query  819   HLSKRASGIRYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasa  986
             HLSKR +GI Y+      G+  + R  Y+ LG   L  L +     +             
Sbjct  153   HLSKRITGITYLHFGGLQGEDRSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEW  212

Query  987   QQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
             +      +  ++ +G        +    + E+                            
Sbjct  213   KLHRNLAHHKNTTKG-KTTGRHSHCTLCLEER----------------------------  243

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +H TATPCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  244   RHTTATPCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  287



>ref|XP_008531910.1| PREDICTED: peroxisome biogenesis factor 10 [Equus przewalskii]
Length=342

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 141/344 (41%), Gaps = 70/344 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  54    GAKKWLEWRKEIELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSQSRVPSRLRRTVLVT  113

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T +PYL ++    +  +   L    D ++    +                        
Sbjct  114   LHTVLPYLLDKALLHLEHE---LQADSDGTWSSQGSLA----------------------  148

Query  666   PSVLSRFKTKIRECWLH------AVQRWPSVLP---LAREILQLVIRANLMFFYFEGLYY  818
             P V SR  T+    WLH        Q+  ++L    + R+ L  + R ++ +FY  G +Y
Sbjct  149   PGVRSRSGTRR---WLHRHVANLTEQQKKALLRATLVLRQGLSCLQRLHVAWFYIHGAFY  205

Query  819   HLSKRASGIRYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasa  986
             HL+KR +G+ Y+ + +P  +    R  Y++LG   L+ L +     L             
Sbjct  206   HLAKRLTGVTYLHVRRPLAEDLRARTSYRLLGIVSLLHLALSTGLQLYGFRQRQRARREW  265

Query  987   QQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
             +     +Y+ S      V     +L T   E+                           R
Sbjct  266   KLHRSLSYRRSHVEERAV--SRNSLCTLCLEE---------------------------R  296

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +H TATPCGH+FCW CI +WC+ K ECPLCR       LV L H
Sbjct  297   RHSTATPCGHLFCWECITQWCDTKAECPLCREKFPPQKLVYLRH  340



>ref|XP_010350891.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Rhinopithecus 
roxellana]
Length=326

 Score =   110 bits (274),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 103/335 (31%), Positives = 147/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +     S        R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DGGRP------SQGSLVPGRRSCSGVRRWVRHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLSCLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPLQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_001261348.1| peroxisome biosynthesis protein (Peroxin-10), putative [Neosartorya 
fischeri NRRL 181]
 gb|EAW19451.1| peroxisome biosynthesis protein (Peroxin-10), putative [Neosartorya 
fischeri NRRL 181]
Length=377

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 93/335 (28%), Positives = 144/335 (43%), Gaps = 26/335 (8%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P   RRA +I 
Sbjct  61    GARFAHIHSDAIKHLTEILYFSLTTLIGNRTLGEEYCDLVQLEDDTLQLPAIHRRAGYIL  120

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VP+  +R+                         +        + +     +  +A 
Sbjct  121   SSILVPWALQRI--------------------LPGFRQRLRAKLERSIARQQLKAQQKAE  160

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQL--VIRANLMFFYFEGLYYHLSKRAS  839
                 ++     ++ +  A++    +L     I  L  +   ++  FYF G YYHLSKR  
Sbjct  161   ELRFTKKNASKKQSFFTALRVQKYILEHLDSITSLSPIYALSIATFYFTGSYYHLSKRFW  220

Query  840   GIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
             G+RYVF  K     QR  Y++LG  L++Q+ +     +R+            +T     +
Sbjct  221   GLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGILHIRKLGLSMQQEGEGIETEVAGSK  280

Query  1014  TSSGRGVPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATP  1187
             T     +  +    NL  + A + +     + +      +   SKC+LCL   + P+ T 
Sbjct  281   THDDSLIRSIQNPYNLPLLPASAARYDLAEDSNVIPWIPSGQQSKCTLCLELYKDPSVTT  340

Query  1188  CGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             CGHVFCW CI +W  EKPECPLCR     S ++ L
Sbjct  341   CGHVFCWTCIRDWVREKPECPLCRQEVIPSKVLPL  375



>ref|XP_003279762.1| PREDICTED: peroxisome biogenesis factor 10 isoform 1 [Nomascus 
leucogenys]
Length=326

 Score =   110 bits (274),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 148/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRTHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P   +     R  +     +      R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRPLQGSLVPGGRGCSGARRWM------RHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + K       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRK-------ALLRAVFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +       +S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RASLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.3 bits (64),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    AGPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_009318833.1| PREDICTED: peroxisome biogenesis factor 10 [Pygoscelis adeliae]
Length=332

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 140/344 (41%), Gaps = 70/344 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRA+F+ 
Sbjct  43    GAKKWLEWRREIELLSDVAYFVLTTLSGYQTLGEEYVNIVQVDSTKKRVPSFLRRAIFVS  102

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T VPY  E+    +  +   L    D+S                         TS++ 
Sbjct  103   LHTVVPYCLEKGLLHLEHE---LQIEPDES------------------------RTSQSS  135

Query  666   PSVLSRFKTKIRECWLHA---------VQRWPSVLPLAREILQLVIRANLMFFYFEGLYY  818
             P++    +T IR  W+            +R    + + ++ + L+ R +L  FY  G +Y
Sbjct  136   PALGLASRTLIRN-WIQKQVGELTEQQKKRVLQTVYVLKQCIPLLHRLHLAVFYIRGTFY  194

Query  819   HLSKRASGIRYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasa  986
             HLSKR +GI Y+      G+  + R  Y+ LG   L  L +     +             
Sbjct  195   HLSKRITGITYLHFGGLQGEDRSIRSSYKFLGIISLFHLLLTIGVQMYSFKQKQRARQEW  254

Query  987   QQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
             +      +  ++ +G        +    + E+                            
Sbjct  255   KLHRNLAHHKNTTKG-KTTGRHSHCTLCLEER----------------------------  285

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +H TATPCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  286   RHTTATPCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  329



>gb|EHH14244.1| hypothetical protein EGK_00134 [Macaca mulatta]
Length=295

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 148/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  7     GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  66

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P   +     R  +     +      R H
Sbjct  67    LHAVLPYLLDKVLLPLEQE--LQADP-DSGRPLQGSLVPGGRGCSGVRRWV------RRH  117

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  118   TATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  167

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  168   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  210

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  211   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  258

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  259   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  293



>ref|XP_003891043.1| PREDICTED: peroxisome biogenesis factor 10 isoform X3 [Papio 
anubis]
Length=326

 Score =   109 bits (272),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERVVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_001083901.2| PREDICTED: peroxisome biogenesis factor 10 isoform 1 [Macaca 
mulatta]
Length=326

 Score =   109 bits (272),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLTCLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>emb|CAG46874.1| PEX10 [Homo sapiens]
 gb|AAX36626.1| peroxisomal biogenesis factor 10 [synthetic construct]
Length=326

 Score =   108 bits (271),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 147/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P   +     R  +     +      R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRPLQGSLGPGGRGCSGARRWM------RHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+    + R   L AV        + R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLT---EQQRRALLRAVF-------VLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +       +S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RASLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 30.0 bits (66),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A+ PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ARPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_004365772.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW40376.1| hypothetical protein CAOG_00901 [Capsaspora owczarzaki ATCC 30864]
Length=406

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 99/194 (51%), Gaps = 20/194 (10%)
 Frame = +3

Query  741   LPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPT--NQRPRYQILGFF--  908
             +P+ R+ ++ + RA+L FFYF GLY H++ R   IRY+   K      RP Y++LG    
Sbjct  220   IPIVRDAIEGLHRAHLAFFYFTGLYSHITWRTLSIRYIMTRKLDIGESRPSYRLLGLLSS  279

Query  909   --LLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEK  1082
               LLV L +     L    + S    +    P    +  S    PV +++ N      ++
Sbjct  280   VQLLVTLILWLKPRLAALYASSHATPAHGTNPASVDRMHSQTENPVESDDEN------DR  333

Query  1083  GsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRS  1262
             G    +  ++S+      +        R++PT TPCGH+FCW CI EWC  KPECPLCR 
Sbjct  334   GDEDDDIPASSKCSLCLAA--------RENPTVTPCGHLFCWKCIAEWCTTKPECPLCRQ  385

Query  1263  PATHSSLVCLYHSD  1304
             PA+ S L C+Y+ D
Sbjct  386   PASLSRLCCIYNYD  399



>emb|CAF90846.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=319

 Score =   107 bits (268),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 104/334 (31%), Positives = 147/334 (44%), Gaps = 59/334 (18%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G++  + ++ E +LL  + YF LTT +  QTLGEEY    QV       P+ +RR+ FIF
Sbjct  38    GSKNWLNWRREIELLADLSYFSLTTFSAYQTLGEEYVHIIQVDPSKCHIPSRSRRSFFIF  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                  PYL +++        ++L+   DD+        S  R++  +          R+ 
Sbjct  98    CHIFFPYLLDKI-------LVSLESHLDDA--------SHERLQTVSPWWSLELWLRRSI  142

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
               VL       R   L      P+V  L +  L L+ R ++  FY  G +Y+LSKR SGI
Sbjct  143   QKVLGLMSESQRRTCL------PTVFILQQN-LSLLHRLHVALFYIFGYFYYLSKRVSGI  195

Query  846   RYVFIG--KPTNQ---RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTY  1010
              ++      P +    R  Y++LG   LVQL I                           
Sbjct  196   THLHATGLNPNSDGSIRSSYRLLGMASLVQLLIT-----------------------ACL  232

Query  1011  QTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPC  1190
             Q SS R    L +  N      + G      +    S  S +S+C LCL  R++ T+TPC
Sbjct  233   QFSSYR----LRQRSN-----QDWGFLRKLSTHHKSSSTSRVSRCILCLEDRRNSTSTPC  283

Query  1191  GHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             GH+FCW CI EWCN K ECPLCR       LV L
Sbjct  284   GHLFCWECITEWCNTKAECPLCREKFQPQRLVYL  317


 Score = 30.8 bits (68),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSIN  250
            A Q +++R+++KDE Y   +  +  +AF+ + GS   +N
Sbjct  6    ANQAQLVRSSQKDEHYRSLIKNSVNEAFQSVAGSKNWLN  44



>ref|NP_002608.1| peroxisome biogenesis factor 10 isoform 2 [Homo sapiens]
 sp|O60683.1|PEX10_HUMAN RecName: Full=Peroxisome biogenesis factor 10; AltName: Full=Peroxin-10; 
AltName: Full=Peroxisomal biogenesis factor 10; 
AltName: Full=Peroxisome assembly protein 10; AltName: Full=RING 
finger protein 69 [Homo sapiens]
 gb|AAC18133.1| peroxisome assembly protein PEX10 [Homo sapiens]
 dbj|BAA87895.1| peroxisome biogenesis factor (peroxin) 10 [Homo sapiens]
 gb|AAH18198.1| Peroxisomal biogenesis factor 10 [Homo sapiens]
 gb|EAW56105.1| peroxisome biogenesis factor 10, isoform CRA_a [Homo sapiens]
 gb|EAW56106.1| peroxisome biogenesis factor 10, isoform CRA_a [Homo sapiens]
 dbj|BAG54100.1| unnamed protein product [Homo sapiens]
 gb|AIC63103.1| PEX10, partial [synthetic construct]
Length=326

 Score =   108 bits (270),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 147/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P   +     R  +     +      R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRPLQGSLGPGGRGCSGARRWM------RHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+    + R   L AV        + R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLT---EQQRRALLRAVF-------VLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +       +S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RASLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>gb|KFM56842.1| Peroxisome biogenesis factor 10, partial [Stegodyphus mimosarum]
Length=298

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 88/337 (26%), Positives = 135/337 (40%), Gaps = 89/337 (26%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARR----A  473
             G  + + +++ + L   +L++ LTT +G QTLGEEY +  QV       P+  +R    +
Sbjct  39    GIPIWIKWKDFSSLFSDLLFYSLTTLSGFQTLGEEYANIIQVDASLKSIPSKLKRTADVS  98

Query  474   LFIFYQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassst  653
             L IF    + +  + + + I+S         +DS+                         
Sbjct  99    LHIFGSYFLLHFQKWLENEISSLPTGTSKSSNDSFE------------------------  134

Query  654   sRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKR  833
                                    +   + +P   +I+ ++ R +L+ FYF G YY  SKR
Sbjct  135   -----------------------ENLLAFIPTIFKIISVIQRIHLIAFYFSGAYYTFSKR  171

Query  834   ASGIRYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              + IRYV I      P  Q+P Y+ILG+    QLC+     +   S    +    + +  
Sbjct  172   LTCIRYVVIRRWLAHPAYQKP-YRILGWIAASQLCLSLIMTMYSASMKDPL----KYSKL  226

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
                + S+    PV   E +L +   EK                           R H TA
Sbjct  227   EKVKDSTSTSAPV--PEKSLCSLCLEK---------------------------RNHSTA  257

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             TPCGH+FCW+CI  W   K ECPLCR   T S L+CL
Sbjct  258   TPCGHLFCWSCITSWMQNKEECPLCREKFTPSKLLCL  294



>gb|EEQ91881.1| peroxisome biosynthesis protein [Blastomyces dermatitidis ER-3]
Length=364

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 98/331 (30%), Positives = 154/331 (47%), Gaps = 29/331 (9%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARR  +I 
Sbjct  59    GARFAHSHTDAIKNLTDLLYLSLTTLVGNRTLGEEYCDVVQLEDDSLRLPSLARRVGYIL  118

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  +R+   +  +                  + S     + A+ ++S   + + 
Sbjct  119   SSILIPWALQRLLPALRQK-------------LRAKLQRSVARLQARAALLSSKQETPSK  165

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             P++  RF+T +    L  +    S+ P        +   NL  FYF G YYH+SKR  G+
Sbjct  166   PNLTLRFQTYV----LDHLDSLTSLSP--------IFALNLAAFYFSGAYYHISKRIWGL  213

Query  846   RYVFIGKPTNQRPR--YQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF  +  +   R  Y++LG  +L+ L I     L  + ++SS  A   +    + Q +
Sbjct  214   RYVFTKRIEDNEARIGYEVLG--VLLVLQIAVQGILHVKDTVSSFTAETAENQQSSDQKT  271

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             + + +       +L  + +         +  +        KC+LCL S + P+AT CGHV
Sbjct  272   ALKAIYYPPSLQSLPASEARYDMANPTNAVLAWVPPGQQRKCTLCLESFKDPSATTCGHV  331

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             FCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  332   FCWTCIRDWVREKPECPLCRQEALGSKILPL  362



>ref|XP_002621786.1| peroxisomal integral membrane protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ73790.1| peroxisomal integral membrane protein [Blastomyces dermatitidis 
SLH14081]
Length=364

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 155/331 (47%), Gaps = 29/331 (9%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARR  +I 
Sbjct  59    GARFAHSHTDAIKNLTDLLYLSLTTLVGNRTLGEEYCDVVQLEDDSLRLPSLARRVGYIL  118

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  +R+   +  +               V  + S     + A+ ++S   + + 
Sbjct  119   SSILIPWALQRLLPALRQK-------------LRVKLQRSVARLQARAALLSSKQETPSK  165

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             P++  RF+T +    L  +    S+ P        +   NL  FYF G YYH+SKR  G+
Sbjct  166   PNLTLRFQTYV----LDHLDSLTSLSP--------IFALNLAAFYFSGAYYHISKRIWGL  213

Query  846   RYVFIGKPTNQRPR--YQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF  +  +   R  Y++LG  +L+ L I     L  + ++SS  A   +    + Q +
Sbjct  214   RYVFTKRIEDNEARIGYEVLG--VLLVLQIAVQGILHVKDTVSSFTAETAENQQSSDQKT  271

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             + + +       +L  + +         +  +        KC+LCL S + P+AT CGHV
Sbjct  272   ALKAIYYPPSLQSLPASEARYDMANPTNAVLAWVPPGQQRKCTLCLESFKDPSATTCGHV  331

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             FCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  332   FCWTCIRDWVREKPECPLCRQEALGSKILPL  362



>ref|XP_003807348.1| PREDICTED: peroxisome biogenesis factor 10 [Pan paniscus]
Length=326

 Score =   108 bits (269),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P      S   +         +    R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRP------SQGSLGPGGRGCSGARRWMRHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+    + R   L AV        + R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLT---EQQRRALLRAVF-------ILRQGLACLQRLHVAWFYIHGVFYHLAKRLAGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRVLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +       +S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RASLEERAISRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_004024555.1| PREDICTED: peroxisome biogenesis factor 10 isoform 1 [Gorilla 
gorilla gorilla]
Length=326

 Score =   108 bits (269),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 147/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRTHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P      S   +         +    R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRP------SQGSLVPGGHGCSGARRWMRHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRSVFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSMGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +       +S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RASLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_001213484.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU34753.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=372

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 100/345 (29%), Positives = 154/345 (45%), Gaps = 47/345 (14%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFI-  482
             G RVA AY    K L ++LYF LTT  G +TLGEEYCD  Q+       P+ ARRA +I 
Sbjct  57    GARVAHAYSETIKNLTELLYFSLTTLIGNRTLGEEYCDLVQLEDDTLQLPSIARRAGYIV  116

Query  483   -------FYQTAVPYLAERVSSR----IASQGITLDDPFDDSYPFsvasesssrveasta  629
                      Q  +P   +R+ ++    IA Q        ++                   
Sbjct  117   SSILLPWMLQKVLPAFRQRLRAKLERSIARQQFRAQQAKEE-------------------  157

Query  630   seiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEG  809
                +S S  +  P +    K ++++  L  +    S+ P        +   ++  FYF G
Sbjct  158   -LKSSKSKPQQQPLIT---KLRVQKYILEHLDSITSLSP--------IYALSIATFYFTG  205

Query  810   LYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaas  983
              YYHLSKR  G+RYVF  K     QR  Y++LG  L++Q+ +     +R+          
Sbjct  206   SYYHLSKRFWGLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGILHVRKVGESLRQEDE  265

Query  984   aQQTPFGTYQTSSGRGVPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslcl  1157
                +    ++  +G  +  +    +L  + A   +     + S+     +   SKC+LCL
Sbjct  266   NAGSESPGFKDRAGSLIKSIENPSSLPLLPASEPRYDLEEDASAIPWIPSGQQSKCTLCL  325

Query  1158  ssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              + + P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  326   ETFKDPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPL  370



>gb|KFP08335.1| Peroxisome biogenesis factor 10, partial [Calypte anna]
Length=326

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 89/344 (26%), Positives = 139/344 (40%), Gaps = 70/344 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT +G QTLGEEY +  QV       P+  +RA+F+ 
Sbjct  37    GAKRWLEWRREVELLSDVAYFTLTTLSGYQTLGEEYVNIVQVDSTKKRVPSFLQRAIFVS  96

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T +PY  E+    +  +  T  D    S                           +++
Sbjct  97    LHTVLPYCLEKGLLHLEHELQTEPDESRTS---------------------------QSN  129

Query  666   PSVLSRFKTKIRECWLH------AVQRWPSVLPLA---REILQLVIRANLMFFYFEGLYY  818
             P++    +T IR  W+         Q+  +VL +    ++ + L+ R +L  FY  G +Y
Sbjct  130   PALGLSSRTLIRN-WIRKQVGDLTEQQKKTVLQIVYVLKQSIPLLHRLHLAAFYISGTFY  188

Query  819   HLSKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasa  986
             HLSKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             
Sbjct  189   HLSKRIAGITYLHFGGLQGEDESIRSSYKFLGIISLFHLLLTIGVQMYSFKQRQRARQEW  248

Query  987   QQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
             +     T+Q +S +   +          + +                            R
Sbjct  249   KLHRSLTHQKNSTKE-KITGRHSRCTLCLED----------------------------R  279

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +H TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  280   RHATATPCGHLFCWECITAWCNTRTECPLCREKFHPQKLIYLRH  323



>ref|XP_008501816.1| PREDICTED: peroxisome biogenesis factor 10 [Calypte anna]
Length=325

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 89/344 (26%), Positives = 139/344 (40%), Gaps = 70/344 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT +G QTLGEEY +  QV       P+  +RA+F+ 
Sbjct  36    GAKRWLEWRREVELLSDVAYFTLTTLSGYQTLGEEYVNIVQVDSTKKRVPSFLQRAIFVS  95

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T +PY  E+    +  +  T  D    S                           +++
Sbjct  96    LHTVLPYCLEKGLLHLEHELQTEPDESRTS---------------------------QSN  128

Query  666   PSVLSRFKTKIRECWLH------AVQRWPSVLPLA---REILQLVIRANLMFFYFEGLYY  818
             P++    +T IR  W+         Q+  +VL +    ++ + L+ R +L  FY  G +Y
Sbjct  129   PALGLSSRTLIRN-WIRKQVGDLTEQQKKTVLQIVYVLKQSIPLLHRLHLAAFYISGTFY  187

Query  819   HLSKRASGIRYVFIG----KPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasa  986
             HLSKR +GI Y+  G    +  + R  Y+ LG   L  L +     +             
Sbjct  188   HLSKRIAGITYLHFGGLQGEDESIRSSYKFLGIISLFHLLLTIGVQMYSFKQRQRARQEW  247

Query  987   QQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
             +     T+Q +S +   +          + +                            R
Sbjct  248   KLHRSLTHQKNSTKE-KITGRHSRCTLCLED----------------------------R  278

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +H TATPCGH+FCW CI  WCN + ECPLCR       L+ L H
Sbjct  279   RHATATPCGHLFCWECITAWCNTRTECPLCREKFHPQKLIYLRH  322



>gb|EGE81192.1| peroxisome biosynthesis protein [Blastomyces dermatitidis ATCC 
18188]
 gb|EQL34926.1| hypothetical protein BDFG_03359 [Blastomyces dermatitidis ATCC 
26199]
Length=364

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 98/331 (30%), Positives = 154/331 (47%), Gaps = 29/331 (9%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARR  +I 
Sbjct  59    GARFAHSHTDAIKNLTDLLYLSLTTLVGNRTLGEEYCDVVQLEDDSLRLPSLARRVGYIL  118

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  +R+   +  +                  + S     + A+ ++S   + + 
Sbjct  119   SSILIPWALQRLLPALRQR-------------LRAKLQRSVARLQARAALLSSKQETPSK  165

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             P++  RF+T +    L  +    S+ P        +   NL  FYF G YYH+SKR  G+
Sbjct  166   PNLTLRFQTYV----LDHLDSLTSLSP--------IFALNLAAFYFSGAYYHISKRIWGL  213

Query  846   RYVFIGKPTNQRPR--YQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF  +  +   R  Y++LG  +L+ L I     L  + ++SS  A   +    + Q +
Sbjct  214   RYVFTKRIEDNEARIGYEVLG--VLLVLQIAVQGILHVKDTVSSFTAETAENQQSSDQKT  271

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             + + +       +L  + +         +  +        KC+LCL S + P+AT CGHV
Sbjct  272   ALKAIYYPPSLQSLPASEARYDMANPTNAVLAWVPPGQQRKCTLCLESFKDPSATTCGHV  331

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             FCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  332   FCWTCIRDWVREKPECPLCRQEALGSKILPL  362



>ref|XP_513729.2| PREDICTED: peroxisome biogenesis factor 10 [Pan troglodytes]
Length=326

 Score =   107 bits (267),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P      S   +         +    R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRP------SQGSLGPGGRGCSGARRWMRHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+    + R   L AV        + R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLT---EQQRRALLRAVF-------VLRQGLACLQRLHVAWFYIHGVFYHLAKRLAGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +       +S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RASLEERAISRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>gb|EEH21627.1| hypothetical protein PABG_03843 [Paracoccidioides brasiliensis 
Pb03]
Length=365

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 144/340 (42%), Gaps = 44/340 (13%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARR  +I 
Sbjct  57    GARFAHSHTDAIKNLTDLLYLSLTTLVGNRTLGEEYCDVVQLEDDSLQLPSLARRVGYIL  116

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  + +   +  +               +  + +     + A+  +S   + + 
Sbjct  117   SSILIPWALQHLLPALRQK-------------LRIKLQHNIIRLQAKAALASSKQGAPST  163

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             PS+  RF+      +L  +    S        L L+   NL  FYF G YYH+SKR  G+
Sbjct  164   PSLTLRFQNY----FLDHLDSLTS--------LSLIFALNLTAFYFSGAYYHISKRIWGL  211

Query  846   RYVFIGKPTNQRPR--YQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF  +  +   R  Y++LG  L++Q+ +     ++   S  +      +T     Q+ 
Sbjct  212   RYVFTKRIEDNEARIGYEVLGVLLVLQITVQGVLYVKDTISSFTT-----ETAIDQQQSQ  266

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQ---------H  1172
             +    P L    ++ T  S +     E      S  +           R+          
Sbjct  267   TSNDKPSLK---SIYTPPSIQSLPAGEARYDVASSNNAALAWVPPGQQRKCTLCLDPYKD  323

Query  1173  PTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             P+   CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  324   PSIVTCGHVFCWTCIRDWVREKPECPLCRQEALGSKILPL  363



>ref|XP_009211722.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Papio 
anubis]
Length=361

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  73    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  132

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  133   LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  183

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  184   TATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  233

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  234   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  276

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  277   RQRAR------KEWRLHRGLSHR------RGSLEERVVSRNPLCTLCLEERRHPTATPCG  324

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  325   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  359



>emb|CDH49797.1| fumarylacetoacetate hydrolase family protein [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=681

 Score =   104 bits (260),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 145/337 (43%), Gaps = 49/337 (15%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R+   +Q E   L    Y+ LTT  G QTLGEEYCD  QV       P   RRA  +F
Sbjct  63    GSRIQHQWQKEINTLSDFCYYGLTTLLGTQTLGEEYCDLAQVDRYAQGFPGILRRASLVF  122

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T +PY+  R  + +  +                             +  A S+ +   
Sbjct  123   AHTLLPYIYVRGVAELKRR----------------------------RARHARSNNTNNE  154

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIR-ANLMFFYFEGLYYHLSKRASG  842
                +SR    I+  WL         LP  +EI Q  ++  +L  FYF G YY  SKR +G
Sbjct  155   SKAVSRKDQFIQ--WLQPR------LPTLQEIFQKAVQPMHLAIFYFVGAYYSFSKRVTG  206

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQT-------  995
              RY+F  +  P  QR  Y++LG  ++ QL I      ++R          Q+        
Sbjct  207   TRYIFTRQLGPHEQRVGYEVLGVLIVAQLAIQGYLSFKKRMEARRKEQEQQEKLKQEQEA  266

Query  996   ---PFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
                      T S   V V  ++ + +    ++     +       +     KC+LCL  R
Sbjct  267   AAAAIAASSTKSADQVVVAEDDFDFMNEFDDEPKDEDQEEKEFSEEEMQFLKCALCLEPR  326

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHS  1277
             +  TATPCGH+FCW+C++EWC  KPECPLCRS  T+ 
Sbjct  327   KVTTATPCGHLFCWSCVIEWCQNKPECPLCRSSITNE  363


 Score = 30.8 bits (68),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (53%), Gaps = 0/38 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            +FP+  QP+I+RA +KD  Y   + E      +   GS
Sbjct  27   NFPMGAQPDIIRANQKDVYYQTLLQEQMTSVCQQFLGS  64



>ref|NP_001270672.1| peroxisome biogenesis factor 10 [Macaca fascicularis]
 sp|Q8HXW8.1|PEX10_MACFA RecName: Full=Peroxisome biogenesis factor 10; AltName: Full=Peroxin-10; 
AltName: Full=Peroxisomal biogenesis factor 10; 
AltName: Full=Peroxisome assembly protein 10 [Macaca fascicularis]
 dbj|BAC20602.1| Peroxisome assembly protein 10 [Macaca fascicularis]
Length=326

 Score =   105 bits (263),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 100/335 (30%), Positives = 146/335 (44%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    +V       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVRVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + + ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLACLQQLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLRL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   HLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  324


 Score = 29.6 bits (65),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_009211821.1| PREDICTED: peroxisome biogenesis factor 10 isoform X4 [Papio 
anubis]
Length=302

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 145/334 (43%), Gaps = 52/334 (16%)
 Frame = +3

Query  309   TRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFY  488
              R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + +  
Sbjct  15    ARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVTL  74

Query  489   QTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHP  668
                +PYL ++V   +  +     DP D   P      S   +              R H 
Sbjct  75    HAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRHT  125

Query  669   SVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIR  848
             + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI 
Sbjct  126   ATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGIT  175

Query  849   YVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
             Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q 
Sbjct  176   YLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQR  218

Query  1017  SSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGH  1196
                R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCGH
Sbjct  219   QRAR------KEWRLHRGLSHR------RGSLEERVVSRNPLCTLCLEERRHPTATPCGH  266

Query  1197  VFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             +FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  267   LFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  300



>ref|XP_003793254.1| PREDICTED: peroxisome biogenesis factor 10 [Otolemur garnettii]
Length=326

 Score =   104 bits (259),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 99/335 (30%), Positives = 143/335 (43%), Gaps = 52/335 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GAKKWLEWRKEIELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQRQVPSLLRRCVLVA  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     D    S+           +              R H
Sbjct  98    LHAILPYLLDKALLPLEQELQAEPDGRRLSH---------GTLVPGGRGRSGVQRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+    + R   L A         + R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLT---EQQRRTLLRAAL-------VFRQGLACLQRLHVAWFYIHGIFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   LV L + A   L                 +G  Q
Sbjct  199   TYLRVRHLPGEDLRARASYRLLGLVSLVHLALSAGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L  ++S +       +S  E  A     C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRSLSHR------RNSLDERIAPRSPLCTLCLEGRRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             H+FCW CI  WC  K ECPLCR       LV L H
Sbjct  290   HLFCWECITAWCTSKTECPLCREKFPPQKLVYLRH  324


 Score = 30.8 bits (68),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEHYRSGLRSAAGGALHSLAGA  39



>ref|XP_004473576.1| PREDICTED: peroxisome biogenesis factor 10 isoform 2 [Dasypus 
novemcinctus]
Length=322

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/336 (26%), Positives = 140/336 (42%), Gaps = 58/336 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  ++YF LTT  G QTLGEEY +  QV   +   P+  RRAL + 
Sbjct  38    GAKKWLEWRKEVELLSDLMYFGLTTLTGCQTLGEEYVNIVQVDPSWRRVPSWPRRALLVA  97

Query  486   YQTAVPYLAERVSSRIASQ-GITLDDPFDDSYPFsvasesssrveastaseiassstsRA  662
               +A+PYL ++    +  +     D P   S                + S        + 
Sbjct  98    LHSALPYLLDKALLLLEHELQADGDRPVQGS------------PGGRSRSAARRWVQRQV  145

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
              P    + +T +R             L + R+ L  + R ++ +FY  G +YH++KR +G
Sbjct  146   APLAEQQKRTLLR------------ALLVVRQGLACLWRLHVAWFYVHGAFYHIAKRLAG  193

Query  843   IRYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTY  1010
             + Y+ + +P  +    R  Y++LG   L+ L +     +   S         +     +Y
Sbjct  194   VSYLQVRRPRAEDLGARAGYKLLGAISLLHLALSVGLQVYSFSQRQRARKEWKLHRNLSY  253

Query  1011  QTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPC  1190
             + SS                V E+    +   +    +             R+H TATPC
Sbjct  254   RRSS----------------VEERAFSRNARCTLCLEE-------------RRHTTATPC  284

Query  1191  GHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             GH+FCW C  EWCN K ECPLCR       LV L H
Sbjct  285   GHLFCWECATEWCNTKAECPLCREKFPPQKLVYLRH  320



>ref|XP_005804908.1| PREDICTED: LOW QUALITY PROTEIN: peroxisome biogenesis factor 
10-like [Xiphophorus maculatus]
Length=323

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 96/322 (30%), Positives = 150/322 (47%), Gaps = 55/322 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G++  + ++ E +LL  + Y+ LTT +G QTLGEEY    QV       P+ ARR LF+ 
Sbjct  38    GSKHWLDWRREVELLSDLAYYGLTTLSGYQTLGEEYVGIVQVDPSRRQIPSRARRCLFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL E+         + L++  +           + R +A++ +        RA 
Sbjct  98    CHAFVPYLLEKAL-------VCLENELEGG-------PEARRRQAASGAWSLEHWLRRAA  143

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S +     + R+    A Q  P+V  + ++ L L+ R ++  FY    +YH+SKRA+GI
Sbjct  144   QSAVGLLTERQRK----ACQ--PAVFVI-QQSLALLHRLHVALFYVSSSFYHMSKRAAGI  196

Query  846   RYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +  P       R  Y++LG    +QL +                         + Q
Sbjct  197   GYLCVAGPNADDSSIRRSYRLLGCVSFLQLLVTL-----------------------SLQ  233

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
              ++ R      +E  L  ++S +          S + AS  ++C LCL +R++ T TPCG
Sbjct  234   LNNLRQRQRARQEWXLYRSLSPR-------HPASSASASRPARCILCLEARRNSTCTPCG  286

Query  1194  HVFCWNCIMEWCNEKPECPLCR  1259
             H+FCW CI EWCN K ECPLCR
Sbjct  287   HLFCWECIAEWCNTKAECPLCR  308



>gb|EPS25914.1| hypothetical protein PDE_00850 [Penicillium oxalicum 114-2]
Length=383

 Score =   105 bits (261),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 154/335 (46%), Gaps = 19/335 (6%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P   RR  +  
Sbjct  60    GARYAHTHSDAIKHLTELLYFSLTTAIGNRTLGEEYCDLVQLEDDTLRLPAITRRVGYTL  119

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VP+  +R+   +  +   +    + S   +     +++  +    +  + ST+ A 
Sbjct  120   SSILVPWSLQRLLPALRQR---VRHKLERS--IAKQQLRAAQQASLLNLKKPAFSTNTAV  174

Query  666   PSVLSRFKTKIR--ECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
                   F TK+R  +  L  +    SV P        +   ++  FYF G YYHLSKR  
Sbjct  175   EKAKKPFFTKLRLQQYLLDHLDSITSVSP--------IYALSIATFYFTGSYYHLSKRIW  226

Query  840   GIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              +RYVF  K   + QR  Y++LG  +++Q+ +     +R+ ++  +          G   
Sbjct  227   RLRYVFTKKIEESEQRIGYEVLGVLMVLQIAVQGFLHVRKLATTMNEEQEDPGAKTGEAS  286

Query  1014  TSSGRGVPVLNEEGN--LITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATP  1187
             + +G  +  +       L+ A S +     +P + +        KC+LCL + + P+ T 
Sbjct  287   SEAGALIATIENPSTVPLLPASSARYDLDVDPGAVAWIPDGQQRKCTLCLEAFKDPSVTT  346

Query  1188  CGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  347   CGHVFCWVCVRDWVREKPECPLCRQEVLISKVLPL  381


 Score = 29.3 bits (64),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+RA EKD   T  + +  +   R L G+ ++
Sbjct  25   YPFATSPDIIRAHEKDAYLTSGLVQQVQSIIRALRGARYA  64



>dbj|GAA89651.1| peroxisome biosynthesis protein (Peroxin-10) [Aspergillus kawachii 
IFO 4308]
Length=378

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 104/342 (30%), Positives = 155/342 (45%), Gaps = 37/342 (11%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  59    GARYAHTHSDAIKHLTEILYFALTTFIGNRTLGEEYCDLVQLEDDTLQLPSLPRRAGYIL  118

Query  486   YQTAVPYLAERV----SSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassst  653
                 +P+  +R+      R+ S+                 S +  + +AS A +      
Sbjct  119   SSILLPWTLQRILPAFRQRLRSK--------------LERSIARQQFKASQAKKTTVEQA  164

Query  654   sRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQL--VIRANLMFFYFEGLYYHLS  827
                  S  + F TK+R      +Q++  +L     I  L  +   ++  FYF G YYHLS
Sbjct  165   KDNKSSKKTSFFTKLR------IQKY--ILEHLDSITSLSPIYAVSIATFYFTGAYYHLS  216

Query  828   KRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
             KR SG+RYVF  K     QR  Y++LG  +L+ L I     L  +   + +    + T  
Sbjct  217   KRFSGLRYVFTKKVEEGEQRVGYEVLG--VLLVLQIAVQGILHIKKVGADLGQENEDTGL  274

Query  1002  ---GTYQTSSGRGVPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslclssR  1166
                   +   G  +P L    +L  + A + +  F  +  +          KC+LCL   
Sbjct  275   EADAGMKQYGGSLIPSLENPSSLPLLPASAARYDFSEDSHAIPWIPEGQQRKCTLCLELF  334

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             + P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  335   KDPSVTTCGHVFCWTCVRDWVREKPECPLCRQEVLLSKVLPL  376



>ref|XP_004351716.1| RING zinc finger-containing protein [Dictyostelium fasciculatum]
 gb|EGG14996.1| RING zinc finger-containing protein [Dictyostelium fasciculatum]
Length=371

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 102/192 (53%), Gaps = 20/192 (10%)
 Frame = +3

Query  723   QRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRPRYQILG  902
             QR+P++  + +E L  + R +L  FYF G YY  SKR S IRY+F  K   +RP+Y ILG
Sbjct  199   QRFPNLYSV-KEFLPKLERFHLALFYFSGSYYEFSKRLSNIRYIFNRKVDQRRPKYHILG  257

Query  903   FFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEK  1082
             F +++QL +     L             ++  F  ++ +    V  L+      ++ S  
Sbjct  258   FLIIIQLFVSLFIYL-------------KENNFFIFKKNEDLNVESLD------SSTSTN  298

Query  1083  GsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRS  1262
                     S   ++ S   KC+LCL +R+H T+T CGH+FCW C+ EWCN K ECPLCR 
Sbjct  299   SGGSGSSGSGINNEESSSGKCTLCLENRKHTTSTICGHLFCWYCLAEWCNTKEECPLCRR  358

Query  1263  PATHSSLVCLYH  1298
             P T  SL+  Y+
Sbjct  359   PITLRSLIPTYN  370


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R  +  QNE+KL+  + YF+LTT  G QTLGEEYC+  Q+       P+   R   +F
Sbjct  122  GPRFIMNKQNESKLVSNLSYFILTTLLGSQTLGEEYCNLRQIKNNSFSLPSIIDRCRLMF  181

Query  486  YQTAVPYLAER  518
            YQ   PYL ++
Sbjct  182  YQLLAPYLIKK  192



>ref|XP_006804329.1| PREDICTED: peroxisome biogenesis factor 10-like [Neolamprologus 
brichardi]
Length=322

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 96/323 (30%), Positives = 143/323 (44%), Gaps = 56/323 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R  +  + E +LL  + YF LTT  G QTLGEEY +  QV       P+PARR +F+ 
Sbjct  38    GSRRWLECRKEIELLSDLAYFGLTTFLGYQTLGEEYVNIVQVDPTKRQIPSPARRGVFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL +++        + L++  +         +  S   +  +        + A 
Sbjct  98    CHAFVPYLLDKLL-------VCLENELEGGQESRRRQQVGSVPWSLESWLRRWVQKAAAL  150

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R     R C L+AV        + ++ L L+ R +   FY  G ++HLSKR + I
Sbjct  151   CSEPQR-----RAC-LNAV-------FVLQQSLTLLYRLHSALFYVSGSFHHLSKRVADI  197

Query  846   RYV-FIGKPTNQR---PRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+  +G  +N       Y++LG   L+QL I                           Q
Sbjct  198   SYMRVVGLNSNDSTVGSSYRLLGVMSLLQLLITV-----------------------CLQ  234

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
              ++ R      +E +L   +S +           +S +   + C LCL  R+H T+TPCG
Sbjct  235   LNNFRQRQRARQEWSLHRKLSPQ---------HRQSSSRRAALCILCLEERRHSTSTPCG  285

Query  1194  HVFCWNCIMEWCNEKPECPLCRS  1262
             H+FCW CI EWCN K ECPLCR 
Sbjct  286   HLFCWECITEWCNTKAECPLCRD  308



>gb|EKV05563.1| Peroxin 10 [Penicillium digitatum Pd1]
 gb|EKV18144.1| Peroxin 10 [Penicillium digitatum PHI26]
Length=375

 Score =   104 bits (259),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 99/341 (29%), Positives = 148/341 (43%), Gaps = 38/341 (11%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +I 
Sbjct  59    GARYAHTHSDAIKHLTELLYFTLTTAIGNRTLGEEYCDLIQLEDDTLQLPSIGRRVGYIL  118

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VP+  +R+         TL   F +    ++A       + +        ST+   
Sbjct  119   SSILVPWTLQRLLP-------TLRQKFRNKLERNIARIQLRAAKQAGLLHKPQFSTTPTK  171

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
               + +  K +I++  L  +    S+ P        +   ++  FYF G YYHLSKR   +
Sbjct  172   RPLFT--KLRIQQYLLEHLDSITSLSP--------IYALSIATFYFTGSYYHLSKRLWRL  221

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLC----IlaaeglrrrsslssiaasaQQTP---  998
             RYVF  K     QR  Y++LG  L++Q+     + A +     +   S +A A Q+P   
Sbjct  222   RYVFTKKIDDNEQRIGYEVLGVLLVLQIAVQGFLHARKLGASLNEDESHSADAGQSPGQD  281

Query  999   ---FGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQ  1169
                  + QT S   +P+L     L     + G+    P          L          +
Sbjct  282   GAVLASIQTPST--IPLLPASVPLYDLEDDPGAVSWMPEGQQRKCTLCLEMF-------K  332

Query  1170  HPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  333   DPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPL  373


 Score = 27.7 bits (60),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  + +  +   R L G+ ++
Sbjct  24   YPFATSPDIIRSHEKDAYLTGSLIQQSQGIVRALRGARYA  63



>ref|XP_004545992.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X1 [Maylandia 
zebra]
 ref|XP_005942778.1| PREDICTED: peroxisome biogenesis factor 10-like [Haplochromis 
burtoni]
Length=322

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 143/327 (44%), Gaps = 64/327 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R  + ++ E +LL  + YF LTT  G QTLGEEY +  QV       P+PARR +F+ 
Sbjct  38    GSRRWLEWRKEIELLSDLAYFGLTTFLGYQTLGEEYVNIVQVDPTKRQIPSPARRGVFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL +++        + L++  +         +  S   +  +        + A 
Sbjct  98    CHAFVPYLLDKLL-------VCLENELEGGQESRRRQQVGSVPWSLESWLRRWVQKAAAL  150

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R     R C L+AV        + ++ L L+ R +   FY  G ++HLSKR + I
Sbjct  151   CSEPQR-----RAC-LNAV-------FVLQQSLTLLYRLHSALFYVSGSFHHLSKRVADI  197

Query  846   RYV-FIGKPTNQR---PRYQILGFF----LLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              Y+  +G  +N       Y++LG      LL+ +C+      +R+ +    +   + +P 
Sbjct  198   SYMRVVGLNSNDSTVGSSYRLLGVMSLLQLLITVCLQLNNFRQRQRARQEWSLHRKLSP-  256

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
               ++ SSG    +       I  + E                            R+H T+
Sbjct  257   -QHRQSSGPRAALC------ILCLEE----------------------------RRHSTS  281

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRS  1262
             TPCGH+FCW CI EWCN K ECPLCR 
Sbjct  282   TPCGHLFCWECITEWCNTKAECPLCRD  308



>ref|XP_008316784.1| PREDICTED: peroxisome biogenesis factor 10 [Cynoglossus semilaevis]
Length=326

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 96/331 (29%), Positives = 148/331 (45%), Gaps = 70/331 (21%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G++  + ++ E +LL  ++Y+ LTT +G QTLGEEY    QV       P+  RR LF+ 
Sbjct  38    GSKRWLDWRKEIELLSDLVYYGLTTLSGYQTLGEEYVSIVQVDPTKRRIPSRVRRTLFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++         + L++  +                      I+S    R  
Sbjct  98    CHAFLPYLLDKFL-------VCLENELERE-----------------QEGISSVRRRRHE  133

Query  666   PSVLSRFKTKIRECWLHAV------QRWPSVLP---LAREILQLVIRANLMFFYFEGLYY  818
              S     ++ +R     AV      QR  + LP   +  + L L+ R ++  FY  G +Y
Sbjct  134   ASTTCSLESWLRRWIQRAVGLLSESQR-RACLPATFVLHQGLTLLHRFHVALFYISGSFY  192

Query  819   HLSKRASGIRYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasa  986
             HLS+R +GI Y+ +  P +     R  Y++LG   L+QL I                   
Sbjct  193   HLSRRMAGISYLRVMGPDSVDGTIRNSYKLLGAVSLLQLLITV-----------------  235

Query  987   QQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
                   + Q ++ R      +E  L   +S +          S+S +  +++C LCL  R
Sbjct  236   ------SLQLNNLRQRQRARKEWKLYRNLSPQ---------RSDSSSPRVARCILCLEER  280

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
             +H T+TPCGH+FCW CI EWCN K ECPLCR
Sbjct  281   RHSTSTPCGHLFCWECITEWCNTKAECPLCR  311



>ref|XP_005745920.1| PREDICTED: peroxisome biogenesis factor 10-like [Pundamilia nyererei]
Length=322

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 142/327 (43%), Gaps = 64/327 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT  G QTLGEEY +  QV       P+PARR +F+ 
Sbjct  38    GARRWLEWRKEIELLSDLAYFGLTTFLGYQTLGEEYVNIVQVDPTKRQIPSPARRGVFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL +++        + L++  +         +  S   +  +        + A 
Sbjct  98    CHAFVPYLLDKLL-------VCLENELEGGQESRRLQQVGSVPWSLESWLRRWVQKAAAL  150

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R     R C L+AV        + ++ L L+ R +   FY  G ++HLSKR + I
Sbjct  151   CSEPQR-----RAC-LNAV-------FVLQQSLTLLYRLHSALFYVSGSFHHLSKRVADI  197

Query  846   RYV-FIGKPTNQR---PRYQILGFF----LLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              Y+  +G  +N       Y++LG      LL+ +C+      +R+ +    +   + +P 
Sbjct  198   SYMRVVGLNSNDSTVGSSYRLLGVMSLLQLLITVCLQLNNFRQRQRARQEWSLHRKLSP-  256

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
               ++ SSG    +       I  + E                            R+H T+
Sbjct  257   -QHRQSSGPRAALC------ILCLEE----------------------------RRHSTS  281

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRS  1262
             TPCGH+FCW CI EWCN K ECPLCR 
Sbjct  282   TPCGHLFCWECITEWCNTKAECPLCRD  308



>ref|XP_003279763.1| PREDICTED: peroxisome biogenesis factor 10 isoform 2 [Nomascus 
leucogenys]
Length=346

 Score =   101 bits (252),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 102/355 (29%), Positives = 147/355 (41%), Gaps = 72/355 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRTHVPSSLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++    +  +     DP D   P   +     R  +     +      R H
Sbjct  98    LHAVLPYLLDKALLPLEQE--LQADP-DSGRPLQGSLVPGGRGCSGARRWM------RHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + K       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRK-------ALLRAVFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI------------------------GKPTNQRPRYQILGFFLLVQLCIlaaeglrr  953
              Y  +                        G+    R  Y++LG   L+ L +     L  
Sbjct  199   TYQVLRPDPLRVLMGVAPSVLQLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL--  256

Query  954   rsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasg  1133
                            +G  Q    R      +E  L   +S +       +S  E   S 
Sbjct  257   ---------------YGFRQRQRAR------KEWRLHRGLSHR------RASLEERAVSR  289

Query  1134  lskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
                C+LCL  R+HPTATPCGH+FCW CI  WC+ K ECPLCR       L+ L H
Sbjct  290   NPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRH  344


 Score = 29.6 bits (65),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    AGPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_749083.1| peroxisome biosynthesis protein (Peroxin-10) [Aspergillus fumigatus 
Af293]
 gb|EAL87045.1| peroxisome biosynthesis protein (Peroxin-10), putative [Aspergillus 
fumigatus Af293]
Length=377

 Score =   104 bits (259),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 93/343 (27%), Positives = 146/343 (43%), Gaps = 42/343 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P   RRA +I 
Sbjct  61    GARFAHIHSDAIKHLTEILYFSLTTLIGNRTLGEEYCDLVQLEDDTLQLPAIHRRAGYIL  120

Query  486   --------YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseia  641
                      Q  +P   +R+ +++  + I+  +                           
Sbjct  121   SSILVPWALQRILPGFRQRLRAKL-ERSISRQE---------------------------  152

Query  642   ssstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQL--VIRANLMFFYFEGLY  815
               +  +A     ++     +  +  A++    +L     I  L  +   ++  FYF G Y
Sbjct  153   LKAQQKAEELRFTKKNASKKPSFFTALRLQKYILEHLDSITSLSPIYALSIATFYFTGSY  212

Query  816   YHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQ  989
             YHLSKR  G+RYVF  K     QR  Y++LG  L++Q+ +     +R+            
Sbjct  213   YHLSKRFWGLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGILHIRKLGLSMQQGGEGI  272

Query  990   QTPFGTYQTSSGRGVPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslclss  1163
             +T     +      +  +    NL  + A + +     + +      +   SKC+LCL  
Sbjct  273   ETEMAGSKMQDDSLIRSIQNPYNLPLLPASAARYDLSEDSNVIPWIPSGQQSKCTLCLEL  332

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              + P+ T CGHVFCW CI +W  EKPECPLCR     S ++ L
Sbjct  333   YKDPSVTTCGHVFCWTCIRDWVREKPECPLCRQEVIPSKVLPL  375


 Score = 26.6 bits (57),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  +    +   R L G+ F+
Sbjct  26   YPFATSPDIIRSNEKDIFITSSLVNQAQAIIRSLRGARFA  65



>emb|CDS04176.1| hypothetical protein LRAMOSA07131 [Absidia idahoensis var. thermophila]
Length=313

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 145/335 (43%), Gaps = 44/335 (13%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R+   +Q E        Y+ LTT  G QTLGEEYCD  QV       P   RRA  +F
Sbjct  10    GSRMQHQWQKEINTFSDFCYYGLTTLLGTQTLGEEYCDLAQVDRYAQGFPGILRRASLVF  69

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T +PY+  R  + +  +                                A ++ +   
Sbjct  70    AHTLLPYIYVRGVAELKRRRARH----------------------------ARNNNNNNE  101

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIR-ANLMFFYFEGLYYHLSKRASG  842
                +SR    I+  WL         LP  +EI Q  ++  +L  FYF G YY  SKR +G
Sbjct  102   SQAVSRKDQFIQ--WLQPR------LPTMQEIFQKAVQPMHLAIFYFIGAYYSFSKRVTG  153

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQT  1016
              RY+F  +  P  QR  Y++LG  ++ QL I      ++R          Q+      + 
Sbjct  154   TRYIFTRQLGPHEQRVGYEVLGVLIVAQLAIQGYLSFKKRMESRRKEQEQQEKMKQEQEA  213

Query  1017  ---SSGRGVPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
                +S + V  +  E +   +    ++     +       +     KC+LCL  R+  TA
Sbjct  214   VVAASTKSVDQIAAEDDFDFMNEFDDEPKEDQQEEEELSEEEMQFLKCALCLEPRKVTTA  273

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLV  1286
             TPCGH+FCW+C++EWC  KPECPLCRS    + L+
Sbjct  274   TPCGHLFCWSCVIEWCQNKPECPLCRSSVNIAHLI  308



>gb|EDP48266.1| peroxisome biosynthesis protein (Peroxin-10), putative [Aspergillus 
fumigatus A1163]
Length=377

 Score =   103 bits (258),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 93/343 (27%), Positives = 146/343 (43%), Gaps = 42/343 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P   RRA +I 
Sbjct  61    GARFAHIHSDAIKHLTEILYFSLTTLIGNRTLGEEYCDLVQLEDDTLQLPAIHRRAGYIL  120

Query  486   --------YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseia  641
                      Q  +P   +R+ +++  + I+  +                           
Sbjct  121   SSILVPWALQRILPGFRQRLRAKL-ERSISRQE---------------------------  152

Query  642   ssstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQL--VIRANLMFFYFEGLY  815
               +  +A     ++     +  +  A++    +L     I  L  +   ++  FYF G Y
Sbjct  153   LKAQQKAEELRFTKKNASKKPSFFTALRLQKYILEHLDSITSLSPIYALSIATFYFTGSY  212

Query  816   YHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQ  989
             YHLSKR  G+RYVF  K     QR  Y++LG  L++Q+ +     +R+            
Sbjct  213   YHLSKRFWGLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGILHIRKLGLSMQQGGEGI  272

Query  990   QTPFGTYQTSSGRGVPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslclss  1163
             +T     +      +  +    NL  + A + +     + +      +   SKC+LCL  
Sbjct  273   ETEMAGSKMQDDSLIRSIQNPYNLPLLPASAARYDLSEDSNVIPWIPSGQQSKCTLCLEL  332

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              + P+ T CGHVFCW CI +W  EKPECPLCR     S ++ L
Sbjct  333   YKDPSVTTCGHVFCWTCIRDWVREKPECPLCRQEVIPSKVLPL  375


 Score = 26.6 bits (57),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  +    +   R L G+ F+
Sbjct  26   YPFATSPDIIRSNEKDIFITSSLVNQAQAIIRSLRGARFA  65



>ref|XP_007577017.1| PREDICTED: peroxisome biogenesis factor 10 [Poecilia formosa]
Length=323

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 145/322 (45%), Gaps = 55/322 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G++  + ++ E +LL  + Y+ LTT +G QTLGEEY    QV       P+ ARR LF+ 
Sbjct  38    GSKHWLDWRREVELLSDLAYYGLTTLSGYQTLGEEYVGIVQVDPSRRQIPSRARRCLFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL E+         + L++  +           + R + ++ +        RA 
Sbjct  98    CHAFVPYLLEKAL-------VCLENELEGG-------PETRRRQTTSRAWSLERWLRRAA  143

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                +     + R+    A Q  P+V  + + +  L+ R ++  FY    +YH+SKRA+GI
Sbjct  144   QRAVGLLTERQRK----ACQ--PAVFVIQQSV-ALLHRLHVALFYVSSSFYHMSKRAAGI  196

Query  846   RYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +  P       R  Y++LG    +QL +                         + Q
Sbjct  197   SYLCVTGPNADDSSIRSSYRLLGCVSFLQLLVTL-----------------------SLQ  233

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
              ++ R      +E  +  ++S +          S S     ++C LCL +R++ T TPCG
Sbjct  234   LNNLRQRQRARQEWQIYRSLSPR-------HPASSSSTPRPARCILCLEARRNSTCTPCG  286

Query  1194  HVFCWNCIMEWCNEKPECPLCR  1259
             H+FCW CI EWCN K ECPLCR
Sbjct  287   HLFCWECIAEWCNTKAECPLCR  308



>ref|XP_008411142.1| PREDICTED: peroxisome biogenesis factor 10 [Poecilia reticulata]
Length=323

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 140/322 (43%), Gaps = 55/322 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G++  + ++ E +LL  + Y+ LTT +G QTLGEEY    QV       P+ ARR LF+ 
Sbjct  38    GSKHWLDWRREVELLSDLAYYGLTTLSGYQTLGEEYVGVVQVDPSRRQIPSRARRCLFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL E+         + L++  +                    +   + S  R  
Sbjct  98    CHAFVPYLLEKAL-------VCLENELEGG-----------PETRRRQATSEAWSLERWL  139

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
                  R    + E    A Q  P+V  + + +  L+ R ++  FY    +YH+SKRA+GI
Sbjct  140   RGAAQRAVGLLTEQQRKACQ--PAVFVIQQSV-ALLHRLHVALFYVSSSFYHMSKRAAGI  196

Query  846   RYVFIGKPTNQ----RPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +  P       R  Y++LG    +QL +                         + Q
Sbjct  197   SYLCVTGPNADDSSIRSSYRLLGCVSFLQLLVTL-----------------------SLQ  233

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
              ++ R      +E  L  ++S +          S +     ++C LCL +R++ T TPCG
Sbjct  234   LNNLRQRQRARQEWQLYRSLSPR-------HPASSASTPQPARCILCLEARRNSTCTPCG  286

Query  1194  HVFCWNCIMEWCNEKPECPLCR  1259
             H+FCW CI EWCN K ECPLCR
Sbjct  287   HLFCWECIAEWCNTKAECPLCR  308



>ref|XP_003454310.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X1 [Oreochromis 
niloticus]
Length=322

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 143/327 (44%), Gaps = 64/327 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R  + ++ E +LL  + YF LTT  G QTLGEEY +  QV       P+PARR +F+ 
Sbjct  38    GSRRWLEWRKEIELLSDLAYFGLTTFLGYQTLGEEYVNIVQVDPTKRQIPSPARRGVFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL +++        + L++  +         +  S   +  A        + A 
Sbjct  98    CHAFVPYLLDKLL-------VCLENELEGGQESRGRQQVGSVPWSLEAWLRRWVQKAAAL  150

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R     R C L+AV        + ++ L L+ R +   FY  G ++HLSKR + I
Sbjct  151   CSEPQR-----RAC-LNAV-------FVLQQSLTLLYRLHSALFYVTGSFHHLSKRLADI  197

Query  846   RYV-FIGKPTNQR---PRYQILGFF----LLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              Y+  +G  +N       Y++LG      LL+ +C+      +R+ +    +   + +P 
Sbjct  198   SYMRVVGLNSNDSTIGSSYRLLGVMSLLQLLITVCLQLNNFRQRQRARQEWSLHRKLSP-  256

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
               ++ SSG    +       I  + E                            R+H T+
Sbjct  257   -QHRQSSGPRAALC------ILCLEE----------------------------RRHSTS  281

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRS  1262
             TPCGH+FCW CI EWCN K ECPLCR 
Sbjct  282   TPCGHLFCWECITEWCNTKAECPLCRD  308



>gb|KEY77453.1| peroxisome biosynthesis protein Peroxin 10 [Aspergillus fumigatus 
var. RP-2014]
Length=377

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 93/343 (27%), Positives = 146/343 (43%), Gaps = 42/343 (12%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P   RRA +I 
Sbjct  61    GARFAHIHSDAIKHLTEILYFSLTTLIGNRTLGEEYCDLVQLEDDTRQLPAIHRRAGYIL  120

Query  486   --------YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseia  641
                      Q  +P   +R+ +++  + I+  +                           
Sbjct  121   SSILVPWALQRILPGFRQRLRAKL-ERSISRQE---------------------------  152

Query  642   ssstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQL--VIRANLMFFYFEGLY  815
               +  +A     ++     +  +  A++    +L     I  L  +   ++  FYF G Y
Sbjct  153   LKAQQKAEELRFTKKNASKKPSFFTALRLQKYILEHLDSITSLSPIYALSIATFYFTGSY  212

Query  816   YHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQ  989
             YHLSKR  G+RYVF  K     QR  Y++LG  L++Q+ +     +R+            
Sbjct  213   YHLSKRFWGLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGILHIRKLGLRMQQGGEGI  272

Query  990   QTPFGTYQTSSGRGVPVLNEEGN--LITAVSEKGsfvsepsstsesqasglskcslclss  1163
             +T     +      +  +    N  L+ A + +     + +      +   SKC+LCL  
Sbjct  273   ETEMAGSKMQDDSLIRSIQNPYNVPLLPASAARYDLSEDSNVIPWIPSGQQSKCTLCLEL  332

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              + P+ T CGHVFCW CI +W  EKPECPLCR     S ++ L
Sbjct  333   YKDPSITTCGHVFCWTCIRDWVREKPECPLCRQEVIPSKVLPL  375



>ref|XP_001396221.1| peroxisome biosynthesis protein (Peroxin-10) [Aspergillus niger 
CBS 513.88]
 emb|CAK41482.1| unnamed protein product [Aspergillus niger]
 gb|EHA27284.1| hypothetical protein ASPNIDRAFT_50837 [Aspergillus niger ATCC 
1015]
Length=378

 Score =   103 bits (256),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 146/337 (43%), Gaps = 27/337 (8%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  59    GARYAHTHSDAIKHLTEILYFALTTFIGNRTLGEEYCDLVQLEDDTLQLPSLPRRAGYIL  118

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  +R+      +   L    + S       +  +     T  E A  +     
Sbjct  119   SSILLPWTLQRILPAFRQR---LRSKLERS---IARQQLKASQAKKTTVEQAKDNKLAKK  172

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             PS  +  K +I++  L  +    S+ P        +   ++  FYF G YYHLSKR SG+
Sbjct  173   PSFFT--KLRIQKYILEHLDSITSLSP--------IYAVSIATFYFTGAYYHLSKRFSGL  222

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVF  K      R   +G+ +L  L +L              A   Q+      +   G
Sbjct  223   RYVFTKKVEEGEQR---VGYEVLGVLLVLQIAVQGILHIKKVGADLGQENEDSGLEADGG  279

Query  1026  RG------VPVLNEEGNL--ITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
                     +P L    +L  + A + +  F  + ++          KC+LCL   + P+ 
Sbjct  280   MKQYGASLIPSLENPSSLPLLPASAARYDFSEDSNAIPWIPEGQQRKCTLCLELFKDPSV  339

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  340   TTCGHVFCWTCVRDWVREKPECPLCRQEVLLSKVLPL  376



>ref|XP_003725095.1| PREDICTED: peroxisome biogenesis factor 10-like [Strongylocentrotus 
purpuratus]
Length=300

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 133/338 (39%), Gaps = 83/338 (25%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             GTR    ++ E  ++  +LYF LTT AG QTLGEEY +  QV G                
Sbjct  39    GTRFWARWRKELDVVSDVLYFGLTTIAGFQTLGEEYVNILQVDGT---------------  83

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
              + AVP L  R    IA   + +  P+                              +  
Sbjct  84    -KRAVPSLQRR----IALVALHIGAPY---------------------------LLDKTL  111

Query  666   PSVLSRFKTKIRECWL--HAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
               +L   +   R   L   A  R    LP  R  L  V R ++  FY  GL+YH++KR S
Sbjct  112   ARLLFHLEAGYRLSHLSEEANNRLRLWLPSVRRALTFVNRVHMAVFYLRGLFYHIAKRFS  171

Query  840   GIRYVFIGKPTNQR---PRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTY  1010
             G+ Y+ + +    +     + ILG+   +QL +                   Q      Y
Sbjct  172   GVNYIQVRRTAVSQALQKSFHILGWLSGIQLSVSLLWHAL------------QLRKMVIY  219

Query  1011  QTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPC  1190
             Q+S         E+   +T  ++                    +CSLCL  RQH T  PC
Sbjct  220   QSSEA-----TEEKERSVTLDTQ--------------VVDPRWRCSLCLERRQHTTCPPC  260

Query  1191  GHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSD  1304
             GH++CW CIMEWC  KPECP+CR     S LV L + D
Sbjct  261   GHLYCWGCIMEWCRTKPECPICRDGFQASRLVRLQNYD  298



>ref|XP_663285.1| hypothetical protein AN5681.2 [Aspergillus nidulans FGSC A4]
 gb|EAA62774.1| hypothetical protein AN5681.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF81414.1| TPA: microbody (peroxisome) biogenesis protein peroxin 10 (Eurofung) 
[Aspergillus nidulans FGSC A4]
Length=373

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 135/352 (38%), Gaps = 82/352 (23%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  Y    K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +I 
Sbjct  57    GARYAHTYSEAIKHLTELLYFSLTTLTGNRTLGEEYCDLVQLEDDTLRLPSIGRRVGYIL  116

Query  486   YQTAVPYLAERV------------SSRIASQGITLDDPFDDSYPFsvasesssrveasta  629
                 VP+  +R+               IA Q +      D +                  
Sbjct  117   SSIMVPWTLQRILPGFRQRLRAKLERSIARQQLKAQQAKDSN------------------  158

Query  630   seiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEG  809
                         P   +  K +I++  L  +    S+ P        +   ++  FYF G
Sbjct  159   --KTPLKNKSKQPPFFT--KLRIQKYILEHLDSITSLSP--------IYALSIATFYFTG  206

Query  810   LYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaas  983
              YYHLSKR  G+RYVF  K     QR  Y++LG  +L+ L I     L  +    S+ + 
Sbjct  207   SYYHLSKRFWGLRYVFTKKLEENEQRVGYEVLG--VLLVLQIAVQSILHVKKVSHSLQSE  264

Query  984   aQQTPFGTYQTSSGR-----------GVPVL---------NEEGNLITAVSEKGsfvsep  1103
              Q     T  +SS              +PVL         +E+ N I  + +        
Sbjct  265   DQDVHSETSGSSSKEDTLTRSIEHPASLPVLPVSTARYDLSEDPNAIPWIPDGQQRKCTL  324

Query  1104  sstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                S                 + P+ T CGHVFCW C+ +W  EKPECPLCR
Sbjct  325   CLESF----------------KDPSVTTCGHVFCWTCVCDWVREKPECPLCR  360



>ref|XP_010762805.1| hypothetical protein PADG_07284 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH42464.1| hypothetical protein PADG_07284 [Paracoccidioides brasiliensis 
Pb18]
Length=366

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 93/336 (28%), Positives = 145/336 (43%), Gaps = 35/336 (10%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARR  +I 
Sbjct  57    GARFAHSHTDAIKNLTDLLYLSLTTLVGNRTLGEEYCDVVQLEDDSLQLPSLARRVGYIL  116

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +P+  + +   +  +               +  + +     + A+  +S   + + 
Sbjct  117   SSILIPWALQHLLPALRQK-------------LRIKLQHNIIRLQAKAALASSKQGAPST  163

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             PS+  RF+      +L  +    S        L L+   NL  FYF G YYH+SKR  G+
Sbjct  164   PSLTLRFQNY----FLDHLDSLTS--------LSLIFALNLTAFYFSGAYYHISKRIWGL  211

Query  846   RYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSG  1025
             RYVF  +  +   R   +G+ +L  L +L            +I++   +T     Q+ + 
Sbjct  212   RYVFTKRIEDNEAR---IGYEVLGVLLVLQITVQGVLYVKDTISSFTTETATDQQQSQTS  268

Query  1026  RGVPVLNEE-------GNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTAT  1184
                P L           +L    +      S  ++ +        KC+LCL   + P+  
Sbjct  269   NDKPSLKSIYTPPPSIQSLPAGEARYDVASSNNAALAWVPPGQQRKCTLCLDPYKDPSIV  328

Query  1185  PCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  329   TCGHVFCWTCIRDWVREKPECPLCRQEALGSKILPL  364



>ref|XP_002789421.1| peroxisome assembly protein [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH39409.1| peroxisome assembly protein [Paracoccidioides sp. 'lutzii' Pb01]
Length=365

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 141/346 (41%), Gaps = 56/346 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A ++ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARR  +I 
Sbjct  57    GARFAHSHTDAIKNLTDLLYLSLTTFVGNRTLGEEYCDVVQLEDDSLQLPSLARRVGYIL  116

Query  486   --------YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseia  641
                      Q  +P L +++  ++    I L                      + A+  +
Sbjct  117   SSILIPWALQHLLPILRQKLRRKLQHNIIRLQ---------------------AKAALAS  155

Query  642   ssstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYH  821
             S   +   PS+  RF+      +L  +    S        L L+   NL  FYF G YYH
Sbjct  156   SKQGAPLTPSLALRFQNY----FLDHLDSLTS--------LSLIFALNLTAFYFSGSYYH  203

Query  822   LSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
             +SKR  G+RYVF  +  +   R   +G+ +L  L +L            +I++   +T  
Sbjct  204   ISKRIWGLRYVFTKRIEDNEAR---IGYEVLGVLLVLQITVQGVVYVKDTISSFTTETAT  260

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQ----  1169
                Q+ +    P L    ++ T  S +     E      S  +           R+    
Sbjct  261   DQQQSQTSDDKPPLK---SIYTPSSIQSQPAGEARYDVASATNAALAWVPPGQQRKCTLC  317

Query  1170  -----HPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                   P+   CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  318   LDPYKDPSIVTCGHVFCWTCIRDWVREKPECPLCRQEALGSKILPL  363



>gb|KGO40923.1| Zinc finger, RING-type [Penicillium expansum]
 gb|KGO50846.1| Zinc finger, RING-type [Penicillium expansum]
 gb|KGO61663.1| Zinc finger, RING-type [Penicillium expansum]
Length=376

 Score = 99.4 bits (246),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 100/355 (28%), Positives = 142/355 (40%), Gaps = 66/355 (19%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +I 
Sbjct  60    GARYAHTHSDAIKHLTELLYFTLTTAIGNRTLGEEYCDLVQLEDDTLQLPSIGRRVGYIL  119

Query  486   YQTAVPYLAERV-------------------SSRIASQGITLDDPFDDSYPFsvasesss  608
                 VP+  +R+                    SR   Q   L+ P   + P      +  
Sbjct  120   SSILVPWTLQRLLPALRQRIRNKLERNIARQQSRAVQQAGLLNKPQFSTTPTKRPLFT--  177

Query  609   rveastaseiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANL  788
                                       K +I++  L  +    S+ P        +   ++
Sbjct  178   --------------------------KLRIQQYILEHLDSITSLSP--------IYALSI  203

Query  789   MFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrss  962
               FYF G YYHLSKR   +RYVF  K     QR  Y++LG    V L +  A      + 
Sbjct  204   ATFYFTGSYYHLSKRLWSLRYVFTKKIDDNEQRIGYEVLG----VLLVLQIAVQGFLHAR  259

Query  963   lssiaasaQQTPFGTYQTSSGRGVPVLNEEGN-----LITAVSEKGsfvsepsstsesqa  1127
                 + +  ++       S G+G  VL    N     L+ A         +P + S    
Sbjct  260   KIGASLNEDESQSADAGQSPGQGGAVLASIQNPSTIPLLPASVPLYDLEEDPGAVSWIPE  319

Query  1128  sglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                 KC+LCL   + P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  320   GQQRKCTLCLEMFKDPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPL  374


 Score = 27.7 bits (60),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  + +  +   R L G+ ++
Sbjct  25   YPFATSPDIIRSHEKDAYLTGSLIQQSQGIVRALRGARYA  64



>emb|CDM30956.1| peroxin 10 [Penicillium roqueforti FM164]
Length=376

 Score = 99.8 bits (247),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 97/360 (27%), Positives = 140/360 (39%), Gaps = 76/360 (21%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +  
Sbjct  60    GARYAHTHSDAIKHLTELLYFSLTTAIGNRTLGEEYCDLVQLEDDTLQLPSIGRRVGYFL  119

Query  486   YQTAVPYLAERV-------------------SSRIASQGITLDDPFDDSYPFsvasesss  608
                 VP+  +R+                    SR A Q   L+ P   + P      +  
Sbjct  120   SSILVPWTLQRLLPALRQRIRNKLERNIARQQSRAAQQAGLLNKPQFSTTPTKRPLFT--  177

Query  609   rveastaseiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANL  788
                                       K +I++  L  +    S+ P        +   ++
Sbjct  178   --------------------------KLRIQQYVLEHLDSITSLSP--------IYALSI  203

Query  789   MFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLL----VQLCIlaaeglr  950
               FYF G YYH+SKR   +RYVF  K     QR  Y++LG  L+    VQ  + A +   
Sbjct  204   ATFYFTGSYYHISKRIWSLRYVFTKKIDDNEQRIGYEVLGVLLVLQIAVQGFLHARKLAA  263

Query  951   rrsslssiaasaQQTP------FGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsst  1112
               +   S +  A Q+P        + Q  S   +P+L     L     + G+    P   
Sbjct  264   SMNEDESESTDAGQSPSQGGAVLASIQNPSS--IPLLPASVPLYDLEEDPGAVSWIPEGQ  321

Query  1113  sesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                    L          + P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  322   QRKCTLCLEMF-------KDPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPL  374


 Score = 26.9 bits (58),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  + +  +   R L G+ ++
Sbjct  25   YPFATSPDIIRSHEKDSFLTGSLIQQSQGIVRALRGARYA  64



>gb|KGO77493.1| Zinc finger, RING-type [Penicillium italicum]
Length=376

 Score = 97.4 bits (241),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 97/350 (28%), Positives = 145/350 (41%), Gaps = 56/350 (16%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +I 
Sbjct  60    GARYAHTHSDGIKHLTELLYFTLTTAIGNRTLGEEYCDLVQLEDDTLQLPSIGRRVGYIL  119

Query  486   --------YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseia  641
                      Q  +P L +R+ +++                      +  ++ A+  + + 
Sbjct  120   SSILVPWALQRLLPALRQRIRNKLERN------------------IARQQLRAAQQAGLL  161

Query  642   ssstsRAHPSVLSRF-KTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYY  818
                     P+    F K +I++  L  +    S+ P        +   ++  FYF G YY
Sbjct  162   IKPQFSTTPTKRPLFTKLRIQQYILEHLDSITSLSP--------IYALSIATFYFTGSYY  213

Query  819   HLSKRASGIRYVFIGK--PTNQRPRYQILGFFLL----VQLCIlaaeglrrrsslssiaa  980
             HLSKR   +RYVF  K     QR  Y++LG  L+    VQ  + A +     +   S + 
Sbjct  214   HLSKRLWSLRYVFTKKIDDNEQRIGYEVLGVLLVLQIAVQGFLHARKLGASLNEDESQSV  273

Query  981   saQQTP------FGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglsk  1142
              A Q+P        + Q  S   VP+L     L     + G+    P          L  
Sbjct  274   DAGQSPAQGGAVLASIQNPSN--VPLLPASVPLYDLEEDPGAVSWIPEGQQRKCTLCLEM  331

Query  1143  cslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                     + P+ T CGHVFCW C+ +W  EKPECPLCR     S ++ L
Sbjct  332   F-------KDPSVTTCGHVFCWICVRDWVREKPECPLCRQEVLLSKVLPL  374


 Score = 27.7 bits (60),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  + +  +   R L G+ ++
Sbjct  25   YPFATSPDIIRSHEKDAYLTGSLIQQSQGIVRALRGARYA  64



>ref|XP_002567494.1| peroxisomal integral membrane protein Pex10-Penicillium chrysogenum 
[Penicillium rubens Wisconsin 54-1255]
 gb|ABH11418.1| peroxin 10 [Penicillium chrysogenum]
 emb|CAP95345.1| peroxisomal integral membrane protein Pex10-Penicillium chrysogenum 
[Penicillium rubens Wisconsin 54-1255]
Length=376

 Score = 98.6 bits (244),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 139/334 (42%), Gaps = 46/334 (14%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +I 
Sbjct  60    GARYAHTHSDAIKHLTELLYFTLTTAIGNRTLGEEYCDLVQLEDDTLQLPSIGRRVGYIL  119

Query  486   YQTAVPYLAER----VSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassst  653
                 VP+  +R    +  RI ++                 + +  ++ A+  + + +   
Sbjct  120   SSILVPWTLQRLLPALRQRIRNK--------------LERNIARQQLRAAQQAGLLNKPQ  165

Query  654   sRAHPSVLSRF-KTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSK  830
                 PS    F K +I++  L  +    S+ P        +   ++  FYF G YYHLSK
Sbjct  166   FSTTPSKRPLFTKLRIQQYILEHLDSITSLSP--------IYALSIATFYFTGSYYHLSK  217

Query  831   RASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFG  1004
             R   +RYVF  K     QR  Y++LG  LLV    +      R+   S     +Q    G
Sbjct  218   RLWSLRYVFTKKIEDNEQRIGYEVLGV-LLVLQIAVQGFLHARKLGASMNEDESQSADAG  276

Query  1005  TYQTSSG---------RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslcl  1157
                + +G           +P+L     L     + G+    P          L       
Sbjct  277   QSLSQAGAVLASIQNPSSIPLLPASVPLYDLEEDPGAVSWIPEGQQRKCTLCLEMF----  332

Query  1158  ssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                + P+ T CGHVFCW C+ +W  EKPECPLCR
Sbjct  333   ---KDPSVTTCGHVFCWICVRDWVREKPECPLCR  363


 Score = 26.6 bits (57),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   T  + +  +   R L G+ ++
Sbjct  25   YPFATSPDIIRSHEKDAFLTGSLVQQSQGIVRALRGARYA  64



>ref|XP_003588927.1| Peroxisome biogenesis factor [Medicago truncatula]
Length=73

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 45/56 (80%), Gaps = 8/56 (14%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCW--------NCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             RQHPTAT CGHVFCW        NCI EWCNEKPECPLCR+P THSSLVC+YHSDF
Sbjct  18    RQHPTATSCGHVFCWYCLPAFLLNCITEWCNEKPECPLCRTPITHSSLVCVYHSDF  73



>gb|ESU13272.1| hypothetical protein FGSG_07078 [Fusarium graminearum PH-1]
 gb|EYB27641.1| hypothetical protein FG05_07078 [Fusarium graminearum]
 emb|CEF85647.1| unnamed protein product [Fusarium graminearum]
Length=365

 Score = 95.9 bits (237),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 133/343 (39%), Gaps = 58/343 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R+      E + L  + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  48    GARLTHTRAPEIQTLATLAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAIDRRAGYVA  107

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PY+A RV   + +Q   L                              +   R  
Sbjct  108   ASILLPYIAARVLPGLRAQARKL------------------------LQRRLETLRKRDG  143

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R + +I   W +  Q   S    A    Q VI   L  FYF G YY LSKR   +
Sbjct  144   QSATGR-EARI---WSYLEQHLSSFTSGA--PFQAVI---LALFYFSGTYYQLSKRLLSL  194

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF      T  R  Y++L    ++ +  LA +      S  + + + ++  FG+    
Sbjct  195   RYVFTRTVPDTPDRAGYELL---GVLLVVQLAVQSYSHIRSTITESTARERAAFGSSDDI  251

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR-----------  1166
             S       N++ NL+ +    GS        +    +           +           
Sbjct  252   SLNHDGAYNQDNNLLLSTGAPGSKTKVDIFAATHTPAATVPRLQLTDDKTMGYIKGGQQR  311

Query  1167  ---------QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
                      + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  312   KCTLCLEEMKDPSATQCGHVFCWECIGDWVREKPECPLCRREA  354


 Score = 28.5 bits (62),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D  R L G+  +
Sbjct  13   YPFATAPDIIRSHQKDAYFTGHLAQILSDLHRRLRGARLT  52



>ref|XP_004473575.1| PREDICTED: peroxisome biogenesis factor 10 isoform 1 [Dasypus 
novemcinctus]
Length=339

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 140/354 (40%), Gaps = 77/354 (22%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G +  + ++ E +LL  ++YF LTT  G QTLGEEY +  QV   +   P+  RRAL + 
Sbjct  38    GAKKWLEWRKEVELLSDLMYFGLTTLTGCQTLGEEYVNIVQVDPSWRRVPSWPRRALLVA  97

Query  486   YQTAVPYLAERVSSRIASQ-GITLDDPFDDSYPFsvasesssrveastaseiassstsRA  662
               +A+PYL ++    +  +     D P   S                + S        + 
Sbjct  98    LHSALPYLLDKALLLLEHELQADGDRPVQGS------------PGGRSRSAARRWVQRQV  145

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
              P    + +T +R             L + R+ L  + R ++ +FY  G +YH++KR +G
Sbjct  146   APLAEQQKRTLLR------------ALLVVRQGLACLWRLHVAWFYVHGAFYHIAKRLAG  193

Query  843   IRYVFIGKPTN-------------QRPR---------YQILGFFLLVQLCIlaaeglrrr  956
             + YV + +P+              +RPR         Y++LG   L+ L +     +   
Sbjct  194   VSYV-MPRPSGLLTWPVCPAQLQVRRPRAEDLGARAGYKLLGAISLLHLALSVGLQVYSF  252

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgl  1136
             S         +     +Y+ SS       +        + E+                  
Sbjct  253   SQRQRARKEWKLHRNLSYRRSSVEER-AFSRNARCTLCLEER------------------  293

Query  1137  skcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
                       +H TATPCGH+FCW C  EWCN K ECPLCR       LV L H
Sbjct  294   ----------RHTTATPCGHLFCWECATEWCNTKAECPLCREKFPPQKLVYLRH  337



>ref|XP_001024158.1| Pex2 / Pex12 amino terminal region family protein [Tetrahymena 
thermophila]
 gb|EAS03913.1| Pex2/Pex12 amino terminal region family protein [Tetrahymena 
thermophila SB210]
Length=319

 Score = 94.7 bits (234),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 131/329 (40%), Gaps = 65/329 (20%)
 Frame = +3

Query  312   RVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGP----YGLPPTPARRALF  479
             R     Q+  K+L    Y++LTT + ++TLGEE+C+  Q         G+P +  RR LF
Sbjct  46    RFISTNQDTLKILSFCAYYILTTISNRKTLGEEFCNLHQFNKQDFDFKGIPTSLKRRVLF  105

Query  480   IFYQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsR  659
             +   T  P++ +++  +   Q   +                               +  +
Sbjct  106   VILTTLSPFIFKKLVKKQYDQSREM-----------------------------MMAERK  136

Query  660   AHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
              +  +L+ F   IR             LP    I + +I+ +L  F+ +GL+  +SKR S
Sbjct  137   EYRGILASF---IRN------------LPSYDGIYEKIIKFHLCMFFLDGLFVQISKRIS  181

Query  840   GIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             GI YVF  +P N    Y+ +G  + +QL I  A    R       +   Q      Y+  
Sbjct  182   GIYYVFQKQPQNHNITYKKVGVLVALQLAIEFARYGYRVYQDYQQSKQIQNQINSEYKYK  241

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHV  1199
             SG      NE  +                            C+LC   R+  +ATPCGH+
Sbjct  242   SGEDK---NENQHEEEEEE--------------IDIPQELLCALCYDKRKITSATPCGHL  284

Query  1200  FCWNCIMEWCNEKPECPLCRSPATHSSLV  1286
             FCW+CI++    KPECP CR       +V
Sbjct  285   FCWDCIIKSTQIKPECPNCRQACLPQKIV  313


 Score = 29.3 bits (64),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAF  217
            + QPE++R  +KDE+Y F +++   DA 
Sbjct  8    STQPELLRLNQKDEEYGFGLFQKLIDAL  35



>gb|ABG78603.1| RING-1 [Fusarium graminearum]
Length=365

 Score = 94.0 bits (232),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 97/351 (28%), Positives = 137/351 (39%), Gaps = 58/351 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R+      E + L  + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  48    GARLTHTRAPEIQTLAALAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAVYRRAGYVA  107

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PY+A RV   + +Q   L                              +   R  
Sbjct  108   ASILLPYIAARVLPGLRAQVRKL------------------------LQRRLETLRKRDG  143

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R + +I   W +  Q   S    A    Q VI   L  FYF G YY LSKR   +
Sbjct  144   QSATGR-EARI---WSYLEQHLSSFTSGA--PFQAVI---LALFYFSGTYYQLSKRLLSL  194

Query  846   RYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTS  1019
             RYVF      T  R  Y++L    ++ +  LA +      S  + +A+ ++  FG+    
Sbjct  195   RYVFTRTVPDTPDRAGYELL---GVLLVVQLAVQSYSHIRSTITESAARERAAFGSSDDI  251

Query  1020  SGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR-----------  1166
             S       N++ NL+ +    GS        +    +           +           
Sbjct  252   SLNHDGAYNQDNNLLLSTGAPGSKTKVDIFAATHTPAATVPRLQLTDDKTMGYIKGGQQR  311

Query  1167  ---------QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                      + P+AT CGHVFCW CI +W  EKPECPLCR  A    ++ L
Sbjct  312   KCTLCLEEMKDPSATQCGHVFCWECIGDWVREKPECPLCRREAMAQHILPL  362


 Score = 29.6 bits (65),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (58%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D +R L G+  +
Sbjct  13   YPFATAPDIIRSHQKDAYFTGHLAQILSDLYRRLRGARLT  52



>ref|XP_010350890.1| PREDICTED: peroxisome biogenesis factor 10 isoform X1 [Rhinopithecus 
roxellana]
Length=339

 Score = 94.0 bits (232),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 94/315 (30%), Positives = 137/315 (43%), Gaps = 52/315 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +     S        R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DGGRP------SQGSLVPGRRSCSGVRRWVRHH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLSCLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEK  1238
             H+FCW CI  WC+ K
Sbjct  290   HLFCWECITAWCSSK  304


 Score = 30.0 bits (66),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>ref|XP_007292671.1| putative peroxisome biosynthesis protein (Peroxin-10) [Marssonina 
brunnea f. sp. 'multigermtubi' MB_m1]
 gb|EKD17205.1| putative peroxisome biosynthesis protein (Peroxin-10) [Marssonina 
brunnea f. sp. 'multigermtubi' MB_m1]
Length=371

 Score = 95.5 bits (236),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 134/343 (39%), Gaps = 61/343 (18%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R    Y +E +   ++LY  LTT  G +TLGEEYCD  Q+       P   RRA +I 
Sbjct  52    GARFLHTYTSEARSFSELLYLSLTTFIGNRTLGEEYCDIIQIEDDTLKLPALERRAGYIL  111

Query  486   YQTAVPY-LAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRA  662
                 +PY LA+ + S  A     L+                         +  +S   R 
Sbjct  112   SSVLLPYGLAKILPSFRARIRAKLEGNLRK----------------MGRRKEEASRNYRI  155

Query  663   HPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASG  842
                +L    T      LHA+                     L  FYF G YY LSKR  G
Sbjct  156   QTYLLEHLATITSPSPLHAL--------------------TLTVFYFSGAYYQLSKRIWG  195

Query  843   IRYVFIGK--PTNQRPRYQILGFFLLVQLCIla-aeglrrrsslssiaasaQQTPFGTYQ  1013
             +RY+F  K  P+  R  Y++LG  LL+Q+ + A         + + + A+A Q   G+  
Sbjct  196   LRYIFTKKIAPSEARVGYEVLGVLLLLQIGVQAWLHLHHTLRTPNPVPANASQMNGGSAI  255

Query  1014  TSSG---------RGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssR  1166
                G          G  +L E  N+++    +   V+      E +     +  +     
Sbjct  256   LEGGVEISLEPPSHGNELLFESNNVVSHTGNEVGIVTHTQVLKEPRYDLRKEDVMGFIKG  315

Query  1167  QHPTATPC------------GHVFCWNCIMEWCNEKPECPLCR  1259
             Q+   T C            GHVFCW CI +W  EKPECPLCR
Sbjct  316   QNRKCTLCLEELKDPSAAACGHVFCWECIGDWVREKPECPLCR  358


 Score = 28.5 bits (62),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYF  241
            ++P A  P+I+RA +KD  +   +        R L+G+ F
Sbjct  16   NYPFAAAPDIIRAHQKDSYFEGILLNHLSALLRRLYGARF  55



>ref|XP_005545088.1| PREDICTED: peroxisome biogenesis factor 10 isoform X3 [Macaca 
fascicularis]
Length=307

 Score = 93.6 bits (231),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 136/315 (43%), Gaps = 52/315 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  38    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  98    LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  148

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  149   TATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  198

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  199   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  241

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  242   RQRAR------KEWRLHRGLSHR------RGSLEERAVSRNPLCTLCLEERRHPTATPCG  289

Query  1194  HVFCWNCIMEWCNEK  1238
             H+FCW CI  WC+ K
Sbjct  290   HLFCWECITAWCSSK  304


 Score = 30.0 bits (66),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A  PE++RAA+KDE Y   +  A   A   L G+
Sbjct  6    ASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGA  39



>gb|EXX54768.1| ubiquitin-protein ligase peroxin 10 [Rhizophagus irregularis 
DAOM 197198w]
Length=229

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 90/186 (48%), Gaps = 32/186 (17%)
 Frame = +3

Query  762   LQLVIRAN-----LMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQ  920
             LQ++++ N     L  FYF G YY +SKRA+GIRY+F  +  P  QR  Y+ILGF L+VQ
Sbjct  68    LQILLKNNVHSVHLAIFYFYGAYYFISKRATGIRYIFTRQLGPHEQRIGYEILGFLLVVQ  127

Query  921   LCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvse  1100
               I A    +     +        + F   +      + V + EG     ++ +   +  
Sbjct  128   FIIQAYRFQKSLIKGT------DDSLFNEVEEEEESDLMVTSTEGLTPQEIAARKCILCL  181

Query  1101  psstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSS  1280
                                  R++ TATPCGH+FCW CI++ CN KPECPLCR     S 
Sbjct  182   SP-------------------RKNTTATPCGHLFCWTCIVDCCNNKPECPLCRQYVNISH  222

Query  1281  LVCLYH  1298
             L+ +Y+
Sbjct  223   LLPIYN  228



>ref|XP_002679102.1| predicted protein [Naegleria gruberi]
 gb|EFC46358.1| predicted protein [Naegleria gruberi]
Length=429

 Score = 92.0 bits (227),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 89/360 (25%), Positives = 147/360 (41%), Gaps = 100/360 (28%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQV------------------  431
             G R  + ++ E +L+  ++Y+  TT  G+ TLGEEYCD  QV                  
Sbjct  133   GQRFTIRFEREIQLVCNLIYYGTTTCTGQSTLGEEYCDLLQVQLKEKTKPPQQVNSTNSN  192

Query  432   ----AGPYGLPPTPARRALFIFYQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvase  599
                    Y +  T + R LF+ Y+  VPYL +R +S   S   + +   ++         
Sbjct  193   KFSPKTLYIVKSTSSTRLLFVLYELIVPYLFDRGTSHWLSHYFSPNGISEN---------  243

Query  600   sssrveastaseiassstsRAHPSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIR  779
                                R + S+L  F                         +Q ++R
Sbjct  244   ------------------MRYYISMLKEF-------------------------VQFILR  260

Query  780   ANLMFFYFEGLYYHLSKRASGIRYVFIGK---PTNQRPRYQILGFFLLVQLCIlaaeglr  950
              NL+ FY  G +  +SKR +GIRY++ GK    + +RP + +L   +++Q  I +A    
Sbjct  261   FNLVSFYINGKFLQVSKRLAGIRYIYTGKTDGDSYKRPNFFLLSLLIMIQQVI-SAFLFI  319

Query  951   rrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqas  1130
             + + +  I+   ++      ++ +  GV  + E  +  T    K                
Sbjct  320   KSAVVQHISKKKEEKKCDNNESITLDGVSYIEEYIDGRTETEFK----------------  363

Query  1131  glskcslclssRQHPTATPCGHVFCWNCIMEWC--NEKPECPLCRSPATHSSLVCLYHSD  1304
                 C LCL  R   TAT CGH++CW+CI E    +++P+CP+CR   +  SL  LY  D
Sbjct  364   ----CCLCLERRVKTTATMCGHLYCWDCITECVSNSKEPKCPICRQSISLQSLCRLYCYD  419


 Score = 29.3 bits (64),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFV-YEACRDAFRHLFGSYFSI  247
             FP + QP+I+R+ +KDE Y+  V +   ++     FG  F+I
Sbjct  96   GFPFSGQPDIVRSLQKDEFYSNHVMFNNLKELCNWFFGQRFTI  138



>gb|KFM23149.1| Peroxisome biogenesis factor 10 [Auxenochlorella protothecoides]
Length=344

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 102/213 (48%), Gaps = 23/213 (11%)
 Frame = +3

Query  321  VAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAV  500
            V    ET++L ++LY+  TTG G+QTLGEEYCD  Q +G  GLPP+P +R      Q+  
Sbjct  17   VPRMRETRVLAELLYYACTTGTGRQTLGEEYCDILQSSGGRGLPPSPLQRGALTLLQSLG  76

Query  501  PYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsR-AHPSVL  677
            PY  ER           L  P D+          S+++ A    E  +  T R A P+  
Sbjct  77   PYCLER-----------LGAPVDEEAEAWRRLRQSAQLGARADEERETEDTHRGASPARR  125

Query  678  SRFKTKIREC-WLHAVQ-------RWPSVLPL---AREILQLVIRANLMFFYFEGLYYHL  824
            +      R    L AVQ         P+++ L    RE    ++R +L  FY  G YY L
Sbjct  126  AWAALARRVREALRAVQGAAGSLAERPAMVALHSTLREHGGALLRFHLALFYVWGAYYAL  185

Query  825  SKRASGIRYVFIGKPTNQRPRYQILGFFLLVQL  923
             KR +G+RY+  G+     P Y+ LG+ LL QL
Sbjct  186  PKRLAGVRYISAGREAGGGPSYRTLGYLLLAQL  218


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYHSDF  1307
             R   TA PCGHVFCW CI EW  +KPECPLCRS    SSLVC+ H+DF
Sbjct  297   RVAATAAPCGHVFCWTCIAEWAAQKPECPLCRSDCPTSSLVCITHADF  344



>ref|XP_005098492.1| PREDICTED: peroxisome biogenesis factor 10-like [Aplysia californica]
Length=299

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 84/178 (47%), Gaps = 34/178 (19%)
 Frame = +3

Query  741   LPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYV-FIGKP---TNQRPRYQILGFF  908
             LPL R+ + ++ R +L  FY  G++YHL+KR SGI YV ++ K    ++ RP +QILG+ 
Sbjct  136   LPLVRKAVTVLHRLHLAAFYINGVFYHLAKRISGIHYVQYMTKDRGASSVRP-FQILGYL  194

Query  909   LLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGs  1088
              +VQ    A   L             Q+    T++  S R      ++ + I   +EK  
Sbjct  195   SIVQFAFSALLNLYSVVQAVKQ----QKKELKTFELESER-----RDQDSRIVKSNEKCP  245

Query  1089  fvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRS  1262
                                      RQH T TPCGH+FCW CI EWC  K ECPLCR 
Sbjct  246   LCLSR--------------------RQHSTLTPCGHLFCWKCIHEWCQSKQECPLCRD  283



>gb|ELU12268.1| hypothetical protein CAPTEDRAFT_174511 [Capitella teleta]
Length=301

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 92/192 (48%), Gaps = 30/192 (16%)
 Frame = +3

Query  735   SVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFI--GKPTNQRPRYQILGFF  908
             S++   R  L  + R +L  FY  G++YH SKR +GI Y+ +  G   ++RP Y++LG+ 
Sbjct  136   SLIKGIRSSLTFLHRCHLAVFYMSGVFYHFSKRFTGIHYLLVRPGMQNSKRPSYKVLGWL  195

Query  909   LLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGs  1088
              ++                        Q  F   Q    + +  L E        +    
Sbjct  196   SVI------------------------QLSFSVLQ----QAIKALQETRKASKTENASSV  227

Query  1089  fvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
                   S  E+      KC+LCL +RQ+ TATPCGH+FCW+CI+EWC  KP+CPLCR  +
Sbjct  228   GSVSKVSVPETSMDPQRKCALCLETRQNSTATPCGHLFCWDCIVEWCTMKPQCPLCRETS  287

Query  1269  THSSLVCLYHSD  1304
               S L+ L + D
Sbjct  288   ELSRLIILKNFD  299


 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 96/219 (44%), Gaps = 70/219 (32%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+ + +++E  LL  + YF+LTT +G QTLGEEY +  QV   + + P+  RR   + 
Sbjct  39   GPRIWINWRHEIDLLADLGYFVLTTVSGYQTLGEEYVNILQVNSSHRVIPSRMRRVAMVL  98

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
             Q   PYL  R+                                                
Sbjct  99   LQILTPYLLHRI------------------------------------------------  110

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLARE-ILQLV--IRANLMF--------FYFEGL  812
               L+  +T++R+       R  ++ P  R+  + L+  IR++L F        FY  G+
Sbjct  111  ---LNWLETEMRQ------NRALNITPRGRDSAISLIKGIRSSLTFLHRCHLAVFYMSGV  161

Query  813  YYHLSKRASGIRYVFI--GKPTNQRPRYQILGFFLLVQL  923
            +YH SKR +GI Y+ +  G   ++RP Y++LG+  ++QL
Sbjct  162  FYHFSKRFTGIHYLLVRPGMQNSKRPSYKVLGWLSVIQL  200



>ref|XP_009211767.1| PREDICTED: peroxisome biogenesis factor 10 isoform X2 [Papio 
anubis]
Length=342

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 93/315 (30%), Positives = 136/315 (43%), Gaps = 52/315 (17%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  73    GARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIVQVDPSQTRVPSWLRRGVLVT  132

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 +PYL ++V   +  +     DP D   P      S   +              R H
Sbjct  133   LHAVLPYLLDKVLLPLEQE--LQADP-DSGRP------SQGSLVPGGRGCSGVRRWVRRH  183

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              + L+  + +       A+ R   VL   R+ L  + R ++ +FY  G++YHL+KR +GI
Sbjct  184   TATLTEQQRR-------ALLRAAFVL---RQGLACLQRLHVAWFYIHGVFYHLAKRLTGI  233

Query  846   RYVFI----GKPTNQRPRYQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQ  1013
              Y+ +    G+    R  Y++LG   L+ L +     L                 +G  Q
Sbjct  234   TYLRVRSLPGEDLRARVSYRLLGVVSLLHLVLSVGLQL-----------------YGFRQ  276

Query  1014  TSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCG  1193
                 R      +E  L   +S +        S  E   S    C+LCL  R+HPTATPCG
Sbjct  277   RQRAR------KEWRLHRGLSHR------RGSLEERVVSRNPLCTLCLEERRHPTATPCG  324

Query  1194  HVFCWNCIMEWCNEK  1238
             H+FCW CI  WC+ K
Sbjct  325   HLFCWECITAWCSSK  339



>ref|XP_004545993.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X2 [Maylandia 
zebra]
Length=316

 Score = 90.5 bits (223),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 86/319 (27%), Positives = 137/319 (43%), Gaps = 64/319 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R  + ++ E +LL  + YF LTT  G QTLGEEY +  QV       P+PARR +F+ 
Sbjct  38    GSRRWLEWRKEIELLSDLAYFGLTTFLGYQTLGEEYVNIVQVDPTKRQIPSPARRGVFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL +++        + L++  +         +  S   +  +        + A 
Sbjct  98    CHAFVPYLLDKLL-------VCLENELEGGQESRRRQQVGSVPWSLESWLRRWVQKAAAL  150

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R     R C L+AV        + ++ L L+ R +   FY  G ++HLSKR + I
Sbjct  151   CSEPQR-----RAC-LNAV-------FVLQQSLTLLYRLHSALFYVSGSFHHLSKRVADI  197

Query  846   RYV-FIGKPTNQR---PRYQILGFF----LLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              Y+  +G  +N       Y++LG      LL+ +C+      +R+ +    +   + +P 
Sbjct  198   SYMRVVGLNSNDSTVGSSYRLLGVMSLLQLLITVCLQLNNFRQRQRARQEWSLHRKLSP-  256

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
               ++ SSG    +       I  + E                            R+H T+
Sbjct  257   -QHRQSSGPRAALC------ILCLEE----------------------------RRHSTS  281

Query  1182  TPCGHVFCWNCIMEWCNEK  1238
             TPCGH+FCW CI EWCN K
Sbjct  282   TPCGHLFCWECITEWCNTK  300


 Score = 26.9 bits (58),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A + +++R+++KD+ Y   +  +  DAF+ L GS
Sbjct  6    ATRAQLIRSSQKDDYYRSSLRNSANDAFQTLAGS  39



>ref|XP_003015161.1| hypothetical protein ARB_06284 [Arthroderma benhamiae CBS 112371]
 gb|EFE34521.1| hypothetical protein ARB_06284 [Arthroderma benhamiae CBS 112371]
Length=373

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 89/179 (50%), Gaps = 11/179 (6%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             NL  FYF G YYHLSKR  G+RYVF  +   + +R  Y++LG  L++Q+ + A    +  
Sbjct  195   NLAAFYFSGAYYHLSKRVWGLRYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEV  254

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNE----EGNLITAVSEKGsfvsepsstsesq  1124
                  +  + Q +   T   + G G P L      +G  + A  E    +S         
Sbjct  255   IESIQLEEAGQVS--ATDSAAKGAGTPGLKSISMPDGMALLAPEEARYDMSVEKDALAMS  312

Query  1125  ---asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                A    KC+LCL   + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  313   WIPAGPQRKCTLCLDPFKDPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  371


 Score = 51.2 bits (121),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A A+ +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  61   GQRYAHAHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLGRRAGYIV  120

Query  486  YQTAVPYLAERV  521
                VP + +R+
Sbjct  121  SSILVPSILQRL  132


 Score = 29.3 bits (64),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRAHEKDSYITSTLSTQAQSIIRTLRGQRYA  65



>gb|KHJ36180.1| putative peroxisome biosynthesis protein (peroxin-10) [Erysiphe 
necator]
Length=342

 Score = 92.0 bits (227),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 133/336 (40%), Gaps = 76/336 (23%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G  +  AY ++ K   ++ Y  LTT  G QTLGEEYC+  Q+       P  +RR  +I 
Sbjct  52    GAHLLHAYISQVKTFSELFYLGLTTFIGNQTLGEEYCNIVQIEDTTLKLPAFSRRLGYIL  111

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
               T  PY+  +                                                 
Sbjct  112   TSTFGPYILNK-------------------------------------------------  122

Query  666   PSVLSRFKTKIR---ECWLHAV-------QRWPSVLPLAREILQLV-----IRA-NLMFF  797
               +L RF+ K+R   E  L  +       Q++  +L    E LQ +     I A  L  F
Sbjct  123   --ILPRFRVKLRTKLESQLQHLKEDNPKDQKYRKILSYLLENLQAITSPSPIHALTLTMF  180

Query  798   YFEGLYYHLSKRASGIRYVFIGK-PTNQ-RPRYQILGFFLLVQLCIlaaeglrrrsslss  971
             YF G YY LSKR   +RY+   + P+++    Y++LG  LL+Q+ +     L     + S
Sbjct  181   YFSGAYYQLSKRIWRLRYISTKRIPSSEAHVGYEVLGVLLLLQISVQTWLHLNSTFRIFS  240

Query  972   iaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcsl  1151
                + ++       T S   V   N         + K  +    +           KC+L
Sbjct  241   SNTNLEEKANDISMTPSEYKVINSN-------IFNSKPRYDLRTAGFMPWLKGQNRKCTL  293

Query  1152  clssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
             CL   + P+A  CGH+FCW CI +W  EKPECPLCR
Sbjct  294   CLEEMKDPSAASCGHIFCWTCIGDWIKEKPECPLCR  329


 Score = 25.4 bits (54),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 11/40 (28%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  122  SFPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYF  241
            +FP A  P+++RA +KD  +   +++      R L G++ 
Sbjct  16   NFPFATAPDVIRAFQKDIFFQDVIFDQFSSLLRRLKGAHL  55



>ref|XP_003237037.1| peroxisome biosynthesis protein [Trichophyton rubrum CBS 118892]
Length=373

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 89/179 (50%), Gaps = 11/179 (6%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             NL  FYF G YYHLSKR  G+RYVF  +   + +R  Y++LG  L++Q+ + A    +  
Sbjct  195   NLAAFYFSGAYYHLSKRVWGLRYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEV  254

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNE----EGNLITAVSEKGsfvsepsstsesq  1124
                  +  + Q +   T   + G G P L      +G  + A  E    +S         
Sbjct  255   IESIQLEEAGQVS--ATDSAAKGAGTPGLKSISMPDGMTLLAPEEARYDMSVEKDALAMS  312

Query  1125  ---asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                A    KC+LCL   + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  313   WIPAGPQRKCTLCLDPFKDPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  371


 Score = 49.3 bits (116),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G + A A+ +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  61   GQQYAHAHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLGRRAGYIV  120

Query  486  YQTAVPYLAERV  521
                VP + +R+
Sbjct  121  SSILVPSILQRL  132


 Score = 29.3 bits (64),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRAHEKDNYITSTLSTQAQSIIRTLRGQQYA  65



>gb|EZF35829.1| hypothetical protein H101_00654 [Trichophyton interdigitale H6]
 gb|KDB20852.1| hypothetical protein H109_07201 [Trichophyton interdigitale MR816]
Length=373

 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 89/179 (50%), Gaps = 11/179 (6%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             NL  FYF G YYHLSKR  G+RYVF  +   + +R  Y++LG  L++Q+ + A    +  
Sbjct  195   NLAAFYFSGAYYHLSKRVWGLRYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEV  254

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNE----EGNLITAVSEKGsfvsepsstsesq  1124
                  +  + Q +   T   S G G P L      +G  + A  E    +S         
Sbjct  255   IESIQLEEAGQVS--ATDSASKGTGTPGLKSISMPDGMPMLAPEEARYDMSVEKDALAMS  312

Query  1125  ---asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                A    KC+LCL   + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  313   WIPAGPQRKCTLCLDPFKDPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  371


 Score = 49.3 bits (116),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A  + +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  61   GQRYAHTHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLGRRAGYIV  120

Query  486  YQTAVPYLAERV  521
                VP + +R+
Sbjct  121  SSILVPSILQRL  132


 Score = 28.9 bits (63),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRAHEKDNYITSTLSTQAQSIVRTLRGQRYA  65



>gb|EZF13248.1| hypothetical protein H100_06408 [Trichophyton rubrum MR850]
 gb|EZF39475.1| hypothetical protein H102_06374 [Trichophyton rubrum CBS 100081]
 gb|EZF50302.1| hypothetical protein H103_06400 [Trichophyton rubrum CBS 288.86]
 gb|EZF60933.1| hypothetical protein H104_06386 [Trichophyton rubrum CBS 289.86]
 gb|EZF71450.1| hypothetical protein H105_06413 [Trichophyton soudanense CBS 
452.61]
 gb|EZF82260.1| hypothetical protein H110_06396 [Trichophyton rubrum MR1448]
 gb|EZF92698.1| hypothetical protein H113_06445 [Trichophyton rubrum MR1459]
 gb|EZG04021.1| hypothetical protein H106_06240 [Trichophyton rubrum CBS 735.88]
 gb|EZG14343.1| hypothetical protein H107_06543 [Trichophyton rubrum CBS 202.88]
 gb|KDB31220.1| hypothetical protein H112_06393 [Trichophyton rubrum D6]
 gb|EGD85488.2| hypothetical protein TERG_01759 [Trichophyton rubrum CBS 118892]
Length=393

 Score = 92.4 bits (228),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 89/179 (50%), Gaps = 11/179 (6%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             NL  FYF G YYHLSKR  G+RYVF  +   + +R  Y++LG  L++Q+ + A    +  
Sbjct  215   NLAAFYFSGAYYHLSKRVWGLRYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEV  274

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNE----EGNLITAVSEKGsfvsepsstsesq  1124
                  +  + Q +   T   + G G P L      +G  + A  E    +S         
Sbjct  275   IESIQLEEAGQVS--ATDSAAKGAGTPGLKSISMPDGMTLLAPEEARYDMSVEKDALAMS  332

Query  1125  ---asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                A    KC+LCL   + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  333   WIPAGPQRKCTLCLDPFKDPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  391


 Score = 49.3 bits (116),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G + A A+ +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  81   GQQYAHAHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLGRRAGYIV  140

Query  486  YQTAVPYLAERV  521
                VP + +R+
Sbjct  141  SSILVPSILQRL  152


 Score = 29.3 bits (64),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  46   FPWATSPDIIRAHEKDNYITSTLSTQAQSIIRTLRGQQYA  85



>ref|XP_005458836.1| PREDICTED: peroxisome biogenesis factor 10-like isoform X2 [Oreochromis 
niloticus]
Length=316

 Score = 89.4 bits (220),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 137/319 (43%), Gaps = 64/319 (20%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G+R  + ++ E +LL  + YF LTT  G QTLGEEY +  QV       P+PARR +F+ 
Sbjct  38    GSRRWLEWRKEIELLSDLAYFGLTTFLGYQTLGEEYVNIVQVDPTKRQIPSPARRGVFVL  97

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                 VPYL +++        + L++  +         +  S   +  A        + A 
Sbjct  98    CHAFVPYLLDKLL-------VCLENELEGGQESRGRQQVGSVPWSLEAWLRRWVQKAAAL  150

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
              S   R     R C L+AV        + ++ L L+ R +   FY  G ++HLSKR + I
Sbjct  151   CSEPQR-----RAC-LNAV-------FVLQQSLTLLYRLHSALFYVTGSFHHLSKRLADI  197

Query  846   RYV-FIGKPTNQR---PRYQILGFF----LLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
              Y+  +G  +N       Y++LG      LL+ +C+      +R+ +    +   + +P 
Sbjct  198   SYMRVVGLNSNDSTIGSSYRLLGVMSLLQLLITVCLQLNNFRQRQRARQEWSLHRKLSP-  256

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
               ++ SSG    +       I  + E                            R+H T+
Sbjct  257   -QHRQSSGPRAALC------ILCLEE----------------------------RRHSTS  281

Query  1182  TPCGHVFCWNCIMEWCNEK  1238
             TPCGH+FCW CI EWCN K
Sbjct  282   TPCGHLFCWECITEWCNTK  300


 Score = 26.6 bits (57),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +2

Query  134  AQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            A + +++R ++KD+ Y   +  +  DAF+ L GS
Sbjct  6    ATRAQLIRCSQKDDYYRSSLRNSANDAFQTLAGS  39



>ref|XP_009045062.1| hypothetical protein LOTGIDRAFT_237439 [Lottia gigantea]
 gb|ESP04252.1| hypothetical protein LOTGIDRAFT_237439 [Lottia gigantea]
Length=292

 Score = 87.8 bits (216),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 80/337 (24%), Positives = 129/337 (38%), Gaps = 92/337 (27%)
 Frame = +3

Query  306   GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
             G R  + ++ E  ++  + YFLLTT +G QT+GEEY +  QV       P+  RRAL   
Sbjct  37    GARKWIKWRRELDVMSDLGYFLLTTLSGNQTIGEEYVNIVQVDSTRRHIPSLPRRALMAL  96

Query  486   YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                  PY+ ++                                                 
Sbjct  97    LHVVSPYILQK-------------------------------------------------  107

Query  666   PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVI---RANLMFFYFEGLYYHLSKRA  836
               VL   +T ++    H  +    +L   R + Q +I   R +L  FY  G++YH++KR 
Sbjct  108   --VLKNLETTLQTA-PHRAEETEKMLKALRALQQCLIYLHRLHLGIFYLRGVFYHIAKRI  164

Query  837   SG---IRYVFIGKPTNQRPR--YQILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPF  1001
             +G   I+Y+    P++      ++ L +  L Q+   A   L      +  ++  +   F
Sbjct  165   TGVHYIKYMGNKSPSSDVSSVTFKYLAWLSLGQITFSAFIQLYHYYQSTMGSSIYKTHAF  224

Query  1002  GTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasglskcslclssRQHPTA  1181
             G+  T+  + + ++  + +L      +G                           Q PT 
Sbjct  225   GS--TTEKKRMGLIYRKCSLCL----EGI--------------------------QSPTL  252

Query  1182  TPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
              PCGH+FCWNCI  WC  K ECP+CR       LV L
Sbjct  253   APCGHLFCWNCIHTWCQNKSECPMCRDKFQPHRLVFL  289


 Score = 27.7 bits (60),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGS  235
            F  A  PEI+R+ +KD+ Y  ++  +  + F+ L G+
Sbjct  2    FKAAGTPEILRSHQKDDYYLTYLRTSIAETFQLLAGA  38



>ref|XP_001538776.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN09214.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=313

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 88/174 (51%), Gaps = 4/174 (2%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRPR--YQILGFFLLVQLCIl--aaeglr  950
             NL  FYF G YYH+SKR  G+RYVF  +  +   R  Y++LG  L++Q+ +         
Sbjct  138   NLAAFYFSGAYYHISKRIWGLRYVFTKRIEDNEARIGYEVLGVLLVLQIAVQGILHVKNT  197

Query  951   rrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqas  1130
               S  +  A   QQ     +Q ++ + +       +L  + +         +S +    S
Sbjct  198   ISSFTAETAEGQQQQEGSDHQKTALKSIYTPPSIQSLPASEARYDLANPTNASLAWVPPS  257

Query  1131  glskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                KC+LCL   + P+AT CGH+FCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  258   QQRKCTLCLELYKDPSATTCGHIFCWTCIRDWVREKPECPLCRQEALGSKILPL  311



>emb|CCX32313.1| Similar to Peroxisome biogenesis factor 10; acc. no. Q00940 [Pyronema 
omphalodes CBS 100304]
Length=325

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 81/185 (44%), Gaps = 35/185 (19%)
 Frame = +3

Query  771   VIRANLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeg  944
             ++  +L  FYF G YYHLSKR  G+RYVF  +  P  QR  Y++LG              
Sbjct  163   ILAVHLGVFYFSGNYYHLSKRLWGLRYVFTQRLQPHEQRQGYEVLGV-------------  209

Query  945   lrrrsslssiaasaQQTPFGTYQTSSGR-GVPVLNEEGNLITAVS--------EKGsfvs  1097
                            Q     Y    GR   PVL EE   +T +         + G    
Sbjct  210   -----------LLLAQLAAQAYFHVKGRWATPVLTEEEKEVTLLDVSRPGEGVQGGEVDL  258

Query  1098  epsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHS  1277
                  +   +    KC+LCL   + PTAT CGHVFCW CI EWC  KPECPLCR  A   
Sbjct  259   GDEKRARYLSGMNRKCTLCLEDMKDPTATQCGHVFCWGCIAEWCRNKPECPLCRQAAVVQ  318

Query  1278  SLVCL  1292
              L+ L
Sbjct  319   GLLPL  323



>ref|XP_003024411.1| hypothetical protein TRV_01374 [Trichophyton verrucosum HKI 0517]
 gb|EFE43800.1| hypothetical protein TRV_01374 [Trichophyton verrucosum HKI 0517]
Length=373

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 88/179 (49%), Gaps = 11/179 (6%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             NL  FYF G YYHLSKR  G+RYVF  +   + +R  Y++LG  L++Q+ + A    +  
Sbjct  195   NLAAFYFSGAYYHLSKRVWGLRYVFTKRIGDSEERIGYEVLGVLLVLQIAVQAIVHAKEV  254

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNE----EGNLITAVSEKGsfvsepsstsesq  1124
                  +  + Q +   T   +   G P L      +G  + A  E    +S         
Sbjct  255   IESIQLEEAGQAS--ATDSAAKVAGTPGLKSISMPDGMALLAPEEARYDMSVEKDALAMS  312

Query  1125  ---asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                A    KC+LCL   + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  313   WIPAGPQRKCTLCLDPFKDPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEAIASKILPL  371


 Score = 51.2 bits (121),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A A+ +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+  RRA +I 
Sbjct  61   GQRYAHAHSDAIKHAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLGRRAGYIV  120

Query  486  YQTAVPYLAERV  521
                VP + +R+
Sbjct  121  SSILVPSILQRL  132


 Score = 28.9 bits (63),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRAHEKDSYITSTLSTQAQSIIRTLRGQRYA  65



>ref|XP_008615780.1| hypothetical protein SDRG_11517 [Saprolegnia diclina VS20]
 gb|EQC30756.1| hypothetical protein SDRG_11517 [Saprolegnia diclina VS20]
Length=356

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 76/178 (43%), Gaps = 29/178 (16%)
 Frame = +3

Query  762   LQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCIlaae  941
             +Q  +  +L  FY  G Y+ ++KR +GIRY+   K      ++ ILG+ +L++L + +  
Sbjct  205   MQAAVAVHLALFYLHGRYFDMAKRVAGIRYILTRKLDAPHAQFSILGYLILLRLALSSVL  264

Query  942   glrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstses  1121
             GL            A +     ++  S    P +  +      ++E              
Sbjct  265   GLSACLRTLLGVEVAPRR-LDQHRVPSDESRPTVTAQRKCALCLTE--------------  309

Query  1122  qasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLY  1295
                           R HP  TPCGHVFCW CI+ WC  KPECPLCR       + C+Y
Sbjct  310   --------------RSHPAMTPCGHVFCWECIVGWCQNKPECPLCRQLVQPQDVKCIY  353



>ref|XP_003172271.1| peroxisome assembly protein 10 [Microsporum gypseum CBS 118893]
 gb|EFR01860.1| peroxisome assembly protein 10 [Microsporum gypseum CBS 118893]
Length=376

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 87/180 (48%), Gaps = 10/180 (6%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             NL  FYF G YYHLSKR  G+RYVF  +   + +R  Y++LG  L++Q+ +      +  
Sbjct  195   NLAAFYFSGAYYHLSKRVWGLRYVFTKRIGDSEERIGYEVLGVLLVLQIVVQGIVHAKEV  254

Query  957   sslssiaasaQQTPFGTYQTSS-GRGVPVLNE----EGNLITAVSEKGsfvsepsstses  1121
                  +          +  +++ G G P L      +G  + A  E    +S        
Sbjct  255   IESIQLEELESAKVSSSVDSAARGAGTPGLKSISMPDGVALLAPDEARYDMSVEGDALAM  314

Query  1122  q---asglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
                 A    KC+LCL   + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  315   SWIPAGPQRKCTLCLDPFKDPSVSTCGHVFCWTCIRDWVQEKPECPLCRQEALASKILPL  374


 Score = 49.7 bits (117),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A  + +  K   ++LY  LTT  G +TLGEEYCD  Q+       P+ +RRA +I 
Sbjct  61   GQRYAHTHSDAIKNAIEVLYLSLTTLLGNRTLGEEYCDVVQLEDDTLQLPSLSRRAGYIV  120

Query  486  YQTAVPYLAERV  521
                VP + +R+
Sbjct  121  SSILVPSILQRL  132


 Score = 28.1 bits (61),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/40 (33%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+R+ EKD   T  +    +   R L G  ++
Sbjct  26   FPWATSPDIIRSHEKDSYITSTLSTQAQSIIRTLRGQRYA  65



>ref|XP_008866558.1| hypothetical protein H310_04140 [Aphanomyces invadans]
 gb|ETW05120.1| hypothetical protein H310_04140 [Aphanomyces invadans]
Length=368

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 92/186 (49%), Gaps = 28/186 (15%)
 Frame = +3

Query  759   ILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQR-PRYQILGFFLLVQLCIla  935
             ++Q +I+ +L FFY  G Y+H +KRA+ IRY+   +P +    ++ ILG  +L+Q  + A
Sbjct  203   VVQGLIQLHLAFFYLHGNYFHPAKRAAAIRYILTYRPAHHTFAQFSILGNLILIQAALTA  262

Query  936   aeglrrrsslssiaasaQQTPFGTYQTSSGRG---VPVLN--EEGNLITAVSEKGsfvse  1100
             +  L              ++   T Q  + RG   VP ++     +   AV +K      
Sbjct  263   SLNLPTIFRAIVGQNLLSRS--STSQPPTLRGSQRVPSMDISRPSSSSHAVVKK------  314

Query  1101  psstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSS  1280
                           C LCL+ R HP+ TPCGH+FCW CI+ WC  KPECPLCR       
Sbjct  315   --------------CVLCLAERTHPSVTPCGHLFCWECIVGWCQNKPECPLCRQLVLPQD  360

Query  1281  LVCLYH  1298
             + CLY+
Sbjct  361   IKCLYN  366



>ref|XP_002113781.1| hypothetical protein TRIADDRAFT_57553 [Trichoplax adhaerens]
 gb|EDV24255.1| hypothetical protein TRIADDRAFT_57553 [Trichoplax adhaerens]
Length=300

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 89/198 (45%), Gaps = 38/198 (19%)
 Frame = +3

Query  723   QRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQR---PRYQ  893
             +R   ++P+ + ++ L  + + + FYF G++YH++KR + I+++ + +    +     Y+
Sbjct  131   RRLKLLIPVLKNLISLFQQIHTISFYFNGVFYHIAKRFTRIKHILVRETEKDQLASITYR  190

Query  894   ILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVL---NEEGNLI  1064
             ILG+   +QL I                   Q  P     ++S    P++    E   + 
Sbjct  191   ILGWLSFIQLIISII----------------QWLPLYIRPSTSQSNHPLIPGHQETSQMH  234

Query  1065  TAVSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPE  1244
               VS   +        S                 QHPT TPCGH+FCW+CI  WC  KPE
Sbjct  235   HQVSTTVNIKCCLCLESC----------------QHPTCTPCGHIFCWHCIAGWCRTKPE  278

Query  1245  CPLCRSPATHSSLVCLYH  1298
             CPLCR     S L+ L+H
Sbjct  279   CPLCRESTEASRLIHLHH  296


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G+R+ + +Q E ++L ++ YF L+T +G QTLGEEYC   QV       P+ +RR L + 
Sbjct  37   GSRLWIKWQRELQILTELAYFGLSTLSGYQTLGEEYCYLIQVEDTRKSIPSFSRRLLMVL  96

Query  486  YQTAVPY  506
              T  PY
Sbjct  97   LSTLTPY  103



>gb|KID90311.1| RING-1 like protein [Metarhizium guizhouense ARSEF 977]
Length=372

 Score = 78.6 bits (192),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 87/210 (41%), Gaps = 37/210 (18%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R   +   E + L  +LYF LTT  G +TLGEEYCD  QV  P G  P   +RA +I 
Sbjct  53   GARATHSLAPELRSLAALLYFALTTLPGNRTLGEEYCDLVQVESPAGQLPDVKKRAAYIA  112

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +PYL  R    + ++   L D   D+                           R  
Sbjct  113  GTILLPYLVSRTLPSLRNRLRKLIDRRLDAL--------------------------RRK  146

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             S  SR        W +     PS+   A   +Q V    L  FYF G YY L+KR   +
Sbjct  147  GSQTSREA----RAWEYISNHLPSLTSAA--PIQAV---TLALFYFNGTYYELTKRLLSL  197

Query  846  RYVFIGKPTNQRPR--YQILGFFLLVQLCI  929
            RYVF     +   R  Y++LG  L++QL +
Sbjct  198  RYVFTRAVPDSPDRGGYEVLGVLLVIQLAV  227


 Score = 33.1 bits (74),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINL  253
            +P A  P+I+RA +KD  +T  +     D +R LFG+  + +L
Sbjct  18   YPFAAAPDIVRAHQKDAYFTGHLANTISDLYRRLFGARATHSL  60


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
             + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  328   KDPSATQCGHVFCWECIGDWVREKPECPLCRREA  361



>gb|EXV03081.1| Pex2/Pex12 and RING finger domain protein [Metarhizium robertsii]
Length=372

 Score = 77.8 bits (190),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 87/210 (41%), Gaps = 37/210 (18%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R   +   E + L  +LYF LTT  G +TLGEEYCD  QV  P G  P   +RA +I 
Sbjct  53   GARATHSLAPELRSLAALLYFALTTLPGNRTLGEEYCDLVQVESPAGQLPDVKKRAAYIA  112

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +PYL  R    + ++   L D   D+                           R  
Sbjct  113  GTILLPYLVSRTLPGLRNRLRKLIDRRLDAL--------------------------RRK  146

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             S  SR        W +     PS+   A   +Q V    L  FYF G YY L+KR   +
Sbjct  147  GSQASREA----RAWEYISNHLPSLTSAA--PIQAV---TLALFYFNGTYYELTKRLLSL  197

Query  846  RYVFIGKPTNQRPR--YQILGFFLLVQLCI  929
            RYVF     +   R  Y++LG  L++QL +
Sbjct  198  RYVFTRAVPDSPDRGGYEVLGVLLVIQLAV  227


 Score = 33.1 bits (74),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINL  253
            +P A  P+I+RA +KD  +T  +     D +R LFG+  + +L
Sbjct  18   YPFAAAPDIVRAHQKDAYFTGHLANTISDLYRRLFGARATHSL  60


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
             + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  328   KDPSATQCGHVFCWECIGDWVREKPECPLCRREA  361



>ref|XP_002146363.1| peroxisome biosynthesis protein (Peroxin-10), putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA25816.1| peroxisome biosynthesis protein (Peroxin-10), putative [Talaromyces 
marneffei ATCC 18224]
 gb|KFX44315.1| Peroxisome biogenesis factor 10 [Talaromyces marneffei PM1]
Length=382

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 89/176 (51%), Gaps = 12/176 (7%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVF---IGKPTNQRPRYQILGFFLLVQLCIlaaeglrr  953
             +L  FYF G YYHLSKR  G+RYVF   IG+ + QR  Y++LG  L++Q+ I     +R 
Sbjct  207   SLATFYFTGAYYHLSKRLWGLRYVFTKQIGE-SEQRVGYEVLGVLLVLQMTIQGIVHVRD  265

Query  954   rsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLI-----TAVSEKGsfvsepsstse  1118
                  S      +    T   S+ +G   L+   N I     TA   +      P + S 
Sbjct  266   TLQQPSTQT---EKIADTQAASASKGDAPLSSVQNPISIPTLTAAMARYDLAENPQAISW  322

Query  1119  sqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLV  1286
                    KC+LCL   + P+ T CGHVFCW CI +W  EKPECPLCR  A  S ++
Sbjct  323   IPEGQHQKCTLCLEPFKDPSVTTCGHVFCWTCIRDWVREKPECPLCRQEALPSKIL  378


 Score = 53.1 bits (126),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A    +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR+ +IF
Sbjct  65   GARYAHGNADTIKNLTELLYFSLTTLIGNRTLGEEYCDVVQLETDTLQLPSIVRRSGYIF  124

Query  486  YQTAVPYLAER  518
                +P++  R
Sbjct  125  SSIIIPWVLGR  135


 Score = 25.4 bits (54),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 10/40 (25%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD      +    +   R + G+ ++
Sbjct  30   YPFATSPDIIRSHEKDAYIVSTLTNQSQSIIRSIKGARYA  69



>gb|KFG87461.1| RING-1 like protein [Metarhizium anisopliae]
 gb|KID66479.1| RING-1 like protein, partial [Metarhizium anisopliae ARSEF 549]
Length=372

 Score = 77.8 bits (190),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 87/210 (41%), Gaps = 37/210 (18%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R   +   E + L  +LYF LTT  G +TLGEEYCD  QV  P G  P   +RA +I 
Sbjct  53   GARATHSLAPELRSLAALLYFALTTLPGNRTLGEEYCDLVQVESPAGQLPDIKKRAAYIA  112

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +PYL  R    + ++   L D   D+                           R  
Sbjct  113  GTILLPYLVSRTLPGLRNRLRKLIDRRLDAL--------------------------RRK  146

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             S  SR        W +     PS+   A   +Q V    L  FYF G YY L+KR   +
Sbjct  147  GSQASREA----RVWEYISNHLPSLTSAA--PIQAV---TLALFYFNGTYYELTKRLLSL  197

Query  846  RYVFIGKPTNQRPR--YQILGFFLLVQLCI  929
            RYVF     +   R  Y++LG  L++QL +
Sbjct  198  RYVFTRAVPDSPDRGGYEVLGVLLVIQLAV  227


 Score = 33.1 bits (74),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINL  253
            +P A  P+I+RA +KD  +T  +     D +R LFG+  + +L
Sbjct  18   YPFAAAPDIVRAHQKDAYFTGHLANTISDLYRRLFGARATHSL  60


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
             + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  328   KDPSATQCGHVFCWECIGDWVREKPECPLCRREA  361



>ref|XP_001644639.1| hypothetical protein Kpol_526p34 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO16781.1| hypothetical protein Kpol_526p34 [Vanderwaltozyma polyspora DSM 
70294]
Length=328

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 83/178 (47%), Gaps = 12/178 (7%)
 Frame = +3

Query  753   REILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRPRY---------QILGF  905
             +E+L  +   +LM FYF G YY +SKR  G+RY  IG   NQ  +          +ILG+
Sbjct  142   KELLDKISSVHLMLFYFSGAYYEISKRIFGLRYA-IGHKLNQNEKMFRKQNSNSLKILGY  200

Query  906   FLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKG  1085
              LL+Q    +   L +           QQ       +S    +  +    N  T + +  
Sbjct  201   ILLIQSFSKSLPILSQCVKTFLPQQQEQQLNEKNTYSSENDQIDTMALTKN--TNLKDSK  258

Query  1086  sfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                    S  +        C LCL+S   P+A PCGH+FCW+CI+ WC E+PECPLCR
Sbjct  259   HIELSDESVFKFIPEESRNCILCLNSMVDPSAAPCGHIFCWDCIINWCKERPECPLCR  316



>gb|KDD73393.1| hypothetical protein H632_c2224p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=195

 Score = 68.6 bits (166),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R +V +  E + L Q+LY+ LTTG+G QTLGEEYC+  Q +G     P   RR +  F
Sbjct  54   GPRRSVQWSREIQTLSQLLYYSLTTGSGLQTLGEEYCEILQASGSVDASPGTVRRCVLAF  113

Query  486  YQTAVPYLAERV  521
             Q+  PY+A+R 
Sbjct  114  LQSVGPYVADRT  125


 Score = 41.6 bits (96),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSIN  250
             P A+   I+RA +KDE Y   + EAC+DA RH+ G   S+ 
Sbjct  19   LPRAEAASIIRAEQKDEIYIQQLNEACQDAVRHVLGPRRSVQ  60



>ref|XP_007820549.1| RING-1 like protein [Metarhizium robertsii ARSEF 23]
 gb|EFZ00583.1| hypothetical protein MAA_04360 [Metarhizium robertsii ARSEF 23]
Length=372

 Score = 76.6 bits (187),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 86/210 (41%), Gaps = 37/210 (18%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R   +   E + L  +LYF LTT  G +TLGEEYCD  QV  P G  P   +RA +I 
Sbjct  53   GARATHSLAPELRSLAALLYFALTTLPGNRTLGEEYCDLVQVESPAGQLPDVKKRAAYIA  112

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +PYL  R    + ++   L D                             +  R  
Sbjct  113  GTILLPYLVSRTLPGLRNRLRKLID--------------------------RRLAALRRK  146

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             S  SR        W +     PS+   A   +Q V    L  FYF G YY L+KR   +
Sbjct  147  GSQASREA----RAWEYISNHLPSLTSAA--PIQAV---TLALFYFNGTYYELTKRLLSL  197

Query  846  RYVFIGKPTNQRPR--YQILGFFLLVQLCI  929
            RYVF     +   R  Y++LG  L++QL +
Sbjct  198  RYVFTRAVPDSPDRGGYEVLGVLLVIQLAV  227


 Score = 33.1 bits (74),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINL  253
            +P A  P+I+RA +KD  +T  +     D +R LFG+  + +L
Sbjct  18   YPFAAAPDIVRAHQKDAYFTGHLANTISDLYRRLFGARATHSL  60


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
             + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  328   KDPSATQCGHVFCWECIGDWVREKPECPLCRREA  361



>gb|KIE03414.1| RING-1 like protein, partial [Metarhizium majus ARSEF 297]
Length=372

 Score = 76.6 bits (187),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 87/210 (41%), Gaps = 37/210 (18%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R   +   E + L  +LYF LTT  G +TLGEEYCD  QV  P G  P   +RA +I 
Sbjct  53   GARATHSLAPELRSLAALLYFALTTLPGNRTLGEEYCDLVQVESPAGQLPDVKKRAAYIA  112

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +PYL  R    + ++   L D   D+                           R  
Sbjct  113  GTILLPYLVSRTLPSLRNRLRRLIDRRLDAL--------------------------RRK  146

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             S  SR        W +     PS+   A   +Q V    L  FYF G YY L+KR   +
Sbjct  147  GSQTSREA----RAWEYISNHLPSLTSAA--PIQAV---TLALFYFNGTYYELTKRLLSL  197

Query  846  RYVFIGKPTNQRPR--YQILGFFLLVQLCI  929
            RYVF     +   R  Y++LG  L++QL +
Sbjct  198  RYVFTRAVPDSPDRGGYEVLGVLLVIQLAV  227


 Score = 33.1 bits (74),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINL  253
            +P A  P+I+RA +KD  +T  +     D +R LFG+  + +L
Sbjct  18   YPFAAAPDIVRAHQKDAYFTGHLANTISDLYRRLFGARATHSL  60


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
             + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  328   KDPSATQCGHVFCWECIGDWVREKPECPLCRREA  361



>gb|KID76860.1| RING-1 like protein, partial [Metarhizium brunneum ARSEF 3297]
Length=372

 Score = 76.3 bits (186),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 87/210 (41%), Gaps = 37/210 (18%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R   +   E + L  +LYF LTT  G +TLGEEYCD  QV  P G  P   +RA +I 
Sbjct  53   GARATHSLAPELRSLAALLYFALTTLPGNRTLGEEYCDLVQVESPAGQLPDVKQRAAYIA  112

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +PYL  R    + ++   L D   D+                           R  
Sbjct  113  GTILLPYLVSRTLPSLRNRLRKLIDRRLDAL--------------------------RRK  146

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             +  SR        W +     PS+   A   +Q V    L  FYF G YY L+KR   +
Sbjct  147  GNQASREA----RVWEYISNHLPSLTSAA--PIQAV---TLALFYFNGTYYELTKRLLSL  197

Query  846  RYVFIGKPTNQRPR--YQILGFFLLVQLCI  929
            RYVF     +   R  Y++LG  L++QL +
Sbjct  198  RYVFTRAVPDSPDRGGYEVLGVLLVIQLAV  227


 Score = 33.1 bits (74),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 25/43 (58%), Gaps = 0/43 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFSINL  253
            +P A  P+I+RA +KD  +T  +     D +R LFG+  + +L
Sbjct  18   YPFAAAPDIVRAHQKDAYFTGHLANTISDLYRRLFGARATHSL  60


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
             + P+AT CGHVFCW CI +W  EKPECPLCR  A
Sbjct  328   KDPSATQCGHVFCWECIGDWVREKPECPLCRREA  361



>ref|XP_009831959.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV78380.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=269

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 91/179 (51%), Gaps = 20/179 (11%)
 Frame = +3

Query  771   VIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQR--PRYQILGFFLLVQLCIlaaeg  944
             +++ ++  F+  G Y HLSKR +GIRY+   +P+      ++ ILG+ +L++  + A+  
Sbjct  106   LLQLHVALFFLRGTYLHLSKRMAGIRYILSYRPSPNTSFAQFSILGYMILIRAALTASFT  165

Query  945   lrrrsslssiaasaQQTPFGTYQTSSGRGVPVL-NEEGNLITAVSEKGsfvsepsstses  1121
             L            A  +   T++      VP+  N     + + S +             
Sbjct  166   LPTIVRAVMGTRLAPPSAASTHRVPC-LAVPITPNPPPRQLPSSSPQ-------------  211

Query  1122  qasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
                 + KC+LCL+ R HP+ATPCGH+FCW+CI+ WC  KPECPLCR       + CLY+
Sbjct  212   ---RIKKCALCLAERSHPSATPCGHLFCWDCIVGWCQSKPECPLCRQLVLPQDIKCLYN  267



>dbj|GAM43046.1| hypothetical protein TCE0_044f17549 [Talaromyces cellulolyticus]
Length=379

 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 81/173 (47%), Gaps = 26/173 (15%)
 Frame = +3

Query  783   NLMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrr  956
             +L  FYF G YYHLSKR  G+RYVF  +   + QR  Y++LG  L++Q+ I     +R  
Sbjct  206   SLATFYFTGAYYHLSKRLWGLRYVFTKQIGDSEQRVGYEVLGVLLVLQMTIQGIVHVRDT  265

Query  957   sslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgl  1136
                        Q P  + QT     VP   +    +++V    S  +  ++ +    +  
Sbjct  266   L----------QQP--SSQTEKIADVPATTQGDTPLSSVQNPVSIPTLTATMARYDLAEN  313

Query  1137  skcslclssRQH------------PTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
              +    +   QH            P+ T CGHVFCW C+ +W  EKPECPLCR
Sbjct  314   PQAISWIPEGQHQKCTLCLEPFKDPSVTTCGHVFCWTCVRDWVREKPECPLCR  366


 Score = 52.4 bits (124),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A    +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+  RR  +IF
Sbjct  65   GARYAHGNADTIKNLTELLYFSLTTFIGNRTLGEEYCDVVQLETDTLQLPSIVRRCGYIF  124

Query  486  YQTAVPYLAER  518
                +P++  R
Sbjct  125  SSIIIPWVLGR  135


 Score = 25.4 bits (54),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 10/40 (25%), Positives = 20/40 (50%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD      +    +   R + G+ ++
Sbjct  30   YPFATSPDIIRSHEKDAYIVSTLTNQSQSIIRSIKGARYA  69



>ref|XP_008938320.1| PREDICTED: peroxisome biogenesis factor 10, partial [Merops nubicus]
Length=262

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 81/186 (44%), Gaps = 33/186 (18%)
 Frame = +3

Query  753   REILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQ----RPRYQILGFFLLVQ  920
             ++ + L+ R +L  FY  G +YHL+KR +GI Y+  G P  +    R  Y++LG   L  
Sbjct  103   KQFVPLLHRLHLAVFYMRGTFYHLAKRVAGITYLHFGGPQEEDQSIRSSYKLLGIISLFH  162

Query  921   LCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvse  1100
             L +  +  L             +Q      +    R +P      +L     EK +    
Sbjct  163   LLLTISVQLYSF----------KQKQRARQEWKLHRSLP------HLKNMTKEKAAGHHS  206

Query  1101  psstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSS  1280
               +    +             R+H TATPCGH+FCW CI EWCN + ECPLCR       
Sbjct  207   RCTLCLEE-------------RRHTTATPCGHLFCWECITEWCNTRNECPLCREKFHPQK  253

Query  1281  LVCLYH  1298
             L+ L H
Sbjct  254   LIYLRH  259



>ref|XP_009831960.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV78379.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=299

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 91/179 (51%), Gaps = 20/179 (11%)
 Frame = +3

Query  771   VIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQR--PRYQILGFFLLVQLCIlaaeg  944
             +++ ++  F+  G Y HLSKR +GIRY+   +P+      ++ ILG+ +L++  + A+  
Sbjct  136   LLQLHVALFFLRGTYLHLSKRMAGIRYILSYRPSPNTSFAQFSILGYMILIRAALTASFT  195

Query  945   lrrrsslssiaasaQQTPFGTYQTSSGRGVPVL-NEEGNLITAVSEKGsfvsepsstses  1121
             L            A  +   T++      VP+  N     + + S +             
Sbjct  196   LPTIVRAVMGTRLAPPSAASTHRVPC-LAVPITPNPPPRQLPSSSPQ-------------  241

Query  1122  qasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
                 + KC+LCL+ R HP+ATPCGH+FCW+CI+ WC  KPECPLCR       + CLY+
Sbjct  242   ---RIKKCALCLAERSHPSATPCGHLFCWDCIVGWCQSKPECPLCRQLVLPQDIKCLYN  297



>ref|XP_003295009.1| hypothetical protein DICPUDRAFT_44226 [Dictyostelium purpureum]
 gb|EGC28461.1| hypothetical protein DICPUDRAFT_44226 [Dictyostelium purpureum]
Length=275

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 89/191 (47%), Gaps = 27/191 (14%)
 Frame = +3

Query  726   RWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQRPRYQILGF  905
             ++P  L + +E+   + R +L  FYF G Y+  SKR S IRY+F  K   +RP+Y ILG 
Sbjct  111   KYPK-LYILKEMFPKLERLHLALFYFNGSYFEFSKRLSNIRYIFNRKIDQKRPKYDILG-  168

Query  906   FLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKG  1085
                          +  +  LS+     + + F     +    +  LNE+ NL    + + 
Sbjct  169   -----------LLIIIQLLLSTFMYLKENSFFLKSNQNDTEEIEELNEK-NLTNENNNQD  216

Query  1086  sfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSP  1265
             S      +    +             R H TAT CGH+FCW+CI EWCN K +CP+CR P
Sbjct  217   SESDAKCTLCLEK-------------RTHTTATICGHLFCWHCITEWCNNKEQCPVCRCP  263

Query  1266  ATHSSLVCLYH  1298
                 + + LY+
Sbjct  264   MGIRTCIPLYN  274


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVA-GPYGLPPTPARRALFI  482
            G RV +  Q+E+KLL   LY+LLTT  G QTLGEEYC+  ++    + +P    R  L+I
Sbjct  33   GPRVLMNKQSESKLLANTLYYLLTTMIGAQTLGEEYCNLRKIKDNTFSIPNIADRTQLYI  92

Query  483  FYQTAVPYLAERV  521
            F+    PYL ++ 
Sbjct  93   FHLLG-PYLIKKA  104



>gb|KFQ18569.1| Peroxisome biogenesis factor 10, partial [Merops nubicus]
Length=283

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 85/196 (43%), Gaps = 33/196 (17%)
 Frame = +3

Query  723   QRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQ----RPRY  890
             +R    + + ++ + L+ R +L  FY  G +YHL+KR +GI Y+  G P  +    R  Y
Sbjct  114   RRVLQTVHVLKQFVPLLHRLHLAVFYMRGTFYHLAKRVAGITYLHFGGPQEEDQSIRSSY  173

Query  891   QILGFFLLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITA  1070
             ++LG   L  L +  +  L             +Q      +    R +P      +L   
Sbjct  174   KLLGIISLFHLLLTISVQLYSF----------KQKQRARQEWKLHRSLP------HLKNM  217

Query  1071  VSEKGsfvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECP  1250
               EK +      +    +             R+H TATPCGH+FCW CI EWCN + ECP
Sbjct  218   TKEKAAGHHSRCTLCLEE-------------RRHTTATPCGHLFCWECITEWCNTRNECP  264

Query  1251  LCRSPATHSSLVCLYH  1298
             LCR       L+ L H
Sbjct  265   LCREKFHPQKLIYLRH  280



>gb|KFP58746.1| Peroxisome biogenesis factor 10, partial [Cariama cristata]
Length=267

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 97/218 (44%), Gaps = 35/218 (16%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G +  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRA+F+ 
Sbjct  1    GAKKWLGWRKEIELLSDVAYFVLTTLSGYQTLGEEYVNILQVDSTKKRVPSFLRRAIFVS  60

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
              T VPY  E+    +  +  T  D F  S                          +   
Sbjct  61   LHTVVPYCLEKGLLHLERELQTEADEFRTS-------------------------QNNPA  95

Query  666  PSVLSRFKTKI---RECWLHAVQRWPSVLPLAREILQ---LVIRANLMFFYFEGLYYHLS  827
            P + SR   +    ++ W    Q+  +VL +   + Q   L+ R +L  FY  G +YHLS
Sbjct  96   PGLSSRTLVQNWIQKQVWELTEQQKKTVLQIVHVLKQCIPLLHRLHLAVFYISGAFYHLS  155

Query  828  KRASGIRYVFI----GKPTNQRPRYQILGFFLLVQLCI  929
            KR +GIRY+      G+  + R  Y+ LG   L  L +
Sbjct  156  KRLTGIRYLHFGGLQGEDQSIRSSYKFLGIISLFHLLL  193


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEK  1238
             R+H TATPCGH+FCW CI EWCN +
Sbjct  243   RRHTTATPCGHLFCWECITEWCNTR  267



>ref|XP_006934380.1| PREDICTED: peroxisome biogenesis factor 10 [Felis catus]
Length=334

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 85/183 (46%), Gaps = 33/183 (18%)
 Frame = +3

Query  762   LQLVIRANLMFFYFEGLYYHLSKRASGIRYVFIGKP----TNQRPRYQILGFFLLVQLCI  929
             L  + R ++ +FY  G +YHL+KR +G+ Y+ +  P    T  R  Y++LGF  L+ L +
Sbjct  179   LACLQRLHVAWFYIHGAFYHLAKRLTGVTYLRVRSPPAEDTRARESYRLLGFISLLHLAL  238

Query  930   laaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepss  1109
                  L                 +G  Q    R       E  L   +S +       S 
Sbjct  239   SVGLQL-----------------YGFRQRQRAR------REWKLHRGLSHR------RSH  269

Query  1110  tsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVC  1289
               E   S  S C+LCL  R+H TATPCGH+FCW CI +WC+ K ECPLCR       LV 
Sbjct  270   VEEKAISRNSLCTLCLEERRHSTATPCGHLFCWECITQWCDTKTECPLCREKFPPQKLVY  329

Query  1290  LYH  1298
             L H
Sbjct  330   LRH  332


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G +  +  + E +LL  + YF LTT AG QTLGEEY    QV       P+  RR + + 
Sbjct  97   GAKRWLRCRREIELLSDVAYFGLTTLAGYQTLGEEYVGIIQVDPSQSRVPSTLRRGVLVA  156

Query  486  YQTAVPYLAERVSSRIASQ  542
              T +PYL +R S+ +  +
Sbjct  157  LHTVLPYLLDRASTHLEHE  175



>ref|XP_003059759.1| peroxisomal protein importer family [Micromonas pusilla CCMP1545]
 gb|EEH55711.1| peroxisomal protein importer family [Micromonas pusilla CCMP1545]
Length=405

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 88/176 (50%), Gaps = 18/176 (10%)
 Frame = +3

Query  777   RANLMFFYFEGLYYHLSKRASGIRYVFIGKPTNQ-RPRYQILGFFLLVQLCIlaaeglrr  953
             RA+L  FY  G YY  +KR +G+RYVF+G+   + RPRY +LG FL  +L          
Sbjct  240   RAHLAAFYLWGTYYAFAKRIAGVRYVFVGQEGPEGRPRYGVLGVFLAARL----------  289

Query  954   rsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasg  1133
                 ++ AA+A          SSG    +++E GN +    E     +      E     
Sbjct  290   ----AAAAAAAAAAAASAAGGSSGAAFRIMDEHGNDVEVEDEPALTATPAGGGEEGVDGV  345

Query  1134  lskcslc-lssRQHPTATPCGHVFCWNCIMEWC--NEKPECPLCRSPATHSSLVCL  1292
               K     LSS + PTAT CGHVFCW+C+  WC  + +PECP+CR+P     LV L
Sbjct  346   GIKKCALCLSSHRAPTATACGHVFCWHCVAAWCARSHQPECPMCRAPCKPQELVRL  401



>ref|XP_001273266.1| peroxisome biosynthesis protein (Peroxin-10), putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW11840.1| peroxisome biosynthesis protein (Peroxin-10), putative [Aspergillus 
clavatus NRRL 1]
Length=376

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 85/164 (52%), Gaps = 17/164 (10%)
 Frame = +3

Query  795   FYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrssls  968
             FYF G YYHLSKR  G+RYVF  K     QR  Y++LG  L++Q+ +     +R      
Sbjct  208   FYFTGSYYHLSKRFWGLRYVFTKKLEENEQRVGYEVLGVLLVLQIAVQGVLHVRTVLQ--  265

Query  969   siaasaQQTPFGTYQTSSGRGVP--VLNEEGN-----LITAVSEKGsfvsepsstsesqa  1127
                   QQ       ++S RG    +++   N     L+ A S +     + ++     +
Sbjct  266   ------QQDEGLEADSASSRGSDNALIHSIQNPPSLPLLPASSPRYDLSEDSNAIPWIPS  319

Query  1128  sglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                SKC+LCL S + P+ T CGHVFCW C+ +W  EKPECPLCR
Sbjct  320   GQQSKCTLCLESYKDPSVTTCGHVFCWTCVRDWVREKPECPLCR  363


 Score = 56.2 bits (134),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A  + +  K L ++LYF LTT  G +TLGEEYCD  Q+       P+ +RRA +I 
Sbjct  63   GARFAHTHSDAIKHLTELLYFSLTTLIGNRTLGEEYCDLVQLEDDSLQLPSVSRRAGYIL  122

Query  486  YQTAVPYLAERV  521
                VP+  +++
Sbjct  123  STIMVPWTLQKI  134


 Score = 25.8 bits (55),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ EKD   +  +    +   R L G+ F+
Sbjct  28   YPFATSPDIIRSHEKDAFLSSSLVNQAQSIARSLRGARFA  67



>gb|KFU99108.1| Peroxisome biogenesis factor 10, partial [Pterocles gutturalis]
Length=290

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 101/221 (46%), Gaps = 41/221 (19%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G +  + ++ E +LL  + YF+LTT AG QTLGEEY +  QV       P+  RRA+ I 
Sbjct  1    GAKKWLEWRKEIELLSDVAYFVLTTLAGYQTLGEEYVNIVQVDSTKKRVPSFLRRAILIS  60

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
              T VPY  E+    +  +   L     DS                         TS+++
Sbjct  61   LHTVVPYCLEKGLLHLEHE---LQTEAGDS------------------------RTSQSN  93

Query  666  PSVLSRFKTKIRECWLH------AVQRWPSVLPLA---REILQLVIRANLMFFYFEGLYY  818
            P +    +T IR  W+         Q+  +VL +    ++ + L+ R +L  FY  G +Y
Sbjct  94   PVLGLSSRTLIRN-WIQRQVGELTAQQKKTVLQIVYVLKQCVPLLHRLHLAVFYISGTFY  152

Query  819  HLSKRASGIRYVFIGKPTNQ----RPRYQILGFFLLVQLCI  929
            HLSKR +GIRY+  G P  +    R  Y++LG   L  L +
Sbjct  153  HLSKRITGIRYLHFGGPQGEDQSVRTSYKLLGIISLFHLLL  193


 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             R+H TATPCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  243   RRHTTATPCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  287



>gb|EGU75261.1| hypothetical protein FOXB_14223 [Fusarium oxysporum Fo5176]
Length=363

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 75/183 (41%), Gaps = 25/183 (14%)
 Frame = +3

Query  786   LMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrs  959
             L  FYF G YY LSKR   +RYVF      T  R  Y++LG  L++QL +     +R   
Sbjct  173   LALFYFSGTYYQLSKRLLSLRYVFTRTVPDTPDRAGYELLGVLLVIQLAVQGYTHIRSTI  232

Query  960   slssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgls  1139
             + S+     ++  FG     S       N + NL+ +     S        +    +   
Sbjct  233   TESAAR---ERAAFGASDDISLNHDGAYNGDNNLLLSTGASSSKAKVDIFAATHTPAAAV  289

Query  1140  kcslclssR--------------------QHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                     +                    + P+AT CGHVFCW CI +W  EKPECPLCR
Sbjct  290   PRVQLTDDKAMGYIKGGQQRKCTLCLEEMRDPSATQCGHVFCWECIGDWVREKPECPLCR  349

Query  1260  SPA  1268
               A
Sbjct  350   REA  352


 Score = 56.2 bits (134),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+  A   E + L  + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  46   GARLTHARAPEIQTLATLAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAIGRRAGYVA  105

Query  486  YQTAVPYLAERV  521
                +PY+A R+
Sbjct  106  ASILLPYIAARI  117


 Score = 28.9 bits (63),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D  R L G+  +
Sbjct  11   YPFATAPDIIRSHQKDAYFTGHLTQILSDLHRRLRGARLT  50



>gb|EKC27741.1| Peroxisome biogenesis factor 10 [Crassostrea gigas]
Length=267

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 86/192 (45%), Gaps = 41/192 (21%)
 Frame = +3

Query  741   LPLAREILQLVIRANLMFFYFEGLYYHLSKRASGIRYV-FIGKPT---NQRPRYQILGFF  908
             LP+ ++ L L+ R +L  FY  G++YH++KR + + Y+ F   PT   + +  ++ LG+ 
Sbjct  109   LPVLQQALSLLQRFHLALFYLRGVFYHIAKRLTNVSYIKFSVSPTEGSSVQQSFRALGWL  168

Query  909   LLVQLCIlaaeglrrrsslssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGs  1088
              L QL                      QT + +Y+ SSG   P    + ++ T  S    
Sbjct  169   SLAQLGFSVL-----------------QTLYHSYR-SSGTSSP----QKDISTRTSNDAI  206

Query  1089  fvsepsstsesqasglskcslclssRQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPA  1268
                                      R+ PTATPCGH+FCW CI EWC+ K ECP+CR   
Sbjct  207   DRKCCLCLEA---------------RRSPTATPCGHLFCWQCIYEWCSTKLECPICRETL  251

Query  1269  THSSLVCLYHSD  1304
                 LV L + D
Sbjct  252   QPQKLVFLQNYD  263



>gb|EWY98939.1| hypothetical protein FOYG_03205 [Fusarium oxysporum FOSC 3-a]
Length=376

 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 75/183 (41%), Gaps = 25/183 (14%)
 Frame = +3

Query  786   LMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrs  959
             L  FYF G YY LSKR   +RYVF      T  R  Y++LG  L++QL +     +R   
Sbjct  186   LALFYFSGTYYQLSKRLLSLRYVFTRTVPDTPDRAGYELLGVLLVIQLAVQGYTHIRSTI  245

Query  960   slssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgls  1139
             + S+     ++  FG     S       N + NL+ +     S        +    +   
Sbjct  246   TESAAR---ERAAFGASDDISLNHDGAYNGDNNLLLSTGASSSKAKVDIFAATHTPAAAV  302

Query  1140  kcslclssR--------------------QHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                     +                    + P+AT CGHVFCW CI +W  EKPECPLCR
Sbjct  303   PRVQLTDDKVMGYIKGGQQRKCTLCLEEMRDPSATQCGHVFCWECIGDWVREKPECPLCR  362

Query  1260  SPA  1268
               A
Sbjct  363   REA  365


 Score = 57.0 bits (136),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+  A   E + L  + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  59   GARLTHARAPEIQTLATLAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAIGRRAGYVA  118

Query  486  YQTAVPYLAERV  521
                +PY+A R+
Sbjct  119  ASILLPYIAARI  130


 Score = 28.9 bits (63),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D  R L G+  +
Sbjct  24   YPFATAPDIIRSHQKDAYFTGHLTQILSDLHRRLRGARLT  63



>ref|XP_005514432.1| PREDICTED: peroxisome biogenesis factor 10 [Columba livia]
Length=310

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 101/221 (46%), Gaps = 41/221 (19%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G +  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P   RRA+FI 
Sbjct  21   GAKKWLEWRREIELLSDVAYFVLTTLSGYQTLGEEYVNIVQVDSTKKKVPAFLRRAVFIA  80

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
              T VPY  ++  S +  +   L    ++S                         TS+ +
Sbjct  81   LHTVVPYCLDKGLSHLEHE---LQTEAEES------------------------RTSQGN  113

Query  666  PSVLSRFKTKIRECWLH------AVQRWPSVLPLAREILQ---LVIRANLMFFYFEGLYY  818
            P++ S  +T IR  W+         Q+  +VL +   + Q   L+ R +L  FY  G +Y
Sbjct  114  PALGSSSRTLIRN-WVQKQVGKLTEQQKKTVLQIVYVLKQSVPLLHRLHLALFYINGTFY  172

Query  819  HLSKRASGIRYVFIGKPTNQ----RPRYQILGFFLLVQLCI  929
            HLSKR +GI Y+  G P  +    R  Y+ LG   L  L +
Sbjct  173  HLSKRIAGITYLHFGGPQGEDQSIRSSYKFLGIISLFHLLL  213


 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             R+H TATPCGH+FCW CI EWCN + ECPLCR       L+ L H
Sbjct  263   RRHTTATPCGHLFCWECITEWCNTRTECPLCREKFHPQKLIYLRH  307



>gb|EXA50295.1| hypothetical protein FOVG_03078 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK42393.1| hypothetical protein FOMG_05379 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXL00264.1| hypothetical protein FOQG_00499 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL77761.1| hypothetical protein FOPG_07898 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=376

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 75/183 (41%), Gaps = 25/183 (14%)
 Frame = +3

Query  786   LMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrs  959
             L  FYF G YY LSKR   +RYVF      T  R  Y++LG  L++QL +     +R   
Sbjct  186   LALFYFSGTYYQLSKRLLSLRYVFTRTVPDTPDRAGYELLGVLLVIQLAVQGYTHIRSTI  245

Query  960   slssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgls  1139
             + S+     ++  FG     S       N + NL+ +     S        +    +   
Sbjct  246   TESAAR---ERAAFGASDDISLNHDGAYNGDNNLLLSTGASSSKAKVDIFAATHTPAAAV  302

Query  1140  kcslclssR--------------------QHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                     +                    + P+AT CGHVFCW CI +W  EKPECPLCR
Sbjct  303   PRVQLTDDKAMGYIKGGQQRKCTLCLEEMRDPSATQCGHVFCWECIGDWVREKPECPLCR  362

Query  1260  SPA  1268
               A
Sbjct  363   REA  365


 Score = 56.6 bits (135),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+  A   E + L  + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  59   GARLTHARAPEIQTLATLAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAIGRRAGYVA  118

Query  486  YQTAVPYLAERV  521
                +PY+A R+
Sbjct  119  ASILLPYIAARI  130


 Score = 28.9 bits (63),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D  R L G+  +
Sbjct  24   YPFATAPDIIRSHQKDAYFTGHLTQILSDLHRRLRGARLT  63



>gb|EMC79373.1| Peroxisome biogenesis factor 10, partial [Columba livia]
Length=291

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 101/221 (46%), Gaps = 41/221 (19%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G +  + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P   RRA+FI 
Sbjct  2    GAKKWLEWRREIELLSDVAYFVLTTLSGYQTLGEEYVNIVQVDSTKKKVPAFLRRAVFIA  61

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
              T VPY  ++  S +  +   L    ++S                         TS+ +
Sbjct  62   LHTVVPYCLDKGLSHLEHE---LQTEAEES------------------------RTSQGN  94

Query  666  PSVLSRFKTKIRECWLH------AVQRWPSVLPLAREILQ---LVIRANLMFFYFEGLYY  818
            P++ S  +T IR  W+         Q+  +VL +   + Q   L+ R +L  FY  G +Y
Sbjct  95   PALGSSSRTLIRN-WVQKQVGKLTEQQKKTVLQIVYVLKQSVPLLHRLHLALFYINGTFY  153

Query  819  HLSKRASGIRYVFIGKPTNQ----RPRYQILGFFLLVQLCI  929
            HLSKR +GI Y+  G P  +    R  Y+ LG   L  L +
Sbjct  154  HLSKRIAGITYLHFGGPQGEDQSIRSSYKFLGIISLFHLLL  194


 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCLYH  1298
             R+H TATPCGH+FCW CI EWCN + +CPLCR       L+ L H
Sbjct  244   RRHTTATPCGHLFCWECITEWCNTRVKCPLCREKFHPQKLIYLRH  288



>ref|XP_001240364.1| hypothetical protein CIMG_07527 [Coccidioides immitis RS]
 gb|EAS29075.2| peroxin 10 [Coccidioides immitis RS]
Length=374

 Score = 75.9 bits (185),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (46%), Gaps = 27/210 (13%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A A+ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARRA +I 
Sbjct  64   GARFAHAHTDAIKNLTDILYLSLTTLVGNRTLGEEYCDVVQLEDDSLRFPSLARRAGYIL  123

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +P+  +R+      +                  E S   + + +   +     +  
Sbjct  124  SSILMPWTLQRILPAFRRR-------------LRAKLERSIARKQAKSVYFSKEEQQKKR  170

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             +++ +F+T I    L  +    S+ P        V   +L  FYF G YYH+SKR  G+
Sbjct  171  QNLVLKFQTYI----LEHLDSLTSLSP--------VYAIHLAAFYFTGAYYHISKRLWGL  218

Query  846  RYVFIGK--PTNQRPRYQILGFFLLVQLCI  929
            RYVF  +   + +R  Y++LG  +++Q+ +
Sbjct  219  RYVFSKRIEESEERVGYEVLGVLMVLQIVV  248


 Score = 29.6 bits (65),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G+ F+
Sbjct  29   FPWATSPDIIRAHEKDAYITGTLSTQAQSIVRTLRGARFA  68


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  331   KDPSVSTCGHVFCWTCIRDWVREKPECPLCRQEALGSKILPL  372



>gb|EWZ45022.1| hypothetical protein FOZG_05545 [Fusarium oxysporum Fo47]
 gb|EWZ98100.1| hypothetical protein FOWG_02338 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXL62347.1| hypothetical protein FOCG_01044 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=376

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 75/183 (41%), Gaps = 25/183 (14%)
 Frame = +3

Query  786   LMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrs  959
             L  FYF G YY LSKR   +RYVF      T  R  Y++LG  L++QL +     +R   
Sbjct  186   LALFYFSGTYYQLSKRLLSLRYVFTRTVPDTPDRAGYELLGVLLVIQLAVQGYTHIRSTI  245

Query  960   slssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgls  1139
             + S+     ++  FG     S       N + NL+ +     S        +    +   
Sbjct  246   TESAAR---ERAAFGASDDISLNHDGAYNGDNNLLLSTGASSSKAKVDIFAATHTPAAAV  302

Query  1140  kcslclssR--------------------QHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                     +                    + P+AT CGHVFCW CI +W  EKPECPLCR
Sbjct  303   PRIQLTDDKAMGYIKGGQQRKCTLCLEEMRDPSATQCGHVFCWECIGDWVREKPECPLCR  362

Query  1260  SPA  1268
               A
Sbjct  363   REA  365


 Score = 56.6 bits (135),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+  A   E + L  + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  59   GARLTHARAPEIQTLATLAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAIGRRAGYVA  118

Query  486  YQTAVPYLAERV  521
                +PY+A R+
Sbjct  119  ASILLPYIAARI  130


 Score = 28.9 bits (63),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D  R L G+  +
Sbjct  24   YPFATAPDIIRSHQKDAYFTGHLTQILSDLHRRLRGARLT  63



>ref|XP_003068101.1| Pex2 / Pex12 amino terminal region family protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER25956.1| Pex2 / Pex12 amino terminal region family protein [Coccidioides 
posadasii C735 delta SOWgp]
Length=374

 Score = 75.9 bits (185),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (46%), Gaps = 27/210 (13%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A A+ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARRA +I 
Sbjct  64   GARFAHAHTDAIKNLTDILYLSLTTLVGNRTLGEEYCDVVQLEDDSLRFPSLARRAGYIL  123

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +P+  +R+      +                  E S   + + +   +     +  
Sbjct  124  SSILMPWTLQRILPAFRRR-------------LRAKLERSIARKQAKSVYFSKEEQQKKR  170

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             +++ +F+T I    L  +    S+ P        V   +L  FYF G YYH+SKR  G+
Sbjct  171  QNLVLKFQTYI----LEHLDSLTSLSP--------VYAIHLAAFYFTGAYYHISKRLWGL  218

Query  846  RYVFIGK--PTNQRPRYQILGFFLLVQLCI  929
            RYVF  +   + +R  Y++LG  +++Q+ +
Sbjct  219  RYVFSKRIEESEERVGYEVLGVLMVLQIVV  248


 Score = 29.6 bits (65),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G+ F+
Sbjct  29   FPWATSPDIIRAHEKDAYITGTLSTQVQSIVRTLRGARFA  68


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             + P+ + CGHVFCW CI +W  EKPECPLCR  A  S ++ L
Sbjct  331   KDPSVSTCGHVFCWTCIRDWVREKPECPLCRQEALGSKILPL  372



>gb|EXM08304.1| hypothetical protein FOIG_03007 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=376

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 75/183 (41%), Gaps = 25/183 (14%)
 Frame = +3

Query  786   LMFFYFEGLYYHLSKRASGIRYVFIGK--PTNQRPRYQILGFFLLVQLCIlaaeglrrrs  959
             L  FYF G YY LSKR   +RYVF      T  R  Y++LG  L++QL +     +R   
Sbjct  186   LALFYFSGTYYQLSKRLLSLRYVFTRTVPDTPDRAGYELLGVLLVIQLAVQGYTHIRSTI  245

Query  960   slssiaasaQQTPFGTYQTSSGRGVPVLNEEGNLITAVSEKGsfvsepsstsesqasgls  1139
             + S+     ++  FG     S       N + NL+ +     S        +    +   
Sbjct  246   TESAAR---ERAAFGASDDISLNHDGAYNGDNNLLLSTGASSSKAKVDIFAATHTPAAAV  302

Query  1140  kcslclssR--------------------QHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
                     +                    + P+AT CGHVFCW CI +W  EKPECPLCR
Sbjct  303   PRVQLTDDKAMGYIKGGQQRKCTLCLEEMRDPSATQCGHVFCWECIGDWVREKPECPLCR  362

Query  1260  SPA  1268
               A
Sbjct  363   REA  365


 Score = 58.9 bits (141),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R+  A   E + LG + YF LTT  G +TLGEEYCD  Q+    G  P   RRA ++ 
Sbjct  59   GARLTHARAPEIQTLGTLAYFALTTIPGNRTLGEEYCDLVQIDARDGQLPAIGRRAGYVA  118

Query  486  YQTAVPYLAERV  521
                +PY+A R+
Sbjct  119  ASILLPYIAARI  130


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            +P A  P+I+R+ +KD  +T  + +   D  R L G+  +
Sbjct  24   YPFATAPDIIRSHQKDAYFTGHLTQILSDLHRRLRGARLT  63



>gb|EFW14430.1| peroxisome biosynthesis protein Peroxin-10 [Coccidioides posadasii 
str. Silveira]
Length=374

 Score = 75.9 bits (185),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (46%), Gaps = 27/210 (13%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G R A A+ +  K L  +LY  LTT  G +TLGEEYCD  Q+       P+ ARRA +I 
Sbjct  64   GARFAHAHTDAIKNLTDILYLSLTTLVGNRTLGEEYCDVVQLEDDSLRFPSLARRAGYIL  123

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
                +P+  +R+      +                  E S   + + +   +     +  
Sbjct  124  SSILMPWTLQRILPAFRRR-------------LRAKLERSIARKQAKSVYFSKEEQQKKR  170

Query  666  PSVLSRFKTKIRECWLHAVQRWPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRASGI  845
             +++ +F+T I    L  +    S+ P        V   +L  FYF G YYH+SKR  G+
Sbjct  171  QNLVLKFQTYI----LEHLDSLTSLSP--------VYAIHLAAFYFTGAYYHISKRLWGL  218

Query  846  RYVFIGK--PTNQRPRYQILGFFLLVQLCI  929
            RYVF  +   + +R  Y++LG  +++Q+ +
Sbjct  219  RYVFSKRIEESEERVGYEVLGVLMVLQIVV  248


 Score = 29.6 bits (65),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 0/40 (0%)
 Frame = +2

Query  125  FPLAQQPEIMRAAEKDEQYTFFVYEACRDAFRHLFGSYFS  244
            FP A  P+I+RA EKD   T  +    +   R L G+ F+
Sbjct  29   FPWATSPDIIRAHEKDAYITGTLSTQVQSIVRTLRGARFA  68


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  1167  QHPTATPCGHVFCWNCIMEWCNEKPECPLCRSPATHSSLVCL  1292
             + P+ + CGHVFCW+CI +W  EKPECPLCR  A  S ++ L
Sbjct  331   KDPSVSTCGHVFCWSCIRDWVREKPECPLCRQEALGSKILPL  372



>ref|XP_004071127.1| PREDICTED: peroxisome biogenesis factor 10-like [Oryzias latipes]
Length=320

 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 99/212 (47%), Gaps = 30/212 (14%)
 Frame = +3

Query  306  GTRVAVAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIF  485
            G+R+ + ++ E +LL  + Y  LTT +G QTLGEEY +  QV       P+ ARR+LF+ 
Sbjct  38   GSRLWLHWRKEVELLSDVTYLSLTTLSGFQTLGEEYVNIVQVDPSKRQIPSRARRSLFVL  97

Query  486  YQTAVPYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAH  665
            +    PYL +++        + L++  + S      + S+                    
Sbjct  98   FHAFFPYLLDKLL-------VCLENELEGSQDGRRRAASAGWGL----------------  134

Query  666  PSVLSRFKTKIRECWLHAVQR--WPSVLPLAREILQLVIRANLMFFYFEGLYYHLSKRAS  839
             S   R   +   C L   QR  W S + +A++ + LV R +   FY    +YHLSKRA+
Sbjct  135  -SCWLRLWVQRGVCLLTGEQRRVWLSAVGIAQQTVALVHRLHTTLFYLSSSFYHLSKRAA  193

Query  840  GIRYVFI----GKPTNQRPRYQILGFFLLVQL  923
            GI Y+ +    G   + R  Y++L    L+QL
Sbjct  194  GISYLRVEGLRGDDASIRTTYRLLAAVSLLQL  225


 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEKPECPLCR  1259
             R++ T TPCGH+FCW CI EWCN K ECPLCR
Sbjct  274   RRNSTCTPCGHLFCWECITEWCNTKAECPLCR  305



>ref|XP_009699661.1| PREDICTED: peroxisome biogenesis factor 10, partial [Cariama 
cristata]
Length=266

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 95/213 (45%), Gaps = 35/213 (16%)
 Frame = +3

Query  321  VAYQNETKLLGQMLYFLLTTGAGKQTLGEEYCDTTQVAGPYGLPPTPARRALFIFYQTAV  500
            + ++ E +LL  + YF+LTT +G QTLGEEY +  QV       P+  RRA+F+   T V
Sbjct  5    LGWRKEIELLSDVAYFVLTTLSGYQTLGEEYVNILQVDSTKKRVPSFLRRAIFVSLHTVV  64

Query  501  PYLAERVSSRIASQGITLDDPFDDSYPFsvasesssrveastaseiassstsRAHPSVLS  680
            PY  E+    +  +  T  D F  S                          +   P + S
Sbjct  65   PYCLEKGLLHLERELQTEADEFRTS-------------------------QNNPAPGLSS  99

Query  681  RFKTKI---RECWLHAVQRWPSVLPLAREILQ---LVIRANLMFFYFEGLYYHLSKRASG  842
            R   +    ++ W    Q+  +VL +   + Q   L+ R +L  FY  G +YHLSKR +G
Sbjct  100  RTLVQNWIQKQVWELTEQQKKTVLQIVHVLKQCIPLLHRLHLAVFYISGAFYHLSKRLTG  159

Query  843  IRYVFI----GKPTNQRPRYQILGFFLLVQLCI  929
            IRY+      G+  + R  Y+ LG   L  L +
Sbjct  160  IRYLHFGGLQGEDQSIRSSYKFLGIISLFHLLL  192


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  1164  RQHPTATPCGHVFCWNCIMEWCNEK  1238
             R+H TATPCGH+FCW CI EWCN +
Sbjct  242   RRHTTATPCGHLFCWECITEWCNTR  266



>ref|NP_001060246.1| Os07g0608900 [Oryza sativa Japonica Group]
 dbj|BAF22160.1| Os07g0608900 [Oryza sativa Japonica Group]
Length=85

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  807  GLYYHLSKRASGIRYVFIGKPTNQRPRYQILGFFLLVQLCI  929
            GLYYHL KRA+GIRYVFIGKP  QRPRYQILG FLL+QLCI
Sbjct  9    GLYYHLPKRAAGIRYVFIGKPMIQRPRYQILGIFLLIQLCI  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3768748596378