BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23083_g1_i1 len=1068 path=[1046:0-150 2996:151-155 1202:156-184
1231:185-368 1415:369-388 1435:389-470 1517:471-543 1590:544-580
1627:581-609 1656:610-1067]

Length=1068
                                                                      Score     E

ref|XP_007024474.1|  Receptor-like protein kinase-related family ...    241   7e-74   
ref|XP_006469729.1|  PREDICTED: cysteine-rich repeat secretory pr...    236   7e-72   
ref|XP_006380319.1|  hypothetical protein POPTR_0007s02730g             231   2e-70   
ref|XP_006387991.1|  receptor-like protein kinase                       231   3e-70   
ref|XP_007149948.1|  hypothetical protein PHAVU_005G112800g             231   7e-70   
ref|XP_011003220.1|  PREDICTED: cysteine-rich repeat secretory pr...    228   3e-69   
ref|XP_003541936.1|  PREDICTED: cysteine-rich repeat secretory pr...    228   7e-69   
ref|XP_002515716.1|  DUF26 domain-containing protein 2 precursor,...    226   4e-68   Ricinus communis
ref|XP_002309843.2|  hypothetical protein POPTR_0007s02720g             225   5e-68   Populus trichocarpa [western balsam poplar]
ref|XP_006447470.1|  hypothetical protein CICLE_v10017568mg             226   6e-68   
ref|XP_002274604.1|  PREDICTED: cysteine-rich repeat secretory pr...    225   7e-68   Vitis vinifera
ref|XP_010247023.1|  PREDICTED: cysteine-rich repeat secretory pr...    223   5e-67   
ref|XP_002274668.1|  PREDICTED: cysteine-rich repeat secretory pr...    223   6e-67   Vitis vinifera
gb|EYU43107.1|  hypothetical protein MIMGU_mgv1a022379mg                222   1e-66   
gb|KDP25874.1|  hypothetical protein JCGZ_22904                         221   2e-66   
gb|AES67291.2|  cysteine-rich RLK (receptor-like kinase) protein        221   3e-66   
ref|XP_002274745.2|  PREDICTED: cysteine-rich repeat secretory pr...    220   6e-66   Vitis vinifera
ref|XP_006372985.1|  hypothetical protein POPTR_0017s06790g             219   1e-65   
gb|KHN36561.1|  Cysteine-rich repeat secretory protein 38               219   1e-65   
emb|CBI28973.3|  unnamed protein product                                220   1e-65   
gb|AFK43074.1|  unknown                                                 219   2e-65   
ref|XP_010051179.1|  PREDICTED: cysteine-rich repeat secretory pr...    218   2e-65   
ref|XP_009793791.1|  PREDICTED: cysteine-rich repeat secretory pr...    219   2e-65   
ref|XP_006372978.1|  hypothetical protein POPTR_0017s06720g             218   3e-65   
ref|XP_006351952.1|  PREDICTED: cysteine-rich repeat secretory pr...    217   1e-64   
ref|XP_003543377.1|  PREDICTED: cysteine-rich repeat secretory pr...    217   1e-64   
ref|XP_009591406.1|  PREDICTED: cysteine-rich repeat secretory pr...    216   2e-64   
ref|XP_009787631.1|  PREDICTED: cysteine-rich repeat secretory pr...    216   3e-64   
ref|XP_006352035.1|  PREDICTED: cysteine-rich repeat secretory pr...    216   3e-64   
ref|XP_003597040.1|  Cysteine-rich repeat secretory protein             218   3e-64   
ref|XP_009605992.1|  PREDICTED: cysteine-rich repeat secretory pr...    216   3e-64   
ref|XP_011079182.1|  PREDICTED: cysteine-rich repeat secretory pr...    215   4e-64   
ref|XP_006372979.1|  hypothetical protein POPTR_0017s06730g             215   4e-64   
ref|XP_010051151.1|  PREDICTED: cysteine-rich repeat secretory pr...    215   4e-64   
gb|EYU43106.1|  hypothetical protein MIMGU_mgv1a021349mg                214   5e-64   
gb|ACU16205.1|  unknown                                                 214   2e-63   Glycine max [soybeans]
ref|XP_008342465.1|  PREDICTED: cysteine-rich repeat secretory pr...    213   3e-63   
ref|XP_008228882.1|  PREDICTED: cysteine-rich repeat secretory pr...    213   5e-63   
ref|XP_010051171.1|  PREDICTED: cysteine-rich repeat secretory pr...    212   1e-62   
ref|XP_008391617.1|  PREDICTED: cysteine-rich repeat secretory pr...    210   4e-62   
ref|XP_007216947.1|  hypothetical protein PRUPE_ppa016345mg             209   4e-62   
ref|XP_006387993.1|  hypothetical protein POPTR_0421s00220g             209   5e-62   
ref|NP_566697.1|  Receptor-like protein kinase-related family pro...    209   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051188.1|  PREDICTED: cysteine-rich repeat secretory pr...    209   1e-61   
ref|XP_010069655.1|  PREDICTED: cysteine-rich repeat secretory pr...    208   2e-61   
ref|XP_008455404.1|  PREDICTED: cysteine-rich repeat secretory pr...    209   2e-61   
gb|EYU43108.1|  hypothetical protein MIMGU_mgv1a018557mg                207   3e-61   
ref|XP_004251507.1|  PREDICTED: cysteine-rich repeat secretory pr...    207   4e-61   
ref|XP_010051161.1|  PREDICTED: cysteine-rich repeat secretory pr...    206   2e-60   
ref|XP_006351953.1|  PREDICTED: cysteine-rich repeat secretory pr...    205   3e-60   
ref|XP_004292427.1|  PREDICTED: cysteine-rich repeat secretory pr...    205   3e-60   
ref|XP_007216907.1|  hypothetical protein PRUPE_ppa019252mg             204   3e-60   
ref|XP_010532487.1|  PREDICTED: cysteine-rich repeat secretory pr...    204   7e-60   
emb|CAN73040.1|  hypothetical protein VITISV_044350                     202   1e-59   Vitis vinifera
ref|XP_003597035.1|  Cysteine-rich repeat secretory protein             204   1e-59   
ref|XP_003633310.1|  PREDICTED: cysteine-rich repeat secretory pr...    202   3e-59   
ref|XP_002533571.1|  DUF26 domain-containing protein 2 precursor,...    202   3e-59   Ricinus communis
emb|CDY68211.1|  BnaCnng58060D                                          202   6e-59   
ref|XP_010684085.1|  PREDICTED: cysteine-rich repeat secretory pr...    201   1e-58   
gb|KFK39506.1|  hypothetical protein AALP_AA3G252600                    201   2e-58   
ref|XP_007010459.1|  Receptor-like protein kinase-related family ...    199   4e-58   
ref|XP_006387992.1|  hypothetical protein POPTR_0421s00210g             199   9e-58   
emb|CAN73036.1|  hypothetical protein VITISV_044346                     198   1e-57   Vitis vinifera
ref|XP_010247024.1|  PREDICTED: cysteine-rich repeat secretory pr...    199   1e-57   
gb|KGN43546.1|  hypothetical protein Csa_7G044860                       199   1e-57   
ref|XP_011003221.1|  PREDICTED: cysteine-rich repeat secretory pr...    198   2e-57   
ref|XP_004144580.1|  PREDICTED: cysteine-rich repeat secretory pr...    194   2e-56   
ref|XP_006372981.1|  hypothetical protein POPTR_0017s06750g             195   2e-56   
ref|XP_004168058.1|  PREDICTED: cysteine-rich repeat secretory pr...    194   2e-56   
ref|XP_006406217.1|  hypothetical protein EUTSA_v10021371mg             196   2e-56   
ref|XP_006380320.1|  hypothetical protein POPTR_0007s02740g             195   2e-56   
ref|XP_008455543.1|  PREDICTED: cysteine-rich repeat secretory pr...    196   5e-56   
ref|XP_008237024.1|  PREDICTED: cysteine-rich repeat secretory pr...    194   7e-56   
ref|XP_010069666.1|  PREDICTED: cysteine-rich repeat secretory pr...    194   8e-56   
ref|XP_006372983.1|  hypothetical protein POPTR_0017s06770g             194   1e-55   
ref|XP_008237025.1|  PREDICTED: cysteine-rich repeat secretory pr...    192   2e-55   
ref|XP_002883339.1|  hypothetical protein ARALYDRAFT_479720             193   2e-55   
emb|CAN73039.1|  hypothetical protein VITISV_044349                     191   5e-55   Vitis vinifera
ref|XP_006372982.1|  hypothetical protein POPTR_0017s06760g             192   6e-55   
ref|XP_007149947.1|  hypothetical protein PHAVU_005G112700g             191   2e-54   
ref|XP_004144581.1|  PREDICTED: cysteine-rich repeat secretory pr...    191   2e-54   
ref|XP_011037144.1|  PREDICTED: cysteine-rich repeat secretory pr...    190   2e-54   
ref|XP_010496825.1|  PREDICTED: cysteine-rich repeat secretory pr...    189   9e-54   
gb|KDO59870.1|  hypothetical protein CISIN_1g046481mg                   189   9e-54   
ref|XP_010510855.1|  PREDICTED: cysteine-rich repeat secretory pr...    189   1e-53   
ref|XP_009145437.1|  PREDICTED: cysteine-rich repeat secretory pr...    189   1e-53   
ref|XP_004144485.1|  PREDICTED: cysteine-rich repeat secretory pr...    188   2e-53   
ref|XP_008455405.1|  PREDICTED: cysteine-rich repeat secretory pr...    188   2e-53   
gb|KDP32106.1|  hypothetical protein JCGZ_12567                         187   2e-53   
emb|CDY57408.1|  BnaA05g36230D                                          187   3e-53   
ref|XP_008236988.1|  PREDICTED: cysteine-rich repeat secretory pr...    187   5e-53   
ref|XP_006469774.1|  PREDICTED: cysteine-rich repeat secretory pr...    187   5e-53   
ref|XP_011037143.1|  PREDICTED: cysteine-rich repeat secretory pr...    186   7e-53   
gb|AFK48353.1|  unknown                                                 186   1e-52   
emb|CAN73038.1|  hypothetical protein VITISV_044348                     184   3e-52   Vitis vinifera
ref|XP_006850460.1|  hypothetical protein AMTR_s00035p00082360          184   3e-52   
ref|XP_006592824.1|  PREDICTED: cysteine-rich repeat secretory pr...    181   6e-52   
ref|XP_010109547.1|  hypothetical protein L484_018282                   184   7e-52   
ref|XP_008342466.1|  PREDICTED: cysteine-rich repeat secretory pr...    183   1e-51   
ref|XP_009787632.1|  PREDICTED: cysteine-rich repeat secretory pr...    179   2e-51   
ref|XP_008228908.1|  PREDICTED: cysteine-rich repeat secretory pr...    182   3e-51   
ref|XP_004487372.1|  PREDICTED: cysteine-rich repeat secretory pr...    180   2e-50   
ref|XP_006298384.1|  hypothetical protein CARUB_v10014454mg             178   1e-49   
ref|XP_004144484.1|  PREDICTED: cysteine-rich repeat secretory pr...    177   2e-49   
ref|XP_009398186.1|  PREDICTED: cysteine-rich repeat secretory pr...    176   6e-49   
ref|XP_004168056.1|  PREDICTED: cysteine-rich repeat secretory pr...    175   2e-48   
gb|KDO59869.1|  hypothetical protein CISIN_1g041051mg                   172   2e-48   
gb|KDP25619.1|  hypothetical protein JCGZ_20775                         174   3e-48   
ref|XP_010679273.1|  PREDICTED: cysteine-rich repeat secretory pr...    174   4e-48   
gb|KHN36560.1|  Cysteine-rich repeat secretory protein 38               173   5e-48   
ref|XP_008455406.1|  PREDICTED: cysteine-rich repeat secretory pr...    174   7e-48   
ref|XP_006447471.1|  hypothetical protein CICLE_v10018332mg             167   8e-46   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg             174   4e-45   
ref|XP_010516475.1|  PREDICTED: putative cysteine-rich repeat sec...    165   9e-45   
ref|XP_009150860.1|  PREDICTED: putative cysteine-rich repeat sec...    165   9e-45   
emb|CDY07878.1|  BnaC03g47440D                                          165   1e-44   
ref|XP_010431451.1|  PREDICTED: putative cysteine-rich repeat sec...    165   1e-44   
emb|CDX88009.1|  BnaA06g26000D                                          165   2e-44   
ref|XP_002878210.1|  hypothetical protein ARALYDRAFT_348900             164   2e-44   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...    171   3e-44   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...    171   3e-44   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...    171   4e-44   
ref|XP_006299311.1|  hypothetical protein CARUB_v10015466mg             162   2e-43   
ref|XP_010466464.1|  PREDICTED: putative cysteine-rich repeat sec...    162   2e-43   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...    168   3e-43   
ref|XP_003635324.2|  PREDICTED: cysteine-rich repeat secretory pr...    161   1e-42   
ref|XP_010504787.1|  PREDICTED: putative cysteine-rich repeat sec...    160   1e-42   
gb|AAN46205.1|  unknown protein                                         157   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    166   2e-42   
gb|AAN46194.1|  unknown protein                                         157   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191390.1|  uncharacterized protein                               159   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292774.1|  hypothetical protein CARUB_v10019024mg             158   5e-42   
ref|XP_010466466.1|  PREDICTED: putative cysteine-rich repeat sec...    158   6e-42   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...    163   2e-41   
gb|AAN46195.1|  unknown protein                                         154   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...    163   3e-41   
ref|XP_010646644.1|  PREDICTED: cysteine-rich repeat secretory pr...    159   3e-41   
ref|XP_010644356.1|  PREDICTED: cysteine-rich receptor-like prote...    157   3e-41   
emb|CAN65760.1|  hypothetical protein VITISV_001837                     157   7e-41   Vitis vinifera
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg             161   8e-41   
emb|CAN74851.1|  hypothetical protein VITISV_019620                     163   9e-41   Vitis vinifera
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...    161   1e-40   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...    161   1e-40   
ref|XP_010247616.1|  PREDICTED: cysteine-rich receptor-like prote...    161   1e-40   
ref|XP_010647173.1|  PREDICTED: putative receptor-like protein ki...    161   1e-40   
gb|KDO75584.1|  hypothetical protein CISIN_1g010329mg                   158   2e-40   
gb|KDP25876.1|  hypothetical protein JCGZ_22906                         152   3e-40   
emb|CBI29181.3|  unnamed protein product                                158   4e-40   
ref|XP_007049618.1|  Receptor-like protein kinase-related family ...    153   5e-40   
emb|CBI23450.3|  unnamed protein product                                157   6e-40   
ref|XP_009418903.1|  PREDICTED: cysteine-rich repeat secretory pr...    152   6e-40   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...    159   7e-40   
gb|KDO75583.1|  hypothetical protein CISIN_1g010329mg                   157   8e-40   
ref|XP_002304943.2|  hypothetical protein POPTR_0004s02390g             153   9e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010056929.1|  PREDICTED: cysteine-rich receptor-like prote...    157   9e-40   
gb|KHN15830.1|  Cysteine-rich receptor-like protein kinase 25           159   9e-40   
sp|Q9LRL8.2|CRR21_ARATH  RecName: Full=Putative cysteine-rich rep...    151   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008800494.1|  PREDICTED: putative receptor-like protein ki...    157   2e-39   
ref|XP_008804396.1|  PREDICTED: putative receptor-like protein ki...    157   2e-39   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...    156   5e-39   
ref|XP_006838094.1|  hypothetical protein AMTR_s00106p00032870          150   5e-39   
ref|XP_010908140.1|  PREDICTED: cysteine-rich repeat secretory pr...    152   6e-39   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057    159   8e-39   
ref|XP_006856952.1|  hypothetical protein AMTR_s01216p00000700          155   9e-39   
ref|XP_003551283.1|  PREDICTED: cysteine-rich repeat secretory pr...    149   9e-39   
ref|XP_010468360.1|  PREDICTED: putative cysteine-rich repeat sec...    149   1e-38   
emb|CDP03947.1|  unnamed protein product                                149   1e-38   
ref|XP_009794300.1|  PREDICTED: cysteine-rich repeat secretory pr...    145   2e-38   
ref|XP_010267898.1|  PREDICTED: uncharacterized protein LOC104605002    158   2e-38   
ref|XP_010466465.1|  PREDICTED: putative cysteine-rich repeat sec...    149   2e-38   
ref|XP_010247622.1|  PREDICTED: cysteine-rich receptor-like prote...    155   2e-38   
sp|Q9LRL4.1|CRR24_ARATH  RecName: Full=Putative cysteine-rich rep...    149   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...    154   2e-38   
ref|XP_002518555.1|  ATP binding protein, putative                      154   3e-38   Ricinus communis
emb|CDP14580.1|  unnamed protein product                                148   3e-38   
ref|XP_006406033.1|  hypothetical protein EUTSA_v10022150mg             147   4e-38   
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...    154   4e-38   
ref|XP_003556008.1|  PREDICTED: cysteine-rich receptor-like prote...    154   5e-38   
ref|XP_006838099.1|  hypothetical protein AMTR_s00106p00036910          148   5e-38   
sp|Q9LRL7.2|CRR22_ARATH  RecName: Full=Putative cysteine-rich rep...    148   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267806.1|  PREDICTED: putative receptor-like protein ki...    153   6e-38   
ref|XP_010481161.1|  PREDICTED: putative cysteine-rich repeat sec...    147   7e-38   
ref|XP_010267805.1|  PREDICTED: putative receptor-like protein ki...    153   8e-38   
emb|CDP03948.1|  unnamed protein product                                148   1e-37   
gb|KHN02664.1|  Cysteine-rich receptor-like protein kinase 29           147   1e-37   
ref|XP_006449122.1|  hypothetical protein CICLE_v10015972mg             148   1e-37   
gb|KDO75586.1|  hypothetical protein CISIN_1g021048mg                   148   1e-37   
ref|XP_006467960.1|  PREDICTED: cysteine-rich repeat secretory pr...    148   1e-37   
ref|XP_006850463.1|  hypothetical protein AMTR_s00035p00086030          146   2e-37   
ref|XP_010463431.1|  PREDICTED: putative cysteine-rich repeat sec...    146   2e-37   
dbj|BAB01372.1|  unnamed protein product                                146   2e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73037.1|  hypothetical protein VITISV_044347                     148   2e-37   Vitis vinifera
ref|XP_010910126.1|  PREDICTED: putative receptor-like protein ki...    152   2e-37   
ref|XP_009360784.1|  PREDICTED: cysteine-rich receptor-like prote...    153   2e-37   
ref|XP_003635677.2|  PREDICTED: putative receptor-like protein ki...    151   3e-37   
ref|XP_006406226.1|  hypothetical protein EUTSA_v10022184mg             147   3e-37   
ref|XP_002518557.1|  DUF26 domain-containing protein 1 precursor,...    146   5e-37   Ricinus communis
ref|XP_007223972.1|  hypothetical protein PRUPE_ppa014621mg             150   5e-37   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...    150   5e-37   
ref|XP_003638011.1|  Cysteine-rich receptor-like protein kinase         150   6e-37   
ref|XP_010646958.1|  PREDICTED: uncharacterized protein LOC100265431    153   6e-37   
ref|XP_009340921.1|  PREDICTED: cysteine-rich receptor-like prote...    150   7e-37   
gb|KDO37599.1|  hypothetical protein CISIN_1g008238mg                   149   7e-37   
ref|XP_007025950.1|  ATP binding protein, putative                      145   8e-37   
ref|XP_003637963.1|  Cysteine-rich receptor-like protein kinase         150   1e-36   
ref|XP_010103954.1|  Cysteine-rich receptor-like protein kinase 25      149   1e-36   
ref|XP_006365261.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   1e-36   
ref|XP_010910239.1|  PREDICTED: putative receptor-like protein ki...    150   1e-36   
gb|KEH43963.1|  cysteine-rich receptor-kinase-like protein              150   1e-36   
ref|XP_006484824.1|  PREDICTED: cysteine-rich repeat secretory pr...    144   1e-36   
ref|XP_003622768.1|  Cysteine-rich repeat secretory protein             144   1e-36   
gb|AAN46206.1|  unknown protein                                         142   2e-36   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010644348.1|  PREDICTED: cysteine-rich receptor-like prote...    148   2e-36   
gb|AAN46207.1|  unknown protein                                         142   2e-36   Arabidopsis lyrata [lyrate rockcress]
ref|XP_006299656.1|  hypothetical protein CARUB_v10015844mg             143   2e-36   
ref|XP_008348836.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    148   2e-36   
emb|CBI38478.3|  unnamed protein product                                148   2e-36   
ref|XP_009357385.1|  PREDICTED: cysteine-rich receptor-like prote...    149   2e-36   
ref|XP_004295243.1|  PREDICTED: cysteine-rich receptor-like prote...    146   2e-36   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...    149   2e-36   
gb|KDO37425.1|  hypothetical protein CISIN_1g005846mg                   146   2e-36   
ref|XP_002874837.1|  hypothetical protein ARALYDRAFT_911789             145   3e-36   
gb|KDO37598.1|  hypothetical protein CISIN_1g008238mg                   148   3e-36   
ref|XP_002894412.1|  predicted protein                                  143   3e-36   
gb|KDO37424.1|  hypothetical protein CISIN_1g005846mg                   146   3e-36   
ref|XP_004290148.1|  PREDICTED: cysteine-rich repeat secretory pr...    142   3e-36   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29           148   4e-36   
gb|KDO37426.1|  hypothetical protein CISIN_1g005846mg                   146   4e-36   
ref|XP_006299328.1|  hypothetical protein CARUB_v10015485mg             142   4e-36   
ref|XP_006449123.1|  hypothetical protein CICLE_v10018168mg             142   4e-36   
ref|XP_007025946.1|  Cysteine-rich protein, putative                    148   4e-36   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182    150   4e-36   
gb|KDO37427.1|  hypothetical protein CISIN_1g005846mg                   146   5e-36   
gb|KDO60896.1|  hypothetical protein CISIN_1g036866mg                   142   5e-36   
ref|XP_006437221.1|  hypothetical protein CICLE_v10032523mg             142   5e-36   
gb|AFK33693.1|  unknown                                                 142   5e-36   
ref|XP_010036760.1|  PREDICTED: cysteine-rich repeat secretory pr...    142   5e-36   
ref|XP_010089691.1|  hypothetical protein L484_006313                   145   6e-36   
emb|CAN80208.1|  hypothetical protein VITISV_010567                     147   7e-36   Vitis vinifera
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...    147   8e-36   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g             147   8e-36   
ref|NP_001238492.1|  cysteine-rich protein precursor                    147   8e-36   
gb|KHN30448.1|  Cysteine-rich receptor-like protein kinase 10           147   8e-36   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25           147   8e-36   
emb|CBI39033.3|  unnamed protein product                                147   9e-36   
ref|XP_006377265.1|  hypothetical protein POPTR_0011s03300g             141   1e-35   
ref|NP_180720.1|  putative cysteine-rich repeat secretory protein 10    141   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655874.1|  PREDICTED: cysteine-rich receptor-like prote...    147   1e-35   
ref|XP_010931306.1|  PREDICTED: putative receptor-like protein ki...    147   1e-35   
gb|KDO37423.1|  hypothetical protein CISIN_1g005846mg                   146   1e-35   
gb|KDO75587.1|  hypothetical protein CISIN_1g040542mg                   140   1e-35   
gb|AGT15891.1|  hypothetical protein SHCRBa_258_I03_F_10                146   1e-35   
ref|XP_008356777.1|  PREDICTED: cysteine-rich receptor-like prote...    148   1e-35   
gb|KHN25769.1|  Cysteine-rich repeat secretory protein 38               136   2e-35   
ref|XP_006468227.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-35   
tpg|DAA62991.1|  TPA: putative DUF26-domain receptor-like protein...    146   2e-35   
ref|NP_001145947.1|  uncharacterized protein LOC100279471 precursor     146   2e-35   Zea mays [maize]
ref|XP_010908261.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-35   
ref|XP_002533056.1|  DUF26 domain-containing protein 1 precursor,...    141   2e-35   Ricinus communis
dbj|BAD43562.1|  putative protein                                       140   2e-35   Arabidopsis thaliana [mouse-ear cress]
sp|P0CJ49.1|CRR42_ARATH  RecName: Full=Cysteine-rich repeat secre...    140   2e-35   
ref|XP_004247276.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   2e-35   
ref|NP_188837.1|  cysteine-rich repeat secretory protein 29             140   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009364708.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-35   
gb|KDO48492.1|  hypothetical protein CISIN_1g0460102mg                  141   3e-35   
sp|Q9SVI0.1|CRR41_ARATH  RecName: Full=Cysteine-rich repeat secre...    140   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193799.2|  uncharacterized protein                               140   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    146   3e-35   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...    145   3e-35   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   145   3e-35   
ref|XP_010241766.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   3e-35   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...    145   3e-35   
ref|XP_009598807.1|  PREDICTED: cysteine-rich receptor-like prote...    145   3e-35   
emb|CBI35672.3|  unnamed protein product                                146   3e-35   
ref|XP_011089218.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    140   4e-35   
ref|XP_009367603.1|  PREDICTED: cysteine-rich receptor-like prote...    145   4e-35   
ref|XP_007140710.1|  hypothetical protein PHAVU_008G135300g             139   4e-35   
ref|XP_006433223.1|  hypothetical protein CICLE_v10003836mg             140   4e-35   
ref|XP_006299457.1|  hypothetical protein CARUB_v10015622mg             139   5e-35   
ref|XP_006828418.1|  hypothetical protein AMTR_s00060p00084230          139   5e-35   
gb|EYU39171.1|  hypothetical protein MIMGU_mgv1a027159mg                139   5e-35   
gb|KDO39525.1|  hypothetical protein CISIN_1g007490mg                   144   5e-35   
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...    145   5e-35   
ref|XP_002518563.1|  serine-threonine protein kinase, plant-type,...    147   6e-35   
ref|XP_010095198.1|  Dehydration-responsive element-binding prote...    142   6e-35   
ref|XP_010100808.1|  hypothetical protein L484_015838                   139   6e-35   
ref|XP_010087722.1|  Cysteine-rich receptor-like protein kinase 25      145   6e-35   
ref|XP_010910400.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   7e-35   
ref|XP_010932101.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   7e-35   
ref|XP_008776432.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   7e-35   
ref|XP_008345332.1|  PREDICTED: cysteine-rich receptor-like prote...    144   7e-35   
ref|XP_010911153.1|  PREDICTED: cysteine-rich repeat secretory pr...    140   8e-35   
ref|XP_007143187.1|  hypothetical protein PHAVU_007G050900g             140   8e-35   
gb|KDO38176.1|  hypothetical protein CISIN_1g0455682mg                  139   9e-35   
ref|XP_006377262.1|  hypothetical protein POPTR_0011s03240g             139   9e-35   
ref|XP_010931363.1|  PREDICTED: cysteine-rich receptor-like prote...    144   1e-34   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g             144   1e-34   
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...    146   1e-34   
ref|XP_004492208.1|  PREDICTED: cysteine-rich repeat secretory pr...    138   1e-34   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...    144   1e-34   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g             144   1e-34   
ref|XP_009364729.1|  PREDICTED: cysteine-rich receptor-like prote...    144   1e-34   
ref|XP_010247618.1|  PREDICTED: putative receptor-like protein ki...    144   1e-34   
ref|XP_006383959.1|  hypothetical protein POPTR_0004s02450g             139   1e-34   
ref|XP_007216147.1|  hypothetical protein PRUPE_ppa015075mg             137   1e-34   
ref|XP_010501991.1|  PREDICTED: putative cysteine-rich repeat sec...    139   1e-34   
gb|KHN15822.1|  Cysteine-rich receptor-like protein kinase 25           145   1e-34   
ref|XP_006303591.1|  hypothetical protein CARUB_v10011141mg             139   1e-34   
ref|XP_009418900.1|  PREDICTED: putative receptor-like protein ki...    144   2e-34   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29           144   2e-34   
ref|XP_010059491.1|  PREDICTED: cysteine-rich repeat secretory pr...    139   2e-34   
ref|XP_010247620.1|  PREDICTED: cysteine-rich receptor-like prote...    144   2e-34   
ref|XP_006295991.1|  hypothetical protein CARUB_v10025134mg             138   2e-34   
ref|XP_006406223.1|  hypothetical protein EUTSA_v10021973mg             138   2e-34   
emb|CDP11363.1|  unnamed protein product                                144   2e-34   
ref|XP_004496789.1|  PREDICTED: cysteine-rich receptor-like prote...    143   2e-34   
ref|XP_006373153.1|  hypothetical protein POPTR_0017s09190g             138   2e-34   
ref|XP_010059191.1|  PREDICTED: cysteine-rich receptor-like prote...    138   2e-34   
ref|XP_008224863.1|  PREDICTED: uncharacterized protein LOC103324571    145   2e-34   
gb|KDO37169.1|  hypothetical protein CISIN_1g041433mg                   142   2e-34   
ref|XP_004496788.1|  PREDICTED: cysteine-rich receptor-like prote...    143   2e-34   
gb|KHN07228.1|  Cysteine-rich receptor-like protein kinase 14           138   2e-34   
ref|XP_007043326.1|  Cysteine-rich RLK 10, putative                     142   3e-34   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...    143   3e-34   
ref|XP_007214583.1|  hypothetical protein PRUPE_ppa026781mg             142   3e-34   
gb|KDP45259.1|  hypothetical protein JCGZ_15124                         137   3e-34   
ref|XP_009338731.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-34   
ref|XP_009338737.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-34   
ref|XP_009338745.1|  PREDICTED: cysteine-rich receptor-like prote...    142   3e-34   
ref|XP_004511333.1|  PREDICTED: cysteine-rich receptor-like prote...    143   3e-34   
ref|XP_004511332.1|  PREDICTED: cysteine-rich receptor-like prote...    143   3e-34   
gb|KDP20813.1|  hypothetical protein JCGZ_21284                         139   4e-34   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...    142   4e-34   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             142   4e-34   
gb|KCW74994.1|  hypothetical protein EUGRSUZ_E03749                     137   4e-34   
gb|KCW75386.1|  hypothetical protein EUGRSUZ_E04136                     137   5e-34   
gb|KCW74427.1|  hypothetical protein EUGRSUZ_E03121                     138   5e-34   
sp|Q9LRL2.2|CRR25_ARATH  RecName: Full=Putative cysteine-rich rep...    137   6e-34   
ref|XP_009405651.1|  PREDICTED: putative receptor-like protein ki...    142   6e-34   
ref|XP_008384023.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    142   6e-34   
ref|XP_010482102.1|  PREDICTED: cysteine-rich repeat secretory pr...    136   8e-34   
ref|XP_006449124.1|  hypothetical protein CICLE_v10018264mg             134   8e-34   
ref|XP_010442278.1|  PREDICTED: cysteine-rich repeat secretory pr...    136   9e-34   
ref|XP_007143172.1|  hypothetical protein PHAVU_007G049700g             136   1e-33   
gb|KDO45002.1|  hypothetical protein CISIN_1g0129892mg                  136   1e-33   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...    141   1e-33   
ref|XP_010655951.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-33   
gb|EEE58797.1|  hypothetical protein OsJ_10340                          135   1e-33   
ref|XP_007213610.1|  hypothetical protein PRUPE_ppa002309mg             141   1e-33   
ref|XP_002518553.1|  ATP binding protein, putative                      141   2e-33   
ref|XP_009418899.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-33   
ref|NP_001049722.1|  Os03g0277700                                       135   2e-33   
gb|EAY89462.1|  hypothetical protein OsI_10995                          135   2e-33   
ref|XP_007226138.1|  hypothetical protein PRUPE_ppa014741mg             141   2e-33   
ref|XP_007025939.1|  Cysteine-rich RLK 29                               143   2e-33   
ref|XP_010052444.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-33   
ref|XP_009114496.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    140   2e-33   
ref|NP_192429.1|  cysteine-rich receptor-like protein kinase 25         140   2e-33   
ref|XP_006287210.1|  hypothetical protein CARUB_v10000385mg             140   2e-33   
ref|XP_006387935.1|  hypothetical protein POPTR_0470s00200g             134   2e-33   
ref|XP_010655950.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-33   
sp|Q9LRL0.2|CRR27_ARATH  RecName: Full=Putative cysteine-rich rep...    135   2e-33   
ref|XP_008776433.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-33   
ref|XP_006280966.1|  hypothetical protein CARUB_v10026967mg             135   2e-33   
sp|Q9LRK9.2|CRR28_ARATH  RecName: Full=Putative cysteine-rich rep...    135   2e-33   
ref|XP_009359012.1|  PREDICTED: cysteine-rich repeat secretory pr...    135   2e-33   
gb|KCW76438.1|  hypothetical protein EUGRSUZ_D00829                     139   2e-33   
ref|XP_007025958.1|  Cysteine-rich RLK 29, putative                     139   2e-33   
ref|XP_007140020.1|  hypothetical protein PHAVU_008G077500g             141   3e-33   
gb|KCW76450.1|  hypothetical protein EUGRSUZ_D00842                     139   3e-33   
ref|XP_002518548.1|  ATP binding protein, putative                      140   3e-33   
ref|XP_003556018.2|  PREDICTED: cysteine-rich receptor-like prote...    140   3e-33   
ref|XP_007140021.1|  hypothetical protein PHAVU_008G077500g             141   3e-33   
ref|XP_009777401.1|  PREDICTED: cysteine-rich receptor-like prote...    135   3e-33   
ref|XP_006480215.1|  PREDICTED: cysteine-rich receptor-like prote...    139   4e-33   
ref|XP_009412446.1|  PREDICTED: putative receptor-like protein ki...    140   4e-33   
ref|XP_003517662.1|  PREDICTED: cysteine-rich receptor-like prote...    140   4e-33   
ref|XP_010999539.1|  PREDICTED: cysteine-rich repeat secretory pr...    135   4e-33   
ref|XP_007143173.1|  hypothetical protein PHAVU_007G049800g             134   4e-33   
ref|XP_010910873.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   4e-33   
ref|XP_006480214.1|  PREDICTED: cysteine-rich receptor-like prote...    139   5e-33   
gb|EYU40655.1|  hypothetical protein MIMGU_mgv1a025334mg                134   5e-33   
ref|XP_010920641.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   5e-33   
ref|NP_001146710.1|  uncharacterized protein LOC100280312 precursor     139   5e-33   
gb|AFW78495.1|  putative DUF26-domain receptor-like protein kinas...    139   5e-33   
ref|XP_006373161.1|  hypothetical protein POPTR_0017s09240g             135   5e-33   
ref|XP_008372641.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   5e-33   
ref|XP_010999538.1|  PREDICTED: cysteine-rich repeat secretory pr...    135   5e-33   
ref|XP_003637976.1|  Cysteine-rich receptor-like protein kinase         139   5e-33   
emb|CDP11362.1|  unnamed protein product                                139   6e-33   
ref|XP_002526797.1|  DUF26 domain-containing protein 2 precursor,...    134   6e-33   
ref|XP_003638035.1|  Cysteine-rich receptor-like protein kinase         139   6e-33   
ref|XP_010513156.1|  PREDICTED: putative cysteine-rich repeat sec...    134   6e-33   
emb|CBI35335.3|  unnamed protein product                                140   6e-33   
ref|XP_002865649.1|  hypothetical protein ARALYDRAFT_494916             134   6e-33   
gb|KCW76445.1|  hypothetical protein EUGRSUZ_D00835                     134   6e-33   
ref|XP_002462969.1|  hypothetical protein SORBIDRAFT_02g035510          139   6e-33   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                   139   6e-33   
gb|KEH43962.1|  cysteine-rich receptor-kinase-like protein              139   6e-33   
ref|NP_188834.4|  receptor-like protein kinase-related family pro...    134   7e-33   
gb|KCW76447.1|  hypothetical protein EUGRSUZ_D00839                     134   7e-33   
gb|EYU27837.1|  hypothetical protein MIMGU_mgv1a002310mg                139   7e-33   
ref|XP_011037142.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   8e-33   
ref|XP_010920640.1|  PREDICTED: cysteine-rich repeat secretory pr...    133   8e-33   
ref|XP_006838101.1|  hypothetical protein AMTR_s00106p00037610          134   8e-33   
ref|XP_006388054.1|  hypothetical protein POPTR_0379s00230g             132   8e-33   
gb|KEH26423.1|  cysteine-rich receptor-kinase-like protein              140   8e-33   
ref|XP_010059663.1|  PREDICTED: putative cysteine-rich receptor-l...    134   8e-33   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g             139   8e-33   
ref|XP_011010157.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   9e-33   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                     139   9e-33   
ref|XP_008224860.1|  PREDICTED: cysteine-rich receptor-like prote...    139   1e-32   
gb|KCW73842.1|  hypothetical protein EUGRSUZ_E02441                     139   1e-32   
ref|XP_011010156.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   1e-32   
ref|XP_010059658.1|  PREDICTED: putative cysteine-rich receptor-l...    134   1e-32   
gb|KHN24392.1|  Cysteine-rich receptor-like protein kinase 5            137   1e-32   
ref|XP_009340953.1|  PREDICTED: cysteine-rich receptor-like prote...    136   2e-32   
ref|XP_010932197.1|  PREDICTED: uncharacterized protein LOC105052907    140   2e-32   
ref|XP_010041928.1|  PREDICTED: cysteine-rich repeat secretory pr...    134   2e-32   
gb|AGT15894.1|  hypothetical protein SHCRBa_258_I03_R_140               138   2e-32   
gb|KHN24396.1|  Cysteine-rich receptor-like protein kinase 25           136   2e-32   
ref|XP_003559703.1|  PREDICTED: cysteine-rich repeat secretory pr...    133   2e-32   
ref|XP_009412444.1|  PREDICTED: putative receptor-like protein ki...    138   2e-32   
ref|XP_010054432.1|  PREDICTED: uncharacterized protein LOC104442733    139   2e-32   
ref|XP_008779475.1|  PREDICTED: cysteine-rich receptor-like prote...    135   2e-32   
ref|XP_010267803.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-32   
tpg|DAA49252.1|  TPA: serine/threonine kinase-like protein              130   3e-32   
emb|CBI23455.3|  unnamed protein product                                137   3e-32   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                     137   3e-32   
ref|XP_010267802.1|  PREDICTED: putative receptor-like protein ki...    137   3e-32   
ref|XP_004293252.1|  PREDICTED: cysteine-rich receptor-like prote...    136   3e-32   
gb|KEH26510.1|  salt stress response/antifungal domain protein          136   3e-32   
gb|KCW74984.1|  hypothetical protein EUGRSUZ_E03739                     137   3e-32   
ref|XP_006590217.1|  PREDICTED: cysteine-rich receptor-like prote...    139   3e-32   
gb|KFK45107.1|  hypothetical protein AALP_AA1G345400                    132   3e-32   
ref|XP_006383965.1|  hypothetical protein POPTR_0004s02530g             137   3e-32   
ref|XP_004961654.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-32   
ref|XP_009340924.1|  PREDICTED: cysteine-rich receptor-like prote...    137   3e-32   
gb|KCW74981.1|  hypothetical protein EUGRSUZ_E03732                     135   3e-32   
gb|KHN02670.1|  Cysteine-rich receptor-like protein kinase 25           138   3e-32   
ref|XP_008788477.1|  PREDICTED: cysteine-rich repeat secretory pr...    132   3e-32   
ref|XP_006590219.1|  PREDICTED: cysteine-rich receptor-like prote...    130   3e-32   
gb|KHG26430.1|  Cysteine-rich receptor-like protein kinase 10           137   3e-32   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-32   
ref|NP_001148207.1|  serine/threonine kinase-like protein precursor     131   4e-32   
emb|CDY39159.1|  BnaC09g21850D                                          136   4e-32   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483    139   4e-32   
ref|NP_001154635.1|  receptor-like protein kinase-related family ...    135   4e-32   
ref|XP_010932126.1|  PREDICTED: cysteine-rich receptor-like prote...    135   4e-32   
ref|XP_008232237.1|  PREDICTED: cysteine-rich receptor-like prote...    137   4e-32   
ref|XP_006388614.1|  hypothetical protein POPTR_0138s00250g             132   4e-32   
ref|XP_006373163.1|  hypothetical protein POPTR_0017s09260g             136   4e-32   
ref|XP_006573897.1|  PREDICTED: cysteine-rich receptor-like prote...    136   4e-32   
ref|XP_008784711.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   5e-32   
gb|EPS71622.1|  hypothetical protein M569_03138                         130   5e-32   
ref|XP_007143168.1|  hypothetical protein PHAVU_007G049400g             137   5e-32   
ref|XP_010059650.1|  PREDICTED: G-type lectin S-receptor-like ser...    138   5e-32   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687    139   5e-32   
ref|XP_009151651.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   6e-32   
ref|XP_009372187.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   6e-32   
ref|XP_006655441.1|  PREDICTED: cysteine-rich receptor-like prote...    135   6e-32   
ref|XP_010059648.1|  PREDICTED: putative cysteine-rich receptor-l...    134   6e-32   
ref|XP_010999622.1|  PREDICTED: cysteine-rich receptor-like prote...    136   6e-32   
ref|XP_010052449.1|  PREDICTED: putative receptor-like protein ki...    136   7e-32   
ref|XP_011096160.1|  PREDICTED: cysteine-rich receptor-like prote...    138   7e-32   
ref|XP_011010158.1|  PREDICTED: cysteine-rich receptor-like prote...    136   7e-32   
gb|AGT17379.1|  hypothetical protein SHCRBa_240_C21_F_200               135   7e-32   
emb|CDX85345.1|  BnaC07g26560D                                          131   7e-32   
ref|XP_006603573.1|  PREDICTED: cysteine-rich receptor-like prote...    136   7e-32   
ref|XP_010042180.1|  PREDICTED: cysteine-rich receptor-like prote...    136   7e-32   
ref|XP_006383961.1|  hypothetical protein POPTR_0004s02480g             130   7e-32   
ref|XP_002274468.2|  PREDICTED: putative receptor-like protein ki...    136   8e-32   
ref|XP_010524650.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   8e-32   
ref|XP_008776133.1|  PREDICTED: putative receptor-like protein ki...    136   8e-32   
ref|XP_003589298.1|  Cysteine-rich receptor-like protein kinase         132   9e-32   
ref|NP_199665.1|  receptor-like protein kinase-related family pro...    130   9e-32   
ref|XP_008780260.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   9e-32   
ref|XP_010911643.1|  PREDICTED: cysteine-rich repeat secretory pr...    131   9e-32   
ref|XP_003632027.1|  PREDICTED: cysteine-rich receptor-like prote...    135   1e-31   
emb|CDP19431.1|  unnamed protein product                                134   1e-31   
ref|XP_002316621.2|  hypothetical protein POPTR_0011s03270g             136   1e-31   
gb|AGT17169.1|  ATP binding protein                                     135   1e-31   
ref|XP_010059495.1|  PREDICTED: cysteine-rich receptor-like prote...    137   1e-31   
emb|CDY46371.1|  BnaA09g19850D                                          135   1e-31   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...    136   1e-31   
gb|KDO42696.1|  hypothetical protein CISIN_1g0091862mg                  132   1e-31   
ref|XP_010488217.1|  PREDICTED: putative cysteine-rich repeat sec...    130   1e-31   
dbj|BAJ88506.1|  predicted protein                                      135   1e-31   
ref|XP_009611212.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   1e-31   
ref|XP_009334264.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   1e-31   
ref|XP_007143165.1|  hypothetical protein PHAVU_007G0492000g            130   1e-31   
gb|EYU40654.1|  hypothetical protein MIMGU_mgv1a012036mg                130   1e-31   
ref|XP_009421340.1|  PREDICTED: cysteine-rich repeat secretory pr...    130   1e-31   
emb|CDP20318.1|  unnamed protein product                                135   1e-31   
ref|XP_002441306.1|  hypothetical protein SORBIDRAFT_09g024150          133   2e-31   
emb|CAN65425.1|  hypothetical protein VITISV_005300                     136   2e-31   
ref|XP_007143181.1|  hypothetical protein PHAVU_007G050300g             137   2e-31   
ref|XP_006828415.1|  hypothetical protein AMTR_s00060p00079250          130   2e-31   
ref|XP_007152378.1|  hypothetical protein PHAVU_004G125100g             136   2e-31   
gb|KCW76457.1|  hypothetical protein EUGRSUZ_D00850                     134   2e-31   



>ref|XP_007024474.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
 gb|EOY27096.1| Receptor-like protein kinase-related family protein [Theobroma 
cacao]
Length=242

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 162/242 (67%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M+ S+  SLL LL+ AF+L          L HFC+N         ++ NLN L G LS  
Sbjct  1    MSSSRFPSLLYLLTFAFLL--QAAFGVDPLFHFCSNAGNFSAHDPYEDNLNKLTGYLSIQ  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P +G+  G+ G+  ++ YGLALCRGDVST DCK+C+ +A ++IR+ CP N G I+WYDN
Sbjct  59   APPSGFGLGSIGQKPNQAYGLALCRGDVSTPDCKTCIVEAGSEIRKRCPSNKGAIIWYDN  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS  +FFG+ID+ NKFYM N  +  DP+SF QKTK+LL++LA++A      YA G 
Sbjct  119  CLLKYSNTEFFGQIDNRNKFYMWNLRDVSDPQSFNQKTKELLSQLANEAYATPKLYATGE  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++ GS  +YGLTQCTRDLS  DCKKCL   I ELP CC   K GGRV+ GSCNFRYE Y
Sbjct  179  TELYGSQKLYGLTQCTRDLSSSDCKKCLDGIIGELPSCC-DGKEGGRVVGGSCNFRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>ref|XP_006469729.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
 gb|KDO59871.1| hypothetical protein CISIN_1g025954mg [Citrus sinensis]
Length=245

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 153/230 (67%), Gaps = 1/230 (0%)
 Frame = +2

Query  80   LSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            L IAF   L T      L HFC++      +  ++ NLN L+G L    P  G+  G  G
Sbjct  14   LLIAFAFFLQTAFGVDPLFHFCSSSENFTANGPYETNLNKLIGYLDYQAPPTGFGKGALG  73

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
            +  +K YGLALCRGDVS++DCK+C+ DA+ +IR+ CP N   I+WYDNCLLKY+  +FFG
Sbjct  74   QRPNKAYGLALCRGDVSSSDCKTCIVDASGEIRKRCPYNKAAIIWYDNCLLKYTNTEFFG  133

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGL  619
            +ID+ NKFYM N     +P SF Q+TK+LLT+LA+KA +    YA G  ++G S+ +YGL
Sbjct  134  QIDNKNKFYMWNVRVVTEPVSFNQRTKELLTQLAEKAYVTPKLYAVGEMELGKSNKLYGL  193

Query  620  TQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            TQCTRDLS  DCKKCL   I ELP CC   K GGRV+ GSCNFRYE YPF
Sbjct  194  TQCTRDLSSVDCKKCLDGIIRELPSCC-DGKEGGRVVSGSCNFRYEIYPF  242



>ref|XP_006380319.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
 gb|ERP58116.1| hypothetical protein POPTR_0007s02730g [Populus trichocarpa]
Length=242

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 154/242 (64%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M++S   S L LL  AF L +HT   A  L HFC+       +  ++ NLN L   L   
Sbjct  1    MSFSNFASFLCLL--AFSLLVHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQ  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             PR G+  G+ G+   + YGLALCRGD ST+DCK+CV +A ++IR+ CP N   I+WYDN
Sbjct  59   APRTGFGMGSKGQKPVQAYGLALCRGDASTSDCKTCVVEAGSEIRKRCPYNKAAIIWYDN  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS   FFG+ID+ NKFYM N     +P  F +KTK+LLT+LA+KA      YA G 
Sbjct  119  CLLKYSNKGFFGQIDNGNKFYMWNVNAVSEPVPFNEKTKELLTQLANKAKATPKLYATGG  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++G S+ +YGL QCTRDLS   CKKCL   I ELP CC   K GGRV+ GSCNFRYE Y
Sbjct  179  MELGESTKLYGLVQCTRDLSSAVCKKCLDGIIGELPSCC-DGKEGGRVVSGSCNFRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>ref|XP_006387991.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46905.1| receptor-like protein kinase [Populus trichocarpa]
Length=242

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 154/242 (64%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M++S   S L LL  AF L +HT   A  L HFC+       +  ++ NLN L   L   
Sbjct  1    MSFSNFASFLCLL--AFSLLVHTGFEADPLFHFCSTPENFTANGPYESNLNKLTSFLYYQ  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             PR G+  G+ G+   + YGLALCRGD ST+DCK+CV +A ++IR+ CP N   I+WYDN
Sbjct  59   APRTGFGMGSKGQKPVQAYGLALCRGDASTSDCKTCVVEAGSEIRKRCPYNEAAIIWYDN  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS   FFG+ID+ NKFYM N     +P  F +KTK+LLT+LA+KA      YA G 
Sbjct  119  CLLKYSNKGFFGQIDNGNKFYMWNVNAVSEPVPFNEKTKELLTQLANKAKATPKLYATGG  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++G S+ +YGL QCTRDLS   CKKCL   I ELP CC   K GGRV+ GSCNFRYE Y
Sbjct  179  MELGESTKLYGLVQCTRDLSSAVCKKCLDGIIGELPSCC-DGKEGGRVVSGSCNFRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>ref|XP_007149948.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
 gb|ESW21942.1| hypothetical protein PHAVU_005G112800g [Phaseolus vulgaris]
Length=253

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M+ +K FS   L S+   L L T   A  L HFC+N      +S ++ NL TL+ +L   
Sbjct  10   MSSTKLFSTF-LFSLTLSLILQTSFGADPLFHFCSNSQNFTANSPYESNLKTLINSLIYK  68

Query  224  tPRNGYSSGTAGKCTDKV-YGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
            TP  G+   + G+  +++ +GLALCRGDVS ++CK+CV++A  +I   CP N G I+WYD
Sbjct  69   TPSTGFGVASVGQNQNQMAHGLALCRGDVSASECKTCVSEAPKEILNRCPYNKGAIIWYD  128

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAG  580
             C+ KYS+ DFFG+ID  N+FYM N +   DP SF  KTK+LL++LA+KA +    YA+G
Sbjct  129  YCMFKYSDTDFFGKIDYSNRFYMWNLKSVSDPSSFNYKTKELLSKLAEKAYVDNKLYASG  188

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
             + +  S  +YGLTQCTRDLS  DCKKCL DAI ELP CC   K GGRV+ GSCNFRYE 
Sbjct  189  EQYLENSVTLYGLTQCTRDLSSNDCKKCLDDAIDELPSCCD-GKEGGRVVSGSCNFRYEI  247

Query  761  YPFYK  775
            YPF K
Sbjct  248  YPFVK  252



>ref|XP_011003220.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=242

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 154/242 (64%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M++S   S L LL  AF L +HT   A  L HFC+       +  ++ NLN L   L   
Sbjct  1    MSFSNFASFLCLL--AFSLLVHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQ  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+  G+ G+  D+ YGLALCRGD ST+DCK+CV +A  +IR+ CP N   I+WYDN
Sbjct  59   TPSTGFGLGSIGQKPDRAYGLALCRGDASTSDCKTCVVEAGGEIRKRCPYNKAAIIWYDN  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS + FFG+ID+ NKFYM N +   +P +F  KTK+LLT+LA+K       Y  G 
Sbjct  119  CLLKYSNNGFFGQIDNGNKFYMWNVKVVSEPVTFNGKTKELLTQLANKVQATPKLYETGE  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++G S+ +YGL QCTRDLS   CKKCL   I ELP CC   K GGRV+ GSCNFRYE Y
Sbjct  179  MELGESTKLYGLVQCTRDLSSAVCKKCLDGIIGELPSCC-DGKEGGRVVSGSCNFRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>ref|XP_003541936.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
Length=245

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 160/249 (64%), Gaps = 7/249 (3%)
 Frame = +2

Query  35   LATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnl  214
            +++   S P + L    + F L   T   A  L HFC++      +S ++ NL TL+ +L
Sbjct  1    MSSSKLSSPVTFL----LIFALVFQTCFGANPLYHFCSSSQNFKANSPYESNLKTLINSL  56

Query  215  ssntPRNGYSSGTAGKC-TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIV  391
               TP  G+  G+ G+   +K YGLALCRGDVS+++CK+CV+DAT +I   CP N GGI+
Sbjct  57   IYRTPSTGFGVGSVGQYQNEKAYGLALCRGDVSSSECKTCVSDATKEILSRCPYNKGGII  116

Query  392  WYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSY  571
            WYDNC+LKY + DFFG+ID+ NKF + N     DP  F   TK+LL+ LA +A+L    Y
Sbjct  117  WYDNCMLKYLDTDFFGKIDNTNKFSLLNVRNVSDPAMFNYMTKELLSLLAYRASLSPKMY  176

Query  572  AAGVEDIGGSSV-IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNF  748
            A+G   IGG S  IYGLTQCTRDLS  DC KCL DAI++LP CC   K GGRV+ GSCN 
Sbjct  177  ASGELKIGGESKDIYGLTQCTRDLSSSDCNKCLDDAISQLPNCC-DGKEGGRVVAGSCNI  235

Query  749  RYETYPFYK  775
            RYE YPF K
Sbjct  236  RYEIYPFVK  244



>ref|XP_002515716.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF46663.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=240

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 152/231 (66%), Gaps = 2/231 (1%)
 Frame = +2

Query  80   LSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            L IAF L + T      L HFC++      +  ++ NLN L GNL    P+ G+  G++G
Sbjct  8    LLIAFALLVQTVYGDDPLFHFCSSSENFTANGPYESNLNKLAGNLYFQVPKEGFGFGSSG  67

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
            +  D+ YGLALCRGDVS++DCK+CV +A+++IR+ CP N   I+WYDNCL KYS+  +FG
Sbjct  68   RDPDQAYGLALCRGDVSSSDCKTCVVEASSEIRKRCPTNKAAIIWYDNCLYKYSDKKYFG  127

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVED-IGGSSVIYG  616
            +ID+ NKFYM N     D   F QKTK+LL+ LA +A +    YA G  D +G S+ +YG
Sbjct  128  QIDNRNKFYMWNVRVVNDSAEFNQKTKELLSELASQAYVTSKLYATGESDKLGKSNKLYG  187

Query  617  LTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            L QCTRDLS  DC+KCL   I ELP CC   K GGRV+ GSCNFRYE YPF
Sbjct  188  LVQCTRDLSSGDCRKCLDGIITELPSCC-DGKEGGRVVSGSCNFRYEIYPF  237



>ref|XP_002309843.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
 ref|XP_006387148.1| receptor-like protein kinase [Populus trichocarpa]
 gb|ERP46062.1| receptor-like protein kinase [Populus trichocarpa]
 gb|EEE90293.2| hypothetical protein POPTR_0007s02720g [Populus trichocarpa]
Length=242

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 152/242 (63%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M+ S   S L LL  AF L +HT   A  L HFC+       +  ++ NLN L   L   
Sbjct  1    MSSSNFASFLCLL--AFSLLVHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQ  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P  G+  G+ G+  D+ YGLALCRGD ST+DCK+CV +A  +IR+ CP N   I+WYDN
Sbjct  59   APSTGFGLGSIGQNPDQAYGLALCRGDASTSDCKTCVVEAGGEIRKRCPYNKAAIIWYDN  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CL+KYS + FFG+ID+ NKFYM N +   +P +F  KTK+LLT+LA+K       Y  G 
Sbjct  119  CLVKYSNNGFFGQIDNGNKFYMWNVKVVSEPVTFNGKTKELLTQLANKVEATPKLYETGE  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++G S+ +YGL QCTRDLS   CKKCL   I ELP CC   K GGRV+ GSCNFRYE Y
Sbjct  179  MELGESTKLYGLVQCTRDLSSAVCKKCLDGIIGELPSCC-DGKEGGRVVSGSCNFRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>ref|XP_006447470.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
 gb|ESR60710.1| hypothetical protein CICLE_v10017568mg, partial [Citrus clementina]
Length=254

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 162/255 (64%), Gaps = 13/255 (5%)
 Frame = +2

Query  8    SQQSSLISVLATMAY-SKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQ  184
            + +S+LI +LATMA  S  F+    L IAF   L T      L HFC++      +  ++
Sbjct  9    TNKSTLIYILATMASPSIKFASSLYLLIAFAFFLQTAFGVDPLFHFCSSSENFTANGPYE  68

Query  185  KnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIREL  364
             NLN L+G L    P  G+  G  G+  +K YGLALCRGDVS++DCK+C+ DA+ +IR+ 
Sbjct  69   TNLNKLIGYLDYQAPPTGFGKGALGQRPNKAYGLALCRGDVSSSDCKTCIVDASGEIRKR  128

Query  365  CPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLAD  544
            CP N   I+WYDNCLLKY+  +FFG+ID+ NKFYM N     +P SF Q+TK+LLT+LA+
Sbjct  129  CPYNKAAIIWYDNCLLKYTNTEFFGQIDNKNKFYMWNVRVVTEPVSFNQRTKELLTQLAE  188

Query  545  KAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGR  724
            KA +    YA G  ++G S+ +YGLTQCTRDLS  DCK C          C G  K GGR
Sbjct  189  KAYVTPKLYAVGEMELGKSNKLYGLTQCTRDLSSVDCKNC----------CDG--KEGGR  236

Query  725  VIQGSCNFRYETYPF  769
            V+ GSCNFRYE YPF
Sbjct  237  VVSGSCNFRYEIYPF  251



>ref|XP_002274604.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 157/242 (65%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M +S+  + L LLS AF+L   T +    L HFC++      +  ++ NLN L+G L   
Sbjct  1    MYFSRFATSLYLLSFAFLL--QTIVGTDPLFHFCSSSEKFIDNGTYETNLNKLMGYLYLA  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P  G+  G+ G+  DKV GLALCRGDVS TDCK+C+ +++ +IR+ CP N   I+WYD 
Sbjct  59   APPTGFGKGSVGEKNDKVNGLALCRGDVSNTDCKACITESSGEIRKRCPDNKAAIIWYDY  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS  +FFG++   N+FYM N     DP SF QKTK+LL+ LA KA +    YA G 
Sbjct  119  CLLKYSNVNFFGQVAYQNRFYMWNLNNVSDPASFNQKTKELLSNLAQKAFINSKMYATGE  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++  S  +YGLTQCTRDLS  DCKKCL DAI+ELP CC   K GGRV+ GSCN RYE Y
Sbjct  179  LELEESEKLYGLTQCTRDLSSSDCKKCLDDAISELPNCC-DGKEGGRVVGGSCNIRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>ref|XP_010247023.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=240

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 159/240 (66%), Gaps = 3/240 (1%)
 Frame = +2

Query  50   YSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntP  229
            YS  F+ L LL+I+  L +H  ++A  L HFC+        S ++ NLN L+ +LS    
Sbjct  2    YSLRFTPLCLLTIS--LLVHGVISADPLFHFCSKSGNFSAKSPYEINLNKLMSSLSYKVV  59

Query  230  RNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
             +G+  G+ G+  D+  GLALCRGDVS+TDCK+CV++A T+I + CP +  GI+WYDNCL
Sbjct  60   PSGFGLGSVGQAPDRANGLALCRGDVSSTDCKTCVSEAKTEILQRCPNDKEGIIWYDNCL  119

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVED  589
            LKYS  DFFG ID   KFYM N +   +P SF QKTK+LL+ L ++A      +A G + 
Sbjct  120  LKYSNKDFFGNIDYKYKFYMWNVQNVSNPASFNQKTKELLSHLTNEAYHSPKLFATGEQK  179

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +G +  +YGL QCTRDLS   CKKCL +AI+E+  CC   K+GGRV+ GSCNFRYE YPF
Sbjct  180  LGEAQTLYGLVQCTRDLSTTGCKKCLDEAISEISSCC-DGKIGGRVVGGSCNFRYELYPF  238



>ref|XP_002274668.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=242

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 156/242 (64%), Gaps = 3/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M +S+  + L LLS AF+L   T      L HFC++      +  ++ NLN L+G L   
Sbjct  1    MYFSRFATSLYLLSFAFLL--QTIAGTDPLYHFCSSSQKFIDNGTYETNLNKLMGYLYLA  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P  G+  G+ G+  D+V GLALCRGDVS TDCK+C+ +++++IR+ CP N   I+WYD 
Sbjct  59   APPTGFRKGSVGENNDQVNGLALCRGDVSNTDCKACITESSSEIRKRCPDNKAAIIWYDY  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS  +FFG++D  N FYM N     DP SF QKTK+LL+ LA +A      YA G 
Sbjct  119  CLLKYSNVNFFGQVDHQNMFYMWNLNNVSDPDSFNQKTKELLSNLAQQAFNAMKMYATGE  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++  S  +YGLTQCTRDLS  DCKKCL DAI++LP CC   K GGRV+ GSCN RYE Y
Sbjct  179  LELEESEKLYGLTQCTRDLSSSDCKKCLDDAISKLPNCC-DGKEGGRVVGGSCNIRYEIY  237

Query  764  PF  769
            PF
Sbjct  238  PF  239



>gb|EYU43107.1| hypothetical protein MIMGU_mgv1a022379mg [Erythranthe guttata]
Length=242

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 165/244 (68%), Gaps = 6/244 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAF-ILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlss  220
            MAYS    LLP+L I+   L + T ++A+ L   C++      +S +++NLN LLG+L  
Sbjct  1    MAYS---FLLPILVISINSLLIQTALSASPLFSICSSTQNFTTNSLYERNLNKLLGDLYF  57

Query  221  ntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
             TP  G+  G++G+ TD+VYGL+LCRGDVST DCK+CV +A++ + ++CP   G ++WYD
Sbjct  58   KTPPTGFGFGSSGQYTDRVYGLSLCRGDVSTNDCKTCVVEASSHVTKICPNIKGAVIWYD  117

Query  401  NCLLKYSEDDFFGEIDDVNKFYMAN-GEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAA  577
            NC LKYS+ +F G ID+ NKFYM N    + + + F QKT++L+  L+  A+     YA 
Sbjct  118  NCYLKYSDVNFHGTIDNRNKFYMWNLNNVSTNAELFNQKTRELIGNLSTNASRTSKMYAN  177

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
            G  DIG  S IYG+ QC+RDLS +DCKKCL  A++ELP CCG  K GGRV+ GSCN RYE
Sbjct  178  GETDIGIESKIYGMAQCSRDLSRDDCKKCLDGAVSELPSCCG-GKQGGRVVGGSCNIRYE  236

Query  758  TYPF  769
             YPF
Sbjct  237  IYPF  240



>gb|KDP25874.1| hypothetical protein JCGZ_22904 [Jatropha curcas]
Length=243

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 163/246 (66%), Gaps = 10/246 (4%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCA---NFATSPPDSRFQKnlntllgnl  214
            M++SK  S + LL+  F L   T +A   L HFC+   NF T+ P   ++ NLN ++GNL
Sbjct  1    MSFSKFTSFIYLLT--FPLLHQTILATDPLFHFCSSSENFTTNGP---YESNLNKIIGNL  55

Query  215  ssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
               TP+ G+  G++G+  D+ YGLALCRGDVST+DCK+CV +A+++IR+ CP N   I+W
Sbjct  56   YIQTPQTGFGFGSSGQKPDQAYGLALCRGDVSTSDCKTCVVEASSEIRKRCPYNKAAIIW  115

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            YDNCLLKYS+ +FFG+ID+ NKFYM N     +P  F  KTK+LL++L   A +    YA
Sbjct  116  YDNCLLKYSDKEFFGQIDNRNKFYMWNVRVVSNPVEFNGKTKELLSQLVKDAYVSPKLYA  175

Query  575  AGVEDIGGS-SVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
             G   +  +   +YGLTQC+RDLS  DCK CL   I ELP CC   K GGRV+ GSCNFR
Sbjct  176  TGELKLEETYDKLYGLTQCSRDLSSYDCKNCLDGIIGELPNCC-DGKEGGRVVSGSCNFR  234

Query  752  YETYPF  769
            YE YPF
Sbjct  235  YEIYPF  240



>gb|AES67291.2| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 155/247 (63%), Gaps = 5/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            MA+SK  ++  L S      + T   A  L HFC+N      +S ++ NL TL+ +L   
Sbjct  1    MAFSKLMTIF-LYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYK  59

Query  224  tPRNGYSSGTAGKCTDK---VYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
            TP  G+ +G++    ++    YGLALCRGDVS ++CK+CV++AT +I+  CP N GGI+W
Sbjct  60   TPSTGFGNGSSSLVQNQNQQTYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIW  119

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            YD CL KYS+ DFFG+I   N+FYM N     DP +F  KTK LL++LA KA++    YA
Sbjct  120  YDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNPKLYA  179

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
             G   +  S  +YGLTQCTRDLS  DCK CL  AI EL  CC   K GGRV+ GSCNFRY
Sbjct  180  TGEVKLEESKKLYGLTQCTRDLSSADCKNCLDAAINELRNCCD-GKEGGRVVGGSCNFRY  238

Query  755  ETYPFYK  775
            E YPF K
Sbjct  239  EIYPFVK  245



>ref|XP_002274745.2| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=243

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 145/221 (66%), Gaps = 1/221 (0%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
             T +    L HFC++      +  ++ NLN L+G L    P  G   G+ G+  D+V GL
Sbjct  20   QTVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLYLAAPPTGSGKGSVGQNHDQVNGL  79

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            ALCRGDVS TDCK C+ +A+T+IR+LCP N   IVWYD+CLLKYS  +FFG++D  N+FY
Sbjct  80   ALCRGDVSNTDCKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFY  139

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            M N      P SF QKTK+LL+ LA +  + +  YA G  ++  S  +YGLTQCTRDLS 
Sbjct  140  MWNLNNVSYPTSFNQKTKELLSHLAQQGFVNQKMYAVGELELEESKKLYGLTQCTRDLSS  199

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DCKKCL DAI+ELP CC   K GGRV+ GSCN RYE YPF
Sbjct  200  SDCKKCLDDAISELPSCC-DGKEGGRVVGGSCNIRYEIYPF  239



>ref|XP_006372985.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
 gb|ERP50782.1| hypothetical protein POPTR_0017s06790g [Populus trichocarpa]
Length=242

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 144/228 (63%), Gaps = 1/228 (0%)
 Frame = +2

Query  86   IAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKC  265
            I F L LHT   A    H C++      +  ++ NLN L   L    P  G+  G+ G  
Sbjct  13   ITFSLLLHTVFGAGPNFHLCSSPENFTANGPYESNLNKLTSYLYYKAPPTGFGMGSRGHT  72

Query  266  TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEI  445
             D+ YGLALCRGDVST+DCK+CV + +++IR+ CP N   I+WYDNCLLKYS + FFG+I
Sbjct  73   PDQTYGLALCRGDVSTSDCKTCVVEVSSEIRKRCPYNKAAIIWYDNCLLKYSNNAFFGQI  132

Query  446  DDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQ  625
            D+ NKFYM N     +P  F +KTK+LL++LA++A      +A G  ++G S+ +YGL Q
Sbjct  133  DNGNKFYMWNVHVVSEPAPFNEKTKELLSQLANEAQATPKLFATGERELGKSTKLYGLVQ  192

Query  626  CTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            CT DLS   CKKCL   I ELP CC   K GGRV+ GSCNF YE YPF
Sbjct  193  CTGDLSSAVCKKCLDGIIGELPICC-DGKQGGRVVSGSCNFIYEIYPF  239



>gb|KHN36561.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=244

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 145/224 (65%), Gaps = 2/224 (1%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTD-KVYG  283
             T   A  L HFC+N      +S ++ NL TL+ +L   TP  G+  G+ G+  + K Y 
Sbjct  21   QTSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKTPSTGFGVGSVGQYQNQKAYA  80

Query  284  LALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKF  463
            LALCRGDVS ++CK+CV++A  +I   CP N G I+WYD C+ KY + DF G+ID+ NKF
Sbjct  81   LALCRGDVSASECKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKF  140

Query  464  YMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLS  643
            YM N +   DP +F  KT++LL++LA KA +    YA G   +  S  +YGLTQCTRDLS
Sbjct  141  YMWNLKNVSDPATFNYKTRELLSQLAQKAYVNNKLYATGEAKLENSETLYGLTQCTRDLS  200

Query  644  GEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
              DCKKCL DAI ELP CC   K GGRV+ GSCNFRYE YPF K
Sbjct  201  SSDCKKCLDDAINELPNCCD-GKEGGRVVSGSCNFRYEIYPFVK  243



>emb|CBI28973.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 145/221 (66%), Gaps = 1/221 (0%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
             T +    L HFC++      +  ++ NLN L+G L    P  G   G+ G+  D+V GL
Sbjct  43   QTVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLYLAAPPTGSGKGSVGQNHDQVNGL  102

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            ALCRGDVS TDCK C+ +A+T+IR+LCP N   IVWYD+CLLKYS  +FFG++D  N+FY
Sbjct  103  ALCRGDVSNTDCKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFY  162

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            M N      P SF QKTK+LL+ LA +  + +  YA G  ++  S  +YGLTQCTRDLS 
Sbjct  163  MWNLNNVSYPTSFNQKTKELLSHLAQQGFVNQKMYAVGELELEESKKLYGLTQCTRDLSS  222

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DCKKCL DAI+ELP CC   K GGRV+ GSCN RYE YPF
Sbjct  223  SDCKKCLDDAISELPSCC-DGKEGGRVVGGSCNIRYEIYPF  262



>gb|AFK43074.1| unknown [Medicago truncatula]
Length=248

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 154/245 (63%), Gaps = 5/245 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            MA+SK  ++  L S      + T   A  L HFC+N      +S ++ NL TL+ +L   
Sbjct  1    MAFSKLMTIF-LYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYK  59

Query  224  tPRNGYSSGTAGKCTDK---VYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
            TP  G+ +G++    ++    YGLALCRGDVS ++CK+CV++AT +I+  CP N GGI+W
Sbjct  60   TPSTGFGNGSSSLVQNQNQQTYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIW  119

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            YD CL KYS+ DFFG+I   N+FYM N     DP +F  KTK LL++LA KA++    YA
Sbjct  120  YDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNPKLYA  179

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
             G   +  S  +YGLTQCTRDLS  DCK CL  AI EL  CC   K GGRV+ GSCNFRY
Sbjct  180  TGEVKLEESKKLYGLTQCTRDLSSADCKNCLDAAINELRNCCD-GKEGGRVVGGSCNFRY  238

Query  755  ETYPF  769
            E YP+
Sbjct  239  EIYPY  243



>ref|XP_010051179.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89432.1| hypothetical protein EUGRSUZ_A01731 [Eucalyptus grandis]
Length=240

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 147/235 (63%), Gaps = 9/235 (4%)
 Frame = +2

Query  77   LLSIAFILALHTPMAAAQLRHFCA---NF-ATSPPDSRFQKnlntllgnlssntPRNGYS  244
            LLS+   + L   + A  L HFC+   NF A SP +S   K  + L        P +G+ 
Sbjct  8    LLSLCSAILLRAALGADPLFHFCSTPENFTAGSPYESNLNKLTSFLYTKT----PSSGFG  63

Query  245  SGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSE  424
             G+ G+  D+VYGLALCRGD+S +DCK+ VADA  +IR  CP N G I+WYD+C+ KY +
Sbjct  64   LGSIGQYQDQVYGLALCRGDISPSDCKAFVADAGAEIRRRCPHNKGAIIWYDDCMFKYLD  123

Query  425  DDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSS  604
             DFFG+ID+ NKFYM N +   DP+ F  K + LLT L ++A  +   YA G   +   +
Sbjct  124  TDFFGQIDNANKFYMWNLKNVSDPEPFNGKVRGLLTGLVEEAYTVPKLYATGEMGLEDKT  183

Query  605  VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             +YGL QCTRDLS  +CK+CL  AI ELP CC   K GGRV+ GSCNFRYE YPF
Sbjct  184  KLYGLVQCTRDLSATECKECLEGAIGELPSCC-DGKEGGRVVGGSCNFRYEIYPF  237



>ref|XP_009793791.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 159/245 (65%), Gaps = 6/245 (2%)
 Frame = +2

Query  44   MAYSKPFS-LLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlss  220
            MA SK  S L  LL IA ++   T ++   L HFC+       +S + KNL  +LG+L  
Sbjct  1    MASSKIISSLFFLLYIAILV--QTVISTDPLFHFCSKSGNFTANSYYAKNLKNVLGDLYL  58

Query  221  ntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
             TP  G+S+ +AG+  D+ YG +LCRGDVS+T+CKSCV DA+ ++ +LCP +   I+WYD
Sbjct  59   KTPPTGFSTSSAGQTPDQTYGFSLCRGDVSSTNCKSCVVDASEELGKLCPYDKEAIIWYD  118

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAG  580
            NCLLKYS +DF G+ID+  KFYM N      P+SF  KTK+LL  L +KA   ++ YA G
Sbjct  119  NCLLKYSYNDFLGKIDNTYKFYMWNVRVVSKPESFNAKTKELLGSLVEKAYKKQNLYANG  178

Query  581  VEDIGGSSV--IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
              ++ G     +YGL QCTRDLS EDCK+CL   I E+P CC   K GGRV+ GSCNFRY
Sbjct  179  EMELIGDQYEKLYGLVQCTRDLSSEDCKQCLEGIITEIPSCC-DGKEGGRVVGGSCNFRY  237

Query  755  ETYPF  769
            E YPF
Sbjct  238  EIYPF  242



>ref|XP_006372978.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
 gb|ERP50775.1| hypothetical protein POPTR_0017s06720g [Populus trichocarpa]
Length=242

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 142/228 (62%), Gaps = 1/228 (0%)
 Frame = +2

Query  86   IAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKC  265
            I F L LHT   A    H C++      +  ++ NLN L   L    P  G+  G+ G  
Sbjct  13   ITFSLLLHTVFGAGPNFHLCSSPENFTANGPYESNLNKLTSYLYYKAPPTGFGMGSRGHT  72

Query  266  TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEI  445
             D+ YGLALCRGDVST+DCK+CV +A+++IR+ CP N   I+WYDNCLLKYS   FFG++
Sbjct  73   PDQTYGLALCRGDVSTSDCKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSNTGFFGQV  132

Query  446  DDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQ  625
            D  NKFYM N      P  F +KTK+LL++LA++A      +A G  ++G S+ +YGL Q
Sbjct  133  DTGNKFYMWNVHVVSKPAPFNKKTKELLSQLANEAQATPKLFATGERELGKSTKLYGLVQ  192

Query  626  CTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            CT DLS   CKKCL   I ELP CC   K GGRV+ GSCNF YE YPF
Sbjct  193  CTGDLSSAVCKKCLDGIIGELPSCC-DGKQGGRVVSGSCNFIYEIYPF  239



>ref|XP_006351952.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 156/242 (64%), Gaps = 2/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M+ SK  S L  LS   IL + T ++   L HFC+N      +S + +NL  LLG+L   
Sbjct  1    MSSSKLISCLFFLSSIAIL-VQTVISTNPLFHFCSNSENFTANSYYAQNLKNLLGDLYLK  59

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+S+ + G+  D+  GL+LCRGD+S+ +CKSCV DA+ ++ + CP +   I+WYDN
Sbjct  60   TPPTGFSTCSIGQNHDQTNGLSLCRGDISSNNCKSCVLDASEELGKRCPYDKEAIIWYDN  119

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS+ DF G+ID++NKFYM N    K+PK F  KTK+LL  LA  A    + YA G 
Sbjct  120  CLLKYSDKDFLGKIDNMNKFYMWNVRVVKNPKYFNAKTKELLGNLAANAYKTSNLYATGE  179

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +I  +  +YGL QCTRDLS EDCKKCL   I ELP CC   K GGRVI GSCNF YE Y
Sbjct  180  MEIEENKKLYGLVQCTRDLSNEDCKKCLDGIINELPSCCD-GKEGGRVISGSCNFIYEIY  238

Query  764  PF  769
            PF
Sbjct  239  PF  240



>ref|XP_003543377.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Glycine 
max]
Length=244

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 143/224 (64%), Gaps = 2/224 (1%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTD-KVYG  283
             T   A  L HFC+N      +S ++ NL TL+ +L   TP  G+  G+ G+  + K Y 
Sbjct  21   QTSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKTPSTGFGVGSVGQYQNQKAYA  80

Query  284  LALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKF  463
            LALCRGDVS ++CK+CV++A  +I   CP N G I+WYD C+ KY + DF G+ID+ NKF
Sbjct  81   LALCRGDVSASECKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKF  140

Query  464  YMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLS  643
            YM N +   DP +F   T+ LL++LA KA +    YA G   +  S  +YGLTQCTRDLS
Sbjct  141  YMWNLKNVSDPATFNYNTRDLLSQLAQKAYVNNKLYATGEAKLENSETLYGLTQCTRDLS  200

Query  644  GEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
              DCKKCL DAI ELP CC   K GGRV+ GSCNFRYE YPF K
Sbjct  201  SSDCKKCLDDAINELPNCCD-GKEGGRVVSGSCNFRYEIYPFVK  243



>ref|XP_009591406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 157/244 (64%), Gaps = 4/244 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            MA S+  S L  LS   IL + T ++   L HFC+       +S + KNL  LLG+L   
Sbjct  1    MASSRIISSLYFLSYIAIL-VQTVVSTDPLFHFCSKSGNFTANSYYAKNLKNLLGDLYLK  59

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+S+ + G+  D+ YGL+LCRGDVS+T+CKSCV DA+ ++ + CP +   I+WYDN
Sbjct  60   TPPTGFSTSSIGQTPDQTYGLSLCRGDVSSTNCKSCVVDASEELGKRCPYDKEAIIWYDN  119

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS +DF G+ID+  KFYM N      P+SF  KTK+LL  L + A   ++ YA+G 
Sbjct  120  CLLKYSYNDFLGKIDNTYKFYMWNVRVVNKPESFNAKTKELLGSLVETAYKKQNLYASGD  179

Query  584  EDIGGSSV--IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
             ++ G     +YGL QCTRDLS EDCKKCL   I E+P CC   K GGRV+ GSCNFRYE
Sbjct  180  MELIGDQYEKLYGLVQCTRDLSSEDCKKCLEGIITEIPSCC-DGKEGGRVVGGSCNFRYE  238

Query  758  TYPF  769
             YPF
Sbjct  239  IYPF  242



>ref|XP_009787631.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
sylvestris]
Length=246

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 156/244 (64%), Gaps = 4/244 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M  SK  S L  L    ILA  T ++   L HFC+       +S + KNL  +LG+L   
Sbjct  1    MTSSKIISSLFFLLYIAILA-QTVISTDPLFHFCSKSGNFTANSYYAKNLKNVLGDLYLK  59

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+S+ + G+  D++YGL+LCRGDVS+T+CKSCV DA+ ++ +LCP +   I+WYDN
Sbjct  60   TPPTGFSTSSVGQTPDQIYGLSLCRGDVSSTNCKSCVVDASEELGKLCPYDKEAIIWYDN  119

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS +DF G+ID+  KFYM N      P+SF  KTK+LL  L +KA   ++ YA G 
Sbjct  120  CLLKYSYNDFLGKIDNTYKFYMWNVRVVSKPESFNAKTKELLGSLVEKAYKKQNLYANGE  179

Query  584  EDIGGSSV--IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
             ++ G     +YGL QCTRDLS EDCK+CL   I E+  CC   K GGRV+ GSCNFRYE
Sbjct  180  MELIGDQYEKLYGLVQCTRDLSSEDCKQCLEGIITEISSCC-DGKEGGRVVGGSCNFRYE  238

Query  758  TYPF  769
             YPF
Sbjct  239  IYPF  242



>ref|XP_006352035.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=244

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 156/242 (64%), Gaps = 2/242 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M  SK  S L  LS   IL + T ++   L HFC+N      +S + +NL  LLG+L   
Sbjct  1    MYSSKLISCLFFLSSIAIL-VQTVISTNPLFHFCSNSENFTANSYYAQNLKNLLGDLYLK  59

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+S+ + G+  D+  GL+LCRGD+S+ +CKSCV DA+ ++ + CP +   I+WYDN
Sbjct  60   TPPTGFSTCSIGQNHDQTNGLSLCRGDISSNNCKSCVLDASEELGKRCPYDKEAIIWYDN  119

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS+ DF G+ID++NKFYM N    K+PK F  KTK+LL  LA  A    + YA G 
Sbjct  120  CLLKYSDKDFLGKIDNMNKFYMWNVRVVKNPKYFNAKTKELLGNLAANAYKTSNLYATGE  179

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +I  +  +YGL QCTRDLS +DCKKCL   I E+P CC   K GGRV+ GSCNFRYE Y
Sbjct  180  MEIEENKKLYGLVQCTRDLSNDDCKKCLDGIITEIPSCC-DGKEGGRVVGGSCNFRYEIY  238

Query  764  PF  769
            PF
Sbjct  239  PF  240



>ref|XP_003597040.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
Length=316

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 154/245 (63%), Gaps = 5/245 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            MA+SK  ++  L S      + T   A  L HFC+N      +S ++ NL TL+ +L   
Sbjct  1    MAFSKLMTIF-LYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYK  59

Query  224  tPRNGYSSGTAGKCTDK---VYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
            TP  G+ +G++    ++    YGLALCRGDVS ++CK+CV++AT +I+  CP N GGI+W
Sbjct  60   TPSTGFGNGSSSLVQNQNQQTYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIW  119

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            YD CL KYS+ DFFG+I   N+FYM N     DP +F  KTK LL++LA KA++    YA
Sbjct  120  YDYCLFKYSDTDFFGKIAKTNRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNPKLYA  179

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
             G   +  S  +YGLTQCTRDLS  DCK CL  AI EL  CC   K GGRV+ GSCNFRY
Sbjct  180  TGEVKLEESKKLYGLTQCTRDLSSADCKNCLDAAINELRNCC-DGKEGGRVVGGSCNFRY  238

Query  755  ETYPF  769
            E YPF
Sbjct  239  EIYPF  243


 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 76/168 (45%), Gaps = 42/168 (25%)
 Frame = +2

Query  266  TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEI  445
            + K+YGL  C  D+S+ DCK+C+  A  ++R  C    GG V   +C  +Y       EI
Sbjct  188  SKKLYGLTQCTRDLSSADCKNCLDAAINELRNCCDGKEGGRVVGGSCNFRY-------EI  240

Query  446  DDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQ  625
               +  +  N                 L + +D    +K      +++    +V      
Sbjct  241  YPFDFIWYDN----------------CLFKCSDMDFFVK------IDNTNKWNV------  272

Query  626  CTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                    DCKKCL DAI ELP CC   K GGRV+ GSCNFRYE YPF
Sbjct  273  ------SIDCKKCLDDAINELPNCC-DGKEGGRVVGGSCNFRYEIYPF  313



>ref|XP_009605992.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nicotiana 
tomentosiformis]
Length=246

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 159/245 (65%), Gaps = 6/245 (2%)
 Frame = +2

Query  44   MAYSKPFS-LLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlss  220
            MA SK  S L  LL IA ILA  T ++   L HFC+       +S + KNL  LLG+L  
Sbjct  1    MASSKIISSLFFLLHIA-ILA-QTVISTDPLFHFCSKSGNFTANSYYAKNLKNLLGDLYL  58

Query  221  ntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
             TP  G+S+ + G+  D+ YGL+LCRGDVS+T+CKSCV DA+ ++ + CP +   I+WYD
Sbjct  59   KTPLTGFSTSSIGQTPDQTYGLSLCRGDVSSTNCKSCVVDASEELGKRCPYDKEAIIWYD  118

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAG  580
            NCLLKYS +DF G+ID+  KFYM N      P+SF  KTK+LL  L + A   ++ YA+G
Sbjct  119  NCLLKYSYNDFLGKIDNTYKFYMWNVRVVNKPESFNAKTKELLGSLVETAYKKQNLYASG  178

Query  581  VEDIGGSSV--IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
              ++ G     +YGL QCTRDLS EDCKKCL   I E+P CC   K GGRV+ GSCNFRY
Sbjct  179  DMELIGDQYEKLYGLVQCTRDLSSEDCKKCLEGIITEIPSCC-DGKEGGRVVGGSCNFRY  237

Query  755  ETYPF  769
            E YPF
Sbjct  238  EIYPF  242



>ref|XP_011079182.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Sesamum 
indicum]
Length=245

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 149/222 (67%), Gaps = 2/222 (1%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
             T ++A  L   C+N      +S ++KNL  LLG L   TP  G+  G++G+  D+ YGL
Sbjct  22   QTAISATPLFSICSNSHNFTANSPYEKNLIKLLGELYFKTPPTGFGLGSSGQGYDRAYGL  81

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            +LCRGDVST DC +CV DA+ +I + CP + G I+WYDNCLLKY++ DF G+ID  N+FY
Sbjct  82   SLCRGDVSTKDCGACVVDASDEIIKRCPNDRGAIIWYDNCLLKYADSDFLGKIDGQNRFY  141

Query  467  MANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLS  643
            M N +    DP+ F Q+T+ LL+ L++ A+     YA G  ++ G   IYG+ QC+RDLS
Sbjct  142  MWNLQNVTIDPQEFNQRTRGLLSELSEHASKTGKMYAKGEVEVTGYEKIYGMAQCSRDLS  201

Query  644  GEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            G +CKKCL DA+ ELP+CCG  K GGRV+ GSCN RYE YPF
Sbjct  202  GAECKKCLDDAVNELPRCCG-GKQGGRVVGGSCNIRYEIYPF  242



>ref|XP_006372979.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
 gb|ERP50776.1| hypothetical protein POPTR_0017s06730g [Populus trichocarpa]
Length=242

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 142/232 (61%), Gaps = 9/232 (4%)
 Frame = +2

Query  86   IAFILALHTPMAAAQLRHFCA---NF-ATSPPDSRFQKnlntllgnlssntPRNGYSSGT  253
            I F L LHT   A    H C+   NF A  P +S  +K  + L        P  G+  G+
Sbjct  13   ITFSLLLHTVFGAGPNFHLCSSPENFTANGPYESNLKKLTSYLYYKA----PPTGFGMGS  68

Query  254  AGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDF  433
             G   D+ YGL LCRGDVST+DCK+CV +A+++IR+ CP N   I+WYDNCLLKYS   F
Sbjct  69   RGHTPDQTYGLDLCRGDVSTSDCKTCVVEASSEIRKRCPYNKAAIIWYDNCLLKYSNTGF  128

Query  434  FGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIY  613
            FG++D  NKFYM N      P  F +KTK+LL++LA++A      +A G  ++G S+ +Y
Sbjct  129  FGQVDTGNKFYMWNVHVVSKPAPFNKKTKELLSQLANEAQATPKLFATGERELGKSTKLY  188

Query  614  GLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            GL QCT DLS   CKKCL   I ELP CC   K GGRV+ GSCNF YE YPF
Sbjct  189  GLVQCTGDLSSAVCKKCLDGIIGELPSCC-DGKQGGRVVSGSCNFIYEIYPF  239



>ref|XP_010051151.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89427.1| hypothetical protein EUGRSUZ_A01726 [Eucalyptus grandis]
Length=240

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 141/213 (66%), Gaps = 1/213 (0%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVS  310
            L HFC+N       S ++ NLN L   L + TP +G+  G+ G+  ++V+GLALCRGD S
Sbjct  26   LFHFCSNPENFTASSPYESNLNKLTSFLYTKTPPSGFGLGSIGQYQNQVFGLALCRGDAS  85

Query  311  TTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK  490
             + CK+CVADA  +IR  CP+N G I+WYD+C+ KY + DFFG+ID  NKFYM N  +  
Sbjct  86   PSVCKACVADAGAEIRRRCPRNKGAIIWYDDCMFKYLDADFFGQIDKTNKFYMWNLNDVS  145

Query  491  DPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLY  670
            DP  F  K + +LTRLA  A+ +   YAAG + +   + +YGL QCTRDLS  +C+KCL 
Sbjct  146  DPALFNGKVRAMLTRLAKAASSIPRLYAAGEKGVDSKTKLYGLVQCTRDLSATECEKCLE  205

Query  671  DAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             AI ELP CC   K GGRV+ GSCNFRYE YPF
Sbjct  206  GAIGELPSCC-DGKEGGRVVGGSCNFRYEIYPF  237



>gb|EYU43106.1| hypothetical protein MIMGU_mgv1a021349mg, partial [Erythranthe 
guttata]
Length=220

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 152/219 (69%), Gaps = 2/219 (1%)
 Frame = +2

Query  116  MAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALC  295
            ++A+ L   C+N      +S +++NLN LLG+L   TP  G+  G++G+  D+VYGL+LC
Sbjct  1    LSASPLFSICSNTQNFSTNSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYNDRVYGLSLC  60

Query  296  RGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMAN  475
            RGDVST DCK+CV +A++++ ++CP   G +VWYDNC LKYS+ DF G+ID+ NKFYM N
Sbjct  61   RGDVSTNDCKTCVVEASSQVTKICPNLKGAVVWYDNCYLKYSDVDFHGKIDNRNKFYMWN  120

Query  476  -GEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGED  652
                + + + F QKT++L+  L+  A+     YA G  DIG  S IYG+ QC+RDLS +D
Sbjct  121  LNNVSTNAELFNQKTRELIENLSTNASRTSKMYANGETDIGIESKIYGMVQCSRDLSRDD  180

Query  653  CKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            CKKCL  A++ELP CCG  K GGRV+ GSCN RYE YPF
Sbjct  181  CKKCLDGAVSELPSCCG-GKQGGRVVGGSCNIRYEIYPF  218



>gb|ACU16205.1| unknown [Glycine max]
Length=242

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 142/222 (64%), Gaps = 2/222 (1%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTD-KVYG  283
             T   A  L HFC+N      +S ++ NL TL+ +L   TP  G+ +G+ G+  + K Y 
Sbjct  21   QTSFGADPLFHFCSNSENFTANSPYESNLKTLINSLIYKTPSTGFGAGSVGQYQNQKAYA  80

Query  284  LALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKF  463
            LALCRGDVS ++CK+CV++A  +I   CP N G I+WYD C+ KY + DF G+ID+ NKF
Sbjct  81   LALCRGDVSASECKTCVSEAPKEILSRCPYNKGAIIWYDYCMFKYLDTDFLGKIDNTNKF  140

Query  464  YMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLS  643
            YM N +   DP +F   T+ LL++LA KA +    YA G   +  S  +YGLTQCTRDLS
Sbjct  141  YMWNLKNVSDPATFNYNTRDLLSQLAQKAYVNNKLYATGEAKLENSETLYGLTQCTRDLS  200

Query  644  GEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
              DCKKCL DAI ELP CC   K  GRV+ GSCNFRYE YPF
Sbjct  201  SSDCKKCLDDAINELPNCCD-GKERGRVVSGSCNFRYEIYPF  241



>ref|XP_008342465.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 153/236 (65%), Gaps = 2/236 (1%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            F  +PL  +   L  H+ + A+ L HFC +      DS +  NLN+L   L +  P  G+
Sbjct  4    FKSIPLGLLVLCLLHHSAIGASPLYHFCFSPENYTADSPYGANLNSLFSLLYTKVPPTGF  63

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
              G+ G+  ++V GLALCRGDVS+ DC +CV DA+ +IRE CP   G I+WYD+CLLKYS
Sbjct  64   GLGSTGQAKNQVNGLALCRGDVSSKDCNTCVVDASKEIRERCPYRKGAIIWYDHCLLKYS  123

Query  422  EDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGG  598
            +  FFG+ID  N+FYM N +E ++   F +K K+LL+ L+++A+      YA G   +  
Sbjct  124  DVSFFGQIDSRNRFYMWNVQEVENGTLFNEKVKELLSGLSNEASEANQKLYATGEVQLDT  183

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             + +YG+ QCTRDLSG DCKKCL  AI+ELP CC  AK GGRV+ GSCNFRYE YP
Sbjct  184  FTTLYGIAQCTRDLSGVDCKKCLDSAISELPNCC-DAKRGGRVVGGSCNFRYELYP  238



>ref|XP_008228882.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=241

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 140/221 (63%), Gaps = 1/221 (0%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
            H  + A+ L HFC +      +S +  NL  L   L +  P  G+  G+ G+  ++  GL
Sbjct  19   HAALGASPLFHFCFSKENYTANSPYGANLIQLFNLLYTKVPPTGFGLGSTGEGQNQANGL  78

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            ALCRGDVS+ DCK+CV +A+ ++ E CP   G I+WYDNCL KYS  +F G+ID  N+FY
Sbjct  79   ALCRGDVSSQDCKTCVVEASKELGERCPSRKGAIIWYDNCLFKYSNVNFAGKIDKNNRFY  138

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            M N +E  DP  F  K K+LL+ L+ KA+     YA G  ++  S  +YGLTQCTRDLS 
Sbjct  139  MWNVQEVDDPTPFNAKVKELLSGLSTKASSNPKFYATGELELSSSETLYGLTQCTRDLSS  198

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DC KCL DAI+ELP CC  AK GGRV+ GSCNFRYE YP 
Sbjct  199  SDCNKCLDDAISELPNCC-DAKRGGRVVGGSCNFRYELYPI  238



>ref|XP_010051171.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89430.1| hypothetical protein EUGRSUZ_A01729 [Eucalyptus grandis]
Length=240

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 140/218 (64%), Gaps = 1/218 (0%)
 Frame = +2

Query  116  MAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALC  295
            + A  L HFC++       S ++ NLN L   L + TP +G+  G+ G+  D+VYGLALC
Sbjct  21   LGADPLSHFCSSSENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIGQYQDQVYGLALC  80

Query  296  RGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMAN  475
            RGD S +DCK+CVADA  +IR  CP N G I+WYDNC+ KY + +FFG+ID+ NKFYM N
Sbjct  81   RGDTSPSDCKACVADAGAEIRRRCPHNKGAIIWYDNCMFKYLDTEFFGQIDNANKFYMWN  140

Query  476  GEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDC  655
                  P++F  + + LLT L ++A  +   YA G   +   + +YGL QCTRDLS  +C
Sbjct  141  VNNVSHPEAFNGRVRGLLTGLVEEAYTVPKLYATGEMGLEDKTKLYGLVQCTRDLSATEC  200

Query  656  KKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            K+CL  AI ELP CC   K GGRV+ GSCNF YE YPF
Sbjct  201  KECLEGAIGELPSCC-DGKEGGRVVGGSCNFVYEIYPF  237



>ref|XP_008391617.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=242

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 148/237 (62%), Gaps = 2/237 (1%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            F  +PL  +   L  H+ + A+ L H C +    P  S +  NLN L   L +  P  G+
Sbjct  4    FKSIPLGLLVLCLFHHSAIGASPLYHICFSQQNYPASSPYGANLNLLFNLLYTKVPPTGF  63

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
              G+ G   ++V GLALCRGDVS+ DC +CV DA+  +RELCP   G I+WYD+CLLKYS
Sbjct  64   GLGSTGHAKNQVNGLALCRGDVSSKDCNTCVVDASKDLRELCPSRKGAIIWYDHCLLKYS  123

Query  422  EDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGG  598
            +  FFG+ID  N+FY+ N +E ++   F +K K+LL+ L+++A+      YA G   +  
Sbjct  124  DVGFFGQIDTNNRFYLYNVQEVENGTVFNEKVKELLSGLSNEASEDNQKFYATGEVQLDT  183

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             + +YGL QCTRDLSG DCKKCL  AI ELP CC  AK GGRV+ GSCN R+E YP 
Sbjct  184  FTTLYGLAQCTRDLSGVDCKKCLDSAIGELPNCC-NAKRGGRVVGGSCNVRFELYPI  239



>ref|XP_007216947.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
 gb|EMJ18146.1| hypothetical protein PRUPE_ppa016345mg [Prunus persica]
Length=210

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = +2

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P  G+  G+ G+  ++  GLALCRGDVS+ DCK+CV +A+ K+ E CP   G I+WYDNC
Sbjct  28   PPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCVVEASKKLGERCPSRKGAIIWYDNC  87

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            L KYS  +F G+ID+ N+FYM N +E  DP  F +K K+LL+ L+ KA+     YA G  
Sbjct  88   LFKYSNVNFAGKIDNNNRFYMWNVQEVDDPTPFNEKVKELLSGLSTKASSNPKFYATGEL  147

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            ++  S  +YGLTQCTRDLS  DCKKCL DAI+ELP CC  AK GGRV+ GSCNFRYE YP
Sbjct  148  ELSSSETLYGLTQCTRDLSSSDCKKCLDDAISELPNCC-DAKQGGRVVGGSCNFRYELYP  206

Query  767  F  769
             
Sbjct  207  I  207



>ref|XP_006387993.1| hypothetical protein POPTR_0421s00220g [Populus trichocarpa]
 gb|ERP46907.1| hypothetical protein POPTR_0421s00220g [Populus trichocarpa]
Length=230

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 149/243 (61%), Gaps = 17/243 (7%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQ-LRHFCANFATSPPDSRFQKnlntllgnlss  220
            M++S   S L LL  AF L +HT +  A  L HFC+       +  ++ NLN L   L  
Sbjct  1    MSFSNFASFLCLL--AFSLLVHTGLIGADPLYHFCSTPENFTANGPYESNLNKLTSYLYY  58

Query  221  ntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
              PR G+   + G   D+ YGLALCRGD ST+DCK+CV +A  +IR+ CP N   I+WYD
Sbjct  59   QAPRKGFGLCSKGHKPDQAYGLALCRGDASTSDCKTCVVEAGGEIRKRCPYNKAAIIWYD  118

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAG  580
            NCLLKYS + FFG+ID  NKFY+ N +  ++P +F  KTK+LLT+LA+K       YA G
Sbjct  119  NCLLKYSNNGFFGQIDYRNKFYLWNVKVVREPVTFNGKTKELLTQLANKVQATPKLYATG  178

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
            V ++G S+ IYGL QCTRDLS   CKKCL +              GGRVI GSCNFRYE 
Sbjct  179  VMELGESTKIYGLVQCTRDLSSAVCKKCLDE--------------GGRVIGGSCNFRYEI  224

Query  761  YPF  769
            YPF
Sbjct  225  YPF  227



>ref|NP_566697.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
 sp|Q9LRJ9.1|CRR38_ARATH RecName: Full=Cysteine-rich repeat secretory protein 38; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB01391.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59407.1| unknown protein [Arabidopsis thaliana]
 gb|ABD91491.1| At3g22060 [Arabidopsis thaliana]
 gb|AEE76585.1| Receptor-like protein kinase-related family protein [Arabidopsis 
thaliana]
Length=252

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 156/254 (61%), Gaps = 10/254 (4%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAF-ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntll  205
            M+  K     P+L+IA  IL++HT ++ +Q    L H C++   S    S ++ NLN L 
Sbjct  1    MSSLKRIVWFPILAIAIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLF  60

Query  206  gnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGG  385
              LS   P  G+++ + G   + V GLALCRGD S++DC+SC+  A  ++R+ CP N  G
Sbjct  61   SQLSYKVPSTGFAASSTGNTPNNVNGLALCRGDASSSDCRSCLETAIPELRQRCPNNKAG  120

Query  386  IVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS  565
            IVWYDNCL+KYS  +FFG+ID  N+FY+ N +   DP +F  +TK LLT L  KA    +
Sbjct  121  IVWYDNCLVKYSSTNFFGKIDFENRFYLYNVKNVSDPSTFNSQTKALLTELTKKATTRDN  180

Query  566  S--YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGS  739
               +A G ++IG +  +YGL QCTRDL    CK CL   I ELP CC   K GGRV+ GS
Sbjct  181  QKLFATGEKNIGKNK-LYGLVQCTRDLKSITCKACLNGIIGELPNCCD-GKEGGRVVGGS  238

Query  740  CNFRYETYPFYKGA  781
            CNFRYE YPF K A
Sbjct  239  CNFRYEIYPFVKTA  252



>ref|XP_010051188.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89433.1| hypothetical protein EUGRSUZ_A01732 [Eucalyptus grandis]
Length=242

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 154/234 (66%), Gaps = 2/234 (1%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            +P+L ++F L L T  +A  L H C         S F+ NL++LL  L S  P +G+ +G
Sbjct  7    IPILLLSFFLLLDTSFSADPLYHICFGKDNYTSGSPFKTNLDSLLTTLVSKVPPSGFGTG  66

Query  251  TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDD  430
            ++G+  D+VYGLALCRGDVS++DCKSCV+DA  ++ + CP+  G I+WYDNCLLKYS  +
Sbjct  67   SSGEGNDQVYGLALCRGDVSSSDCKSCVSDAGPELLQRCPEQKGAIIWYDNCLLKYSNVE  126

Query  431  FFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSV  607
            FFG+ID  NKFY+ N ++   D   F +K KQLL+ L D+A      YA G   +GG   
Sbjct  127  FFGKIDTKNKFYLLNVQDVDMDFMEFYRKIKQLLSNLTDEAVAGPKLYAYGELGLGGYKT  186

Query  608  IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            ++GL QCTRDLS +DCK CL  AI++LP CC   K GGR + GSCN RYE YPF
Sbjct  187  LFGLAQCTRDLSADDCKTCLKGAISDLPSCC-YGKRGGRTVGGSCNVRYELYPF  239



>ref|XP_010069655.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89428.1| hypothetical protein EUGRSUZ_A01727 [Eucalyptus grandis]
Length=240

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 139/213 (65%), Gaps = 1/213 (0%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVS  310
            L HFC++       S ++ NLN L   L + TP +G+  G+  +  D+VYGLALCRGD S
Sbjct  26   LSHFCSSSENFTAGSPYESNLNKLTSFLYTKTPSSGFGLGSIRQYQDQVYGLALCRGDTS  85

Query  311  TTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK  490
             +DCK+CVADA  +IR  CP+N G I+WYDNC++KY + DFFG+ID+ NKFYM N     
Sbjct  86   PSDCKACVADAGAEIRRRCPRNKGAIIWYDNCMIKYLDTDFFGQIDNANKFYMWNVNNVS  145

Query  491  DPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLY  670
             P++F  + + LLT L ++A  +   YA G   +   + +YGL QCTRDLS  +CK+CL 
Sbjct  146  YPEAFNGRVRGLLTGLVEEAYTVPKLYATGEMGLEDKTKLYGLVQCTRDLSATECKECLE  205

Query  671  DAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             AI ELP CC   K GGRV+ GSCNF YE YPF
Sbjct  206  GAIGELPSCC-DGKEGGRVVGGSCNFGYEIYPF  237



>ref|XP_008455404.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=249

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 156/247 (63%), Gaps = 4/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M  SKPF  + L  ++ +  + T + A+ L H C++      +S +  NL   L  L+++
Sbjct  1    MRQSKPFVPILLFFLSALGNIITTINASYLYHTCSSSDNYTMNSLYASNLRQALDRLTNS  60

Query  224  tPRNGYS-SGTAGK-CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWY  397
             P +G+  S T GK   ++V GLALCRGD+S TDCK+CV  A   I++ CP   G  +WY
Sbjct  61   APPSGFGLSSTGGKDSQNQVNGLALCRGDISPTDCKTCVITAAQDIQQRCPYKKGAAIWY  120

Query  398  DNCLLKYSEDDFFGEIDDVN-KFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            D+CLLKYS   FFG+  +   +FY+ N  EA DP SF ++ K LL  L++ A   ++ YA
Sbjct  121  DSCLLKYSNAKFFGKNQNGGFRFYLVNVREADDPTSFKEQVKNLLNGLSEMAKTSRNLYA  180

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGT-AKVGGRVIQGSCNFR  751
             G  +IG S  +YGL QCTRDL   DCKKCL DAIAELP CC   AKVGGRV+ GSCNFR
Sbjct  181  IGDLEIGSSKKLYGLVQCTRDLWTADCKKCLDDAIAELPYCCANGAKVGGRVVGGSCNFR  240

Query  752  YETYPFY  772
            YETYPF+
Sbjct  241  YETYPFF  247



>gb|EYU43108.1| hypothetical protein MIMGU_mgv1a018557mg, partial [Erythranthe 
guttata]
Length=220

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 150/219 (68%), Gaps = 2/219 (1%)
 Frame = +2

Query  116  MAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALC  295
            ++A+ L   C++      +S +++NLN LLG+L   TP  G+  G++G+  D+ YGL+LC
Sbjct  1    LSASPLFSICSSTQNFTTNSLYERNLNKLLGDLYFKTPPTGFGFGSSGQYNDRAYGLSLC  60

Query  296  RGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMAN  475
            RGDVST DCK+CV +A++++ ++CP   G ++WYDNC LKYS+ +F G ID+ NKFYM N
Sbjct  61   RGDVSTNDCKTCVVEASSQVTKICPNLKGAVIWYDNCYLKYSDVNFHGTIDNRNKFYMWN  120

Query  476  -GEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGED  652
                + + + F QKT++L+  L+  A+     YA G  DIG  S IYG+ QC+RDLS +D
Sbjct  121  LNNVSTNAELFNQKTRELIGNLSTNASRTSKMYAHGETDIGIESKIYGMVQCSRDLSRDD  180

Query  653  CKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            CKKCL  A++ELP CCG  K GGRV+ GSCN RYE YPF
Sbjct  181  CKKCLDGAVSELPSCCG-GKQGGRVVGGSCNIRYEIYPF  218



>ref|XP_004251507.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Solanum 
lycopersicum]
Length=240

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 151/242 (62%), Gaps = 6/242 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M+ SK  S L  LS   I+    P     L HFC+N      +S + +NL  LLG+L   
Sbjct  1    MSSSKLISCLFFLSSIAIVISTDP-----LFHFCSNHENFTANSYYAQNLKNLLGDLYLK  55

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+S+ + G+  D+  GL+LCRGDV++ +CKSCV DA+ ++ + CP +   I+WYDN
Sbjct  56   TPPTGFSTSSIGQNHDQTNGLSLCRGDVTSNNCKSCVLDASEELGKRCPYDKEAIIWYDN  115

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS+ DF G ID+  KFYM N     +P+ F  KTK+LL  L++ A    + YA G 
Sbjct  116  CLLKYSDKDFLGNIDNTYKFYMWNVRVVSNPEYFNAKTKELLGSLSENAYKTTNLYAIGE  175

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +I  +  +YGL QCTRDLS EDCKKC+   I E+P CC   K GGRV+ GSCNFRYE Y
Sbjct  176  MEIEENKKLYGLVQCTRDLSNEDCKKCVDGIITEIPSCCD-GKEGGRVVSGSCNFRYEIY  234

Query  764  PF  769
            PF
Sbjct  235  PF  236



>ref|XP_010051161.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89429.1| hypothetical protein EUGRSUZ_A01728 [Eucalyptus grandis]
Length=240

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 138/218 (63%), Gaps = 1/218 (0%)
 Frame = +2

Query  116  MAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALC  295
            + A  L H C+        S ++ NLN L   L +NTP +G+  G+ G+  D+ YGL LC
Sbjct  21   LGADPLFHVCSTPEDFTAGSPYESNLNKLTSFLYTNTPSSGFGPGSIGQYPDQPYGLTLC  80

Query  296  RGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMAN  475
            RGD S  DC++CVADA  +IR  CP+N G I+WYDNC+ KY + DFFG+ID+ NKFYM N
Sbjct  81   RGDTSPLDCEACVADAVAEIRRHCPRNKGAIIWYDNCMFKYLDTDFFGQIDNANKFYMWN  140

Query  476  GEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDC  655
             +   DP++F  K + LLT L ++A  +   YA G   +   + +YGL QCTRDLS   C
Sbjct  141  PKSVSDPEAFNGKVRGLLTGLVEEAYSVPKLYATGEMGLEEKTKLYGLVQCTRDLSATQC  200

Query  656  KKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            K+CL  AI ELP   G  K GGRV+ GSCNFRYE YPF
Sbjct  201  KECLEGAIGELPS-YGNGKEGGRVVGGSCNFRYEIYPF  237



>ref|XP_006351953.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Solanum 
tuberosum]
Length=240

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 151/243 (62%), Gaps = 8/243 (3%)
 Frame = +2

Query  44   MAYSKPFSLLPLLS-IAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlss  220
            M+ SK  S L  LS IA +++         L HFC+N      +S + +NL  LLG+L  
Sbjct  1    MSSSKLISCLFFLSSIALVIS------TDPLFHFCSNSENFTANSYYAQNLKNLLGDLYL  54

Query  221  ntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
             TP  G+S+ + G+  D+  GL+LCRGDVS+  CKSCV DA+ ++ + CP +   I+WYD
Sbjct  55   KTPPTGFSTSSIGQNHDQTNGLSLCRGDVSSNSCKSCVLDASEELGKRCPYDKEAIIWYD  114

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAG  580
            NCLLKYS  DF G ID+  KFYM N     +P+ F  KTK+LL  L++ A    + YA G
Sbjct  115  NCLLKYSNKDFLGNIDNTYKFYMWNVRVVSNPEYFNAKTKELLGSLSENAYKTSNLYAIG  174

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
              +I  +  +YGL QCTRD+S EDCKKCL   I E+P CC   K GGRV+ GSCNFRYE 
Sbjct  175  EMEIEENKKLYGLVQCTRDISNEDCKKCLDGIITEIPSCC-DGKEGGRVVGGSCNFRYEI  233

Query  761  YPF  769
            YPF
Sbjct  234  YPF  236



>ref|XP_004292427.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Fragaria 
vesca subsp. vesca]
Length=244

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 146/238 (61%), Gaps = 4/238 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            +  +PL  + F   +H+   A+ L HFC +      DS +  +L  L   L +  P  G+
Sbjct  4    YKTIPLGFLVFCFFIHSSFGASSLNHFCFSHENYTADSPYDAHLTRLFTLLQTKVPPTGF  63

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
               + G+   K  GLALCRGDVS+ DC +CV DA+  IRE CP + G I+WYD+CLLKYS
Sbjct  64   GLASTGQGLKKANGLALCRGDVSSEDCTTCVVDASKDIREFCPNSKGAIIWYDHCLLKYS  123

Query  422  EDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVEDI  592
              DFFG+ID+ NKFYM N +E ++P  F +  K LL+ LA +A+   ++   YA G   +
Sbjct  124  NVDFFGKIDNKNKFYMWNVQEVQNPTLFNKSVKDLLSGLAVEASEAAAAPKFYATGELQL  183

Query  593  GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
               + +YGL  CTRDLS  DCKKCL  A++ELP CC +AK GGRV+ GSCN  +E YP
Sbjct  184  DTFTTLYGLATCTRDLSAADCKKCLDGAVSELPNCC-SAKRGGRVVGGSCNVGFELYP  240



>ref|XP_007216907.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
 gb|EMJ18106.1| hypothetical protein PRUPE_ppa019252mg [Prunus persica]
Length=215

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 125/181 (69%), Gaps = 1/181 (1%)
 Frame = +2

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P  G+  G+ G+  ++  GLALCRGDVS+ DCK+CV +A+ ++ E CP   G I+WYDNC
Sbjct  33   PPTGFGLGSTGEGQNQANGLALCRGDVSSQDCKTCVVEASKELGERCPSRKGAIIWYDNC  92

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            L KYS  +F G+ID+ N+FYM N +E  DPK F  K ++LL+ L+ KA+     YA G  
Sbjct  93   LFKYSNVNFAGKIDNNNRFYMWNVQEVDDPKPFNAKVEELLSGLSTKASSNPKFYATGEL  152

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            ++  S  +YGLTQCTRDLS  DCKKCL  AI+ELP CC  AK GGRV+ GSCNFRYE YP
Sbjct  153  ELSSSETLYGLTQCTRDLSSSDCKKCLDGAISELPNCC-DAKRGGRVVGGSCNFRYELYP  211

Query  767  F  769
             
Sbjct  212  I  212



>ref|XP_010532487.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Tarenaya 
hassleriana]
Length=251

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 155/246 (63%), Gaps = 8/246 (3%)
 Frame = +2

Query  53   SKPFSLLPLLSIAFIL-ALHTPMAAAQLRHFCANF-ATSPPDSRFQKnlntllgnlssnt  226
            SK   LL  +++  ++ ++ +    A L H C++   T    S ++ NLN LLG+LS   
Sbjct  3    SKNLVLLHCMAVLLLVRSVSSSQDNAFLFHVCSDIEGTFTTKSPYETNLNMLLGSLSYKA  62

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P  G+  G+AG+  DKV GLALCRGDVS  DC+SC+  AT ++R+ CP N GG +WYD C
Sbjct  63   PPTGFGLGSAGQSPDKVNGLALCRGDVSPADCRSCITAATPELRKRCPNNKGGAIWYDFC  122

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            L+K+S  +FFG+ID  NKFY+ N     DP SF  +TK LL+RL+ +AA +K  YAAG +
Sbjct  123  LVKHSTINFFGKIDYDNKFYLYNVNNVTDPTSFNAQTKNLLSRLSKEAAAVKKLYAAGED  182

Query  587  DI-----GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
            ++      G   +YGL QCTRDL+ E C  CL   I ELP CC   K GGRV+  SCNFR
Sbjct  183  NLYGGAGSGKKKLYGLVQCTRDLTSEACTACLDGIIGELPNCC-DGKEGGRVVGTSCNFR  241

Query  752  YETYPF  769
            YE YPF
Sbjct  242  YEIYPF  247



>emb|CAN73040.1| hypothetical protein VITISV_044350 [Vitis vinifera]
Length=190

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 125/183 (68%), Gaps = 2/183 (1%)
 Frame = +2

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P  G+   + G   D+  GLALCR DVS TDCK+CV +A+T+I + CP     I+WYDNC
Sbjct  9    PPTGFGKASVGLNADRSNGLALCRPDVSNTDCKACVTEASTEILKRCPDYKAAIIWYDNC  68

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LLKYS  DFFG++D   KFY  N +   +P SF QKT++LL+RLA++A +  + YA G  
Sbjct  69   LLKYSNMDFFGQVDH-QKFYSFNEKNVSNPASFNQKTRELLSRLAEEAFVAPNMYATGEV  127

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            D+  S  +YGL QCTRDLS  DCK+CL DA++E+P CC   K GGRV  GSCN RYETYP
Sbjct  128  DLEDSKKLYGLVQCTRDLSTIDCKQCLDDAVSEVPNCCD-GKEGGRVATGSCNIRYETYP  186

Query  767  FYK  775
            F K
Sbjct  187  FXK  189



>ref|XP_003597035.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES67286.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=246

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 150/247 (61%), Gaps = 5/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M  SK F+++ L S  F+  + T +    L H C+        S ++ NL TL+ +L   
Sbjct  1    MGSSKLFTII-LFSFTFVFLIQTTLGTDPLFHICSTSENFTAHSPYESNLKTLINSLIYK  59

Query  224  tPRNGYSSGTAGKC---TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
            TP  G+ SG+         K YGLALCRGDVST++CK+CV+ AT +I  +CP   G I+W
Sbjct  60   TPSTGFGSGSIDLTQYQNQKAYGLALCRGDVSTSECKTCVSQATKEILNVCPYKKGAIIW  119

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            YDNC+ KY ++DFFG+ID+ NKF + N +   DP  F   T  LL+ LA++A++    YA
Sbjct  120  YDNCMFKYLDNDFFGKIDNTNKFALLNVQNVSDPIKFNNMTNDLLSFLANEASMNHKLYA  179

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
             G   IG S  +YGLTQCTRD+S  DCKKCL  AI+ELP CC   K G  V  GSCN RY
Sbjct  180  TGELKIGESERVYGLTQCTRDISSVDCKKCLDGAISELPNCCDGKKGGRVV-GGSCNIRY  238

Query  755  ETYPFYK  775
            E YPF +
Sbjct  239  EIYPFVR  245



>ref|XP_003633310.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Vitis vinifera]
 emb|CBI28970.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 138/215 (64%), Gaps = 2/215 (1%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVS  310
            L HFC        +  ++ NLN L+ +L    P  G+   + G   D+  GLALCR DVS
Sbjct  28   LFHFCTGSEKFIDNGPYETNLNKLMDSLQILAPPTGFGKASVGLNADRSNGLALCRPDVS  87

Query  311  TTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK  490
             TDCK+CV +A+T+I + CP     I+WYDNCLLKYS  DFFG++D   KFY  N +   
Sbjct  88   NTDCKACVTEASTEILKRCPDYKAAIIWYDNCLLKYSNMDFFGQVDH-QKFYSFNEKNVS  146

Query  491  DPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLY  670
            +P SF QKT++LL+RL ++A +  + YA G  D+  S  +YGL QCTRDLS  DCK+CL 
Sbjct  147  NPASFNQKTRELLSRLVEEAFVAPNMYATGEVDLEESKKLYGLVQCTRDLSTIDCKQCLD  206

Query  671  DAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            DA++E+P CC   K GGRV  GSCN RYETYPF K
Sbjct  207  DAVSEVPNCCD-GKEGGRVATGSCNIRYETYPFVK  240



>ref|XP_002533571.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF28806.1| DUF26 domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=243

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 146/239 (61%), Gaps = 4/239 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            FS + L  ++ +L + +      L H C+       +  + K+LN L+GN +      G+
Sbjct  3    FSRISLYLLSTVLLVQSVYGIEPLFHSCSTNENFTANGHYDKSLNKLIGNFNYLAAAKGF  62

Query  242  SSGTAG-KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            + G+ G    D  YGL LCRGD++ +DC +CVA+A+T+IR  CP     I+WYDNCLLKY
Sbjct  63   ALGSLGMNRQDLPYGLTLCRGDITASDCITCVAEASTEIRRRCPYKKEAIIWYDNCLLKY  122

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG-  595
            S  DFFG+ID+ NK Y+ N     DP +F QKTK+LLT+LA  A++    YAAG  + G 
Sbjct  123  SNKDFFGQIDNKNKVYLLNLRNVSDPVTFNQKTKELLTQLAVDASVTPRMYAAGDLEFGD  182

Query  596  -GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             G   IYG+ QCTRDLS  DCK CL  AI ELP CC   K GGRV+ GSC  RYE YPF
Sbjct  183  QGLKKIYGMAQCTRDLSSADCKSCLDRAIGELPSCC-DGKEGGRVVGGSCTVRYEIYPF  240



>emb|CDY68211.1| BnaCnng58060D [Brassica napus]
 emb|CDY52060.1| BnaCnng21700D [Brassica napus]
Length=255

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 155/248 (63%), Gaps = 16/248 (6%)
 Frame = +2

Query  71   LPLLSIAF-ILALHTPMAAAQ----LRHFCA----NFATSPPDSRFQKnlntllgnlssn  223
            LPLL++A  +L++H+ ++ +Q    L H C+    NF +  P   ++ NLN+L   LS +
Sbjct  13   LPLLALAIQLLSIHSVLSQSQDNAFLYHKCSDIEGNFTSRSP---YESNLNSLFPRLSYS  69

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P NG+++ + G   D V GL LCRGD S +DC++C+A A  ++R+ CP N  GI+WYDN
Sbjct  70   VPSNGFAALSTGNKPDNVNGLGLCRGDASPSDCRTCLATAIPELRKRCPNNKAGIIWYDN  129

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAA  577
            CL+KYS  +FFG+ID  N+FY+ N     +P SF  +TK LLT L  KA    +   +A 
Sbjct  130  CLVKYSSTNFFGKIDYENRFYLYNVNNVSNPASFNTQTKALLTELTKKATAGGNQKLFAT  189

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
            G + + G   +YGL QCTRDL  + CK CL   I ELP CC   K GGRV+ GSCNFRYE
Sbjct  190  GEKSL-GEKKLYGLVQCTRDLRSDSCKACLDGIIGELPNCC-DGKEGGRVVGGSCNFRYE  247

Query  758  TYPFYKGA  781
             YPF K A
Sbjct  248  IYPFVKTA  255



>ref|XP_010684085.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=243

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/247 (47%), Positives = 156/247 (63%), Gaps = 12/247 (5%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFC----ANFATSPPDSRFQKnlntllgn  211
            M+  K    + LLS  F   L T  A   L HFC     NF  + P   +  NLNTLL  
Sbjct  1    MSSIKITPFIFLLSFTF---LQTTFAVNPLYHFCLSTSGNFTLNTP---YDTNLNTLLTL  54

Query  212  lssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIV  391
            L   T  +G+S  + G+   +VYGLALCRGDV++TDC +CV DA T+IR+ CP N GGI+
Sbjct  55   LQRKTSPSGFSLASTGQNPSQVYGLALCRGDVNSTDCTTCVYDARTEIRKRCPYNKGGII  114

Query  392  WYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKD-PKSFMQKTKQLLTRLADKAALLKSS  568
            WYDNC LKY + +FFG+ID+ N+F ++N     + P  F QK K LL++LA+++A  +  
Sbjct  115  WYDNCFLKYIDQNFFGQIDNKNEFQLSNVANISNAPSLFNQKVKGLLSQLANESASARKL  174

Query  569  YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNF  748
            YAAG   +   + +YGL QCTRDLS ++CK CL +AI +LP CC  ++ GGR + GSCN 
Sbjct  175  YAAGEMKLDTFTNLYGLAQCTRDLSSKNCKICLDEAINKLPTCCDGSQ-GGRTVGGSCNV  233

Query  749  RYETYPF  769
            RYE YPF
Sbjct  234  RYEIYPF  240



>gb|KFK39506.1| hypothetical protein AALP_AA3G252600 [Arabis alpina]
Length=255

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 123/187 (66%), Gaps = 4/187 (2%)
 Frame = +2

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P  G++S ++G   DKV GLALCRGD S++DC SC+A A  +I   CP N  GI+WYDNC
Sbjct  71   PSTGFASSSSGNTPDKVNGLALCRGDASSSDCGSCLAIAIPEISRRCPDNKAGIIWYDNC  130

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADK--AALLKSSYAAG  580
            L+KY+  +FFG+ID  N+FY+ N     DP SF  +TK LLT LA K  A +    +AAG
Sbjct  131  LVKYASTNFFGKIDFENRFYLYNVNNVSDPASFNMQTKTLLTELAKKVTAGINNKLFAAG  190

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
             ++I G  ++YGL QCTRDL  E CK CL   I E+P CC   K GGRV+ GSCNFRYE 
Sbjct  191  EKNI-GKQMLYGLVQCTRDLRSESCKACLDGIIGEIPNCC-DGKEGGRVVGGSCNFRYEI  248

Query  761  YPFYKGA  781
            YPF   A
Sbjct  249  YPFVTDA  255



>ref|XP_007010459.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
 gb|EOY19269.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
Length=222

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 142/247 (57%), Gaps = 29/247 (12%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCAN---FATSPPDSRFQKnlntllgnl  214
            M+ S+  SLL LL+ AF+L          + HFC+N   F+   P               
Sbjct  1    MSSSRFASLLYLLTFAFLLP--AAFGVNPIFHFCSNAGNFSAYDP---------------  43

Query  215  ssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
                    Y           +   +  RGDVST DC++CV +A  +IR+LCP   G I+W
Sbjct  44   --------YEGNLKQAHLLPLISSSSLRGDVSTPDCQTCVVEAGNEIRKLCPSTKGAIIW  95

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            YDNCLLKYS+ +FFG+ID+ N FY+ NG    DP+SF QKTK+LL++LA++A      YA
Sbjct  96   YDNCLLKYSDTEFFGQIDNKNMFYLWNGRVVSDPQSFNQKTKELLSQLANEAYATPKLYA  155

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
                ++ GS  +YGLTQCTRDLS  DCKKCL   I +LP CC   + GGRV+ GSCNFRY
Sbjct  156  TRETELYGSPKLYGLTQCTRDLSSSDCKKCLDGIIGKLPSCC-DGQEGGRVVGGSCNFRY  214

Query  755  ETYPFYK  775
            E YPF K
Sbjct  215  EIYPFVK  221



>ref|XP_006387992.1| hypothetical protein POPTR_0421s00210g [Populus trichocarpa]
 gb|ERP46906.1| hypothetical protein POPTR_0421s00210g [Populus trichocarpa]
Length=245

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 123/183 (67%), Gaps = 2/183 (1%)
 Frame = +2

Query  230  RNGYSSGTAG-KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            + G++ G+ G K  D+ YGL LCRGDVS+ DC +CVADAT +IR+ CP    G + YDNC
Sbjct  63   KEGFALGSLGQKNLDRPYGLVLCRGDVSSPDCSACVADATREIRKRCPYGKSGFIAYDNC  122

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LLKYS  DFFG+ID  NK Y+ N     +P  F QKTK LLT+LA+KA + +  YAAG  
Sbjct  123  LLKYSNKDFFGQIDSQNKIYLYNVRNVSNPVVFNQKTKDLLTQLANKAYIARKMYAAGEL  182

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             +GGS  +YG+ QCTRDLS  DCKKCL  AI+EL    G  K GGRV  GSC  RYE YP
Sbjct  183  GLGGSKKLYGMAQCTRDLSSADCKKCLDGAISELQGFAG-GKEGGRVTGGSCTVRYEIYP  241

Query  767  FYK  775
            F K
Sbjct  242  FVK  244



>emb|CAN73036.1| hypothetical protein VITISV_044346 [Vitis vinifera]
Length=229

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 136/221 (62%), Gaps = 15/221 (7%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
             T +    L HFC++      +  ++ NLN L+G L    P  G+  G+ G         
Sbjct  20   QTVVGVDPLFHFCSSSEKFIDNGPYETNLNKLMGYLYLAAPPTGFGKGSVG---------  70

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
                 DVS TDCK C+ +A+T+IR+LCP N   IVWYD+CLLKYS  +FFG++D  N+FY
Sbjct  71   -----DVSNTDCKDCITEASTEIRKLCPDNKAAIVWYDHCLLKYSNMNFFGQVDYQNRFY  125

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            M N     DP SF QKTK+LL+ LA +  + +  YA G  ++  S  +YGLTQCTRDLS 
Sbjct  126  MWNLNNVSDPTSFNQKTKELLSHLAQQXFVNQKMYAVGELELEESKKLYGLTQCTRDLSS  185

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DCKKCL DAI+ELP CC   K GGRV+ GSCN RYE YPF
Sbjct  186  SDCKKCLDDAISELPSCC-DGKEGGRVVGGSCNIRYEIYPF  225



>ref|XP_010247024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=238

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 143/221 (65%), Gaps = 1/221 (0%)
 Frame = +2

Query  107  HTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
            H   +A  L HFC+  A    +  ++KNLN L   LSS  P  G+   + G+  D+V GL
Sbjct  16   HCVASADPLFHFCSGSANYTSNGTYEKNLNQLTDYLSSKVPPTGFGFDSVGEAPDRVNGL  75

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            ALCRGDVST DCKSCV  A ++IR+ CP +   I+WYDNCLLKYS  DF G+ID   +FY
Sbjct  76   ALCRGDVSTEDCKSCVIGANSEIRQRCPNDKEAIIWYDNCLLKYSNLDFSGKIDYKYRFY  135

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            M N +   DP SF QKT++LL+RLA++A      +A G + +  +  +YGL QCTRDL  
Sbjct  136  MWNTQNVSDPASFNQKTEELLSRLAEQAYRGAMLFATGEQQLDEAVTLYGLVQCTRDLPS  195

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
              CK+CL DAI+ELP CC   +  GRV+ GSCNFRYE YPF
Sbjct  196  AGCKRCLDDAISELPSCCDGKRG-GRVVGGSCNFRYELYPF  235



>gb|KGN43546.1| hypothetical protein Csa_7G044860 [Cucumis sativus]
Length=250

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 144/225 (64%), Gaps = 4/225 (2%)
 Frame = +2

Query  110  TPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYS-SGTAGK-CTDKVYG  283
            T + A+ L H C++      +S +  NL   +  L+++ P +G+  S T GK   ++V G
Sbjct  24   TTVNASYLYHTCSSSDNYTMNSLYASNLKQAVDRLTNSAPPSGFGLSSTGGKDSQNQVNG  83

Query  284  LALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVN-K  460
            LALCRGD+S  DCK+CV  A   I++ CP   G  +WYD+CLLKYS   FFG+  +   +
Sbjct  84   LALCRGDISPNDCKTCVTSAGQDIQQRCPYKKGAAIWYDSCLLKYSNAKFFGKNQNGGFR  143

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDL  640
            FY+ N  EA DP SF ++ K LL  L++ A   ++ YA G  +IG S  +YGL QCTRDL
Sbjct  144  FYLVNVREADDPTSFKEQVKNLLNGLSETAKTSRNLYAIGDLEIGSSRKLYGLVQCTRDL  203

Query  641  SGEDCKKCLYDAIAELPQCCGT-AKVGGRVIQGSCNFRYETYPFY  772
               DCKKCL DAIAELP CC   AKVGGRV+ GSCNFRYETYPF+
Sbjct  204  WTADCKKCLDDAIAELPYCCANGAKVGGRVVGGSCNFRYETYPFF  248



>ref|XP_011003221.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 124/183 (68%), Gaps = 2/183 (1%)
 Frame = +2

Query  230  RNGYSSGTAG-KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            + G++ G+ G +  D+ YGL LCRGDVS++DC +CVADAT +IR+ CP    G + YDNC
Sbjct  63   KEGFALGSLGQRNLDRPYGLVLCRGDVSSSDCSACVADATREIRKRCPYGKSGFIAYDNC  122

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LLKYS  DFFG+ID  NK Y+ N     +P  F QKTK LL++LA+KA + +  YAAG  
Sbjct  123  LLKYSNKDFFGQIDSRNKIYLYNVRNVSNPVVFNQKTKDLLSQLANKAYIARKMYAAGEL  182

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             +GGS  +YG+ QCTRDLS  DCKKCL  AI+EL    G  K GGRV  GSC  RYE YP
Sbjct  183  GLGGSKKLYGMAQCTRDLSSVDCKKCLNSAISELQGFSG-GKEGGRVTGGSCTVRYEIYP  241

Query  767  FYK  775
            F K
Sbjct  242  FVK  244



>ref|XP_004144580.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=208

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 125/186 (67%), Gaps = 4/186 (2%)
 Frame = +2

Query  227  PRNGYS-SGTAGK-CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
            P +G+  S T GK   ++V GLALCRGD+S  DCK+CV  A   I++ CP   G  +WYD
Sbjct  21   PPSGFGLSSTGGKDSQNQVNGLALCRGDISPNDCKTCVTSAGQDIQQRCPYKKGAAIWYD  80

Query  401  NCLLKYSEDDFFGEIDDVN-KFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAA  577
            +CLLKYS   FFG+  +   +FY+ N  EA DP SF ++ K LL  L++ A   ++ YA 
Sbjct  81   SCLLKYSNAKFFGKNQNGGFRFYLVNVREADDPTSFKEQVKNLLNGLSETAKTSRNLYAI  140

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGT-AKVGGRVIQGSCNFRY  754
            G  +IG S  +YGL QCTRDL   DCKKCL DAIAELP CC   AKVGGRV+ GSCNFRY
Sbjct  141  GDLEIGSSRKLYGLVQCTRDLWTADCKKCLDDAIAELPYCCANGAKVGGRVVGGSCNFRY  200

Query  755  ETYPFY  772
            ETYPF+
Sbjct  201  ETYPFF  206



>ref|XP_006372981.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
 gb|ERP50778.1| hypothetical protein POPTR_0017s06750g [Populus trichocarpa]
Length=236

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 143/215 (67%), Gaps = 4/215 (2%)
 Frame = +2

Query  140  FCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCT-DKVYGLALCRGDVSTT  316
             C++ A S  +S ++ ++N L+G+L    P  G++ G+ G+   D+ YGL LCRGDVS++
Sbjct  22   MCSSNANSTANSSYKTSMNVLMGSLYHLAPVEGFALGSLGQNNQDRPYGLVLCRGDVSSS  81

Query  317  DCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDP  496
            DC++C ADAT +IR+ CP +   I+ YDNCLLKYS+ DFFG+IDD NKFYM N     +P
Sbjct  82   DCRTCAADATREIRKRCPYSKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNP  141

Query  497  KSFMQKTKQLLTRLADKAALLKSS-YAAGVED-IGGSSVIYGLTQCTRDLSGEDCKKCLY  670
              F +KT +LL++LADKA+   S  YAAG  D + GS  +YG+ QCTRDLS  DCKKCL 
Sbjct  142  VLFNEKTSELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMAQCTRDLSSVDCKKCLD  201

Query  671  DAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
             AI ELP      K G RV+ GSC   YE YPF K
Sbjct  202  GAIGELPG-VAYGKQGARVVGGSCMVIYEIYPFVK  235



>ref|XP_004168058.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=208

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 125/186 (67%), Gaps = 4/186 (2%)
 Frame = +2

Query  227  PRNGYS-SGTAGK-CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
            P +G+  S T GK   ++V GLALCRGD+S  DCK+CV  A   I++ CP   G  +WYD
Sbjct  21   PPSGFGLSSTGGKDSQNQVNGLALCRGDISPNDCKTCVTSAGQDIQQRCPYKKGAAIWYD  80

Query  401  NCLLKYSEDDFFGEIDDVN-KFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAA  577
            +CLLKYS   FFG+  +   +FY+ N  EA DP SF ++ K LL  L++ A   ++ YA 
Sbjct  81   SCLLKYSNAKFFGKNQNGGFRFYLVNVREADDPTSFKEQVKNLLNGLSETAKTSRNLYAI  140

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGT-AKVGGRVIQGSCNFRY  754
            G  +IG S  +YGL QCTRDL   DCKKCL DAIAELP CC   AKVGGRV+ GSCNFRY
Sbjct  141  GDLEIGSSRKLYGLVQCTRDLWTADCKKCLDDAIAELPYCCANGAKVGGRVVGGSCNFRY  200

Query  755  ETYPFY  772
            ETYPF+
Sbjct  201  ETYPFF  206



>ref|XP_006406217.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
 dbj|BAJ34612.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47670.1| hypothetical protein EUTSA_v10021371mg [Eutrema salsugineum]
Length=255

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = +2

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P +G+++ +AG   D V GLALCRGD S++DC SC+A A  ++R+ CP N  GI+WYDNC
Sbjct  71   PSSGFAASSAGNSPDNVNGLALCRGDASSSDCGSCLATAIPELRQRCPNNKAGIIWYDNC  130

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAG  580
            L+KYS  +FFG+ID  N+FY+ N     DP SF  +TK LLT L  KA    +   +A G
Sbjct  131  LVKYSSTNFFGKIDYENRFYLYNVNNVSDPASFNTQTKALLTELTQKATTGDNQKLFATG  190

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
             +++     +YGL QCTRDL  E CK CL   I ELP CC   K GGRV+ GSCNFRYE 
Sbjct  191  EKNLEKKK-LYGLVQCTRDLRRESCKACLDGIIGELPNCC-DGKEGGRVVGGSCNFRYEI  248

Query  761  YPFYKGA  781
            YPF K A
Sbjct  249  YPFVKIA  255



>ref|XP_006380320.1| hypothetical protein POPTR_0007s02740g [Populus trichocarpa]
 gb|ERP58117.1| hypothetical protein POPTR_0007s02740g [Populus trichocarpa]
Length=245

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 123/183 (67%), Gaps = 2/183 (1%)
 Frame = +2

Query  230  RNGYSSGTAG-KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            + G++ G+ G K  D+ YGL LCRGDVS++DC +CVADAT +IR+ CP    G + YDNC
Sbjct  63   KEGFALGSLGQKNLDRPYGLVLCRGDVSSSDCSACVADATREIRKRCPYGKSGFIAYDNC  122

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LLKYS  DFFG+ID  NK Y+ N     +P  F QKTK LL++LA+KA + +  YA G  
Sbjct  123  LLKYSNKDFFGQIDSQNKIYLYNVRNVSNPVVFNQKTKDLLSQLANKAYIARKMYATGEL  182

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             +GGS  +YG+ QCTRDLS  +CKKCL  AI+EL    G  K GGRV  GSC  RYE YP
Sbjct  183  GLGGSKKLYGMAQCTRDLSSANCKKCLDGAISELQGFAG-GKEGGRVTGGSCTVRYEIYP  241

Query  767  FYK  775
            F K
Sbjct  242  FVK  244



>ref|XP_008455543.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=277

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 122/182 (67%), Gaps = 2/182 (1%)
 Frame = +2

Query  227  PRNGYSSGTAGK-CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            P +G+   + G     +V  LALCRGDVS TDCK+C+  A+ +I++ CP   GG +WYD 
Sbjct  92   PPSGFGLTSVGNDLQSQVNALALCRGDVSPTDCKTCIETASNEIQQRCPDKKGGSIWYDF  151

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS   FFG+ID+  + YM N +EA++P  F ++ K LLT L ++  +    Y  G 
Sbjct  152  CLLKYSNIKFFGKIDNGFRLYMWNVQEAENPTLFNEQVKNLLTSLVEQVEVTPKLYVIGE  211

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
            ++I GS  +YGL QCTRDLS   CKKCL DA+AELP CC  AK+GGRVI GSCNFRYE Y
Sbjct  212  KEIEGSKKLYGLVQCTRDLSTAACKKCLNDAVAELPNCCD-AKIGGRVIGGSCNFRYEIY  270

Query  764  PF  769
            P 
Sbjct  271  PI  272



>ref|XP_008237024.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 150/238 (63%), Gaps = 3/238 (1%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            F  +PL  +   +  H+ + A+ L+HFC +      DS +  NLN L   L +  P +G+
Sbjct  4    FKSIPLCFLVLCVFHHSAIGASPLKHFCFSPENYTADSSYGANLNLLFNLLYTKVPPSGF  63

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
              G+ G   ++V GLALCRGDV + +C +CV  A+ ++RE CP + G I+WYD+CLLKYS
Sbjct  64   GLGSTGHAQNQVNGLALCRGDVLSQNCSTCVIGASKELRERCPYSKGAIIWYDHCLLKYS  123

Query  422  EDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIG  595
            + +FFG+ID+ NKF M N +  + +P  F +K K+LL+ L+++A+      YA G   + 
Sbjct  124  DVNFFGKIDNKNKFSMTNVQAVENNPTLFNEKVKELLSGLSNEASDANQKFYATGEVQLD  183

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
              + +YG+ QCTRDLS  +CKKCL  AI+ELP CC  AK GGRV+ GSCN  +E YP 
Sbjct  184  TFTTLYGIAQCTRDLSNVNCKKCLNVAISELPNCC-DAKRGGRVVGGSCNVGFELYPI  240



>ref|XP_010069666.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Eucalyptus 
grandis]
 gb|KCW89431.1| hypothetical protein EUGRSUZ_A01730 [Eucalyptus grandis]
Length=239

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 137/222 (62%), Gaps = 8/222 (4%)
 Frame = +2

Query  116  MAAAQLRHFC--ANF-ATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
            +    L HFC   NF A SP +S   K  + L        P +G++  + G+   +VYG+
Sbjct  21   LGEGPLFHFCTSGNFTANSPYESNLNKLTSFLHTKT----PPSGFALDSIGRHQHRVYGI  76

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            ALCRGDVS + CK+CVADA  +I+ LCP+N G I+WYD+C+ KY++ +FF +ID  N FY
Sbjct  77   ALCRGDVSPSVCKACVADAGAEIQRLCPRNKGAIMWYDDCMFKYNDTNFFRQIDKANNFY  136

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            + NG +  DP  F  +  ++LTRLA KA  +   YAAG + + G + +YGL QCTRDLS 
Sbjct  137  LYNGNKVSDPALFNLRVTEMLTRLAKKAYSIPKLYAAGKKRVDGKTTLYGLVQCTRDLSA  196

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             +CK CL   I  +P    + + GGR+   SCNFRYETY F+
Sbjct  197  AECKACLEGEIGAIP-IKFSGQEGGRLGGASCNFRYETYRFF  237



>ref|XP_006372983.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
 gb|ERP50780.1| hypothetical protein POPTR_0017s06770g [Populus trichocarpa]
Length=245

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 144/218 (66%), Gaps = 6/218 (3%)
 Frame = +2

Query  137  HF--CANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCT-DKVYGLALCRGDV  307
            HF  C++ A S  +S ++ +LN L+G+L    P  G++ G+ G+   D+ YGL LCRGDV
Sbjct  28   HFSRCSSNANSTANSFYKTSLNVLMGSLYHLAPVEGFALGSLGQNNQDRPYGLVLCRGDV  87

Query  308  STTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEA  487
            S++DC++C A+AT +IR+ CP     I+ YDNCLLKYS+ DFFG+IDD NKFYM N    
Sbjct  88   SSSDCRTCAANATREIRKRCPNGKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNV  147

Query  488  KDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVED-IGGSSVIYGLTQCTRDLSGEDCKK  661
             +P  F +KT +LL++LADKA+   S  YAAG  D + GS  +YG+ QCTRDLS  DCKK
Sbjct  148  SNPVLFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMAQCTRDLSSVDCKK  207

Query  662  CLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            CL  AI ELP      K G RV+ GSC   YE YPF K
Sbjct  208  CLDGAIGELPG-VAYGKQGARVVGGSCMVIYEIYPFVK  244



>ref|XP_008237025.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 151/237 (64%), Gaps = 3/237 (1%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            F  +PL  +    + H+ + A+ L HFC +      +S +  NLN L   L +  P +G+
Sbjct  4    FKSIPLCFLVLCFSHHSAIGASPLYHFCFSQENYTANSSYGANLNLLFNLLYTKVPPSGF  63

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
              G+ G   ++V GLALCRGDVS+ +C +CV  A+ ++RE CP + G ++WYD+CLLKYS
Sbjct  64   GLGSTGDAQNQVNGLALCRGDVSSKNCNTCVIGASKELRERCPYSKGAVIWYDHCLLKYS  123

Query  422  EDDFFGEIDDVNKFYMANGEEAKDPKS-FMQKTKQLLTRLADKAALLKSS-YAAGVEDIG  595
            + +FFG+ID+ NKF MAN +  ++  + F +K K+LL+ L+++A+      YA G   + 
Sbjct  124  DVNFFGQIDNRNKFSMANVQAVENNTTLFNEKVKELLSGLSNEASDANPKFYATGEVQLD  183

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
              + +YG+ QCTRDLS  +CKKCL  AI+ELP CC  AK GGRV+ GSCN  +E YP
Sbjct  184  TFTTLYGIAQCTRDLSNVNCKKCLDVAISELPNCC-DAKRGGRVVGGSCNVGFELYP  239



>ref|XP_002883339.1| hypothetical protein ARALYDRAFT_479720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59598.1| hypothetical protein ARALYDRAFT_479720 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 156/254 (61%), Gaps = 10/254 (4%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAF-ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntll  205
            M+ SK     P+L +A  IL++HT ++ +Q    L H C++   S    S ++ NLN L 
Sbjct  1    MSSSKRIVWFPILIVAIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSPYESNLNNLF  60

Query  206  gnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGG  385
              LS   P  G+++ +AG   D V GLALCRGD S++DC SC+A A  +IR+ CP N  G
Sbjct  61   PQLSYKVPSTGFATSSAGITPDNVNGLALCRGDASSSDCSSCLATAIPEIRQRCPSNKAG  120

Query  386  IVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS  565
            I+WYDNCL+KYS  +FFG+ID  N+FY+ N     DP +F  +TK LLT+L  KA    +
Sbjct  121  IIWYDNCLVKYSSTNFFGKIDFENRFYLYNVNNVSDPSTFNTQTKALLTKLTKKATTGDN  180

Query  566  S--YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGS  739
               +A G ++IG    +YGL QCTRDL  E CK CL   I ELP CC   K GGRV+ GS
Sbjct  181  QKLFATGEKNIGMKK-LYGLVQCTRDLKSEACKACLNGIIGELPNCC-DGKEGGRVVGGS  238

Query  740  CNFRYETYPFYKGA  781
            CNFRYE YPF   A
Sbjct  239  CNFRYEIYPFVNAA  252



>emb|CAN73039.1| hypothetical protein VITISV_044349 [Vitis vinifera]
Length=231

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 140/226 (62%), Gaps = 2/226 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M +S+  + L LLS AF+L   T +    L HFC++      +  ++ NLN L+G L   
Sbjct  1    MYFSRXXTSLYLLSFAFLL--QTIVGTDPLFHFCSSSZKFIDNGXYETNLNKLMGYLYLA  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P  G+  G+ G+  DKV GLALCRGDVS TDCK+C+ +++ +IR+ CP N   I+WYD 
Sbjct  59   APPTGFGKGSVGEKNDKVNGLALCRGDVSNTDCKACITESSGEIRKRCPDNKAAIIWYDY  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLLKYS  +FFG++   N+FYM N     DP SF QKTK+LL+ LA KA +    YA G 
Sbjct  119  CLLKYSNVNFFGQVAYQNRFYMWNLNNVSDPASFNQKTKELLSNLAQKAFINSKMYATGE  178

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGG  721
             ++  S  +YGLTQCTRDLS  DCKKCL DAI+E        K GG
Sbjct  179  LELEESEKLYGLTQCTRDLSSSDCKKCLDDAISEFQTVVMAKKEGG  224



>ref|XP_006372982.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
 gb|ERP50779.1| hypothetical protein POPTR_0017s06760g [Populus trichocarpa]
Length=245

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 141/214 (66%), Gaps = 4/214 (2%)
 Frame = +2

Query  143  CANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCT-DKVYGLALCRGDVSTTD  319
            C++ A S  +S ++ +LN L+G+L    P  G++ G+ G+   D+ YGL LCRGDVS++D
Sbjct  32   CSSNANSTANSSYKTSLNVLMGSLYHLAPVEGFALGSLGQNNQDRPYGLVLCRGDVSSSD  91

Query  320  CKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPK  499
            C++C A+AT +IR+ CP     I+ YDNCLLKYS+ DFFG+IDD NKFYM N     +P 
Sbjct  92   CRTCAANATREIRKRCPNGKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNPV  151

Query  500  SFMQKTKQLLTRLADKAALLKSS-YAAGVED-IGGSSVIYGLTQCTRDLSGEDCKKCLYD  673
             F +KT +LL++LADKA+   S  YAAG  D + GS  +YG+  CTRDLS  DCKKCL  
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMAHCTRDLSSVDCKKCLDG  211

Query  674  AIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            AI ELP      K G RV+ GSC   YE YPF K
Sbjct  212  AIGELPG-VAYGKEGARVVGGSCMVIYEIYPFVK  244



>ref|XP_007149947.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
 gb|ESW21941.1| hypothetical protein PHAVU_005G112700g [Phaseolus vulgaris]
Length=249

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 130/213 (61%), Gaps = 1/213 (0%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVS  310
            L  FC N       S +  NLN L   L +    NG++  + G+  DKV GLALCRGDV+
Sbjct  35   LFRFCFNHENYTDSSPYATNLNQLFDLLHTKVSLNGFALDSIGQGMDKVNGLALCRGDVN  94

Query  311  TTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK  490
             T+C SCV DAT K++E CPK  G IVWYD CLLKYS + FFGE D+ NKFYM N  +  
Sbjct  95   ATNCMSCVDDATKKLQERCPKKKGAIVWYDYCLLKYSNEYFFGESDEKNKFYMVNIYDVD  154

Query  491  DPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLY  670
            DP +F  K  +LL+ L+  A+     YA G   +  +  +YGL QCTRDL G  CKKCL 
Sbjct  155  DPATFNAKVNELLSALSYNASQTPMLYAVGELQLEEAKTLYGLAQCTRDLFGPSCKKCLD  214

Query  671  DAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +AI+ELP  C   K GGRV+ GSC  RYE YP 
Sbjct  215  EAISELPDFC-DGKEGGRVVGGSCYVRYELYPI  246



>ref|XP_004144581.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43545.1| hypothetical protein Csa_7G044850 [Cucumis sativus]
Length=256

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 139/219 (63%), Gaps = 7/219 (3%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTD---KVYGLALCRG  301
            L H C++F     +S +  NLN  L  L SN+P +G+   +  K  D   +V GLALCRG
Sbjct  34   LFHICSSFDNYTSNSPYASNLNQALDQLISNSPPSGFGLSSVRKDDDLQNQVNGLALCRG  93

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            DVS+ DCK+CVA A+ +I+E CP   G  +WYD CLLKYS   FFG+ID+ NKFYM N +
Sbjct  94   DVSSADCKNCVATASQEIQERCPNRKGAAIWYDFCLLKYSNTKFFGKIDNRNKFYMWNLQ  153

Query  482  EAKD-PKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI--GGSSVIYGLTQCTRDLSGED  652
            E  D P+ F ++ K+LL  L++K    K+ Y  G  ++   G   +YGL QC+RDLS   
Sbjct  154  ERDDEPEVFNKQVKRLLISLSEKVEGTKNLYVIGEVEMRTKGMEKLYGLVQCSRDLSSNA  213

Query  653  CKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            CKKCL  AI ELP CC   K+GGRV+ GSCNFRYE YP 
Sbjct  214  CKKCLQIAIGELPNCCND-KIGGRVVGGSCNFRYELYPI  251



>ref|XP_011037144.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 143/214 (67%), Gaps = 4/214 (2%)
 Frame = +2

Query  143  CANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCT-DKVYGLALCRGDVSTTD  319
            C++ A S  +S ++ +LN L+G+L    P  G++ G+ G+   D+ YGL LCRGDVS++D
Sbjct  32   CSSNANSTANSSYKTSLNVLMGSLYHLAPVEGFALGSLGQNNQDRPYGLVLCRGDVSSSD  91

Query  320  CKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPK  499
            C++C A+AT +IR+ CP +   I+ YDNCLLKYS+ DFFG+ID+ NKFYM N     +P 
Sbjct  92   CRTCAANATREIRKRCPNSKRAIIAYDNCLLKYSDSDFFGQIDEQNKFYMWNVNNVSNPV  151

Query  500  SFMQKTKQLLTRLADKAALLKSS-YAAGVED-IGGSSVIYGLTQCTRDLSGEDCKKCLYD  673
             F +KT +LL++LADKA+   S  YAAG  D + GS  +YG+ +CTRDLS  DCKKCL  
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMAECTRDLSSVDCKKCLDG  211

Query  674  AIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            AI ELP+     K G RV+ GSC   YE YP  K
Sbjct  212  AIGELPR-VAYGKEGARVVGGSCMVIYEIYPIVK  244



>ref|XP_010496825.1| PREDICTED: cysteine-rich repeat secretory protein 38 [Camelina 
sativa]
Length=255

 Score =   189 bits (480),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 157/257 (61%), Gaps = 10/257 (4%)
 Frame = +2

Query  35   LATMAYSKPFSLLPLLSIAF-ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnln  196
            ++++  SK     P+L++A  IL++H+ ++ +Q    L H C++   S    S ++ NLN
Sbjct  1    MSSLFSSKRTVWFPILALAIQILSIHSVLSQSQTNAFLYHKCSDIEGSFTSKSLYESNLN  60

Query  197  tllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKN  376
             L   LS   P  G+++ ++G   + V GLALCRGD S++DC SC+A A  +IR+ CP N
Sbjct  61   NLFPQLSYIVPSTGFAASSSGNTQENVNGLALCRGDASSSDCSSCLATAIPEIRQRCPNN  120

Query  377  NGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL  556
              GI+WYDNCLLKYS   FFG+ID  N+FY+ N     DP SF  +T+ LLT L  KA  
Sbjct  121  KAGIIWYDNCLLKYSSTKFFGKIDYENRFYLYNVNNVSDPTSFNTQTRALLTELTKKATT  180

Query  557  --LKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVI  730
               +  +A G ++IG    +YGL QCTRDL  E CK CL   I ELP CC   K GGRV+
Sbjct  181  GGNQKLFATGEKNIGKKK-LYGLVQCTRDLRSESCKACLNGIIGELPNCC-DGKEGGRVV  238

Query  731  QGSCNFRYETYPFYKGA  781
             GSCNFRYE YPF   A
Sbjct  239  GGSCNFRYEIYPFVNTA  255



>gb|KDO59870.1| hypothetical protein CISIN_1g046481mg [Citrus sinensis]
Length=247

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 148/246 (60%), Gaps = 11/246 (4%)
 Frame = +2

Query  53   SKPFSLLPLLSIAFILALHTPMAAAQ---LRHFCANFATSPPDSRFQKnlntllgnlssn  223
            S  FSLL    I+F L L T    A    + + C+N      + R+Q NLN L+G +   
Sbjct  7    SSTFSLL----ISFALLLQTVTFGANVDPISYSCSN-ENFTANGRYQTNLNALMGYIYHQ  61

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P  G+  G+ GK   +  GLALCRGDVS +DCK+CVADA + IR+ CP +    ++YDN
Sbjct  62   APPTGFGIGSLGKNPIQANGLALCRGDVSASDCKTCVADAISTIRKNCPYSKSAKIFYDN  121

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            C+LKYS D FFG+ID+  K++M N      P  F QK+K LL +LAD+A+     YAAG 
Sbjct  122  CMLKYSNDKFFGQIDNGTKYFMWNVNNVGYPVIFNQKSKDLLRQLADEASGKPKLYAAGE  181

Query  584  EDI--GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
             ++  G    IYGL QCTRDLS  DCK  L   I++LP+CC   K GGRV+ GSC  RYE
Sbjct  182  LELNEGSKKKIYGLAQCTRDLSYNDCKMGLDRIISDLPRCC-DGKQGGRVVTGSCTIRYE  240

Query  758  TYPFYK  775
             YPF K
Sbjct  241  IYPFAK  246



>ref|XP_010510855.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Camelina 
sativa]
Length=255

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 155/257 (60%), Gaps = 10/257 (4%)
 Frame = +2

Query  35   LATMAYSKPFSLLPLLSIAF-ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnln  196
            ++++  SK     P+L++A  IL++H+ ++ +Q    L H C++   S    S +Q NLN
Sbjct  1    MSSLFSSKRTVWFPILALAIQILSIHSVLSQSQNNAFLYHKCSDIEGSFTSKSLYQSNLN  60

Query  197  tllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKN  376
             L   LS   P  G+++ ++G   D V GLALCRGD S++DC SC+A A  +IR+ CP N
Sbjct  61   NLFPQLSYIVPSTGFAASSSGNTLDNVNGLALCRGDASSSDCSSCLATAIPEIRQRCPNN  120

Query  377  NGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL  556
              GI+WYDNCLLKYS   FFG+ID  N+FY+ N     DP SF  +T+ LL  L   A  
Sbjct  121  KAGIIWYDNCLLKYSSTKFFGKIDYENRFYLYNVNNVSDPTSFNTQTRALLIELTKNATT  180

Query  557  LKSS--YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVI  730
              +   +A G ++IG    +YGL QCTRDL  E CK CL   I ELP CC   K GGRV+
Sbjct  181  RGNQKLFATGEKNIGKKK-LYGLVQCTRDLRSESCKACLNGIIGELPNCC-DGKEGGRVV  238

Query  731  QGSCNFRYETYPFYKGA  781
             GSCNFRYE YPF   A
Sbjct  239  GGSCNFRYEIYPFVNTA  255



>ref|XP_009145437.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Brassica 
rapa]
Length=274

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 145/237 (61%), Gaps = 15/237 (6%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCA----NFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            +L +H+ ++ +Q    L H C+    NF +  P   ++ NLN+L   LS + P +G+++ 
Sbjct  41   LLFIHSVLSQSQDNAFLYHKCSDIEGNFTSRSP---YESNLNSLFPRLSYSVPSSGFAAL  97

Query  251  TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDD  430
            + G   D V GL LCRGD S +DC++C+A A  ++R+ CP N  GI+WYDNCL+KYS  +
Sbjct  98   STGNKPDNVNGLGLCRGDASPSDCRTCLATAIPELRKRCPNNKAGIIWYDNCLVKYSSTN  157

Query  431  FFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVEDIGGSS  604
            FFG+ID  N+FY+ N     +P SF  +TK +LT L  KA     +  +A G + + G  
Sbjct  158  FFGKIDYENRFYLYNVNNVSNPASFNTQTKAILTDLTKKATAGGHQKLFATGEKSL-GEK  216

Query  605  VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
             +YGL QCTRDL  E CK CL   I ELP CC   K GGRV+ GSCN RYE YPF K
Sbjct  217  KLYGLVQCTRDLRSESCKACLDGIIGELPNCC-DGKEGGRVVGGSCNVRYEIYPFVK  272



>ref|XP_004144485.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 ref|XP_004159198.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43543.1| hypothetical protein Csa_7G044830 [Cucumis sativus]
Length=253

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 137/216 (63%), Gaps = 2/216 (1%)
 Frame = +2

Query  125  AQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGK-CTDKVYGLALCRG  301
            A L + C+++     ++ +  NL   L  L+S  P +G+   + G    ++V  LALCRG
Sbjct  34   AFLTYTCSSYDNYTANTPYANNLKQALYQLTSTAPPSGFGLTSVGDDLQNQVNALALCRG  93

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            DVS TDCK+C+  A+ +I++ C    GG +WYD C LKYS   FFG+ID+  + YM N +
Sbjct  94   DVSPTDCKTCIQVASNEIQQQCLNKKGGSIWYDFCFLKYSNIKFFGKIDNGFRLYMWNVQ  153

Query  482  EAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKK  661
            EA++P  F ++ K LLT L ++  +    Y  G ++  GS  +YGL QCTRDLS   CKK
Sbjct  154  EAENPTVFNEQVKNLLTSLVEQVEVTPKLYVIGEKENEGSKKLYGLVQCTRDLSTAACKK  213

Query  662  CLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            CL DA+AELP+CC  AK+GGRVI GSCNFRYE YP 
Sbjct  214  CLTDAVAELPRCCD-AKIGGRVIGGSCNFRYEIYPI  248



>ref|XP_008455405.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=258

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTD---KVYGLALCRG  301
            L H C++F     +S +  NLN  L  L SN P +G+   + GK  D   +V GLALCRG
Sbjct  34   LFHICSSFDNYTSNSPYASNLNQALDQLISNAPPSGFGLSSVGKDDDLQNQVNGLALCRG  93

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            DVS+ DCK+C+A A+ +I+E C    G  +WYD CLLKYS   FFG+ID+ NKFYM N +
Sbjct  94   DVSSADCKNCIAMASQEIQERCTNRKGAAIWYDFCLLKYSNTKFFGKIDNRNKFYMWNLQ  153

Query  482  EA-KDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI----GGSSVIYGLTQCTRDLSG  646
            E  +DP+ F ++ K+LL  L++K    K+ Y  G  ++     G   +YGL QC+RDLS 
Sbjct  154  ERDEDPEVFNKQVKRLLISLSEKVEGTKNLYVIGEVEMMIRTKGMEKLYGLVQCSRDLSS  213

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
              CK+CL  AI ELP CC   K+GGRV+ GSCNFRYE YP 
Sbjct  214  NACKQCLQIAIGELPNCCND-KIGGRVVGGSCNFRYELYPI  253



>gb|KDP32106.1| hypothetical protein JCGZ_12567 [Jatropha curcas]
Length=241

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 123/182 (68%), Gaps = 2/182 (1%)
 Frame = +2

Query  227  PRNGYSSGTAGKCT-DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            P  G++ G+ G+ + D+ YGL LCRGD+S +DC +C+A+A+ +IR  CP N    +WYDN
Sbjct  58   PAKGFALGSLGQTSQDRPYGLTLCRGDISASDCLTCIAEASNEIRTRCPNNKQATIWYDN  117

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CL+KYS  +FFG+ID+ NKFY+ N +   DP SF    K LL++LA+ A++    +AAG 
Sbjct  118  CLIKYSNINFFGQIDEQNKFYLLNVQNVSDPASFNANVKDLLSKLAENASVSPRMFAAGD  177

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +I GS  +YGL QC+RDLS  DC+KC+  AI+ELP CC   K G  V  GSC  RYE Y
Sbjct  178  MEIEGSKKVYGLAQCSRDLSSGDCQKCIDSAISELPSCCDGKKGGRVV-GGSCTVRYEIY  236

Query  764  PF  769
            PF
Sbjct  237  PF  238



>emb|CDY57408.1| BnaA05g36230D [Brassica napus]
Length=255

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 144/237 (61%), Gaps = 15/237 (6%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCA----NFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            +L +H+ ++ +Q    L H C+    NF +  P   ++ NLN+L   LS + P +G+++ 
Sbjct  22   LLFIHSVLSQSQDNAFLYHKCSDIEGNFTSRSP---YESNLNSLFPRLSYSVPSSGFAAL  78

Query  251  TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDD  430
            + G   D V GL LCRGD S +DC++C+A A  ++R+ CP N  GI+WYDNCL+KYS  +
Sbjct  79   STGNKPDNVNGLGLCRGDASPSDCRTCLATAIPELRKRCPNNKAGIIWYDNCLVKYSSTN  138

Query  431  FFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVEDIGGSS  604
            FFG+ID  N+FY+ N      P SF  +TK +LT L  KA     +  +A G + + G  
Sbjct  139  FFGKIDYENRFYLYNVNNVSSPASFNTQTKAILTDLTKKATAGGHQKLFATGEKSL-GEK  197

Query  605  VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
             +YGL QCTRDL  E CK CL   I ELP CC   K GGRV+ GSCN RYE YPF K
Sbjct  198  KLYGLVQCTRDLRSESCKACLDGIIGELPNCC-DGKEGGRVVGGSCNVRYEIYPFVK  253



>ref|XP_008236988.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=243

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 151/243 (62%), Gaps = 6/243 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M +SK    +PL  +       + + A+ L HFC +      +S +  NLN L   L S 
Sbjct  1    MIFSKS---IPLFLLVLCFFHRSAIGASPLYHFCFSPENYTANSSYGANLNLLFNLLYSK  57

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P +G+  G+ G   ++  GLALCRGDVS+ +C +CV  A+ ++RE CP + G ++WYD+
Sbjct  58   VPPSGFGLGSTGHAQNQANGLALCRGDVSSKNCNTCVIGASKELRERCPYSKGAVIWYDH  117

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKS-FMQKTKQLLTRLADKAALLKSS-YAA  577
            CLLKYS+ +FFG+ID+ NKF MAN +  ++  + F +K K+LL+ L+++A+      YA 
Sbjct  118  CLLKYSDVNFFGQIDNRNKFSMANVQAVENNTTLFNEKVKELLSGLSNEASDANPKFYAT  177

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
            G   +   + +YG+ QCTRDLS  +CKKCL  AI+ELP CC  AK GGR++ GSCN  +E
Sbjct  178  GEVQLDTFTTLYGIAQCTRDLSNVNCKKCLDVAISELPNCC-DAKRGGRIVGGSCNVGFE  236

Query  758  TYP  766
             YP
Sbjct  237  LYP  239



>ref|XP_006469774.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=246

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 145/237 (61%), Gaps = 11/237 (5%)
 Frame = +2

Query  86   IAFILALHTPMAAAQ---LRHFCAN--FATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            ++F+L L T    A    L H C+N  F  + P   +Q NLNTL+G L    P  G+  G
Sbjct  13   LSFVLLLQTVALGANVDPLFHSCSNENFTANGP---YQTNLNTLVGYLYHQAPTTGFGIG  69

Query  251  TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDD  430
            + G+   +  GLALCRGDVS +DCK CVADA + IR+ CP +    ++YDNC+ KYS D+
Sbjct  70   SLGQNPSQANGLALCRGDVSASDCKRCVADAVSTIRKSCPYSKSAKIFYDNCMFKYSNDN  129

Query  431  FFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSS--  604
            FFG+ID+  K++M N     +  +F QK+K+LL+RLA++A+     YAAG  ++   S  
Sbjct  130  FFGQIDNGTKYFMWNVNNVSNRVTFNQKSKELLSRLANEASGNPKLYAAGELELNEESKK  189

Query  605  VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
             IYGL QCTRDLS  DCK CL   I +LP CC   K GGRVI  SC   YE YPF K
Sbjct  190  KIYGLAQCTRDLSYNDCKMCLDRIIGDLPSCC-DGKQGGRVITASCIINYEIYPFVK  245



>ref|XP_011037143.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Populus 
euphratica]
Length=245

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 140/215 (65%), Gaps = 4/215 (2%)
 Frame = +2

Query  143  CANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCT-DKVYGLALCRGDVSTTD  319
            C++ A S   S +  +LN L+G+L    P  G++ G+ G+   D+ YGL LCRGDV ++D
Sbjct  32   CSSNANSTATSSYITSLNVLMGSLYRLAPVEGFALGSLGQNNQDRPYGLVLCRGDVPSSD  91

Query  320  CKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPK  499
            C++C A+AT +IR+ CP +   I+ YDNCLLKYS+ DFFG+IDD NKFYM N     +P 
Sbjct  92   CRTCAANATREIRKRCPNSKRAIIAYDNCLLKYSDSDFFGQIDDQNKFYMWNVNNVSNPV  151

Query  500  SFMQKTKQLLTRLADKAALLKSS-YAAGVED-IGGSSVIYGLTQCTRDLSGEDCKKCLYD  673
             F +KT +LL++LADKA+   S  YAAG  D + GS  +YG+ QC+RDLS  DCKKCL  
Sbjct  152  LFNEKTTELLSQLADKASYNSSKLYAAGEMDLLEGSMKLYGMAQCSRDLSSIDCKKCLDG  211

Query  674  AIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            AI ELP+     K   RV+ GSC   YE YPF K 
Sbjct  212  AIGELPR-VAYGKEEARVVGGSCMVIYEIYPFVKA  245



>gb|AFK48353.1| unknown [Medicago truncatula]
Length=241

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 130/211 (62%), Gaps = 3/211 (1%)
 Frame = +2

Query  77   LLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTA  256
            L S      + T   A  L HFC+N      +S ++ NL TL+ +L   TP  G+ +G++
Sbjct  5    LYSFTLAFLIQTSFGADPLFHFCSNSGNFTANSPYESNLKTLINSLIYKTPSTGFGNGSS  64

Query  257  GKCTDK---VYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSED  427
                ++    YGLALCRGDVS ++CK+CV++AT +I+  CP N GGI+WYD CL KYS+ 
Sbjct  65   SLVQNQNQQTYGLALCRGDVSPSECKTCVSEATKEIQSRCPYNKGGIIWYDYCLFKYSDT  124

Query  428  DFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSV  607
            DFFG+I   N+FYM N     DP +F  KTK LL++LA KA++    YA G   +  S  
Sbjct  125  DFFGKIAKTNRFYMWNLNNVSDPSTFNYKTKDLLSQLAQKASMNPKLYATGEVKLEESKK  184

Query  608  IYGLTQCTRDLSGEDCKKCLYDAIAELPQCC  700
            +YGLTQCTRDLS  DCK CL  AI EL  CC
Sbjct  185  LYGLTQCTRDLSSADCKNCLDAAINELRNCC  215



>emb|CAN73038.1| hypothetical protein VITISV_044348 [Vitis vinifera]
Length=243

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 137/221 (62%), Gaps = 7/221 (3%)
 Frame = +2

Query  116  MAAAQLRHFC---ANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGL  286
            + A  L HFC    N+  + P   F  NLN L   LSS  P  G+   + G+  D V GL
Sbjct  22   IGADPLFHFCFIPENYTANDP---FSSNLNELTTLLSSKVPPTGFGLASTGQGQDSVNGL  78

Query  287  ALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFY  466
            ALCRGDVS+ DCK+CV +AT ++   CP N G I+WYDNCL  YS   FFGEID+ NKFY
Sbjct  79   ALCRGDVSSRDCKTCVTEATKELHNRCPYNKGAIIWYDNCLFNYSNVKFFGEIDNKNKFY  138

Query  467  MANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSG  646
            + N + A DP SF  KTK+LL+ L++KA      +A G   +  S  +YGL QCTRDLS 
Sbjct  139  VYNVQSADDPTSFNVKTKELLSSLSNKAYGSPMLFATGELVLEESMKLYGLAQCTRDLSS  198

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DCKK L DA++ELP  C   +  GRV+ GSCN RYE YPF
Sbjct  199  LDCKKSLDDAVSELPSYCDGKRG-GRVVGGSCNVRYELYPF  238



>ref|XP_006850460.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
 gb|ERN12041.1| hypothetical protein AMTR_s00035p00082360 [Amborella trichopoda]
Length=244

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 142/243 (58%), Gaps = 13/243 (5%)
 Frame = +2

Query  68   LLPLLSIAFILALHTPMAAAQLRHFCA----NFATSPPDSRFQKnlntllgnlssntPRN  235
            LLP+L++   + L   ++A  L H C+    N+ T PP       L++LL  LS+ T   
Sbjct  7    LLPILALCLTMRLQGTISADPLSHICSPTSTNYTTHPP---LDHALSSLLRTLSAKTAIT  63

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G++  TA     K +GL LCR DV+  DCK C+ DAT +IR LCP     IVW+D CL+ 
Sbjct  64   GFA--TASSPDRKYHGLGLCRADVTRYDCKVCMEDATAEIRHLCPNKEEAIVWFDYCLVH  121

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAG---VE  586
            YS   FFG+ID+ NK YM N      P  F +   +L+ + + +A+L  S +A G   + 
Sbjct  122  YSNKSFFGKIDEKNKIYMWNTLNVSAPHLFNRYLGELMYQFSSQASLSLSFFATGEIQLS  181

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            ++G  + IYGL QC+ DLS  DCK CL + I ELP  C + K GGRV+ GSCN RYE YP
Sbjct  182  EVGDKTTIYGLAQCSYDLSSGDCKACLDEVIGELPTRC-SGKQGGRVLTGSCNIRYEVYP  240

Query  767  FYK  775
            FY+
Sbjct  241  FYR  243



>ref|XP_006592824.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine 
max]
 gb|KHN25767.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=171

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = +2

Query  269  DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEID  448
            D+V GLALCRGDV+ T+C +CV +AT K++E C K  G IVWYD CLLKYS + FFGEID
Sbjct  2    DQVNGLALCRGDVNATNCMACVNEATKKLQERCSKKKGAIVWYDYCLLKYSNEYFFGEID  61

Query  449  DVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQC  628
            + NKFYM N  +  DP +F  K  +LL+ L+  A+     YA G   +  S  +YGL QC
Sbjct  62   EKNKFYMVNIYDVDDPSTFSDKVNELLSGLSYNASQTPMLYAVGELQLQESKTLYGLAQC  121

Query  629  TRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            TRDL G  CKKCL DAI++LP CC   K G RV+ GSC  RYE YP 
Sbjct  122  TRDLLGPGCKKCLDDAISDLPNCC-DGKQGARVVGGSCYVRYELYPI  167



>ref|XP_010109547.1| hypothetical protein L484_018282 [Morus notabilis]
 gb|EXC23151.1| hypothetical protein L484_018282 [Morus notabilis]
Length=249

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 140/221 (63%), Gaps = 4/221 (2%)
 Frame = +2

Query  116  MAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALC  295
            +AA  L HFC N      +S F  NLN LL  LS   P  G+   T G+   +V GL LC
Sbjct  24   IAADPLYHFCFNKENYTANSPFGANLNELLSRLSVKVPPTGFGVSTTGQGDSQVNGLGLC  83

Query  296  RGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMAN  475
            RGDVST DCK+C  +A  +++  CP N G ++WYDNCLLKYS+ +FFG+ID  N+FYM N
Sbjct  84   RGDVSTEDCKTCTVEAGKELQSRCPYNKGAVIWYDNCLLKYSDKNFFGQIDSTNRFYMWN  143

Query  476  GEEA-KDPKSFMQKTKQLLTRLADKAALLKSSYAAG--VEDIGGSSVIYGLTQCTRDLSG  646
             ++  +DPKSF  K K+LL+ L++KA+     Y+ G  V   G    +YGL QCTRDL G
Sbjct  144  VKDVDQDPKSFDSKVKELLSSLSEKASATSKLYSTGELVLGTGPDPKLYGLAQCTRDLKG  203

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DCKKCL DAI+ELP    + K GGRV+ GSC  RYE YP 
Sbjct  204  IDCKKCLDDAISELPN-FSSGKRGGRVVGGSCYVRYELYPI  243



>ref|XP_008342466.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Malus 
domestica]
Length=243

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 145/235 (62%), Gaps = 3/235 (1%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            +PL  +   L  H+ + A+ L H C +      +S +  NLN L   L +  P  G++  
Sbjct  7    IPLCLLVLCLYHHSAIGASPLSHSCFSPENYTANSPYGANLNLLFNLLYTKVPPTGFALD  66

Query  251  TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDD  430
            + G   + V+G+ALCRGDVS  +C +CV DA  ++R+ C  + G ++WYD+CLLKYS+  
Sbjct  67   STGHGQNLVHGMALCRGDVSEKNCNTCVXDAGKELRQRCAYSKGAVIWYDHCLLKYSDVS  126

Query  431  FFGEIDDVNKFYMANGEEA-KDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGGSS  604
            FFG+ID   +F M+N  E  ++   F +K K+LL+ L+++A+      YA G   +   +
Sbjct  127  FFGQIDYATRFSMSNVREVDQNGTLFNEKVKELLSELSNEASDANPKLYATGELQLDTVT  186

Query  605  VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             +YG+ QCTRDLSG +CKKCL  AI+ELP CCG AK+GGRV+ GSCN  +E YP 
Sbjct  187  TLYGIAQCTRDLSGVNCKKCLDGAISELPNCCG-AKLGGRVVGGSCNVGFELYPI  240



>ref|XP_009787632.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Nicotiana sylvestris]
Length=164

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = +2

Query  293  CRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMA  472
            CRGDVS+T+CKSCV DA+ ++ +LCP +   I+WYDNCLLKYS +DF G+ID+  KFYM 
Sbjct  1    CRGDVSSTNCKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYMW  60

Query  473  NGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSV--IYGLTQCTRDLSG  646
            N      P+SF  KTK+LL  L +KA   ++ YA G  ++ G     +YGL QCTRDLS 
Sbjct  61   NVRVVSKPESFNAKTKELLGSLVEKAYKKQNLYANGEMELIGDQYEKLYGLVQCTRDLSS  120

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            EDCK+CL   I E+  CC   K GGRV+ GSCNFRYE YPF
Sbjct  121  EDCKQCLEGIITEISSCC-DGKEGGRVVGGSCNFRYEIYPF  160



>ref|XP_008228908.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Prunus 
mume]
Length=240

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 131/215 (61%), Gaps = 1/215 (0%)
 Frame = +2

Query  122  AAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRG  301
             A L HFC +       S +  NL  L   L    P  G+  G+ GK  ++  GLALCRG
Sbjct  23   GASLFHFCFSKENYTARSPYDANLIQLFNLLYKKVPPTGFGLGSTGKGQNQANGLALCRG  82

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            DVS+ DCK+CV +A+ ++ E CP   G I+W+DNCL KYS   F G++D  NKF + NG 
Sbjct  83   DVSSQDCKTCVVEASKELGERCPSGKGAIIWHDNCLFKYSNVKFAGKVDYKNKFSLWNGY  142

Query  482  EAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKK  661
            +  DP  F  K K+LL+ L+ KA+     YA G  ++  S  +YGLTQCTRDL   DCKK
Sbjct  143  KVDDPTPFNAKVKELLSGLSTKASSNPKFYATGELELSSSETLYGLTQCTRDLYSSDCKK  202

Query  662  CLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            CL DAI+ELP CC   +  GRV+ GSCNFRYE +P
Sbjct  203  CLDDAISELPNCCDGQRG-GRVVGGSCNFRYELFP  236



>ref|XP_004487372.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cicer 
arietinum]
Length=248

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 153/249 (61%), Gaps = 7/249 (3%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQ-LRHFCANFATSPPDSRFQKnlntllgnlss  220
            M+ S  F+++ L+S+   L   T  A    L H C+      P + ++ NL TL+ +L  
Sbjct  1    MSSSNFFTII-LISLTLALIPQTSFALNDPLFHICSTSKNFTPHTPYESNLKTLINSLIY  59

Query  221  ntPRNGYSSGTAGKC---TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIV  391
             TP  G+  G+ G+        YGLALCRGD++T +CK+CV++A+ +I  LCP N G I+
Sbjct  60   KTPSTGFGIGSVGQAQYQNQPAYGLALCRGDITTLECKTCVSNASKEILNLCPYNKGAII  119

Query  392  WYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS  568
            WYDNC+ KYS+ DFFG+ID+ NKF + N +    D   F   TK LL+ LA +A+L K  
Sbjct  120  WYDNCMFKYSDIDFFGKIDNTNKFSLLNVQNVSGDSMKFNNMTKDLLSLLAYEASLDKKL  179

Query  569  YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNF  748
            YA+G   IG    +YGL++CTRDL+  DCKKCL DAI+EL       K GGRV+ GSCN 
Sbjct  180  YASGELKIGELERVYGLSECTRDLTSVDCKKCLDDAISELSN-FSDGKKGGRVVGGSCNV  238

Query  749  RYETYPFYK  775
            +YE YPF +
Sbjct  239  QYEIYPFVR  247



>ref|XP_006298384.1| hypothetical protein CARUB_v10014454mg [Capsella rubella]
 gb|EOA31282.1| hypothetical protein CARUB_v10014454mg [Capsella rubella]
Length=254

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 152/257 (59%), Gaps = 11/257 (4%)
 Frame = +2

Query  35   LATMAYSKPFSLLPLLSIAF-ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnln  196
            +++++ SK    LP+L++A  +L++   +  +Q    L H C++   S    S ++ NLN
Sbjct  1    MSSLSSSKRMVWLPILALAIQLLSIQNVLCQSQSNAFLYHKCSDIEGSFTSKSTYESNLN  60

Query  197  tllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKN  376
             L   LS   P  G+++ + G   D V GLALCRGD S++DC SC+A A  +I + CP N
Sbjct  61   NLFSQLSYKVPSTGFATSSTGNTPDNVNGLALCRGDASSSDCSSCLATAIPEISKRCPNN  120

Query  377  NGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL  556
              GI+WYDNCL+KYS  +FFG ID  N+F + N     DP SF  +T+ LLT L   A  
Sbjct  121  KAGIIWYDNCLVKYSSTNFFGRIDYENRFALYNVNNVSDPTSFNTQTRDLLTELTKTATT  180

Query  557  LKSS--YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVI  730
              +   +A G ++IG    +YGL QCTRDL    CK CL   I ELP CC   K GGRV+
Sbjct  181  GGNQKLFATGEKNIGKK--LYGLVQCTRDLRSGSCKACLDGIIGELPNCC-DGKEGGRVV  237

Query  731  QGSCNFRYETYPFYKGA  781
             GSCNFRYE YPF K A
Sbjct  238  GGSCNFRYEIYPFVKTA  254



>ref|XP_004144484.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
 gb|KGN43544.1| hypothetical protein Csa_7G044840 [Cucumis sativus]
Length=255

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 140/240 (58%), Gaps = 8/240 (3%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            L LL  + + +      +A L H C +F     +S +  NLN     L+SN P +G++  
Sbjct  12   LFLLFPSLVFSEDIVTDSAFLNHICTSFDNYTANSTYASNLNQAFYQLTSNAPPSGFAQV  71

Query  251  TAGK-CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSED  427
            + GK    +V G+ALCRGDVS  DC++CVA  + +I+  CP + G I+WYD CLLKYS  
Sbjct  72   SIGKDLQTQVNGVALCRGDVSVADCRNCVATGSQEIQVRCPLSKGAIIWYDYCLLKYSNT  131

Query  428  DFFGEIDDVNKFYMANGEEAKDPKS--FMQKTKQLLTRLADKAAL---LKSSYAAGVEDI  592
             FFG+ID+ NKF + N +   D  +  F ++ K LLT LA K  L   +   Y  G  +I
Sbjct  132  QFFGKIDNRNKFSLINVQSVDDNVTTVFNEEVKSLLTDLAKKVELPNNIPKFYVIGEREI  191

Query  593  GG-SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  +YGL QC+RDLSG  CKKCL DAI  L  CC  A++GGRV+  SCNFRYE YP 
Sbjct  192  EVLKKKLYGLVQCSRDLSGAACKKCLSDAIGALSSCCD-ARIGGRVVGASCNFRYEIYPI  250



>ref|XP_009398186.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Musa 
acuminata subsp. malaccensis]
Length=247

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 117/179 (65%), Gaps = 1/179 (1%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G++ G+ G+   +  GLALCRGD+ +T C +CV  A  ++R+LCP N  GI+W+D C+L+
Sbjct  68   GFALGSVGQGGARANGLALCRGDIKSTACTTCVRTAGARVRDLCPNNKDGIIWFDECMLR  127

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS+ +FFGEID  ++FYM N E   D   F  K + L+ RL  KA +    +A G  +IG
Sbjct  128  YSDVEFFGEIDFDHRFYMWNRENVSDAVMFDGKVENLMNRLKQKAYISPLLFATGEMEIG  187

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             S  +YGL QCT+DLSG DCKKCL   I ELP CC   +  GRV+ GSCN RYE YPF+
Sbjct  188  ESQELYGLVQCTKDLSGGDCKKCLEAVIGELPSCCDGKRG-GRVVGGSCNIRYELYPFF  245



>ref|XP_004168056.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
sativus]
Length=261

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 139/240 (58%), Gaps = 8/240 (3%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            L LL  + + +      +A L H C +F     +S +  NLN     L+SN P +G++  
Sbjct  12   LFLLFPSLVFSEDIITDSAFLNHICTSFDNYTANSTYASNLNQAFYQLTSNAPPSGFAQV  71

Query  251  TAGK-CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSED  427
            + GK    +V G+ALCRGDVS  DC++CVA  + +I+  CP + G I+WYD CLLKYS  
Sbjct  72   SIGKDLQTQVNGVALCRGDVSVADCRNCVATGSQEIQVRCPLSKGAIIWYDYCLLKYSNT  131

Query  428  DFFGEIDDVNKFYMANGEEAKDPKS--FMQKTKQLLTRLADKAAL---LKSSYAAGVEDI  592
             FFG+ID+ NKF + N +   D  +  F ++ K LL  LA K  L   +   Y  G  +I
Sbjct  132  QFFGKIDNRNKFSLINVQSVDDNVTTVFNEEVKSLLMDLAKKVELPNNIPKFYVIGEREI  191

Query  593  GG-SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  +YGL QC+RDLSG  CKKCL DAI  L  CC  A++GGRV+  SCNFRYE YP 
Sbjct  192  EVLKKKLYGLVQCSRDLSGAACKKCLSDAIGALSSCCD-ARIGGRVVGASCNFRYEIYPI  250



>gb|KDO59869.1| hypothetical protein CISIN_1g041051mg, partial [Citrus sinensis]
Length=168

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 111/168 (66%), Gaps = 3/168 (2%)
 Frame = +2

Query  281  GLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNK  460
            GLALCRGDVS +DCK CVADA + IR+ CP +    ++YDNC+ KYS D+FFG+ID+  K
Sbjct  2    GLALCRGDVSASDCKRCVADAVSTIRKSCPYSKSAKIFYDNCMFKYSNDNFFGQIDNGTK  61

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSS--VIYGLTQCTR  634
            ++M N     +  +F QK+K+LL+RLA++A+     YAAG  ++   S   IYGL QCTR
Sbjct  62   YFMWNVNNVSNRVTFNQKSKELLSRLANEASGNPKLYAAGELELNEESKKKIYGLAQCTR  121

Query  635  DLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            DLS  DCK CL   I +LP CC   K GGRVI  SC   YE YPF K 
Sbjct  122  DLSYNDCKMCLDRIIGDLPSCC-DGKQGGRVITASCIINYEIYPFVKA  168



>gb|KDP25619.1| hypothetical protein JCGZ_20775 [Jatropha curcas]
Length=231

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 119/187 (64%), Gaps = 7/187 (4%)
 Frame = +2

Query  227  PRNGYSSGTAG--KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
            P  G+   + G  +    V  LALCRGDV+  DCK+CVA+A   + + C  N G I+WYD
Sbjct  39   PATGFGLASTGPPRGRGHVNALALCRGDVAKKDCKTCVANAGDALIDRCSNNKGAIIWYD  98

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGE--EAKDPKSFMQKTKQLLTRLADKAALLKSSYA  574
            +CLLKYS  +FFG+ID+ NKFY+ N +  E  +P  F +K K+LL+ L+ KA   K  YA
Sbjct  99   DCLLKYSNFNFFGDIDEQNKFYLYNYQDVEKMNPALFNKKVKELLSGLSGKAYGNKKFYA  158

Query  575  AGVEDIGGSSV--IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNF  748
             G   + G     IYG+ QCTRDLS  +CKKCL DAI ELP CC + K G RV+ GSCN 
Sbjct  159  TGELKLFGGKYKKIYGMAQCTRDLSNMECKKCLDDAINELPSCC-SGKKGARVVTGSCNV  217

Query  749  RYETYPF  769
            RY+ YPF
Sbjct  218  RYKLYPF  224



>ref|XP_010679273.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Beta 
vulgaris subsp. vulgaris]
Length=238

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 140/240 (58%), Gaps = 7/240 (3%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY  241
            F+ + L+S  F L      A   L + C N       S ++ NLN L G L   T   GY
Sbjct  3    FTNIFLISCIFFLQTTIIAANNPLSYSCINSQNFTTGSHYELNLNKLTGLLVYLTQPTGY  62

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
            +  T G+     +GL LCRGDVS+ DC SC+++A  + R+LCP N G ++WYD+C+ KY 
Sbjct  63   AQATVGQ----AHGLGLCRGDVSSFDCLSCISEAGIQARKLCPGNKGAVIWYDHCMFKYL  118

Query  422  EDDFFGEIDD-VNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGG  598
            + +FFG+ID  V    +       +   F+QK  +LL +L+++A++    YA+G   + G
Sbjct  119  DQNFFGQIDQSVAVSLLNVNNVTNNQMLFIQKNSELLGKLSEEASVDTKRYASGEIIVDG  178

Query  599  SSVIYGLTQCTRDLSGEDCKKCL-YDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            ++ IYGL QCTRDLS  +CKKCL Y   + LP CC   K GGRV+ GSCN RYE YPF K
Sbjct  179  NTTIYGLAQCTRDLSSYNCKKCLDYQITSNLPNCC-EGKRGGRVLVGSCNVRYEVYPFVK  237



>gb|KHN36560.1| Cysteine-rich repeat secretory protein 38 [Glycine soja]
Length=227

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 130/208 (63%), Gaps = 6/208 (3%)
 Frame = +2

Query  35   LATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnl  214
            +++   S P + L    + F L   T   A  L HFC++      +S ++ NL TL+ +L
Sbjct  1    MSSSKLSSPVTFL----LIFALVFQTCFGANPLYHFCSSSQNFKANSPYESNLKTLINSL  56

Query  215  ssntPRNGYSSGTAGKC-TDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIV  391
               TP  G+  G+ G+   +K YGLALCRGDVS+++CK+CV+DAT +I   CP N GGI+
Sbjct  57   IYRTPSTGFGVGSVGQYQNEKAYGLALCRGDVSSSECKTCVSDATKEILSRCPYNKGGII  116

Query  392  WYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSY  571
            WYDNC+LKY + DFFG+ID+ NKF + N     DP  F   TK+LL+ LA +A+L    Y
Sbjct  117  WYDNCMLKYLDTDFFGKIDNTNKFSLLNVRNVSDPAMFNYMTKELLSLLAYRASLSPKMY  176

Query  572  AAGVEDIGGSSV-IYGLTQCTRDLSGED  652
            A+G   IGG S  IYGLTQCTRDLS  D
Sbjct  177  ASGELKIGGESKDIYGLTQCTRDLSSSD  204



>ref|XP_008455406.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Cucumis 
melo]
Length=262

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 133/223 (60%), Gaps = 8/223 (4%)
 Frame = +2

Query  122  AAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGK-CTDKVYGLALCR  298
            +A L H C +F     +S +  NLN     L+SN P +G++  + GK    +V G+ALCR
Sbjct  30   SAFLYHICTSFDNYTANSTYASNLNQAFYQLTSNAPPSGFAQVSIGKDLQTQVNGVALCR  89

Query  299  GDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANG  478
            GDVS  DC++CVA  + +I+  CP + G I+WYD CLLKYS   FFG+ID+ N F + N 
Sbjct  90   GDVSVADCRNCVATGSQEIQVRCPLSKGAIIWYDYCLLKYSNTQFFGKIDNRNTFSLINV  149

Query  479  EEAKDPKS--FMQKTKQLLTRLADKAAL---LKSSYAAGVEDIGG-SSVIYGLTQCTRDL  640
            +   D  +  F ++ K LL  LA K  L   +   Y  G  +I      +YGL QC+RDL
Sbjct  150  QSVDDKATTVFNEEVKSLLMDLAKKVELPNNIPKFYVIGEREIEVLKKKLYGLVQCSRDL  209

Query  641  SGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            SG  CKKCL DAI +L  CC  A++GGRV+  SCNFRYE YP 
Sbjct  210  SGAACKKCLSDAIGQLSSCCD-ARIGGRVVGASCNFRYEVYPI  251



>ref|XP_006447471.1| hypothetical protein CICLE_v10018332mg, partial [Citrus clementina]
 gb|ESR60711.1| hypothetical protein CICLE_v10018332mg, partial [Citrus clementina]
Length=219

 Score =   167 bits (422),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 133/221 (60%), Gaps = 7/221 (3%)
 Frame = +2

Query  92   FILALHTPMAAAQ---LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGK  262
            F L L T    A    + + C+N      + R+Q NLN L+G +    P  G+  G+ GK
Sbjct  1    FALLLQTVTFGANVDPISYSCSN-ENFTANGRYQTNLNALMGYIYHQAPPTGFGIGSLGK  59

Query  263  CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGE  442
               +  GLALCRGDVS +DCK+CVADA + IRE CP +    ++YDNC+LKYS D FFG+
Sbjct  60   NPIQANGLALCRGDVSASDCKTCVADAISTIRENCPYSKSAKIFYDNCMLKYSNDKFFGQ  119

Query  443  IDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI--GGSSVIYG  616
            ID+  K++M N      P  F QK+K LL +LAD+A+     YAAG  ++  G    IYG
Sbjct  120  IDNGTKYFMWNVNNVGYPVIFNQKSKDLLRQLADEASGKPKLYAAGELELNEGSKKKIYG  179

Query  617  LTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGS  739
            L QCTRDLS  DCK C    I++LP+CC   K GG+V+ GS
Sbjct  180  LAQCTRDLSYNDCKMCRDRIISDLPRCC-DGKQGGKVVTGS  219



>ref|XP_007211369.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
 gb|EMJ12568.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
Length=663

 Score =   174 bits (440),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 140/241 (58%), Gaps = 5/241 (2%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR-NGY  241
            S+L  + +  +L+  +P  A  L H C N  T  P+S FQ NLN LL  LSSN  R +G+
Sbjct  8    SILSSIFVVTLLSFPSPAEADYLYHVCPNTTTFTPNSTFQSNLNRLLSTLSSNATRPSGF  67

Query  242  SSGTAGKCT--DKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
             + TA   T  D VYGL LCRGDV+ TD CKSCV+ AT+ I + CP     ++WYD+C+L
Sbjct  68   YNATASSRTPNDAVYGLFLCRGDVAATDACKSCVSTATSDIVQRCPTEKQVVIWYDDCML  127

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI  592
            +YS + FF  + +  + +M N + A +   F Q     +  +A +AA     +A    ++
Sbjct  128  RYSNESFFSTMAETPRLFMWNTQNATEQTRFNQVLSTGMNEVATEAANDADKFATSQGNV  187

Query  593  GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             G   IY L QCT+DLS  DC +CL  AIA+ P CC + K G RV+  SC  RYE YPFY
Sbjct  188  SGLVSIYSLGQCTQDLSSADCNRCLKGAIAQFPNCC-SGKEGARVLYPSCTVRYEVYPFY  246

Query  773  K  775
            +
Sbjct  247  Q  247



>ref|XP_010516475.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Camelina sativa]
Length=258

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 106/181 (59%), Gaps = 5/181 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+     G   + VY L  CRGD   + C SC+  AT+++R  CP N  GIVW+D CLLK
Sbjct  75   GFVYAYQGDDPNTVYILLQCRGDSYGSKCGSCLTTATSELRRRCPMNKAGIVWFDKCLLK  134

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVE  586
             S   FF +IDD NKFYM   ++  DP SF  KTK LLT L  KA         Y  G  
Sbjct  135  ISPTAFFEKIDDKNKFYMYRTKKVSDPVSFNAKTKALLTELTTKATRRSDKLLLYEKGEM  194

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            ++G    +YG+ QCTRDL    CK CL + I ELP+CC   K GGRV+ GSCNFRYE YP
Sbjct  195  NLGKMK-LYGMVQCTRDLWFTVCKTCLDNIIRELPKCCN-GKEGGRVVSGSCNFRYEIYP  252

Query  767  F  769
            F
Sbjct  253  F  253



>ref|XP_009150860.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Brassica rapa]
Length=259

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 107/184 (58%), Gaps = 8/184 (4%)
 Frame = +2

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            Y  G  G   D VY +  CRGD   + C +C++ A +++R+ CP N G IVW+D CLL+ 
Sbjct  72   YLYGVYGYRPDTVYMVIQCRGDAYGSRCDTCLSTAYSELRKRCPMNKGAIVWFDQCLLRI  131

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-------YAA  577
            S   F  E+D  NKFYM N ++ +DP SF  KTK LLT+L  +A    S        Y  
Sbjct  132  SPTTFINEMDLKNKFYMYNMKKVRDPASFNAKTKALLTKLTKEATRKGSERSPAQEYYEP  191

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
            G   + G   +YG+ QCTR +   DCKKCL   I ELP CC   K GGRV+ GSCNFRYE
Sbjct  192  GDMKLDGKMKLYGMVQCTRLIWNTDCKKCLDTIIGELPNCCD-GKEGGRVVSGSCNFRYE  250

Query  758  TYPF  769
             YPF
Sbjct  251  IYPF  254



>emb|CDY07878.1| BnaC03g47440D [Brassica napus]
Length=259

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 107/184 (58%), Gaps = 8/184 (4%)
 Frame = +2

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            Y  G  G   D VY +  CRGD   + C +C++ A +++R+ CP N G IVW+D CLL+ 
Sbjct  72   YLYGVYGYRPDTVYMVIQCRGDSYGSKCNTCLSTAYSELRKRCPMNKGAIVWFDRCLLRI  131

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-------YAA  577
            S   F  E+D  NKFYM N ++ +DP SF  KTK LLT+LA +A    S        Y  
Sbjct  132  SPTTFINEMDLKNKFYMYNMKKVRDPVSFKAKTKALLTKLAKEATRKGSERSPAQEYYEP  191

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
            G   + G   +YG+ QCTR +   DCKKCL   I ELP CC   K GGRV+ GSC FRYE
Sbjct  192  GDMKLDGKMTLYGMVQCTRLIWNTDCKKCLDTIIGELPNCCD-GKEGGRVVSGSCTFRYE  250

Query  758  TYPF  769
             YPF
Sbjct  251  IYPF  254



>ref|XP_010431451.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Camelina sativa]
Length=258

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 106/181 (59%), Gaps = 5/181 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+     G   + VY L  CRGD   + C SC+  AT+++R  CP N  GIVW+D CLLK
Sbjct  75   GFVYAYHGDDPNTVYILLQCRGDSYGSKCGSCLTTATSELRRRCPMNKAGIVWFDKCLLK  134

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVE  586
             S   FF +IDD NKFYM + ++  DP SF  KTK LLT L  KA         Y  G  
Sbjct  135  ISPTAFFEKIDDKNKFYMYSTKKVSDPVSFNAKTKALLTELTTKATRRSDKLLLYEKGEM  194

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            ++G    +YG+ QCTRDL    CK CL   I ELP+CC   K GGRV+ GSCNFRYE YP
Sbjct  195  NLGKMK-LYGMVQCTRDLWFTVCKTCLDKIIGELPKCCN-GKEGGRVVSGSCNFRYEIYP  252

Query  767  F  769
            F
Sbjct  253  F  253



>emb|CDX88009.1| BnaA06g26000D [Brassica napus]
Length=259

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 107/184 (58%), Gaps = 8/184 (4%)
 Frame = +2

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            Y  G  G   D VY +  CRGD   + C +C++ A +++R+ CP N G IVW+D CLL+ 
Sbjct  72   YLYGVYGYRPDTVYMVIQCRGDSYGSKCDTCLSTAYSELRKRCPMNKGAIVWFDRCLLRI  131

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-------YAA  577
            S   F  E+D  NKFYM N ++ +DP SF  KTK LLT+L  +A    S        Y  
Sbjct  132  SPTTFINEMDLKNKFYMYNMKKVRDPASFNAKTKALLTKLTKEATRKGSERSPAQEYYEP  191

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
            G   + G   +YG+ QCTR +   DCKKCL   I ELP CC   K GGRV+ GSCNFRYE
Sbjct  192  GDMKLDGKMKLYGMVQCTRLIWNTDCKKCLDTIIGELPNCCD-GKEGGRVVSGSCNFRYE  250

Query  758  TYPF  769
             YPF
Sbjct  251  IYPF  254



>ref|XP_002878210.1| hypothetical protein ARALYDRAFT_348900 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54469.1| hypothetical protein ARALYDRAFT_348900 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/258 (41%), Positives = 142/258 (55%), Gaps = 15/258 (6%)
 Frame = +2

Query  8    SQQSSLISVLATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANF-ATSPPDSRFQ  184
            S++  L+  LA +A      +LP+ S++ +   +     A L H C+       P S ++
Sbjct  7    SKRIVLVLNLAVVATQ----VLPIRSVSSMNKTN-----AYLYHKCSEIEGKYKPKSPYE  57

Query  185  KnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIREL  364
            +NLN ++ ++  +T   G+     G   + VY L  CRGD     C SC+  A++++R  
Sbjct  58   ENLNFIINDMYKDTFVRGFVYAYHGDDPNTVYILLQCRGDSYGPKCGSCLTTASSELRRR  117

Query  365  CPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLAD  544
            CP N  GIVW+D CLLK+S   FF +IDD NKFYM + ++  DP SF  KTK LLT L  
Sbjct  118  CPMNKAGIVWFDKCLLKFSPTAFFEKIDDKNKFYMYSTKKVSDPASFNAKTKALLTELTT  177

Query  545  KAALLKSS---YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKV  715
            KA         Y  G   +G    +YG+ QCTRDL    CK CL   I ELP+CC   K 
Sbjct  178  KATRRSDKLLLYETGEMKLGKMK-LYGMVQCTRDLWFTVCKTCLDKIIGELPKCCD-GKE  235

Query  716  GGRVIQGSCNFRYETYPF  769
            GGRV+ GSCNFRYE YPF
Sbjct  236  GGRVVSGSCNFRYEIYPF  253



>ref|XP_008349286.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/238 (43%), Positives = 135/238 (57%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + S+  +L+  T   A  L H C N  T  P+S FQ NLN LL  LSSN  R+ G+
Sbjct  6    TLLLIFSVFTLLSFPTSTDADYLAHICPNTTTFTPNSTFQSNLNRLLSTLSSNANRSTGF  65

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CV  AT +  + C      ++WYD+CLL+Y
Sbjct  66   YNATVQSTNNAVYGLFLCRGDVVGTDACQTCVTTATAEAPKRCSVEKQVVIWYDDCLLRY  125

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGG  598
            S + FF    +  + YM N E A DP  F Q     + ++A +AA     +A    ++ G
Sbjct  126  SNESFFSTAAESPRLYMWNTENATDPTRFNQVLGASMNQVAGQAAGEADKFATNQANVSG  185

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
               +Y L QCT+DLS  DC +CL   IA LP CC   K+GGRV+  SCN RYE YPFY
Sbjct  186  LISVYSLGQCTQDLSEADCNRCLRGTIALLPSCCN-GKLGGRVLFPSCNVRYEVYPFY  242



>ref|XP_008358736.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/238 (43%), Positives = 135/238 (57%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + S+  +L+  T   A  L H C N  T  P+S FQ NLN LL  LSSN  R+ G+
Sbjct  6    TLLLIFSVFTLLSFPTSTDADYLAHICPNTTTFTPNSTFQSNLNRLLSTLSSNANRSTGF  65

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CV  AT +  + C      ++WYD+CLL+Y
Sbjct  66   YNATVQSTNNAVYGLFLCRGDVVGTDACQTCVTTATAEAPKRCSVEKQVVIWYDDCLLRY  125

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGG  598
            S + FF    +  + YM N E A DP  F Q     + ++A +AA     +A    ++ G
Sbjct  126  SNESFFSTAAESPRLYMWNTENATDPTRFNQVLGASMNQVAGQAAGEADKFATNQANVSG  185

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
               +Y L QCT+DLS  DC +CL   IA LP CC   K+GGRV+  SCN RYE YPFY
Sbjct  186  LISVYSLGQCTQDLSEADCNRCLRGTIALLPSCCN-GKLGGRVLFPSCNVRYEVYPFY  242



>ref|XP_008340068.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=668

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 136/238 (57%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + SI  + +  T   A  L H C N  T  P+S FQ NLN LL NLSSN  R+ G+
Sbjct  11   TLLLIFSIFTLPSFLTNTEAVYLSHICPNTTTFTPNSTFQSNLNRLLSNLSSNANRSTGF  70

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV +TD C++CVA ATT+  + CP     ++WYD+C+L+Y
Sbjct  71   YNVTVQTTNNAVYGLFLCRGDVVSTDACETCVATATTEAPQRCPVEKQVVIWYDDCMLRY  130

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGG  598
            S   FF  + +  ++YM N + A DP  F Q     + + A +A      +     ++ G
Sbjct  131  SNVSFFSTVTESPRWYMWNTQNATDPTRFNQVMAASVNQAASEAVGDADKFGTNQANVSG  190

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
               +Y L QCT+DLS  DC +CL   IA LP CC  A +G RV+  SCN RYE YPFY
Sbjct  191  LISVYSLGQCTQDLSATDCNRCLRGTIALLPSCCNGA-LGARVLYPSCNVRYEVYPFY  247



>ref|XP_006299311.1| hypothetical protein CARUB_v10015466mg [Capsella rubella]
 gb|EOA32209.1| hypothetical protein CARUB_v10015466mg [Capsella rubella]
Length=278

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 148/274 (54%), Gaps = 27/274 (10%)
 Frame = +2

Query  23   LISVLATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCAN-FATSPPDSRFQKnlnt  199
            L+S+ A +A    FS   ++S+    +L+     A L H C N   T  P S +++NLN 
Sbjct  10   LVSIFAMIAIQLVFSH-SVMSLNQTNSLN--QTNAYLHHTCINGQGTYKPGSPYEENLNR  66

Query  200  llgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNN  379
            ++  +S +    G+  G+ G   +KV+G   CRGD + + C+SC+  A ++IR  CP N 
Sbjct  67   VIRAISISISNYGFVHGSNGDAPNKVFGKLQCRGDSNESKCRSCLDTAFSEIRSKCPNNK  126

Query  380  GGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAA-  553
            GGI+WYDNCLL+ S  +  G+ID  N FYM N  +   D  SF + ++ LL RL +KA  
Sbjct  127  GGIIWYDNCLLEISPINSLGKIDYQNTFYMYNENDVNGDTNSFNKNSRALLYRLKEKATS  186

Query  554  -------------------LLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDA  676
                                +K  YAAG E   G   +Y + QCT+DLS ++C  CL   
Sbjct  187  KENNNGKQDLPQNGENRLIRMKKLYAAG-EGSLGKMKLYAMVQCTKDLSIKNCNVCLNWI  245

Query  677  IAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            +A+LP CC   K GGRV+  SCNFRYE YPF K 
Sbjct  246  MAKLPTCCNN-KQGGRVLSTSCNFRYELYPFVKN  278



>ref|XP_010466464.1| PREDICTED: putative cysteine-rich repeat secretory protein 22 
[Camelina sativa]
Length=277

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 151/279 (54%), Gaps = 33/279 (12%)
 Frame = +2

Query  35   LATMAYSKPF-SLLPLLSIAFI-----LALHTPMAAAQ----LRHFC-ANFATSPPDSRF  181
            +++++ SK   S+  ++SI F+     ++L+   +  Q    L H C  +  T  P S +
Sbjct  1    MSSLSVSKRIVSVFAMISIQFVFPRSVMSLNQTNSLNQTNAYLHHTCIKSQGTYKPGSPY  60

Query  182  QKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRE  361
            ++NLN ++  +S +    G+  G+ G   + V+G   CRGD  ++ C+SC+  A ++IR 
Sbjct  61   EENLNRVVRAISISISNYGFVHGSNGDAPNTVFGKLQCRGDSYSSKCRSCLNTAFSEIRR  120

Query  362  LCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRL  538
             CP N GGI+WYDNCLL+ S  +  G+ID  N FYM N +    D  SF + T+ LL RL
Sbjct  121  KCPNNKGGIIWYDNCLLEISPINSLGKIDYENNFYMYNEKAVNGDTNSFNKNTRALLYRL  180

Query  539  ADKAA-------------------LLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKK  661
             +KA                     +K  YA G E +G    +Y + QCT+DLS +DC  
Sbjct  181  KEKATSKENNNGKQDLPETKEERLKMKKLYATGEESLGKMK-LYAMVQCTKDLSIKDCNV  239

Query  662  CLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            CL   +A+LP CC   K GGRV+  SCNFRYE YPF K 
Sbjct  240  CLNWIMAKLPTCCNN-KQGGRVLSTSCNFRYELYPFVKN  277



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 134/238 (56%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + SI  + +      A  L H C N  T  P+S FQ NLN LL NLSSN  R+ G+
Sbjct  6    TLLLIFSIFTLPSFLISTEAVYLYHICPNTTTFTPNSTFQSNLNRLLSNLSSNANRSTGF  65

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CVA ATT+  + CP     ++WYD+C+L+Y
Sbjct  66   YNVTVQTTNNAVYGLFLCRGDVVGTDACETCVATATTEAPQRCPVEKQVVIWYDDCMLRY  125

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGG  598
            S + FF  + +    +M N + A DP  F Q     + + A +A      +     ++ G
Sbjct  126  SNESFFSTVTESPSVFMWNTQNATDPTRFNQVMAASVNQAASEAVGDADKFGTNQANVSG  185

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
               +Y L QCT+DLS  DC +CL   IA LP CC   K+GGRV+  SCN RYE YPFY
Sbjct  186  LISVYSLGQCTQDLSATDCNRCLRGTIALLPSCCN-RKLGGRVLFPSCNVRYEVYPFY  242



>ref|XP_003635324.2| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Vitis vinifera]
Length=309

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/243 (39%), Positives = 139/243 (57%), Gaps = 5/243 (2%)
 Frame = +2

Query  56   KPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN  235
            KP +LL L   +F L   +P  A  +   C+N +    +S ++ NLN+L  +L++  P  
Sbjct  7    KPSTLL-LFFYSF-LCFCSPTKADYIYSVCSNHSEIASNS-YKTNLNSLFSSLTTKGPLT  63

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + T+GK  D+V+GL LCRGD ++ DC+ C+ +A+ ++ + C     G +WYD CLL+
Sbjct  64   GFYNTTSGKTPDEVFGLVLCRGDDTSNDCQICIKEASQELLQRCNSTKEGTIWYDECLLR  123

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDI  592
            YS  +FF  +    +  + N   A DP  F     QL+  ++ +AA   S  +A G   +
Sbjct  124  YSSQNFFSSVTLKKELSLLNTISASDPIRFNTILGQLMDNISSEAAFSSSQMFATGEAVV  183

Query  593  GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                 IYGL QCTRDLS EDC  CL  +I +L  CC + K GG+VI  SC  RYE YPF+
Sbjct  184  SSLQKIYGLVQCTRDLSKEDCNDCLESSIEKLSSCC-SGKQGGQVISKSCFLRYEVYPFF  242

Query  773  KGA  781
            +GA
Sbjct  243  RGA  245



>ref|XP_010504787.1| PREDICTED: putative cysteine-rich repeat secretory protein 61 
[Camelina sativa]
Length=258

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 134/247 (54%), Gaps = 11/247 (4%)
 Frame = +2

Query  56   KPFSLLPLLSIAFILALHTPMAA-----AQLRHFCANFATS-PPDSRFQKnlntllgnls  217
            + F +L L+ +A  + L   +++     A L H C+       P S ++ NLN L+ ++ 
Sbjct  9    RIFLVLNLVVVAIQVFLIRNVSSMNNTNAYLNHKCSEIERKYKPKSPYEGNLNFLIKDMY  68

Query  218  sntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWY  397
             +T   G+     G     VY L  CRGD   + C S +  AT+++R  CP N  GIVW+
Sbjct  69   KDTFVRGFVYAYHGDDPSTVYILLQCRGDSYGSKCGSFLTTATSELRRRCPMNKAGIVWF  128

Query  398  DNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---  568
            D CLLK S   FF +IDD NKFYM + ++  DP SF  KTK L T L  KA         
Sbjct  129  DKCLLKISPTAFFEKIDDKNKFYMYSTKKVNDPVSFNAKTKALFTELTTKATRRSDKLLL  188

Query  569  YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNF  748
            Y  G  ++G    +YG+ QCTRDL    CK CL   I ELP+CC   K GGRV+ GSCNF
Sbjct  189  YEKGEMNLGKMK-LYGMVQCTRDLWFTVCKTCLDKIIGELPKCCN-GKEGGRVVSGSCNF  246

Query  749  RYETYPF  769
            RYE YPF
Sbjct  247  RYEIYPF  253



>gb|AAN46205.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 121/198 (61%), Gaps = 8/198 (4%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            IL++HT ++ +Q    L H C++   S    S ++ NLN L   LS   P  G+++ + G
Sbjct  4    ILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAASSTG  63

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
               + V GLALCRGD S++DC+SC+  A  ++R+ CP N  GIVWYDNCL+KYS  +FFG
Sbjct  64   NTPNNVNGLALCRGDASSSDCRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFG  123

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIY  613
            +ID  N+FY+ N +   DP +F  +TK LLT L  KA    +   +A G E I G + +Y
Sbjct  124  KIDFENRFYLYNVKNVSDPSTFNSQTKALLTELTKKATTRDNQKLFATG-EKIIGKNKLY  182

Query  614  GLTQCTRDLSGEDCKKCL  667
            GL QCTRDL    CK CL
Sbjct  183  GLVQCTRDLKSITCKACL  200



>ref|XP_008370580.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=661

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 133/239 (56%), Gaps = 4/239 (2%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN--G  238
            +LL + SI  + +  T   A  L  FC N  T  P+S FQ NLN LL NLSSN  R+  G
Sbjct  3    TLLLIFSIFTLPSFLTSTEAVWLFTFCPNTTTFXPNSTFQSNLNRLLSNLSSNANRSSTG  62

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            + + T     + VYGL LCRGDV  TD C  CVA+ TT  R+ CP     ++WYD+C+L+
Sbjct  63   FYNVTVQTTNNAVYGLFLCRGDVVGTDACGICVANTTTVARKSCPVEKQVVIWYDDCMLR  122

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS + FF  + D   FYM N   A DP  F Q     + + A +A      +     ++ 
Sbjct  123  YSNESFFSTVTDWPSFYMRNTLNATDPVRFNQVVTASVNQAASEAVGDADKFGTNRANVN  182

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
            G + +Y L QCT+DLS  DC +CL   I +LP  C   +VGGR++  SCN RYE YPFY
Sbjct  183  GLTSVYSLGQCTQDLSATDCNRCLRMTIDQLPTYC-YGRVGGRLVFPSCNIRYEVYPFY  240



>gb|AAN46194.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46196.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46198.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46199.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46200.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46201.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46202.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46203.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46204.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 122/198 (62%), Gaps = 8/198 (4%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            IL++HT ++ +Q    L H C++   S    S ++ NLN L   LS   P  G+++ + G
Sbjct  4    ILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAASSTG  63

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
               + V GLALCRGD S++DC+SC+  A  ++R+ CP N  GIVWYDNCL+KYS  +FFG
Sbjct  64   NTPNNVNGLALCRGDASSSDCRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFG  123

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIY  613
            +ID  N+FY+ N +   DP +F  +TK LLT L  KA    +   +A G ++IG +  +Y
Sbjct  124  KIDFENRFYLYNVKNVSDPSTFNSQTKALLTELTKKATTRDNQKLFATGEKNIGKNK-LY  182

Query  614  GLTQCTRDLSGEDCKKCL  667
            GL QCTRDL    CK CL
Sbjct  183  GLVQCTRDLKSITCKACL  200



>ref|NP_191390.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9M2I5.1|CRR61_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
61; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB68169.1| putative protein [Arabidopsis thaliana]
 gb|AEE79768.1| uncharacterized protein AT3G58310 [Arabidopsis thaliana]
Length=258

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 104/181 (57%), Gaps = 5/181 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+     G   + VY L  CRGD   + C SC++ AT+++R  CP N  GIVW+D CLLK
Sbjct  75   GFVYAYHGDDPNTVYILLQCRGDSYGSKCGSCLSTATSELRRRCPMNKAGIVWFDKCLLK  134

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVE  586
             S   FF +IDD NKFYM + ++  DP  F  KTK LLT L  KA         Y  G  
Sbjct  135  ISPTAFFEKIDDKNKFYMYSTKKVSDPALFNVKTKALLTELTAKATRRSDKLLLYETGEM  194

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             +G    +YG+ QC RDL    CK CL   I ELP+CC   K GGRV+ GSCNFRYE YP
Sbjct  195  KLGKMK-LYGMVQCRRDLWFTVCKTCLDKIIGELPKCCD-GKEGGRVLSGSCNFRYEIYP  252

Query  767  F  769
            F
Sbjct  253  F  253



>ref|XP_006292774.1| hypothetical protein CARUB_v10019024mg [Capsella rubella]
 gb|EOA25672.1| hypothetical protein CARUB_v10019024mg [Capsella rubella]
Length=258

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 105/181 (58%), Gaps = 5/181 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+     G   + VY L  CRGD   + C SC+  AT+++R  CP +  GIVW+D CLLK
Sbjct  75   GFVYSYHGDDPNTVYILLQCRGDSYGSKCGSCLTTATSELRRRCPMSKAGIVWFDKCLLK  134

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVE  586
             S   FF +ID  NKFYM + ++  DP SF  KTK LLT LA KA         Y  G  
Sbjct  135  ISPTAFFEKIDYKNKFYMYSTKKVSDPGSFNAKTKALLTELAAKATRRSDKLLLYEKGEM  194

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            ++G    +YG+ QCTR+L    CK CL   I ELP CC   K GGRV+ GSCNFRYE YP
Sbjct  195  NLGKMK-LYGMVQCTRNLWFTVCKTCLDKIIGELPNCCN-GKEGGRVVSGSCNFRYEIYP  252

Query  767  F  769
            F
Sbjct  253  F  253



>ref|XP_010466466.1| PREDICTED: putative cysteine-rich repeat secretory protein 21 
[Camelina sativa]
Length=262

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 98/261 (38%), Positives = 146/261 (56%), Gaps = 17/261 (7%)
 Frame = +2

Query  38   ATMAYSKPFSLLPLLSIAFILALHT------PMAAAQLRHFCANF-ATSPPDSRFQKnln  196
            ++   SK    +P+L++  I  L            A L H C N   T    S +++NLN
Sbjct  3    SSFPISKRLVSVPILAVVTIQILFIRSGFSLNQTNAYLHHKCINSQGTYKSRSPYEENLN  62

Query  197  tllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKN  376
             ++ ++S+   R+G++  + G   + V+    CRGD   + C SC+A A + +R+ CP N
Sbjct  63   RVVRSISTGNLRSGFAHVSNGDTPNTVFVKLQCRGDSYWSKCHSCLATAISGLRKRCPNN  122

Query  377  NGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEE-AKDPKSFMQKTKQLLTRLADKAA  553
             GGI+WYDNCLL+ S  D  G+ID  N FYM N +E + D +SF +  + LL +L +KA 
Sbjct  123  KGGIIWYDNCLLEISSIDTLGKIDYKNNFYMYNAKEVSSDIESFNKNVRILLNKLKEKAT  182

Query  554  LLKSS-------YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAK  712
              +++       YAAG   +G    +Y + QCT+DLS + C +CL   + +LP+CC   K
Sbjct  183  SNETNAGRDYTVYAAGDNKLGPMK-LYAMVQCTQDLSTDGCNECLNYILTKLPKCC-IGK  240

Query  713  VGGRVIQGSCNFRYETYPFYK  775
             GGRV+  SCNFRYE YPF K
Sbjct  241  QGGRVLSTSCNFRYELYPFVK  261



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 134/251 (53%), Gaps = 16/251 (6%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN---  235
            +LL + SI  + +      A  L H C N  T  P+S FQ NLN LL NLSSN  R+   
Sbjct  6    TLLLIFSIFTLPSFLISTEAVYLYHICPNTTTFTPNSNFQSNLNRLLSNLSSNANRSTGF  65

Query  236  -----------GYSSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNN  379
                       G+ + T     + VYGL LCRGDV  TD C++CVA ATT+  + CP   
Sbjct  66   YNITANANRPPGFYNVTVQTTNNAVYGLFLCRGDVVGTDACETCVATATTEAPQRCPVEK  125

Query  380  GGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALL  559
              ++WYD+C+L+YS + FF  + +    +M N + A DP  F Q     + + A +A   
Sbjct  126  QVVIWYDDCMLRYSNESFFSTVTESPSVFMWNTQNATDPTRFNQVMAASVNQAASEAVGD  185

Query  560  KSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGS  739
               +     ++ G   +Y L QCT+DLS  DC +CL   IA LP CC   K+GGRV+  S
Sbjct  186  ADKFGTNQANVSGLISVYSLGQCTQDLSATDCNRCLRGTIALLPSCCN-RKLGGRVLFPS  244

Query  740  CNFRYETYPFY  772
            CN RYE YPFY
Sbjct  245  CNVRYEVYPFY  255



>gb|AAN46195.1| unknown protein [Arabidopsis thaliana]
 gb|AAN46197.1| unknown protein [Arabidopsis thaliana]
Length=200

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (62%), Gaps = 8/198 (4%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            IL++HT ++ +Q    L H C++   S    S ++ NLN L   LS   P  G+++ + G
Sbjct  4    ILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAASSTG  63

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
               + V GLALCRGD S++DC+SC+  A  ++R+ CP N  GIVWYDNCL+KYS  +FFG
Sbjct  64   NTPNNVNGLALCRGDASSSDCRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFG  123

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIY  613
            +ID  N+F + N +   DP +F  +TK LLT LA KA    +   +A G +++G +  +Y
Sbjct  124  KIDFENRFSLYNVKNVSDPSTFNSQTKALLTELAKKATTRDNQKLFATGEKNLGKNK-LY  182

Query  614  GLTQCTRDLSGEDCKKCL  667
            GL QCTRDL    CK CL
Sbjct  183  GLVQCTRDLKSTACKACL  200



>ref|XP_008363779.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=678

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 130/239 (54%), Gaps = 4/239 (2%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN--G  238
            +L+ + SI  + +  T   A  L   C N  T  P+S FQ NLN LL NLSSN  R+  G
Sbjct  15   TLVLIFSIFTLPSFLTSTEAVFLLSVCPNTTTFTPNSTFQSNLNRLLFNLSSNANRSSTG  74

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            + + T     + VYGL LCRGDV  TD CK CVA+AT   R+ CP     ++WYD+C+L+
Sbjct  75   FYNVTVQTTNNAVYGLFLCRGDVVGTDVCKICVANATALARQRCPVEKQVVIWYDDCMLR  134

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS + FF  + D   FYM N   A DP  F Q     + + A +A      +     ++ 
Sbjct  135  YSNESFFSTVTDSPSFYMRNTVNATDPIQFNQVVAASVNQAAREAVGDADKFGTNRANVN  194

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
            G   +Y L QCT+DLS  DC +CL   I ELP  C   ++GGR    SCN RYE YPFY
Sbjct  195  GLISVYSLAQCTQDLSAADCNRCLQGTIDELPNYC-YGRIGGRFAYPSCNVRYEVYPFY  252



>ref|XP_010646644.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Vitis 
vinifera]
Length=373

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 106/181 (59%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + +AG+ +DKV  +ALCRGDV  T C+SC+ D+  ++ +LCP     I WYDNC+L+
Sbjct  66   GFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTQLCPNQKEAIGWYDNCMLR  125

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS D  FG       FYM N + A + + F Q    ++  L  KAA    +  +A G  +
Sbjct  126  YSNDSIFGTQQSSPYFYMRNSKNASNVEEFNQVLGNMMASLRSKAASGDWRRKFATGEAN  185

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DLS   C  CL  A  E+P CC + K GGRV++ SCN RYETY F
Sbjct  186  VTSFQSIYGLMQCTPDLSELSCSNCLEGATNEIPTCCDSRK-GGRVVKPSCNLRYETYRF  244

Query  770  Y  772
            Y
Sbjct  245  Y  245



>ref|XP_010644356.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Vitis 
vinifera]
Length=307

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 135/247 (55%), Gaps = 5/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            +++S+    L  L +A I  L    A   + H C+N  T  P+S +Q NLN+LL +LSSN
Sbjct  3    VSFSRNLLFLCALGLA-ISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSN  61

Query  224  tPR-NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
              R NG+ + TAG+  D  YGL LCRGDV+  DC+ CVA+A+ +I + C      I+WYD
Sbjct  62   ATRANGFYNATAGQSPDVAYGLFLCRGDVAIDDCRDCVANASAEILQQCSGVKKAIIWYD  121

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYA  574
             C+L YS    F  +++     + N +   DP  F Q     +   A  AA  +S   +A
Sbjct  122  QCMLHYSNRSIFSRVEENPMLQLYNLQNVTDPGPFNQLVVDTMNATATLAANDESGKKFA  181

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
               E+  GS  +Y L QCT DLS  DC KCL  AI  L  CC + K G R +  SCN RY
Sbjct  182  TKEENFTGSQTLYSLVQCTPDLSIADCSKCLEGAIGALSLCC-SGKQGARTLTPSCNARY  240

Query  755  ETYPFYK  775
            E YPFY+
Sbjct  241  ELYPFYQ  247



>emb|CAN65760.1| hypothetical protein VITISV_001837 [Vitis vinifera]
Length=316

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 135/247 (55%), Gaps = 5/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            +++S+    L  L +A I  L    A   + H C+N  T  P+S +Q NLN+LL +LSSN
Sbjct  3    VSFSRNLLFLCALGLA-ISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSSLSSN  61

Query  224  tPR-NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYD  400
              R NG+ + TAG+  D  YGL LCRGDV+  DC+ CVA+A+ +I + C      I+WYD
Sbjct  62   ATRANGFYNATAGQSPDVAYGLFLCRGDVAIDDCRDCVANASAEILQQCSGVKKAIIWYD  121

Query  401  NCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYA  574
             C+L YS    F  +++     + N +   DP  F Q     +   A  AA  +S   +A
Sbjct  122  QCMLHYSNRSIFSRVEENPMLQLYNLQNVTDPGPFNQLVVDTMNATATLAANDESGKKFA  181

Query  575  AGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRY  754
               E+  GS  +Y L QCT DLS  DC KCL  AI  L  CC + K G R +  SCN RY
Sbjct  182  TKEENFTGSQTLYSLVQCTPDLSIADCSKCLEGAIGALSLCC-SGKQGARTLTPSCNARY  240

Query  755  ETYPFYK  775
            E YPFY+
Sbjct  241  ELYPFYQ  247



>ref|XP_006449119.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
 gb|ESR62359.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
Length=674

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 125/218 (57%), Gaps = 6/218 (3%)
 Frame = +2

Query  137  HFCANFATSPPDSRFQKnlntllgnlssntPR-NGYSSG----TAGKCTDKVYGLALCRG  301
            HFC++ A    +S F+ NLN LL +L +N  R NG+S G    TAG+  ++VY L LCRG
Sbjct  34   HFCSDTANFTRNSTFESNLNRLLTSLPTNASRGNGFSRGFFNATAGQDPNRVYSLFLCRG  93

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            D +T  C++CV  AT  +  LCP +   IVWYD CLL+YS    F  I+     Y+ N +
Sbjct  94   DQTTDICQNCVTFATRDVIRLCPVSKDPIVWYDECLLRYSNKYIFSTIETTRTVYLWNTQ  153

Query  482  EAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKK  661
             A DP  F      L++  A +A     ++A  + +      +Y L QCT+DLS  DC K
Sbjct  154  NATDPVKFNDLVGSLMSEAASQAVNDPKNFATKMANFTSFQNLYALAQCTQDLSSSDCNK  213

Query  662  CLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            CL  AIA+LP CCG  K GGRV+  SC  RYE YPFY 
Sbjct  214  CLRGAIAQLPTCCG-GKQGGRVLTPSCIVRYELYPFYN  250



>emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera]
Length=839

 Score =   163 bits (412),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 106/181 (59%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + +AG+ +DKV  +ALCRGDV  T C+SC+ D+  ++ +LCP     I WYDNC+L+
Sbjct  230  GFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTQLCPNQKEAIGWYDNCMLR  289

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS D  FG       FYM N + A D + F Q    ++  L  KAA    +  +A G  +
Sbjct  290  YSNDSIFGTQQSSPYFYMRNSKNASDVEEFNQVLGNMMASLRSKAASGDWRRKFATGEAN  349

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DLS   C  CL  A  E+P CC + K GGRV++ SCN RYETY F
Sbjct  350  VTSFQSIYGLMQCTPDLSELSCSNCLEGATNEIPTCCDSRK-GGRVVKPSCNLRYETYRF  408

Query  770  Y  772
            Y
Sbjct  409  Y  409



>ref|XP_010247617.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=690

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 109/183 (60%), Gaps = 4/183 (2%)
 Frame = +2

Query  233  NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
            NG+ + TAG   D+VYGL LCRGDV+   C++CV  AT  I + CP      +WYD C++
Sbjct  85   NGFYNTTAGSNPDRVYGLFLCRGDVTDDVCRTCVVTATQDITQRCPNRKVATIWYDECMI  144

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVE  586
            +YS   FF  + D   FYM + +   +P  F Q   + + ++A +AA   S   +A    
Sbjct  145  RYSHLSFFSFVADP-VFYMLSSQNISNPDRFNQLLNETMNQIASQAAFNSSPKKFATQEA  203

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            +I GS  +Y L QCT+DLSG  C +CL  AI+++P CC   K GGRVI  SCN RYE YP
Sbjct  204  NISGSRNLYSLVQCTQDLSGNGCYQCLLRAISDIPMCC-DGKQGGRVIGPSCNLRYEIYP  262

Query  767  FYK  775
            FY+
Sbjct  263  FYQ  265



>ref|XP_009357380.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=671

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 131/239 (55%), Gaps = 4/239 (2%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN--G  238
            +LL + SI  + +  T   A  L  FC N     P+S FQ NLN LL NLSSN  R+  G
Sbjct  12   TLLLIFSIFTLPSFFTSTEAVWLSTFCPNTTIFTPNSTFQSNLNQLLSNLSSNANRSSTG  71

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            + + T     + VYGL LCRGD+  TD C++CVA+AT   R+ CP     ++WYD C+L+
Sbjct  72   FYNVTVQTTNNAVYGLFLCRGDIVGTDACETCVANATALARQRCPVEKQVVIWYDECMLR  131

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS + FF  + D   F M N   A DP  F Q  +  + + A +A      +     ++ 
Sbjct  132  YSNESFFSTVTDWPSFPMRNTVNATDPTRFNQVVEASVNQAASEAVGDAYKFGTSRANVT  191

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
            G   +Y L QCT+DLS  DC +CL   IA LP CC   ++GGR +  SCN RYE Y FY
Sbjct  192  GLISVYSLGQCTQDLSATDCNRCLRRTIALLPGCC-YGRIGGRYVFPSCNIRYEVYLFY  249



>ref|XP_010247616.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Nelumbo 
nucifera]
Length=676

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 132/236 (56%), Gaps = 5/236 (2%)
 Frame = +2

Query  86   IAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntP--RNGYSSGTAG  259
            + F+  L    +AA L   C+N  T  P+S +Q NLN LL +LSSN+    NG+ +   G
Sbjct  25   LIFLPFLGLRGSAAPLYQICSNTTTYAPNSTYQANLNRLLSSLSSNSTPFNNGFYNTPVG  84

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
            +  + VYGL LCRGDV+   C+SCV  AT +I +LCP      VWYD C+L+YS    F 
Sbjct  85   RNPNTVYGLFLCRGDVTEDACRSCVQTATQEILQLCPDRKVATVWYDECMLRYSNQSIFS  144

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIY  613
             I D    YM+N +   +P  F Q     +  +A +AA   SS  +A    +      +Y
Sbjct  145  TISDSILVYMSNTQNISNPDQFNQLLANKMDEIATQAASGGSSRKFATAEANFTTFQRLY  204

Query  614  GLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKGA  781
             L QCT DLS +DC +CL + I  LP CC  +K GGRV+  SCN RYE YPFY+ A
Sbjct  205  TLAQCTPDLSNQDCYRCLRNVINNLPSCC-NSKQGGRVLADSCNVRYEIYPFYQLA  259



>ref|XP_010647173.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=657

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/243 (39%), Positives = 139/243 (57%), Gaps = 5/243 (2%)
 Frame = +2

Query  56   KPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN  235
            KP +LL L   +F L   +P  A  +   C+N +    +S ++ NLN+L  +L++  P  
Sbjct  7    KPSTLL-LFFYSF-LCFCSPTKADYIYSVCSNHSEIASNS-YKTNLNSLFSSLTTKGPLT  63

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + T+GK  D+V+GL LCRGD ++ DC+ C+ +A+ ++ + C     G +WYD CLL+
Sbjct  64   GFYNTTSGKTPDEVFGLVLCRGDDTSNDCQICIKEASQELLQRCNSTKEGTIWYDECLLR  123

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDI  592
            YS  +FF  +    +  + N   A DP  F     QL+  ++ +AA   S  +A G   +
Sbjct  124  YSSQNFFSSVTLKKELSLLNTISASDPIRFNTILGQLMDNISSEAAFSSSQMFATGEAVV  183

Query  593  GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                 IYGL QCTRDLS EDC  CL  +I +L  CC + K GG+VI  SC  RYE YPF+
Sbjct  184  SSLQKIYGLVQCTRDLSKEDCNDCLESSIEKLSSCC-SGKQGGQVISKSCILRYEVYPFF  242

Query  773  KGA  781
            +GA
Sbjct  243  RGA  245



>gb|KDO75584.1| hypothetical protein CISIN_1g010329mg [Citrus sinensis]
Length=434

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 131/246 (53%), Gaps = 9/246 (4%)
 Frame = +2

Query  62   FSLLPLLSI---AFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR  232
            FS+L L  I   +F  +         + HFC++ A    +S F+ NLN LL +L +N  R
Sbjct  6    FSVLFLFVIYLSSFQFSFTAAADPTYVYHFCSDTANFTRNSTFESNLNRLLTSLPTNASR  65

Query  233  -NGYSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWY  397
             NG+S G    TAG+  ++VY L LCRGD +T  C++CV  AT  +   CP +   IVWY
Sbjct  66   GNGFSRGFFNATAGQDPNRVYSLFLCRGDQTTNSCQNCVTFATRDVIGRCPVSKDTIVWY  125

Query  398  DNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAA  577
            D CLL+YS    F   +     Y+ N + A DP  F      L+   A +A      +A 
Sbjct  126  DECLLRYSNRYIFSTRETTRTVYLWNTQNATDPVKFNDLVGSLMGEAASQAVNDPKKFAT  185

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
             + +      +Y L QCT+DLS  DC  CL  AIA+LP CCG  K GGRV+  SCN RYE
Sbjct  186  KMANFTSFQKLYALAQCTQDLSSSDCNICLRGAIAQLPTCCG-GKQGGRVLTPSCNVRYE  244

Query  758  TYPFYK  775
             YPFY 
Sbjct  245  VYPFYN  250



>gb|KDP25876.1| hypothetical protein JCGZ_22906 [Jatropha curcas]
Length=226

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 130/219 (59%), Gaps = 5/219 (2%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVS  310
            L   C++    PP S ++KNLN LL  LS+  P  G+     G   D++ GL LCRGDVS
Sbjct  11   LESICSDLEY-PPHSPYEKNLNNLLNILSTKIPPYGFGLSILGNGVDQINGLGLCRGDVS  69

Query  311  TTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK  490
            + DC +CV++A+ KI ++C  +  GI+WYD+C L+YS + FFG+ID   +F+  N   A 
Sbjct  70   SKDCSACVSEASKKILDVCTGSKAGIIWYDHCFLRYSHEYFFGKIDYQEEFFTYNPVFAS  129

Query  491  DPKSFMQKTKQLLTRLADKAALLKSSYAAG--VEDIGGSSVIYGLTQCTRDLSGEDCKKC  664
            + K    K K+LL  L+ +A+  ++ +A G  V D   S  +YG+ QCT DLS  DCK  
Sbjct  130  NTKLLEDKMKELLNGLSVQASQKRTFFATGELVYD-DSSHKLYGMAQCTIDLSTSDCKTS  188

Query  665  LYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKGA  781
            L  AI +L  CC + ++G RV  GS + RYE YPF   A
Sbjct  189  LDAAIKKLSSCC-SGRIGARVKGGSYSVRYEMYPFLNNA  226



>emb|CBI29181.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 137/251 (55%), Gaps = 5/251 (2%)
 Frame = +2

Query  32   VLATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgn  211
            V+  +++S+    L  L +A I  L    A   + H C+N  T  P+S +Q NLN+LL +
Sbjct  161  VVMKVSFSRNLLFLCALGLA-ISCLAIQAAPDYIHHVCSNTTTIQPNSTYQTNLNSLLSS  219

Query  212  lssntPR-NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGI  388
            LSSN  R NG+ + TAG+  D  YGL LCRGDV+  DC+ CVA+A+ +I + C      I
Sbjct  220  LSSNATRANGFYNATAGQSPDVAYGLFLCRGDVAIDDCRDCVANASAEILQQCSGVKKAI  279

Query  389  VWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS-  565
            +WYD C+L YS    F  +++     + N +   DP  F Q     +   A  AA  +S 
Sbjct  280  IWYDQCMLHYSNRSIFSRVEENPMLQLYNLQNVTDPGPFNQLVVDTMNATATLAANDESG  339

Query  566  -SYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSC  742
              +A   E+  GS  +Y L QCT DLS  DC KCL  AI  L  CC + K G R +  SC
Sbjct  340  KKFATKEENFTGSQTLYSLVQCTPDLSIADCSKCLEGAIGALSLCC-SGKQGARTLTPSC  398

Query  743  NFRYETYPFYK  775
            N RYE YPFY+
Sbjct  399  NARYELYPFYQ  409



>ref|XP_007049618.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
 gb|EOX93775.1| Receptor-like protein kinase-related family protein, putative 
[Theobroma cacao]
Length=254

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 105/180 (58%), Gaps = 2/180 (1%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
             Y + ++G+  D+VYGLA CRGDVS+ DC SC+ DA T+IR+ CP  +   +WYD C L+
Sbjct  56   AYIATSSGRGPDRVYGLAQCRGDVSSKDCSSCIQDAATQIRQRCPNQSDARIWYDYCFLR  115

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDI  592
            YS+++F GE+D     +  N E   DP+SF Q+   L  ++  +A + K+     G   +
Sbjct  116  YSKENFIGEVDTSFGIFYYNVENVTDPESFNQELGALTNKIRSEAVMPKNEGLGKGKTKL  175

Query  593  GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                 +Y L QCTRDLS  DC +CL  A+   P  C   K G RV+  SC  RYE YPF+
Sbjct  176  SPFVTLYALVQCTRDLSEIDCAQCLAIAVGNFPNFCDNRK-GCRVLYSSCYVRYELYPFF  234



>emb|CBI23450.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 106/182 (58%), Gaps = 3/182 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+ +DKV  +ALCRGDV T  C+SCV D+  ++ +LCP     I WYD C+L+
Sbjct  114  GFYNFSYGQNSDKVNAIALCRGDVVTDACRSCVNDSRIQLTQLCPNQKEAIGWYDKCMLR  173

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS +  FG       FYM N E A + + F Q    L+  L  KAA    +  +A G  +
Sbjct  174  YSNNSIFGTAQTSLSFYMWNPENASNVEDFNQVLGNLMASLRSKAASGDSRHKFATGEAN  233

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DLS   C+ CL  A  E+P CC + K GGRVI+ SCN R+ETY F
Sbjct  234  VTSFVTIYGLMQCTPDLSEASCRDCLEGATNEIPNCCDSKK-GGRVIKPSCNLRFETYRF  292

Query  770  YK  775
            Y+
Sbjct  293  YE  294



>ref|XP_009418903.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/240 (38%), Positives = 137/240 (57%), Gaps = 2/240 (1%)
 Frame = +2

Query  56   KPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN  235
            + + +L   S+  +L  H   ++  L   C + A    +S FQ NLN LL +LSS+T   
Sbjct  3    RSYPVLLFFSLGLMLRCHA-TSSNFLWINCPHDANYTTNSTFQTNLNLLLASLSSSTAAT  61

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            GYS+ T G+ +D+V+GLALCRGDVS++ C++C+  A   I + CP      + YD+CLL+
Sbjct  62   GYSNDTEGQSSDQVHGLALCRGDVSSSVCQTCLDAAVQDIIQSCPNGMTSTICYDDCLLR  121

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS   FF  +D   +++  N +   D + F      L+  L +KA+     +AAG   + 
Sbjct  122  YSNQMFFSTVDTSFRYWAWNIQNVSDQQQFETTLGNLMDDLTEKASSSPKLFAAGSAKVT  181

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
                +YGL QC+RDLS +DC +CL D +  +P+CC + K GG+V   SC  R+E YP+Y 
Sbjct  182  SFDKLYGLVQCSRDLSADDCYRCLRDTVTFIPKCC-SWKQGGKVYAQSCYLRFELYPYYN  240



>ref|XP_008224765.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 140/247 (57%), Gaps = 5/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            MA     S+L  + +  +L+  +P  A  L H C N  T  P S FQ NLN LL  LSSN
Sbjct  14   MANLMLVSILSSIFVVTLLSFPSPAEADYLYHVCPNTTTFTPTSTFQSNLNRLLSTLSSN  73

Query  224  tPR-NGYSSGTAGKCT--DKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIV  391
                +G+ + TA   +  D+VYGL LCRGDV+ TD CK+CV++AT++  + CP     ++
Sbjct  74   AALPSGFYNATASSSSPNDRVYGLFLCRGDVAATDACKTCVSNATSEAVQRCPTEKQVVI  133

Query  392  WYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSY  571
            WYD+C+L+YS + FF    +    YM N + A +P  F Q     +  +A +A+     +
Sbjct  134  WYDDCMLRYSNESFFSTAAESPAVYMWNTQNATEPTRFNQVLATGMDEVATEASTDADKF  193

Query  572  AAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
            A    ++ G   +Y L QCT+DLS  DC +CL  AIA+ P CC   K+GGRV   SC  R
Sbjct  194  ATSQTNVSGLISVYSLGQCTQDLSTADCNRCLRGAIAQFPSCCN-GKLGGRVFNPSCYVR  252

Query  752  YETYPFY  772
            YE YPF+
Sbjct  253  YEVYPFF  259



>gb|KDO75583.1| hypothetical protein CISIN_1g010329mg [Citrus sinensis]
Length=513

 Score =   157 bits (398),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 131/246 (53%), Gaps = 9/246 (4%)
 Frame = +2

Query  62   FSLLPLLSI---AFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR  232
            FS+L L  I   +F  +         + HFC++ A    +S F+ NLN LL +L +N  R
Sbjct  6    FSVLFLFVIYLSSFQFSFTAAADPTYVYHFCSDTANFTRNSTFESNLNRLLTSLPTNASR  65

Query  233  -NGYSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWY  397
             NG+S G    TAG+  ++VY L LCRGD +T  C++CV  AT  +   CP +   IVWY
Sbjct  66   GNGFSRGFFNATAGQDPNRVYSLFLCRGDQTTNSCQNCVTFATRDVIGRCPVSKDTIVWY  125

Query  398  DNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAA  577
            D CLL+YS    F   +     Y+ N + A DP  F      L+   A +A      +A 
Sbjct  126  DECLLRYSNRYIFSTRETTRTVYLWNTQNATDPVKFNDLVGSLMGEAASQAVNDPKKFAT  185

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
             + +      +Y L QCT+DLS  DC  CL  AIA+LP CCG  K GGRV+  SCN RYE
Sbjct  186  KMANFTSFQKLYALAQCTQDLSSSDCNICLRGAIAQLPTCCG-GKQGGRVLTPSCNVRYE  244

Query  758  TYPFYK  775
             YPFY 
Sbjct  245  VYPFYN  250



>ref|XP_002304943.2| hypothetical protein POPTR_0004s02390g, partial [Populus trichocarpa]
 gb|EEE85454.2| hypothetical protein POPTR_0004s02390g, partial [Populus trichocarpa]
Length=282

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 133/242 (55%), Gaps = 8/242 (3%)
 Frame = +2

Query  68   LLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN---G  238
            LL LL++A I        A  L HFC N  TS  +S ++ NLN LL +L+SN  RN   G
Sbjct  10   LLSLLTLAIITLAQEDADANYLNHFCQNATTSTINSTYRVNLNLLLSSLASNATRNNTNG  69

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            + + + G+ TD+VYGL +CRGDVS T C++CV  AT  I + CP     IV+YD C+L+Y
Sbjct  70   FYNTSFGQNTDQVYGLFICRGDVSNTVCQNCVTFATKDIVQRCPVGIASIVYYDACILRY  129

Query  419  SEDDFFGEIDDVNKFYMANGEE-AKDPKSFMQKTKQLLTRLADKAALL---KSSYAAGVE  586
            S  +FF ++D    F + N +    +P+ F       +  LA +AA        +A    
Sbjct  130  SNVNFFSKVDQSPGFSLLNTQNITTEPQRFNNLVGAAVNDLAARAASAPPGAKKFAVNKT  189

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
                   IY L QCT DLS  DC +CL  AIA LP CC ++K+GGRV+  SC   YE   
Sbjct  190  SFNAFQNIYSLAQCTPDLSSSDCNRCLSAAIAGLPNCC-SSKIGGRVLFPSCYIHYEITE  248

Query  767  FY  772
            FY
Sbjct  249  FY  250



>ref|XP_010056929.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=527

 Score =   157 bits (398),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 99/180 (55%), Gaps = 0/180 (0%)
 Frame = +2

Query  233  NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
            +G+   T G+  DKVYGL LCRGDV+   C+SC+  AT KI E CP+    I+WYD CL+
Sbjct  68   DGFYKATEGEDPDKVYGLFLCRGDVAANLCQSCIDSATRKILENCPEEKEAIIWYDECLV  127

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI  592
            +YS   FF  ++     YM N     DP  F+Q  ++    + D A   K  YA    + 
Sbjct  128  RYSNRSFFTIMESTPALYMWNVNNVTDPNRFLQILRETFKNVTDSAISSKRLYATIKFNF  187

Query  593  GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                 ++ L QCT DLS  +C  CL  AI +LP   G  K GGRV+  SCN RYE YPFY
Sbjct  188  SSLVTLHELVQCTPDLSKLNCSDCLVSAIGQLPTFIGDGKQGGRVLLPSCNIRYELYPFY  247



>gb|KHN15830.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=675

 Score =   159 bits (401),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 106/181 (59%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+ +D+V  + LCRGD     C+SC  D+   + +LCP     IVWYDNC+L+
Sbjct  67   GFYNFSYGQESDRVNAIGLCRGDFKPDACRSCFNDSKVVLTQLCPNQKEAIVWYDNCMLR  126

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS    F  ++     YM N   A D   F Q  + LL  L  + +   S +     ++ 
Sbjct  127  YSNRSIFNTMEASPSAYMWNPGNATDVDQFNQVLRTLLYSLVSQGSSGDSRHKFAAANVS  186

Query  596  GSS--VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            G S   IYGL QCT DLS ++C  CL DAI+E+P+CC + K GGRV++ SCNFRYETYPF
Sbjct  187  GPSFQTIYGLVQCTPDLSEQECTSCLVDAISEIPRCCDSKK-GGRVMRPSCNFRYETYPF  245

Query  770  Y  772
            Y
Sbjct  246  Y  246



>sp|Q9LRL8.2|CRR21_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
21; Flags: Precursor [Arabidopsis thaliana]
Length=256

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 136/238 (57%), Gaps = 9/238 (4%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQLRHFCAN-FATSPPDSRFQKnlntllgnlssntPRNGYSS  247
            L LL I  +L+L+     A L H C N   T    + ++KNLN+L+  +S+     G+  
Sbjct  20   LQLLFIPNVLSLN--QTNAYLHHKCVNDQGTYNSGTPYEKNLNSLIRTISTLNLNFGFVH  77

Query  248  GTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSED  427
             + G   + V+    CRGD   + C+SC+A A ++IR  CPKN   I+WYDNC+L+ S  
Sbjct  78   SSNGDAPNSVFIKLQCRGDSYFSKCRSCLATANSEIRRRCPKNKEKIIWYDNCVLEISSI  137

Query  428  DFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS---YAAGVEDIG  595
            D F +ID  N F+M N ++   D + F + T+ LL  L +KA +       YAAG + +G
Sbjct  138  DTFNKIDYQNNFFMYNAKDVSGDIELFNKNTRDLLHELKEKANIKSKKDFMYAAGEKGLG  197

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                +Y + QCT+DL+  +C  CL   +A+LP+CC   K GGRV+  SCNFRYE YPF
Sbjct  198  EKK-LYAMVQCTKDLTPNNCNVCLNWIMAKLPKCC-KGKQGGRVLSTSCNFRYELYPF  253



>ref|XP_008800494.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=686

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 128/231 (55%), Gaps = 9/231 (4%)
 Frame = +2

Query  107  HTPMAAAQ-LRHFCANFATSPPDSRFQKnlntllgnlssntPRNG-YSSGTAGKCTDKVY  280
            H+P AAA  L   C       P S +  NL  +L +L +NT  +G +S+ T G+  +++Y
Sbjct  25   HSPPAAADPLYQICGKTGNYTPKSTYDSNLQLVLNSLDANTSLSGGFSNATVGQVPNQIY  84

Query  281  GLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNK  460
            GLALCRGD + + C+SC+  A      LCP + G I+WYD CLL YS   F   ID+ N 
Sbjct  85   GLALCRGDTNASVCRSCLDTAVVDAPNLCPYDKGAIIWYDYCLLHYSNQRFLSTIDNSNV  144

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGG----SSVIYGLTQC  628
             YM N +   DP  F +    L+ RLAD AA   +   A  E +      S  IYGL QC
Sbjct  145  VYMYNTQNITDPSRFDKLVNVLMGRLADWAADNSTEMFATGEMMNSTNPPSPTIYGLAQC  204

Query  629  TRDLSGEDCKKCLYDAIAEL-PQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            TRDLS   C++CL   + ++ PQ  G  K G R + GSCN+RYE Y FY+G
Sbjct  205  TRDLSRSQCRQCLSGMLNQIYPQFKG--KQGARELGGSCNYRYEIYSFYEG  253



>ref|XP_008804396.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=683

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 129/238 (54%), Gaps = 4/238 (2%)
 Frame = +2

Query  77   LLSIAFILALHTPMAAAQLRHFCANFATSPPDSRF-QKnlntllgnlssntPRNGYSSGT  253
            L S+ F+L    P AA  L  FC         S +            S+ +  +G+++ T
Sbjct  15   LGSLVFLLLRCAPTAADPLYEFCGGTGNYTAKSAYASNLNLLFPNLTSNASSSDGFATAT  74

Query  254  AGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDF  433
             G   ++++GLALCRGDV+T++C+SC+  A+  + +LCP N   IVWYD C+L+YS+ DF
Sbjct  75   IGLTPNQIFGLALCRGDVNTSECQSCLNTASKDVLQLCPYNKTAIVWYDPCMLRYSDQDF  134

Query  434  FGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS-SYAAG-VEDIGGSSV  607
                ++  + +M N +   D   F +   +L+  +AD AA   +  +A G V        
Sbjct  135  LSSYNNSRQVFMWNTQNVTDRDKFDKLLTELIDAVADYAAYNSTRRFATGEVNFTKPFPT  194

Query  608  IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKGA  781
            IYGL QCT D+ G  C++CL D I ++P+     K GGRV+   C FRYE YPFY GA
Sbjct  195  IYGLAQCTPDMPGSPCRRCLQDLINDIPKRFA-GKQGGRVLGRRCTFRYEVYPFYNGA  251



>ref|XP_010646639.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Vitis vinifera]
Length=681

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 106/182 (58%), Gaps = 3/182 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+ +DKV  +ALCRGDV T  C+SCV D+  ++ +LCP     I WYD C+L+
Sbjct  74   GFYNFSYGQNSDKVNAIALCRGDVVTDACRSCVNDSRIQLTQLCPNQKEAIGWYDKCMLR  133

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS +  FG       FYM N E A + + F Q    L+  L  KAA    +  +A G  +
Sbjct  134  YSNNSIFGTAQTSLSFYMWNPENASNVEDFNQVLGNLMASLRSKAASGDSRHKFATGEAN  193

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DLS   C+ CL  A  E+P CC + K GGRVI+ SCN R+ETY F
Sbjct  194  VTSFVTIYGLMQCTPDLSEASCRDCLEGATNEIPNCCDSKK-GGRVIKPSCNLRFETYRF  252

Query  770  YK  775
            Y+
Sbjct  253  YE  254



>ref|XP_006838094.1| hypothetical protein AMTR_s00106p00032870 [Amborella trichopoda]
 gb|ERN00663.1| hypothetical protein AMTR_s00106p00032870 [Amborella trichopoda]
Length=271

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 104/179 (58%), Gaps = 2/179 (1%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G++S T+G   D+VYGLALCRGD +T  C+ C+  +TT    LCP     I+WY+NCLL+
Sbjct  63   GFNSTTSGTSPDRVYGLALCRGDTTTAQCRDCMDMSTTDALRLCPNKKEAILWYNNCLLR  122

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS+  FFG I+ +   Y++N   A + +SF ++   L+  L  +A      YA+G     
Sbjct  123  YSDSSFFGSIEGI-LIYLSNINNATNQESFNKELGVLMRNLTTRAISDPRLYASGTIMYD  181

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                IYGL QCTRDL    C+ CL   I  +  CC   +VGG+V+ GSC  R+ET  F+
Sbjct  182  NFVTIYGLLQCTRDLDATKCRSCLESRIGNIQTCCN-GRVGGQVLSGSCILRFETESFF  239



>ref|XP_010908140.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Elaeis 
guineensis]
Length=366

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 104/186 (56%), Gaps = 5/186 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+S  T G+  +++YGLALCRGD   + C+SC+  A      LCP   G I+WYD+CLL 
Sbjct  70   GFSKATIGQIPNRIYGLALCRGDTDASVCRSCLDTAIQDAPNLCPYAKGTIIWYDHCLLH  129

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS   F   ID  N+ +M N  +  DP  F +    L+ R+AD AA   +   A  E + 
Sbjct  130  YSNQLFLSTIDTSNEIFMYNIYKITDPSRFDKLLDVLMGRIADWAAYNSTKMFATGEMMN  189

Query  596  GSS----VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             ++     IYGL QCTRDLS   C++CL   +   P      K G RV+ GSCN+RYE Y
Sbjct  190  STNPPFPTIYGLAQCTRDLSRSQCRQCLSGILDPRPSIF-EGKRGARVLGGSCNYRYEIY  248

Query  764  PFYKGA  781
            PFY GA
Sbjct  249  PFYLGA  254



>ref|XP_006468228.1| PREDICTED: uncharacterized protein LOC102629057 [Citrus sinensis]
Length=1332

 Score =   159 bits (401),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 101/260 (39%), Positives = 137/260 (53%), Gaps = 7/260 (3%)
 Frame = +2

Query  8    SQQSSLISVLATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQK  187
            +QQ S    +  + +S  F  +  LS +F  +         + HFC++ A    +S F+ 
Sbjct  650  TQQKSWELRMTPLKFSVLFLFVIYLS-SFQFSFTAAADPTYVYHFCSDTANFTRNSTFES  708

Query  188  nlntllgnlssntPR-NGYSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTK  352
            NLN LL +L +N  R NG+S G    TAG+  ++VY L LCRGD +T  C++CV  AT  
Sbjct  709  NLNRLLTSLPTNASRGNGFSRGFFNATAGQDPNRVYSLFLCRGDQTTNSCQNCVTFATRD  768

Query  353  IRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLT  532
            +   CP +   IVWYD CLL+YS    F   +     Y+ N + A DP  F      L+ 
Sbjct  769  VIGRCPVSKDTIVWYDECLLRYSNRYIFSTRETTRTVYLWNTQNATDPVKFNDLVGSLMG  828

Query  533  RLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAK  712
              A +A      +A  + +      +Y L QCT+DLS  DC  CL  AIA+LP CCG  K
Sbjct  829  EAASQAVNDPKKFATKMANFTSFQKLYALAQCTQDLSSSDCNICLRGAIAQLPTCCG-GK  887

Query  713  VGGRVIQGSCNFRYETYPFY  772
             GGRV+  SCN RYE YPFY
Sbjct  888  QGGRVLTPSCNVRYEVYPFY  907


 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 130/240 (54%), Gaps = 7/240 (3%)
 Frame = +2

Query  68   LLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSS  247
            +L L+   F+L++ T   A  L   C+N  +  P+S F+ NL  LL ++++NT + G+ +
Sbjct  1    MLLLVVQFFMLSIFTD--ANPLDIACSN-TSYAPNSPFESNLKLLLESIATNTSQ-GFYN  56

Query  248  GTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSED  427
             + G   ++V+G ALCRGDV+ T C++C+ +A  +I + C      I+WY+ C ++YS  
Sbjct  57   LSIGDDPNRVFGRALCRGDVNGTVCQNCLENARHEILKNCKTAEEAIIWYELCQIQYSYR  116

Query  428  DFFGEI--DDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGS  601
             F   +      + +    +   +P  F++    L+T L+ +A+   + +A G       
Sbjct  117  KFLVMVYAGQYAEKWNNQWKSVSNPARFIEVLTYLMTNLSIEASSDPAMFAVGEVKFPKR  176

Query  602  SVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKGA  781
              IYGL QCTRD++  DC  CL  A+ +L  CCG A+  G ++  +CN R++   FY  +
Sbjct  177  KTIYGLVQCTRDINSRDCNDCLTGALGDLKACCG-AREAGIIVNENCNLRFQLSLFYNAS  235



>ref|XP_006856952.1| hypothetical protein AMTR_s01216p00000700 [Amborella trichopoda]
 gb|ERN18419.1| hypothetical protein AMTR_s01216p00000700 [Amborella trichopoda]
Length=530

 Score =   155 bits (391),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 109/183 (60%), Gaps = 9/183 (5%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G++S T+G   D+ YGLA CRGD +T +C+ C+   TT   ++CP     I W D C+L+
Sbjct  61   GFNSTTSGTSPDQAYGLAQCRGDTTTAECEDCMNRTTTDALQVCPNRKEAIFWDDQCILR  120

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAA----LLKSSYAAGV  583
            YS+ +F G I + N+FY+ N   A DP SF ++   L+  L  +A     LL   YA+G 
Sbjct  121  YSDSNFIGSI-NTNRFYLWNVNNASDPDSFNRELGGLMRNLTSRAVSDPLLL---YASGK  176

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
                    IYGL QCTRDL    C+ CL +AIA++P+CC    VGG+V+ GSC  RYETY
Sbjct  177  TVYDNFVTIYGLLQCTRDLDAALCRNCLDNAIADIPKCC-NGHVGGQVLSGSCILRYETY  235

Query  764  PFY  772
             F+
Sbjct  236  SFF  238



>ref|XP_003551283.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Glycine 
max]
 gb|KHN31799.1| Cysteine-rich repeat secretory protein 55 [Glycine soja]
Length=257

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 120/232 (52%), Gaps = 4/232 (2%)
 Frame = +2

Query  86   IAFILALHTPMAAAQ--LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            I F+  L T  A A+  L  FC          +   N++ +L  ++  TP  G+ + T G
Sbjct  7    IIFLFFLCTWGAKAEDPLGRFCNENTIIGSGGKLSANIDKILTEIALKTPSTGFVATTYG  66

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
            K  DKVY LA CRGDVST DC +C+ DAT +IR+ CP    G +WYD C L+YS   FFG
Sbjct  67   KDQDKVYALAQCRGDVSTQDCSNCIQDATKQIRQRCPNQVDGRIWYDYCFLRYSNKSFFG  126

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGGSSVIYG  616
            E+D     +  N E   DP+ F ++   L+  +  +A + +      G   +     +Y 
Sbjct  127  EVDTSFGIFYFNVENVTDPEDFNKELGALMDHIRAQAVVPREEGLGKGKSVLSPFVTLYA  186

Query  617  LTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
            L QCTRDLS   C +CL  A+   P  C   K G RV+  SC  RYE YPF+
Sbjct  187  LVQCTRDLSEISCAQCLSIAVNNFPNFCSNRK-GCRVLYSSCYVRYELYPFF  237



>ref|XP_010468360.1| PREDICTED: putative cysteine-rich repeat secretory protein 23 
[Camelina sativa]
Length=260

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 106/169 (63%), Gaps = 10/169 (6%)
 Frame = +2

Query  293  CRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMA  472
            CRGD ST+ C++C+  A ++IR  CP N G I+WYDNC+L       + EID  N FY++
Sbjct  90   CRGDSSTSKCRTCLDTAFSEIRRRCPNNRGRIIWYDNCVLTILTFYTYAEIDYQNHFYIS  149

Query  473  NGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-------YAAGVEDIGGSSVIYGLTQC  628
            N ++   D KSF +KT+ LL RL +KA+  ++        YA G E +G    +YG+ QC
Sbjct  150  NAKDVSGDTKSFNEKTRALLHRLMEKASSKENVPSKKNYLYATGEESLGKMR-LYGMVQC  208

Query  629  TRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            T+DLS ++C  CL   +A+LP+CC   K GGR +  SCNFRYE YPF K
Sbjct  209  TQDLSIKNCSVCLNWILAKLPKCCN-GKQGGRFLSTSCNFRYELYPFVK  256



>emb|CDP03947.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 2/181 (1%)
 Frame = +2

Query  233  NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
            NG+++ + GK  D+V+GL  CRGDVS  DC SC+ DA+ +IR+LCP      +WYD C L
Sbjct  58   NGFTTSSYGKAKDQVFGLGQCRGDVSNEDCSSCIKDASKQIRKLCPTQADARIWYDYCFL  117

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKA-ALLKSSYAAGVED  589
            +Y  + FFG +D     +  N E   DP SF ++  +L  +++ +A A   +    G ++
Sbjct  118  RYETEKFFGRVDTSIGIFFYNVENVTDPDSFNKELGKLSDKISSEAVAPGNNGLGRGKKE  177

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     +Y L QCTRDLS   C++CL  AI E P  C   K G RV+  SC  RYE YPF
Sbjct  178  LSPFLTLYELVQCTRDLSQLSCEQCLAIAIGEFPTFCNNKK-GCRVLYSSCIVRYELYPF  236

Query  770  Y  772
            +
Sbjct  237  F  237



>ref|XP_009794300.1| PREDICTED: cysteine-rich repeat secretory protein 38-like, partial 
[Nicotiana sylvestris]
Length=134

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +2

Query  290  LCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYM  469
            LCRGDVS+T+CKSCV DA+ ++ +LCP +   I+WYDNCLLKYS +DF G+ID+  KFYM
Sbjct  1    LCRGDVSSTNCKSCVVDASEELGKLCPYDKEAIIWYDNCLLKYSYNDFLGKIDNTYKFYM  60

Query  470  ANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSV--IYGLTQCTRDLS  643
             N      P+SF  KTK+LL  L +KA   ++ YA G  ++ G     +YGL QCTRDLS
Sbjct  61   WNVRVVSKPESFNAKTKELLGSLVEKAYKKQNLYANGEMELIGDQYEKLYGLVQCTRDLS  120

Query  644  GEDCKKCLYDAIAE  685
             EDCK+CL   I E
Sbjct  121  SEDCKQCLEGIITE  134



>ref|XP_010267898.1| PREDICTED: uncharacterized protein LOC104605002 [Nelumbo nucifera]
Length=1359

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 118/213 (55%), Gaps = 3/213 (1%)
 Frame = +2

Query  143  CANFATSPPDSRFQKnlntllgnlss-ntPRN-GYSSGTAGKCTDKVYGLALCRGDVSTT  316
            C N  T P +  +Q NLN LL +LSS  TP N G+ + TAG+ ++ VYGL LCRGDV+  
Sbjct  42   CPNTTTYPSNGTYQNNLNLLLSSLSSNATPTNHGFYNTTAGRGSNTVYGLFLCRGDVTDD  101

Query  317  DCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDP  496
             C+ CV  A   I + CP     I WYD CLL+YS   FF  +D+   F M N +   DP
Sbjct  102  LCRECVKSAAQTITQRCPNGKVAITWYDECLLRYSNQSFFSIMDETPSFSMYNTQNNSDP  161

Query  497  KSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDA  676
            + F Q     L  LA   A   S YA    +      +Y L QCT DLSG  C +CL  A
Sbjct  162  RQFNQLVGDKLGELATTVASSASKYATLEANYTSFQSLYCLAQCTPDLSGSSCNQCLRGA  221

Query  677  IAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            I+ LP CC  A VG R ++ SCN RYE YPFY+
Sbjct  222  ISHLPVCCSGA-VGARAVRPSCNVRYEVYPFYR  253


 Score =   148 bits (374),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 120/227 (53%), Gaps = 9/227 (4%)
 Frame = +2

Query  110  TPMAAAQLRHFCANFATSP--PDSRFQ-KnlntllgnlssntPRNGYSSGTAGKCTDKVY  280
            TP    Q   +C N  T+   P+S +Q      L    S+ +  NG+ + TAG   + VY
Sbjct  724  TPTYVTQ---YCQNTTTNEFSPNSSYQVNLNLVLSFLTSNASSPNGFYNATAGLSNNTVY  780

Query  281  GLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNK  460
            GL LCRGDV+   C+ C+  A+ +I   CP      +WYD C+L+YS    F  I++V  
Sbjct  781  GLFLCRGDVTRDVCRECIETASREIIRRCPNGRVAYIWYDECMLRYSNQLIFSTINEVPG  840

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVEDIGGSSVIYGLTQCTR  634
            F   N  +  +P  F +  +Q++ RL ++ A   S   ++  V++   S  +Y L QCT 
Sbjct  841  FSFPNSSDVPNPGEFSKLLRQVVDRLRNRVAFDPSLGKFSTEVDNFTSSQTLYSLAQCTP  900

Query  635  DLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            DLS  DC +CL  ++A +P CC   K GG  +  SC+ RY+ YPF++
Sbjct  901  DLSANDCSRCLVGSVANIPICC-NGKQGGNFLNPSCSLRYDMYPFFR  946



>ref|XP_010466465.1| PREDICTED: putative cysteine-rich repeat secretory protein 25 
[Camelina sativa]
Length=258

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 141/260 (54%), Gaps = 15/260 (6%)
 Frame = +2

Query  32   VLATMAYSKPFSLLPLLSIAFILALHTPMAA----AQLRHFCANFATSPPDSRFQKnlnt  199
            ++++ + +KPF  + +L++  +   H+ ++     A L H C     +   + +++ +  
Sbjct  1    MMSSYSVTKPFVSVYVLAMVALQFPHSVLSLNHTNAYLNHICIKGEGTVKGNSYEEAVKG  60

Query  200  llgnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNN  379
            ++ ++S+     G+ +G       K+Y    CR D S + C+SC+  A  +IR  CP N 
Sbjct  61   VIDHMSTYLGY-GFVNGAGSDGPTKIYAKIQCRPDASESICRSCITTALPEIRRKCPNNK  119

Query  380  GGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPK-SFMQKTKQLLTRLADKAAL  556
            G I+WYDNCLL  S     G+ID    FYM N ++    K +F + TK LL  L +KA  
Sbjct  120  GRIIWYDNCLLDISSIYTLGKIDYRYIFYMYNSKDVSSNKMAFNKNTKALLYELKEKATS  179

Query  557  LKSS-------YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKV  715
             K         YAAG E +G + V Y + QCT+DLS ++C  CL   +A+LP+CC   K 
Sbjct  180  KKEIPYRRDYLYAAGEESLGTTKV-YAMVQCTKDLSAKNCSVCLDWIMAKLPKCC-NGKQ  237

Query  716  GGRVIQGSCNFRYETYPFYK  775
            GGRV+  SCNFRYE YPF K
Sbjct  238  GGRVLSPSCNFRYELYPFVK  257



>ref|XP_010247622.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=675

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 106/183 (58%), Gaps = 4/183 (2%)
 Frame = +2

Query  233  NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
            NG+ + TAG+  D+VYGL LCRGD++   C+SCV  AT  I + CP      +WYD+C+L
Sbjct  72   NGFYNTTAGRIPDRVYGLFLCRGDITDDVCQSCVETATQDIIQRCPNRKVATIWYDDCML  131

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI  592
            +YS+  FF     V+ FYM N +   D   F Q     + ++A++AA   S      ++ 
Sbjct  132  RYSDLSFFSVASGVS-FYMWNTQNITDRNKFDQILDDTMNQIANRAAFNSSPKKFSTQEA  190

Query  593  GGSS--VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
              SS   +Y L QCT DLSG  C  CL  AI+ +P CC   K GGRV+  SCN RYE YP
Sbjct  191  NFSSFQTLYSLVQCTPDLSGNSCYNCLLGAISNIPTCC-DGKQGGRVLGPSCNLRYEIYP  249

Query  767  FYK  775
            FY+
Sbjct  250  FYR  252



>sp|Q9LRL4.1|CRR24_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
24; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01376.1| unnamed protein product [Arabidopsis thaliana]
Length=262

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 137/256 (54%), Gaps = 20/256 (8%)
 Frame = +2

Query  29   SVLATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCAN-FATSPPDSRFQKnlntll  205
            S+LA +A   P       S+  +L+L+     A L H C N   T    S ++K +  L+
Sbjct  15   SILAIVAMQLP-------SVHSVLSLNE--TNAYLHHICINGEGTFKSGSPYEKEIKQLI  65

Query  206  gnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGG  385
              LSS      +  G +G   D +     CRGD     C+SC+A A ++IR  CP N G 
Sbjct  66   DFLSSFIKDYSFVHGVSGIGPDDINVKFQCRGDTLQAKCRSCLATAFSEIRSKCPNNKGR  125

Query  386  IVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLK  562
            I+WYDNC L  S    +G+ID  N FYM N ++ + D KSF +  K  L +L  KA+  +
Sbjct  126  IIWYDNCHLDLSSIYTYGQIDYKNNFYMYNAKDVRGDKKSFYKNMKAFLHKLKAKASSKE  185

Query  563  SS-------YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGG  721
            +        YAAG E + G+  +Y + QCT+DLS ++C  CL   + +LP+CC   K GG
Sbjct  186  NKPYVKDYMYAAGRESL-GTVKLYAMVQCTQDLSLKNCTVCLDWIMTKLPECC-NGKQGG  243

Query  722  RVIQGSCNFRYETYPF  769
            RV+  SCNFRYE YPF
Sbjct  244  RVLSPSCNFRYELYPF  259



>ref|XP_009357379.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=669

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 132/239 (55%), Gaps = 4/239 (2%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + SI  + +  T   A  L H C N  T  P+S FQ N+N LL  LSSN  R+ G+
Sbjct  11   TLLLIFSIFTLPSFLTKTEADYLYHICPNTTTFTPNSTFQSNVNRLLSTLSSNANRSTGF  70

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CVA AT +  ELCP     ++WYD+C+L+Y
Sbjct  71   YNATVQTPNNAVYGLFLCRGDVVGTDACETCVATATAQAPELCPVEKQAVIWYDDCMLRY  130

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKS-FMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            S + FF    +  +  M N +     ++ F Q  +  L ++A +AA     +A       
Sbjct  131  SNESFFSTSAESPRVSMLNTQNITTEQTRFNQMVEASLNQVATEAANDTDKFATKQAKFT  190

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                +Y L QCT+DLS   C +C   AI +LP CC + K GGR++  SCN RYE YPFY
Sbjct  191  DQITLYSLGQCTQDLSAAACDQCFRGAIGQLPICC-SGKQGGRILFPSCNVRYEIYPFY  248



>ref|XP_002518555.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43942.1| ATP binding protein, putative [Ricinus communis]
Length=671

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 134/245 (55%), Gaps = 10/245 (4%)
 Frame = +2

Query  59   PFSLLPLLSIAFILALHTPMAAAQLR-HFCANFATSPPDSRFQKnlntllgnlssntPRN  235
            P  LL LL +A I+   +P    + R HFC+N  T  P+S +Q NLN +L +LS+N   +
Sbjct  8    PIILLFLLRLAIIVKAESP----EYRYHFCSNTTTFTPNSTYQTNLNQVLSSLSNNANNS  63

Query  236  -GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
             G+ +  +G+  D VYG  LCRGDVST  C+ CV  AT  I + CP     IVWYD CLL
Sbjct  64   IGFFNIPSGQQPDDVYGSFLCRGDVSTDVCQDCVTFATQDIVKRCPIEKVAIVWYDQCLL  123

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSF---MQKTKQLLTRLADKAALLKSSYAAGV  583
            +Y    F   +D     +++N ++  DP  F   +  T + L   A  AA  +  +AA  
Sbjct  124  RYENQSFISTMDQTPGVFLSNTQDISDPDRFDNLLATTMENLATDASSAASGEKKFAATD  183

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
            ++      +Y L QCT DLS   C++CL  AI+ LP CCG  K G  V+  SCN RYE Y
Sbjct  184  DNFTAFQKLYSLVQCTPDLSNPGCRQCLRGAISNLPSCCG-GKRGANVLYPSCNVRYEVY  242

Query  764  PFYKG  778
            PF+  
Sbjct  243  PFFNA  247



>emb|CDP14580.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 128/233 (55%), Gaps = 3/233 (1%)
 Frame = +2

Query  77   LLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTA  256
            LL +  IL + T  +A     FC N  +    ++   N+++LL  L S T +NG+S+ + 
Sbjct  7    LLLLFTILCICTAESAELWSQFC-NHNSQINSTQLSANIDSLLAELMSGTVQNGFSTISY  65

Query  257  GKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFF  436
            GK  D+V+GLA CRGDVS+ DC SCV DA+ +IR+LCP  +   +WYD C ++Y  + FF
Sbjct  66   GKAEDQVFGLAQCRGDVSSEDCSSCVEDASKQIRKLCPSQSDARIWYDYCFVRYGTNKFF  125

Query  437  GEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALL-KSSYAAGVEDIGGSSVIY  613
            G++D        N E   DP SF ++   L  +++ +A          G + +     +Y
Sbjct  126  GQVDTSVGIIFYNVENVTDPDSFNKELASLSDKISSEAVKPGNKGLGRGKKQLSPFLTLY  185

Query  614  GLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             + QCTRDL+   C +CL  AI   P  C   K G RV+ GSC  RYE YPF+
Sbjct  186  EVAQCTRDLTPLSCDQCLAIAIGNFPIFCNNKK-GCRVLHGSCIVRYELYPFF  237



>ref|XP_006406033.1| hypothetical protein EUTSA_v10022150mg [Eutrema salsugineum]
 gb|ESQ47486.1| hypothetical protein EUTSA_v10022150mg [Eutrema salsugineum]
Length=256

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 134/258 (52%), Gaps = 24/258 (9%)
 Frame = +2

Query  59   PF-SLLPLLSIAFILALHTPMAAAQL-----RHFCANFAT-----SPPDSRFQKnlntll  205
            PF  L+P+L+I  I  L   +++  L      H C N        SP +    + + ++ 
Sbjct  3    PFVGLVPILAIVTIQLLPRSVSSLNLTNEYLHHECINSQGKYKKGSPFEDNLNRVIRSVS  62

Query  206  gnlssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGG  385
               +    R+G+     G   +KVY    CR D   + C++C+A A   +R  CP+N G 
Sbjct  63   TTSNF---RDGFDDTAFGDGPNKVYARLQCRADSYWSKCRTCLATAIAGLRRRCPRNKGA  119

Query  386  IVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLK  562
            I+WYD CLL+ S     G+ID  NKFY++N  +   +P SF ++T   L  LA KA   K
Sbjct  120  IIWYDQCLLRISTIRVSGKIDYENKFYLSNPNKVNGNPVSFNKETSAFLENLAYKATDTK  179

Query  563  SS-------YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGG  721
            +        YA+G + IG ++ +Y + QCT+DL    C +CL   + E P CC   KVGG
Sbjct  180  NVDGIALVLYASGEKTIGTTN-LYAMVQCTKDLVFNSCLECLKWILEEFPTCCD-GKVGG  237

Query  722  RVIQGSCNFRYETYPFYK  775
            RV+  SCNFRYE YPF +
Sbjct  238  RVLSTSCNFRYELYPFLR  255



>ref|XP_008384459.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=658

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 94/244 (39%), Positives = 131/244 (54%), Gaps = 9/244 (4%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + S+  +L+  T   A  L H C N  T  P+S FQ NLN LL  LSSN  R+ G+
Sbjct  11   TLLLIFSVFTLLSFPTSTDADYLXHICPNTTTFTPNSTFQSNLNRLLSTLSSNANRSTGF  70

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + +     + VYGL LCRGDV  TD C++CVA AT +  + CP     ++WYD C+L+Y
Sbjct  71   YNASVQTPNNDVYGLFLCRGDVVGTDSCETCVATATAEAPQRCPVEKQMVIWYDYCMLRY  130

Query  419  SEDDFFGEIDDVNKFYMANGEEAK---DPKSFMQKTKQLLTRLADKAALLKSSYAAGVED  589
            S + FF   DD    YM N + A    D   F +     +T +A + +     +A    +
Sbjct  131  SNESFFSRADDKPXVYMWNTQNASSITDQNRFNEVLAATVTXVAAQTSNSSHKFATKETN  190

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            + GS  +YG  QCT+DL   DC  CL  A  ++P+       GGR ++ SCN R+E YPF
Sbjct  191  VSGSITLYGFGQCTQDLXSGDCNWCLLXAATQIPR----TSAGGRXLKPSCNLRFEVYPF  246

Query  770  YKGA  781
            Y  A
Sbjct  247  YSSA  250



>ref|XP_003556008.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 1 [Glycine max]
Length=675

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 104/181 (57%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+ +D+V  + LCRGDV    C+ C  D+   + +LCP     I WYDNC+L+
Sbjct  67   GFYNFSYGQESDRVNAIGLCRGDVKPDACRICFNDSKVLLTQLCPNQKEAIGWYDNCMLR  126

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS    F  ++ +  F M N     D   F Q  + LL  L  + +   S +     ++ 
Sbjct  127  YSNRSIFNTMEALPSFSMRNHGNTTDVDQFNQVLRTLLYSLVGQGSSGDSRHKFAAANVS  186

Query  596  GS--SVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            G     IYGL QCT DLS ++C  CL DAI+E+P+CC + K GGRV++ SCNFRYETYPF
Sbjct  187  GPGFETIYGLVQCTPDLSEQECTSCLVDAISEIPRCCDSKK-GGRVVRPSCNFRYETYPF  245

Query  770  Y  772
            Y
Sbjct  246  Y  246



>ref|XP_006838099.1| hypothetical protein AMTR_s00106p00036910 [Amborella trichopoda]
 gb|ERN00668.1| hypothetical protein AMTR_s00106p00036910 [Amborella trichopoda]
Length=284

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 138/237 (58%), Gaps = 5/237 (2%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntP-RNGY  241
            +LLPL  + F L LH  +A A++   C         SR+++NLN+LL +L ++ P   G+
Sbjct  8    TLLPLSLLQFTLLLH--IAEAEVYELCLGSTNYTAGSRYEENLNSLLQSLKADVPISRGF  65

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
            ++  +G  + +VYGLA CRGD +T  C+ C+  +TT  ++LCP     I WYD+CLL+YS
Sbjct  66   NATASGTSSPRVYGLAQCRGDTTTAKCRDCMYTSTTDAQQLCPNRKEAIFWYDDCLLRYS  125

Query  422  EDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGS  601
            + DF G I   N+ Y+ N   A DP+SF ++   L+  L+ +A      YA+G       
Sbjct  126  DSDFIGSITQ-NRLYLWNIYNATDPESFNKELAGLMRNLSSRAISDALLYASGNTVYDNF  184

Query  602  SVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
              I+GL QCTRDL   +C++CL  AI ++P CC     G  V+ GSC  RYETY F+
Sbjct  185  VTIHGLLQCTRDLDATECRRCLEGAIGDIPSCCDGRVGGR-VLGGSCFLRYETYSFF  240



>sp|Q9LRL7.2|CRR22_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
22; Flags: Precursor [Arabidopsis thaliana]
Length=279

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 140/259 (54%), Gaps = 25/259 (10%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQ----LRHFCANF-ATSPPDSRFQKnlntllgnlssntPRN  235
            + ++ I  +++L+   +  Q    L H C N   T  P S +++NLN ++  +S      
Sbjct  21   VQIVFIHCVMSLNETNSLNQTNVYLHHICINSQGTYKPGSPYEENLNRVIRAISITISNY  80

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+  G+ G   + V+G   CRGD   + C+SC+  A +++R  CPKN G I+WYDNCLL+
Sbjct  81   GFVHGSNGDAPNTVFGKLQCRGDSYLSKCRSCLTTAFSELRGRCPKNKGRIIWYDNCLLE  140

Query  416  YSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSSYA-AGVED  589
             S  +  G+ID    FYM N ++   D   F + T+ LL RL +KA   +++     + +
Sbjct  141  ISPINSLGKIDYEYNFYMYNEKDVNGDTNLFNKNTRALLYRLKEKATSKENNNGKQDLPE  200

Query  590  IGGSSV-----------------IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVG  718
            IGG  +                 +YG+ QCT+DLS +DC  CL   IA+LP CC + K G
Sbjct  201  IGGKRLGMKMLYATGEKSLRTMKLYGMVQCTKDLSIKDCIVCLNWIIAKLPTCC-SNKQG  259

Query  719  GRVIQGSCNFRYETYPFYK  775
            GRV+  SCNFRYE Y F K
Sbjct  260  GRVLSTSCNFRYELYRFVK  278



>ref|XP_010267806.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Nelumbo nucifera]
Length=643

 Score =   153 bits (386),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 105/184 (57%), Gaps = 3/184 (2%)
 Frame = +2

Query  230  RNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            RNG+S+ TAG+  + VYGL LCRGDV+   C++CV  A+ +I   CP      +WYD C+
Sbjct  68   RNGFSNATAGQSNNTVYGLFLCRGDVTHDVCRNCVETASLEIIRRCPNRKVAYIWYDECM  127

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGV  583
            L+YS    F  I++V  F  +N     DP  F +   Q++ RL ++ A   S   +  G 
Sbjct  128  LRYSNLFIFSTINEVPGFSFSNSPNISDPDGFRELLIQVVNRLTNRVAFDPSVGKFTTGE  187

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +   S  +Y L QCT DLS  DC +CL  +IA++P CC   K G  ++  SC+ RY+ Y
Sbjct  188  YNFTSSQTLYSLAQCTPDLSANDCNRCLRGSIAQIPICCD-GKQGAIILNPSCSLRYDMY  246

Query  764  PFYK  775
            PF++
Sbjct  247  PFFR  250



>ref|XP_010481161.1| PREDICTED: putative cysteine-rich repeat secretory protein 10 
[Camelina sativa]
Length=264

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 106/173 (61%), Gaps = 10/173 (6%)
 Frame = +2

Query  275  VYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDV  454
            +Y    CRGD S + C+SC+  A + IR LCP N G I+WYDNC+L  S    +GEID+ 
Sbjct  87   IYAKFQCRGDTSESKCRSCLTTAFSGIRRLCPHNKGRIIWYDNCILDLSSIYTYGEIDNK  146

Query  455  NKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-------YAAGVEDIGGSSVI  610
            + FY+ N ++   D K F + T+ LL +L +KA+  +         YAAG E +G    +
Sbjct  147  HIFYLYNAKDVNGDTKLFNKNTRALLYKLKEKASRKEQKPYRKDYMYAAGEESLGKMK-L  205

Query  611  YGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            Y + QCT+DLS ++C  CL   +A+LP+CC   K GGRV+  +CNFRYE YPF
Sbjct  206  YAMVQCTQDLSVKNCSVCLDGIMAKLPRCCN-GKQGGRVLNPNCNFRYEFYPF  257



>ref|XP_010267805.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=662

 Score =   153 bits (386),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 105/184 (57%), Gaps = 3/184 (2%)
 Frame = +2

Query  230  RNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            RNG+S+ TAG+  + VYGL LCRGDV+   C++CV  A+ +I   CP      +WYD C+
Sbjct  68   RNGFSNATAGQSNNTVYGLFLCRGDVTHDVCRNCVETASLEIIRRCPNRKVAYIWYDECM  127

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGV  583
            L+YS    F  I++V  F  +N     DP  F +   Q++ RL ++ A   S   +  G 
Sbjct  128  LRYSNLFIFSTINEVPGFSFSNSPNISDPDGFRELLIQVVNRLTNRVAFDPSVGKFTTGE  187

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +   S  +Y L QCT DLS  DC +CL  +IA++P CC   K G  ++  SC+ RY+ Y
Sbjct  188  YNFTSSQTLYSLAQCTPDLSANDCNRCLRGSIAQIPICCD-GKQGAIILNPSCSLRYDMY  246

Query  764  PFYK  775
            PF++
Sbjct  247  PFFR  250



>emb|CDP03948.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/250 (37%), Positives = 141/250 (56%), Gaps = 10/250 (4%)
 Frame = +2

Query  35   LATMAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnl  214
            +  MA S+   LL +LS + I A+   ++       C++ +T P  ++   N+++L+  L
Sbjct  59   IRNMALSRFIFLLWILS-SCIFAVLADVSVEN----CSDNSTIPT-AQMSANIDSLVAEL  112

Query  215  ssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
            +S+T +N +S  T GK TDKVYGL  CRGDV++TDC +C+ DA   IR  C       +W
Sbjct  113  ASSTSQNRFSIATYGKGTDKVYGLGQCRGDVNSTDCTTCIQDAAKNIRTNCQNQTDAWLW  172

Query  395  Y-DNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL-LKSS  568
              DNC+L++ +D FFG +D  +   + N +  + P +F ++   L+++++ +A +     
Sbjct  173  QNDNCILRFDDDQFFGNVDPSSFANLYNNDHPQHPSAFKKQLDALISKVSSEAVVPANEG  232

Query  569  YAAGVE-DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAK-VGGRVIQGSC  742
               G    +  +  IY LTQCTRDLS   C +CL  AI   P+ C   K VG RV+ GSC
Sbjct  233  LGRGKSFSVASNDTIYALTQCTRDLSRHSCSECLNIAIGNFPKFCNNEKTVGCRVLYGSC  292

Query  743  NFRYETYPFY  772
              RYE YPFY
Sbjct  293  YVRYEIYPFY  302



>gb|KHN02664.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=261

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 104/181 (57%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+  DKV  + LCRGD+   +C+SC+ DA   + + CP     I++YD CLL+
Sbjct  66   GFYNLSYGENEDKVNAIGLCRGDLKPDECRSCLNDARGNLTQRCPNQKEAIIYYDECLLR  125

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVED  589
            YS+   FG ++    + + N + A +   F Q  + L+  L   AA   S   YAA    
Sbjct  126  YSDRSIFGVMETSPDYVLFNIQNATNVGQFNQVLRNLMRMLTGIAASGDSRRKYAAASAT  185

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  IYGL QCT DLS  +CK CL  AI+E+P+CC   K+GGRV++ SCN RYE YPF
Sbjct  186  ATNIQAIYGLVQCTPDLSQPECKHCLIGAISEIPRCCN-GKIGGRVLRPSCNIRYENYPF  244

Query  770  Y  772
            Y
Sbjct  245  Y  245



>ref|XP_006449122.1| hypothetical protein CICLE_v10015972mg [Citrus clementina]
 gb|ESR62362.1| hypothetical protein CICLE_v10015972mg [Citrus clementina]
Length=317

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 104/182 (57%), Gaps = 5/182 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+  DKV  + LCRGDV    C+SC+A AT ++ + CP     I+WYDNC+L+
Sbjct  68   GFFNISYGQNLDKVNAMGLCRGDVKPDSCRSCIATATVELPKRCPNEKEAIIWYDNCMLR  127

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI-  592
            YS   FFG ++    F M N + A D  +F Q  K LL  L  KAA     +A G  +  
Sbjct  128  YSNRFFFGNMEFGPWFSMYNLKNASDASTFNQAVKSLLDSLKIKAA-PGDKFATGNANTS  186

Query  593  --GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
               GS  IY L QCT DLS + C  CL +A   LP+CC   ++GGRVI  SCNFRYE   
Sbjct  187  AGAGSQTIYALVQCTPDLSEQQCIDCLNNATELLPKCCD-GRLGGRVIAPSCNFRYEIGR  245

Query  767  FY  772
            FY
Sbjct  246  FY  247



>gb|KDO75586.1| hypothetical protein CISIN_1g021048mg [Citrus sinensis]
Length=318

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+  DKV  + LCRGDV    C+SC+A AT  +   CP     I+WYDNC+L+
Sbjct  68   GFFNISYGQNLDKVNAMGLCRGDVKPDSCRSCIATATLALPTRCPNQKEAIIWYDNCMLR  127

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI-  592
            YS   FFG ++   +F M N + A D  +F Q  K LL  L  KAA     +A G  +  
Sbjct  128  YSNRFFFGNMEFGPRFSMYNLKNASDASTFNQAVKSLLDSLKIKAA-PGDKFATGNANTS  186

Query  593  --GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
               GS  IY L QCT DLS + C  CL +A   LP+CC   ++GGRVI  SCNFRYE   
Sbjct  187  AGAGSQTIYALVQCTPDLSEQQCIDCLNNATELLPKCCD-GRLGGRVIAPSCNFRYEIDR  245

Query  767  FY  772
            FY
Sbjct  246  FY  247



>ref|XP_006467960.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Citrus 
sinensis]
Length=320

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+  DKV  + LCRGDV    C+SC+A AT  +   CP     I+WYDNC+L+
Sbjct  68   GFFNISYGQNLDKVNAMGLCRGDVKPDSCRSCIATATLALPTRCPNQKEAIIWYDNCMLR  127

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI-  592
            YS   FFG ++   +F M N + A D  +F Q  K LL  L  KAA     +A G  +  
Sbjct  128  YSNRFFFGNMEFGPRFSMYNLKNASDASTFNQAVKSLLDSLKIKAA-PGDKFATGNANTS  186

Query  593  --GGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
               GS  IY L QCT DLS + C  CL +A   LP+CC   ++GGRVI  SCNFRYE   
Sbjct  187  AGAGSQTIYALVQCTPDLSEQQCIDCLNNATELLPKCCD-GRLGGRVIAPSCNFRYEIDR  245

Query  767  FY  772
            FY
Sbjct  246  FY  247



>ref|XP_006850463.1| hypothetical protein AMTR_s00035p00086030 [Amborella trichopoda]
 gb|ERN12044.1| hypothetical protein AMTR_s00035p00086030 [Amborella trichopoda]
Length=255

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 126/220 (57%), Gaps = 3/220 (1%)
 Frame = +2

Query  116  MAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntP-RNGYSSGTAGKCTDKVYGLAL  292
            MAA    + C        +S++++NLN LL +L +N P   G++S T G   D+V+GL L
Sbjct  22   MAAIPTGNVCLGTTNYTSNSQYEQNLNQLLQSLQANVPVSGGFNSTTLGTSPDQVFGLGL  81

Query  293  CRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMA  472
            CRGDV TT+C  C++++T++I  LCP +   I WYD C+++YS+ +FFG +D   +  + 
Sbjct  82   CRGDVKTTECTKCISNSTSEILRLCPGSKEAIAWYDTCIVRYSDSNFFGTVDGY-RGGLL  140

Query  473  NGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGED  652
            N +   D  SF +    L+  L+  A      YA+G          YGL QCTRDL    
Sbjct  141  NTQNVSDVTSFREALGTLMRDLSSTAPYNPLMYASGQAVYADFFTFYGLVQCTRDLDAPQ  200

Query  653  CKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
            C+ CL + I ++P CC + K+GG++I GSC  R+E   F+
Sbjct  201  CEVCLENLIQKIPSCC-SDKLGGQIISGSCFLRFEDSRFF  239



>ref|XP_010463431.1| PREDICTED: putative cysteine-rich repeat secretory protein 25 
[Camelina sativa]
Length=264

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 10/173 (6%)
 Frame = +2

Query  275  VYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDV  454
            +Y    CRGD S + C+SC+  A ++IR LCP N G I+WYDNC+L  S    +GEID+ 
Sbjct  87   IYAKFQCRGDTSESKCRSCLTTAFSRIRRLCPNNKGRIIWYDNCILDLSSIYTYGEIDNK  146

Query  455  NKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-------YAAGVEDIGGSSVI  610
            + F++ N ++   D KSF + TK LL +L +KA+  +         YAAG E +G    +
Sbjct  147  HIFFLYNAKDVNGDTKSFNKNTKALLYKLKEKASRKEQKPYRKDYMYAAGEESLGKMK-L  205

Query  611  YGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            Y + QCT+DLS ++C  CL   +A+LP+CC   K GGR +  + NFRYE YPF
Sbjct  206  YAMVQCTQDLSVKNCSVCLDGIMAKLPRCCN-GKQGGRFLNPNSNFRYELYPF  257



>dbj|BAB01372.1| unnamed protein product [Arabidopsis thaliana]
Length=262

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 127/220 (58%), Gaps = 7/220 (3%)
 Frame = +2

Query  125  AQLRHFCAN-FATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRG  301
            A L H C N   T    + ++KNLN+L+  +S+     G+   + G   + V+    CRG
Sbjct  42   AYLHHKCVNDQGTYNSGTPYEKNLNSLIRTISTLNLNFGFVHSSNGDAPNSVFIKLQCRG  101

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            D   + C+SC+A A ++IR  CPKN   I+WYDNC+L+ S  D F +ID  N F+M N +
Sbjct  102  DSYFSKCRSCLATANSEIRRRCPKNKEKIIWYDNCVLEISSIDTFNKIDYQNNFFMYNAK  161

Query  482  EAK-DPKSFMQKTKQLLTRLADKAALLKSS---YAAGVEDIGGSSVIYGLTQCTRDLSGE  649
            +   D + F + T+ LL  L +KA +       YAAG + +G    +Y + QCT+DL+  
Sbjct  162  DVSGDIELFNKNTRDLLHELKEKANIKSKKDFMYAAGEKGLGEKK-LYAMVQCTKDLTPN  220

Query  650  DCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +C  CL   +A+LP+CC   K GGRV+  SCNFRYE YPF
Sbjct  221  NCNVCLNWIMAKLPKCC-KGKQGGRVLSTSCNFRYELYPF  259



>emb|CAN73037.1| hypothetical protein VITISV_044347 [Vitis vinifera]
Length=337

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  314  TDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAKD  493
            T+ K+CV +AT ++   CP N G I+WY NCL KYS  +FFGEID+ NKFYM N + A D
Sbjct  184  TNYKTCVTEATKELCNRCPHNRGAIIWYYNCLFKYSNVEFFGEIDNKNKFYMYNVQSADD  243

Query  494  PKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYD  673
            P SF  KTK+L + L++KA      +A G   +  S  +YGL QCTR+LS  DCKKCL  
Sbjct  244  PTSFNVKTKELSSSLSNKAYGSPVLFATGELVLEESMKLYGLAQCTRNLSSLDCKKCLDG  303

Query  674  AIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            A++ELP CC   +  GRV+ GSCN RYE YPF
Sbjct  304  AVSELPSCCDGKRG-GRVVGGSCNVRYELYPF  334


 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            M +S+  + L LLS AF+L   T      L HFC++      +  ++ NLN L+G L   
Sbjct  1    MYFSRFVTSLYLLSFAFLL--QTIAGTDPLYHFCSSSZKFIDNGTYETNLNKLMGYLYLA  58

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
             P  G+  G+ G+  D+V GLALCRGDVS TDCK+C+ +++++IR+ CP N   I+WYD 
Sbjct  59   APPTGFGKGSVGENNDQVNGLALCRGDVSNTDCKACITESSSEIRKRCPDNKAAIIWYDY  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMAN  475
             LLKYS  +FFG++D  N FYM N
Sbjct  119  XLLKYSNVNFFGQVDHQNMFYMWN  142



>ref|XP_010910126.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=683

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 126/230 (55%), Gaps = 7/230 (3%)
 Frame = +2

Query  107  HTPMAAAQL-RHFCANFATSPPDSRFQKnlntllgnlssntPRNG-YSSGTAGKCTDKVY  280
            H+P AAA L    C N      +S +  NLN LL +L SNT  +G +S+ T G+  +++Y
Sbjct  25   HSPPAAADLLAQKCGNTGNYTTNSTYASNLNILLTSLDSNTSLSGGFSNFTVGQIPNQIY  84

Query  281  GLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNK  460
            GLALCRGD + + C+SC+  AT     LCP     I WYD+CLL YS   FF  ID  ++
Sbjct  85   GLALCRGDTNASTCRSCLDIATQNAPNLCPYAKSAIFWYDDCLLHYSNQRFFSTIDTSDE  144

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSS----VIYGLTQC  628
             +M N     DP  F      L+ R+ D AA   +   A  E +  ++     IYGL QC
Sbjct  145  IWMYNTNNITDPSQFDNLVGVLMNRIVDWAASNSTKMFATGEMLNSTNSPLPTIYGLAQC  204

Query  629  TRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            TRDLS   C++CL   +  LP      K G RV+ GSCN+RYE Y FY+G
Sbjct  205  TRDLSRSQCQQCLTGMLDPLPAAF-KGKQGARVLGGSCNYRYEIYSFYEG  253



>ref|XP_009360784.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=882

 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 133/238 (56%), Gaps = 3/238 (1%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + SI  + +  T   A  + + C N  T  P+S FQ N+N LL  LSSN  R+ G+
Sbjct  3    TLLLIFSIFTLPSFLTSTKAEYVYNICPNTTTFTPNSIFQSNVNHLLSTLSSNANRSTGF  62

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYS  421
             + T     + VYGL LCRGDV T  C++CVADATT+  +LCP     ++WYD C+L+YS
Sbjct  63   YNDTVQTTNNAVYGLFLCRGDVGTDVCETCVADATTEAPKLCPTEKEAVIWYDECMLRYS  122

Query  422  EDDFFGEIDDVNKFYMANGEEAKDPKS-FMQKTKQLLTRLADKAALLKSSYAAGVEDIGG  598
             + FF    +    ++ N +   + ++ F Q     +  +A +AA     +AA       
Sbjct  123  YESFFSTSAENPSVFLRNVQNVTEQQTRFNQVLAASMNEVATEAANDAYKFAAKQTKFSD  182

Query  599  SSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
               +Y L QCT+DLS   C +CL  AIA+L  CC + K GGRV+  SCN RYE YPFY
Sbjct  183  QITLYSLGQCTQDLSAAVCNRCLAVAIAQLQSCC-SGKQGGRVLFPSCNVRYEIYPFY  239


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 119/223 (53%), Gaps = 10/223 (4%)
 Frame = +2

Query  110  TPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GYSSGTAGKCT---DKV  277
            TP  A +L   C + AT  P+S FQ NLN LL  LSS   R+ G+ + T        D V
Sbjct  249  TPTEAVRLVEDCRDPATFTPNSAFQSNLNLLLSTLSSKATRDTGFYNATVSSSQNPDDTV  308

Query  278  YGLALCRGDV-STTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDV  454
            YGL LC  DV ST DCK+CVA AT++  + CP     I+WY+NC+L+YS+  FF   DD 
Sbjct  309  YGLFLCGVDVVSTDDCKTCVATATSEAPQNCPSRKNVIIWYNNCMLRYSDVSFFSRADDE  368

Query  455  NKFYMAN-GEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQCT  631
              + + N G+   +  SF +    ++ +LA +A+     +A    D+ GS  +  L QCT
Sbjct  369  PFWPIENTGKVTVNQTSFYEVLAAMVNKLAAQASNESRKFATKTADVLGSISLKVLAQCT  428

Query  632  RDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
            +DLS  DC  CL   I + P+     + GGR++  SC    E 
Sbjct  429  QDLSSRDCNLCLRRTIEKFPRI----QQGGRLLCPSCRLTIEV  467



>ref|XP_003635677.2| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=684

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 105/182 (58%), Gaps = 3/182 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+ +DKV  +ALCRGDV T  C+SCV ++  ++ +LCP     I WYD C+L+
Sbjct  77   GFYNFSYGQNSDKVNAIALCRGDVMTDACRSCVNNSRIQLTQLCPNQKEAIGWYDECMLR  136

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS +  FG       FYM N E A + + F Q    L+  L  KAA    +  +A G  +
Sbjct  137  YSNNSIFGTAQTSPSFYMWNVENASNVEDFNQVLGNLMASLRSKAASGDWRHKFATGEAN  196

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DL    C+ CL  A  E+P+CC + K GGRV++ SCN R+ET  F
Sbjct  197  VSSFVTIYGLMQCTPDLPESSCRDCLEGATNEIPKCCDSKK-GGRVVRPSCNLRFETSRF  255

Query  770  YK  775
            Y+
Sbjct  256  YE  257



>ref|XP_006406226.1| hypothetical protein EUTSA_v10022184mg [Eutrema salsugineum]
 gb|ESQ47679.1| hypothetical protein EUTSA_v10022184mg [Eutrema salsugineum]
Length=318

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 127/225 (56%), Gaps = 9/225 (4%)
 Frame = +2

Query  125  AQLRHFCANF-ATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKVYGLALCRG  301
            A L H C N   T  P S +++N+N  +  +       G+     G   + VY    CRG
Sbjct  90   AYLHHTCINSQGTYRPGSPYEENVNRAIKTMFKKLLDYGFIHSVVGDAPNTVYPKLQCRG  149

Query  302  DVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGE  481
            D+S + C SC+  A   IR+ CPKN G I+WY+NC+L+ S    + +ID  N F++ N +
Sbjct  150  DLSLSQCHSCLTTAFAGIRKRCPKNKGRIIWYENCVLEISSVYRWSQIDYQNNFFLYNAK  209

Query  482  EAK-DPKSFMQKTKQLLTRLADKAA------LLKSSYAAGVEDIGGSSVIYGLTQCTRDL  640
            +A  D +SF +KTK LL  L +KA+        K+   A +E+  G+  +YG+ QC +DL
Sbjct  210  DASGDKESFNKKTKALLYNLKEKASSKENDPYGKNYMYATMEESLGTMKLYGMVQCMKDL  269

Query  641  SGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            S ++C  CL   +A+ P+CC   K GGRV+  SCNFRYE YPF K
Sbjct  270  SVKNCSLCLDWIMAKFPKCC-NGKQGGRVLCTSCNFRYELYPFVK  313



>ref|XP_002518557.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF43944.1| DUF26 domain-containing protein 1 precursor, putative [Ricinus 
communis]
Length=295

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 98/247 (40%), Positives = 134/247 (54%), Gaps = 5/247 (2%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFI-LALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlss  220
            M  S    +L LLSI F+ LA  T    A L ++C N      +S +Q NLN LL ++ +
Sbjct  1    MPSSISLFVLSLLSIQFLALANVTVAQPAMLYNYCVNNGNYTTNSTYQTNLNHLLTSIYT  60

Query  221  ntPRN-GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWY  397
            NT    G+ + + G+  DKV  +ALCR D+S   C++CV +A+  +  +CP +   I  Y
Sbjct  61   NTEITYGFYNFSYGQNPDKVSAIALCRPDISPDACRACVRNASDSLMTICPNSKEAIGGY  120

Query  398  DNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--Y  571
            DNC+L+Y+    FG+++    F++       D   F Q    LL +L D+AA   SS  Y
Sbjct  121  DNCMLRYANRSIFGQVEGGPYFWVYGLNNVSDVTGFNQSRAALLDKLTDQAASGNSSYKY  180

Query  572  AAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
            A G      S  IY L QCT DLS + C  CL  +I  +PQCC   + GGRVI  SCNFR
Sbjct  181  ATGHTGAPNSQNIYALLQCTPDLSKQQCMDCLTQSIELIPQCCN-ERQGGRVITPSCNFR  239

Query  752  YETYPFY  772
            YET  FY
Sbjct  240  YETGLFY  246



>ref|XP_007223972.1| hypothetical protein PRUPE_ppa014621mg [Prunus persica]
 gb|EMJ25171.1| hypothetical protein PRUPE_ppa014621mg [Prunus persica]
Length=664

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 110/188 (59%), Gaps = 8/188 (4%)
 Frame = +2

Query  230  RNGYS--SGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            RNGY   + + G+  D+VY + LCRGD+ +  C  C++DAT  + E CP     I WYDN
Sbjct  59   RNGYGFYNSSRGQNADRVYAMGLCRGDIKSDGCGKCLSDATYVLTESCPNQKEAIGWYDN  118

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDP--KSFMQKTKQLLTRLADKAALLKS-SYA  574
            C+L+YS    +G ++ +  +YM N +        +F QK   LL  L  +AA +    +A
Sbjct  119  CMLRYSNRSLYGLMETIPAYYMWNVQNVSSTILDAFNQKLAALLNGLTSEAAGVDDLKFA  178

Query  575  AGVEDIGGSS--VIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNF  748
             G   +G SS   IYGL QCT DLS  +C  CL DA+A +P CC + KVGGRV++ SCN 
Sbjct  179  VGNASVGASSNVTIYGLAQCTPDLSEVNCTHCLDDALAAIPTCC-SGKVGGRVVRPSCNI  237

Query  749  RYETYPFY  772
             YE+Y F+
Sbjct  238  TYESYSFF  245



>ref|XP_010267891.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=673

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 106/182 (58%), Gaps = 4/182 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G++S T G+  DKVYGL LCRGDV++  C SC+  A+ +I E CP      +W+D C ++
Sbjct  78   GFNSTTIGENPDKVYGLFLCRGDVASDLCPSCIDVASHQIIEKCPGRKRATIWFDECFVR  137

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVED  589
            YS+  FF  I D   FYM N +   +   F Q+ + +L +L  +AA   ++  +A G  +
Sbjct  138  YSDTPFFS-ILDSPSFYMWNTQNVSETDGFNQQLENMLNQLTTRAAFDPAARMFATGEVN  196

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  IYGL QCT DLS  DC  CL  AI+ +P CC   K GGRVI  +C  RYE YPF
Sbjct  197  FTEFRSIYGLAQCTSDLSRNDCNTCLLTAISYIPICC-DGKQGGRVIGQNCYVRYEIYPF  255

Query  770  YK  775
            Y+
Sbjct  256  YR  257



>ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, partial [Medicago 
truncatula]
Length=552

 Score =   150 bits (378),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 135/244 (55%), Gaps = 11/244 (5%)
 Frame = +2

Query  68   LLPLLSIAFILALHTPMAAAQ---LRHFCAN-FATSPPDSRFQKnlntllgnlssntPRN  235
            LL   S  F++      A AQ   L +FC N       +S +Q NLNT+L NL+SN   N
Sbjct  9    LLTFYSFLFLITF-VSQAKAQPDFLYNFCKNDNGNYTANSTYQNNLNTVLSNLTSNAEIN  67

Query  236  -GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
             G+ + + G+ TDKV  + LCRGDV    C+SC+ D+   + +LCP     I WYDNC+L
Sbjct  68   YGFYNISYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYDNCML  127

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI  592
            +YS    FG ++   KFYM N     +   F Q    L+ +L +KAA   S      ++ 
Sbjct  128  RYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMRKLKEKAASSDSRRKFATDNA  187

Query  593  GGSSV----IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
               ++    IYGL QCT DLS +DC  CL  AI+++P CC   K+GGRV++ SCN RYET
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNNCLDGAISDIPSCCNN-KIGGRVLKPSCNIRYET  246

Query  761  YPFY  772
              FY
Sbjct  247  SSFY  250



>ref|XP_010646958.1| PREDICTED: uncharacterized protein LOC100265431, partial [Vitis 
vinifera]
Length=1495

 Score =   153 bits (387),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 128/225 (57%), Gaps = 3/225 (1%)
 Frame = +2

Query  98    LALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKCTDKV  277
             +AL  P  A  +   C+N +    +S ++ NLN+L  +L++  P  G+ + T+GK  D+V
Sbjct  1273  VALRCPTKADYIYRVCSNHSEIASNS-YKTNLNSLFSSLTTKGPLTGFYNTTSGKTPDEV  1331

Query  278   YGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVN  457
             +GL LCRGD ++ DC+ C+ +A+ ++ + C  +    +WYD CLL+YS  +FF  +    
Sbjct  1332  FGLVLCRGDDTSNDCQICIKEASQELLQRCNSSKESTIWYDECLLRYSSQNFFSSVTLKK  1391

Query  458   KFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGGSSVIYGLTQCTR  634
             +  + N   A DP  F     QL+  ++ +AA   S  +A G   +     IYGL QCTR
Sbjct  1392  ELSLLNTISASDPIRFNTILGQLMDNISSEAAFSSSQMFATGEAVVSSLQKIYGLVQCTR  1451

Query  635   DLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             DLS EDC  CL  +I +L  CC + K GG+VI  SC  RYE YPF
Sbjct  1452  DLSKEDCNDCLESSIEKLSSCC-SGKQGGQVISKSCFLRYEVYPF  1495


 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 91/171 (53%), Gaps = 3/171 (2%)
 Frame = +2

Query  269  DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEID  448
            +++Y L LCRGDV+ T C++CV  A+ ++++ C  N   I+WYD C L+YS ++FFG   
Sbjct  748  NQIYSLYLCRGDVNATTCQNCVRTASQEVQQQCQSNRTAIIWYDECKLRYSSENFFGIAA  807

Query  449  DVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI--GGSSVIYGLT  622
                F + N      P          +  L  KA   ++ +   V +     S  IYG  
Sbjct  808  TSPYFLLWNTRNNSSPDERDVGGLAFIYTLVSKAPNSENMFGTDVAEAVNNASQNIYGSV  867

Query  623  QCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            QCTRD+S ++C+ CL   I E+  CC   K+G  ++  SCN RYE Y FY+
Sbjct  868  QCTRDISNDECRSCLLQQIEEIEGCC-QGKIGWNIMGPSCNMRYEQYLFYQ  917


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 88/169 (52%), Gaps = 2/169 (1%)
 Frame = +2

Query  269  DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEID  448
            +++Y L LCRGDV  T C++CV  A+ +I++ C  N   I+WYD C+++YS  +FFG   
Sbjct  116  NQIYSLYLCRGDVDATTCQNCVKTASQEIQKRCQSNKTAIIWYDECIVRYSNLNFFGIGQ  175

Query  449  DVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIGGSSVIYGLTQC  628
                  M N +     +    +   +++ L   A   ++ +    + +  S   YGL QC
Sbjct  176  TTPMVLMWNAQNTSSREEPPWEAVGMISELLANAPYAENMFNTSEKKL-DSGYRYGLVQC  234

Query  629  TRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            +RD+  ++C+ CL      + QCC   + G +++  SC  RYE + FY 
Sbjct  235  SRDMGRDECRNCLTQLRENISQCC-NGRRGWQIMCPSCYLRYEDHQFYN  282



>ref|XP_009340921.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=670

 Score =   150 bits (379),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 132/241 (55%), Gaps = 9/241 (4%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            ++L + SI  + +  T   A  L H C N  T  P+S FQ NLN LL NLSSN  R+ G+
Sbjct  11   TVLFIFSILTLPSFLTNTEAVYLYHVCPNNTTFAPNSTFQSNLNRLLSNLSSNANRSTGF  70

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CV  AT +  + CP     ++WYD+C+L+Y
Sbjct  71   YNTTVQTQNNAVYGLFLCRGDVVGTDACETCVPPATAEAPQRCPVEKEVVIWYDDCMLRY  130

Query  419  SEDDFFGEIDDVNKFYMANGEEAK---DPKSFMQKTKQLLTRLADKAALLKSSYAAGVED  589
            S + FF   DD    YM N + A    D   F +     +T +A + +     +A    +
Sbjct  131  SNESFFSRADDKPAVYMWNTQNASSIADQNRFNEVLAATVTEVAVQTSNSSHKFATKETN  190

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            + G   +YG  QCT+DLS  DC  CL  A  ++P+    +  GGRV++ SCN R+E YPF
Sbjct  191  VSGFITLYGFGQCTQDLSSGDCNWCLLGAATQIPR----SSAGGRVLKPSCNLRFEVYPF  246

Query  770  Y  772
            Y
Sbjct  247  Y  247



>gb|KDO37599.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=451

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 126/244 (52%), Gaps = 10/244 (4%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFC-ANFATSPPDSRFQKnlntllgnlssntPR-N  235
            F  +  LSI+F  +           H C ANF     +S +Q N N LL +L +N  R N
Sbjct  15   FLFVIYLSISFQSSFTAAADPTYAYHVCSANFTG---NSTYQTNRNLLLSSLPTNASRGN  71

Query  236  GYSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            GYSSG    T G+  +KVYGL LCRGD + + C+ CV  AT  + + CP     I+WYD 
Sbjct  72   GYSSGFYNETTGQDPNKVYGLFLCRGDQTASSCQDCVTFATRDLVQRCPDGKQTIIWYDQ  131

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLL+YS    F  +D V    + N +   D   F Q    L++++ ++A      +A   
Sbjct  132  CLLRYSNRSIFSTMDTVPYVSLLNTQNVTDRGRFNQILASLMSQVVNQAVNNSRKFATRT  191

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +      +Y L QCT DLS  DC  CL  AIAELP CC + K G +V+  SC  RYE Y
Sbjct  192  ANFTALQTLYSLAQCTPDLSSSDCNVCLQAAIAELPNCC-SGKTGAQVLIPSCIVRYEFY  250

Query  764  PFYK  775
            PFY 
Sbjct  251  PFYN  254



>ref|XP_007025950.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOY28572.1| ATP binding protein, putative [Theobroma cacao]
Length=280

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 126/227 (56%), Gaps = 9/227 (4%)
 Frame = +2

Query  110  TPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntP--RNGYSSGTAGKCTDKVYG  283
            TP  +A   H+C N  +  P+S +Q N+ TLL +LSSNT   +NG+ + TAG+  + VYG
Sbjct  24   TPTYSA---HYCDNSTSFTPNSTYQANIKTLLSSLSSNTRSSKNGFYNTTAGQDPNLVYG  80

Query  284  LALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKF  463
              LCRGDVS   C+ CVA+A  +I + C     G++WYD C ++YS+ + F     V   
Sbjct  81   TFLCRGDVSANLCQHCVANAINEIAQRCRMEKTGVIWYDECTVQYSDQNIFSISRQVPGM  140

Query  464  YMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVEDIGGSSVIYGLTQCTR  634
              +      D   F Q    ++  L ++AA    S   +AAG  +   S  +Y L QCT 
Sbjct  141  DNSTSASITDKDRFNQLLVSVMKILENRAAYEDKSGKRFAAGEANFTSSQTLYSLVQCTP  200

Query  635  DLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            DL+ E C +CL  AIA LP CC   K GGRV+  SCN RYE +PFY 
Sbjct  201  DLTNELCFRCLQSAIATLPMCCD-GKQGGRVLLPSCNIRYEMFPFYN  246



>ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=671

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 135/244 (55%), Gaps = 11/244 (5%)
 Frame = +2

Query  68   LLPLLSIAFILALHTPMAAAQ---LRHFCAN-FATSPPDSRFQKnlntllgnlssntPRN  235
            LL   S  F++      A AQ   L +FC N       +S +Q NLNT+L NL+SN   N
Sbjct  9    LLTFYSFLFLITF-VSQAKAQPDFLYNFCKNDNGNYTANSTYQNNLNTVLSNLTSNAEIN  67

Query  236  -GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
             G+ + + G+ TDKV  + LCRGDV    C+SC+ D+   + +LCP     I WYDNC+L
Sbjct  68   YGFYNISYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYDNCML  127

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI  592
            +YS    FG ++   KFYM N     +   F Q    L+ +L +KAA   S      ++ 
Sbjct  128  RYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMRKLKEKAASSDSRRKFATDNA  187

Query  593  GGSSV----IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
               ++    IYGL QCT DLS +DC  CL  AI+++P CC   K+GGRV++ SCN RYET
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNNCLDGAISDIPSCCNN-KIGGRVLKPSCNIRYET  246

Query  761  YPFY  772
              FY
Sbjct  247  SSFY  250



>ref|XP_010103954.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB97657.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=590

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 118/218 (54%), Gaps = 6/218 (3%)
 Frame = +2

Query  137  HFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAG--KCTDKVYGLALCRGDVS  310
            H C N  T  P+S +Q NLN+LL +LSSN     + + TAG    +   YGL  CRGDV 
Sbjct  26   HSCPNTTTFAPNSTYQSNLNSLLSSLSSNATSREHHNATAGGRDPSTVSYGLFFCRGDVG  85

Query  311  TTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK  490
            T DC+ CV  A   +R  CP     I+WY+ C L+YS   FFG +D+    Y+ N  +  
Sbjct  86   TKDCRECVQSAVEDVRNRCPVEKDAIIWYEQCQLRYSNLSFFGALDETPTIYLWNTADIT  145

Query  491  DPKSFMQKTKQLLTRLADKAALLK---SSYAAGVEDIGGSSVIYGLTQCTRDLSGEDCKK  661
            + + F Q  +  L     +AA  +     +A    +      +YGL QC+ DLS EDC +
Sbjct  146  EKERFNQLVEDTLNEATAEAAKGRPGGEKFAMRTANFSRFQKLYGLVQCSPDLSSEDCNR  205

Query  662  CLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            CL D++++LP CC   K GGRVI   CN RYE YPF+ 
Sbjct  206  CLQDSVSKLPSCC-YGKFGGRVISPCCNIRYEVYPFFN  242



>ref|XP_006365261.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Solanum 
tuberosum]
Length=265

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/239 (36%), Positives = 123/239 (51%), Gaps = 7/239 (3%)
 Frame = +2

Query  71   LPLLSIAFILALHTPMAAAQ----LRHFCANFATSPPDSRFQKnlntllgnlssntPRNG  238
            +  L  +F+L L   +  A+    L +FC + AT   DS+    +  +L  L S + +N 
Sbjct  5    MAFLHYSFLLILVFCICTAESVNPLGNFCDD-ATKSNDSKTSAIIGKVLAELVSVSAKNS  63

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            +S+ + G   ++VYGL  CRGDVS+ DC SC+ DA  +IR+ CP      +WYD C L+Y
Sbjct  64   FSTTSYGDAKNQVYGLYQCRGDVSSNDCLSCIRDAAKEIRKSCPDQTDARIWYDYCFLRY  123

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRL-ADKAALLKSSYAAGVEDIG  595
               +F G+++ V   +  N +   DP  F +K  QL  +L AD    +      G   I 
Sbjct  124  QAKNFLGQVETVPGIFYWNIDFVSDPDFFNKKLAQLKNQLIADAIVPMNKGLGKGKSKIS  183

Query  596  GSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
                +Y L QCTRDL   DC +CL  A+   P  C   K G RV+  SC  RYE YPF+
Sbjct  184  PFLTLYALMQCTRDLPNIDCAQCLAVAVGNFPTTCLNRK-GCRVLYSSCYVRYELYPFF  241



>ref|XP_010910239.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=686

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 125/226 (55%), Gaps = 5/226 (2%)
 Frame = +2

Query  113  PMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNG-YSSGTAGKCTDKVYGLA  289
            P++A  L   C        +S +  NLN LL +L SNT R+G +S+ T G+  +++YGLA
Sbjct  29   PVSADPLYQICGKTGNYTTNSTYDSNLNILLTSLDSNTSRSGGFSNFTVGQTPNQIYGLA  88

Query  290  LCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYM  469
            LCRGD + + C+SC+  A      LCP     I+WYD CLL YS + F   +D+ +K YM
Sbjct  89   LCRGDTNASTCRSCLDTAIQDAPNLCPYAKSAIIWYDYCLLHYSNERFLSTVDNSDKVYM  148

Query  470  ANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGGS--SVIYGLTQCTRDL  640
             N     DP  F      L+ ++ D+AA   +  +A G  +   S    IYGL QCTRDL
Sbjct  149  YNVNNITDPSQFDNLVGVLMNKIVDRAASNSTEMFATGEMNSTNSPFPTIYGLAQCTRDL  208

Query  641  SGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKG  778
            S   C++CL   +  LP      K G RV+ GSCN+RYE Y FY+G
Sbjct  209  SSSLCQQCLTGMLDPLPSLF-KGKQGARVLGGSCNYRYEIYSFYEG  253



>gb|KEH43963.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=671

 Score =   150 bits (378),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/244 (41%), Positives = 135/244 (55%), Gaps = 11/244 (5%)
 Frame = +2

Query  68   LLPLLSIAFILALHTPMAAAQ---LRHFCAN-FATSPPDSRFQKnlntllgnlssntPRN  235
            LL   S  F++      A AQ   L +FC N       +S +Q NLNT+L NL+SN   N
Sbjct  9    LLTFYSFLFLITF-VSQAKAQPDFLYNFCKNDNGNYTANSTYQNNLNTVLSNLTSNAEIN  67

Query  236  -GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
             G+ + + G+ TDKV  + LCRGDV    C+SC+ D+   + +LCP     I WYDNC+L
Sbjct  68   YGFYNISYGQNTDKVNAIGLCRGDVKPDVCRSCLNDSRVLLTKLCPNQKEAIGWYDNCML  127

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDI  592
            +YS    FG ++   KFYM N     +   F Q    L+ +L +KAA   S      ++ 
Sbjct  128  RYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMRKLKEKAASSDSRRKFATDNA  187

Query  593  GGSSV----IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
               ++    IYGL QCT DLS +DC  CL  AI+++P CC   K+GGRV++ SCN RYET
Sbjct  188  TDVNLNFQTIYGLVQCTPDLSEQDCNNCLDGAISDIPSCCNN-KIGGRVLKPSCNIRYET  246

Query  761  YPFY  772
              FY
Sbjct  247  SSFY  250



>ref|XP_006484824.1| PREDICTED: cysteine-rich repeat secretory protein 55-like [Citrus 
sinensis]
Length=254

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/231 (37%), Positives = 122/231 (53%), Gaps = 3/231 (1%)
 Frame = +2

Query  83   SIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGK  262
            S+  +L L+   AA  L  FC   +    +     N++ LL  L + T + GY + + GK
Sbjct  6    SLVLLLFLYI-CAADPLGEFCNKDSNVSGNGMISANIDNLLAELVAETAKTGYIATSYGK  64

Query  263  CTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGE  442
              DKV+GLA CRGDV + DC SC+ DA  +IR+ C       +WYD C L+Y+ ++F G+
Sbjct  65   DQDKVFGLAQCRGDVDSKDCASCIQDAAKQIRQRCVNQADARIWYDYCFLRYNTENFVGK  124

Query  443  IDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGGSSVIYGL  619
            +D     +  N E   DPKSF ++   L+  +  +A + K+     G   +     +Y L
Sbjct  125  VDTSFGIFYYNVENVTDPKSFNKELGALMDEIRSQAVVPKNEGLGKGETTLSPFVTLYAL  184

Query  620  TQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             QCTRDLS  DC +CL  A+   P  C   K G RV+  SC  RYE YPF+
Sbjct  185  VQCTRDLSQIDCAQCLAIAVGNFPNFCNNKK-GCRVLYSSCYVRYELYPFF  234



>ref|XP_003622768.1| Cysteine-rich repeat secretory protein [Medicago truncatula]
 gb|AES78986.1| cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula]
Length=257

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 120/235 (51%), Gaps = 4/235 (2%)
 Frame = +2

Query  77   LLSIAFILALHTPMAAAQ--LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSG  250
            L  I F+L L T  A ++  L  FC          +   N++ LL  L+  TP   + + 
Sbjct  4    LYKIVFLLILSTSSAKSEDPLGEFCNKNTNISTGGKLSTNIDKLLSQLALQTPSTFFVAT  63

Query  251  TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDD  430
            T G   +KVYGLA CRGD++T DC +C+ DAT +IR+ CP      +WYD C ++YS   
Sbjct  64   TYGNSKEKVYGLAQCRGDINTQDCSNCIQDATKQIRQRCPNQADARIWYDYCFIRYSNKS  123

Query  431  FFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVEDIGGSSV  607
            F GE+D     +  N E   D + F +K   L+ ++  +A ++K+     G   +     
Sbjct  124  FIGEVDTSFGIFYFNVENVTDSEVFNKKLGNLMDQIRGEAVMVKNKGLGKGKTVLSPFVT  183

Query  608  IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
            +YGL QCTRDL    C +CL  A+      C   K G RV+  SC  RYE YPF+
Sbjct  184  LYGLVQCTRDLDEISCAQCLAIAVNNFQTFCSNRK-GCRVLYSSCYVRYELYPFF  237



>gb|AAN46206.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46209.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46210.1| unknown protein [Arabidopsis lyrata]
Length=200

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 123/198 (62%), Gaps = 8/198 (4%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            IL++HT ++ +Q    L H C++   S    S ++ NLN L   LS   P  G+++ +AG
Sbjct  4    ILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSPYESNLNNLFPQLSYKVPSTGFATSSAG  63

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
               D V GLALCRGD S++DC SC+A A  +IR+ CP N  GI+WYDNCL+KYS  +FFG
Sbjct  64   ITPDNVNGLALCRGDASSSDCSSCLATAIPEIRQRCPSNKAGIIWYDNCLVKYSSTNFFG  123

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIY  613
            +ID  N+FY+ N     DP +F  +TK LLT+L  KA    +   +A G ++IG    +Y
Sbjct  124  KIDFENRFYLYNVNNVSDPSTFNTQTKALLTKLTKKATTGDNQKLFATGEKNIGKKK-LY  182

Query  614  GLTQCTRDLSGEDCKKCL  667
            GL QCTRDL  E CK CL
Sbjct  183  GLVQCTRDLKSEACKACL  200



>ref|XP_010644348.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=507

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 126/227 (56%), Gaps = 6/227 (3%)
 Frame = +2

Query  110  TPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GYSSGTAGKCT-DKVYG  283
            T  A   L H C N  T  P+S ++ NLN  L +LSSN  R+ G+ + TAG+   D  YG
Sbjct  18   TESAPGYLYHICPNTTTFNPNSSYETNLNFALSSLSSNATRDTGFYNVTAGRTPPDVAYG  77

Query  284  LALCRGDVSTTDCKSCVADATTK-IRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNK  460
            L LCRGDV++  C+ CVA A  + +R+ C      I+WYD C+L+YS + FF ++ +  +
Sbjct  78   LFLCRGDVTSQVCQDCVATAVNETVRQRCRGFKQAIIWYDECMLRYSNESFFSQVSESPR  137

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIYGLTQCTR  634
              M N +   +P  F Q     L  +  +A   +S   +A   E+  G   +Y L QCT 
Sbjct  138  VSMWNTQNITEPDQFNQVLGDTLDSIRTQAVNDQSGKKFATKEENFTGFQRVYSLVQCTP  197

Query  635  DLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            DLS + C +CL   IA LP CCG  K G RV+  SCN RYE YPFY+
Sbjct  198  DLSPDQCDRCLIGTIAILPDCCG-GKQGARVLFPSCNVRYELYPFYQ  243



>gb|AAN46207.1| unknown protein [Arabidopsis lyrata]
 gb|AAN46208.1| unknown protein [Arabidopsis lyrata]
Length=200

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 122/198 (62%), Gaps = 8/198 (4%)
 Frame = +2

Query  95   ILALHTPMAAAQ----LRHFCANFATS-PPDSRFQKnlntllgnlssntPRNGYSSGTAG  259
            IL++HT ++ +Q    L H C++   S    S ++ NLN L   LS   P  G+++ +AG
Sbjct  4    ILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSPYESNLNNLFPQLSYKVPSTGFATSSAG  63

Query  260  KCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFG  439
               D V GLALCR D S++DC SC+A A  +IR+ CP N  GI+WYDNCL+KYS  +FFG
Sbjct  64   ITPDNVNGLALCRSDASSSDCSSCLATAIPEIRQRCPSNKAGIIWYDNCLVKYSSTNFFG  123

Query  440  EIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVEDIGGSSVIY  613
            +ID  N+FY+ N     DP +F  +TK LLT+L  KA    +   +A G ++IG    +Y
Sbjct  124  KIDFENRFYLYNVNNVSDPSTFNTQTKALLTKLTKKATTGDNQKLFATGEKNIGKKK-LY  182

Query  614  GLTQCTRDLSGEDCKKCL  667
            GL QCTRDL  E CK CL
Sbjct  183  GLVQCTRDLKSEACKACL  200



>ref|XP_006299656.1| hypothetical protein CARUB_v10015844mg [Capsella rubella]
 gb|EOA32554.1| hypothetical protein CARUB_v10015844mg [Capsella rubella]
Length=260

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 102/169 (60%), Gaps = 10/169 (6%)
 Frame = +2

Query  293  CRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMA  472
            CRGD ST+ C+SC+  A + I   CPKN G I+WYDNC+L       +GEID  N FY++
Sbjct  90   CRGDSSTSTCRSCLDTAFSGISRRCPKNRGKIIWYDNCVLTILTSRTYGEIDYQNNFYIS  149

Query  473  NGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-------YAAGVEDIGGSSVIYGLTQC  628
            N ++   D KSF +K + LL  L DKA+  ++        YA G E  G    +YG+ QC
Sbjct  150  NSKDVSGDTKSFNEKRRALLYTLKDKASSKENVPNTKNYLYATGEESFGKMK-LYGMMQC  208

Query  629  TRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
            T+DLS ++C  CL   +A+LP+CC   K G R +  SCNFRYE YPF K
Sbjct  209  TQDLSIKNCSVCLNWILAKLPKCCN-GKQGCRFLSTSCNFRYELYPFVK  256



>ref|XP_008348836.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=544

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 132/244 (54%), Gaps = 9/244 (4%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            +LL + SI  + +  T   A  L H C+N  T  P+S FQ N+N LL  LSSN+ R+ G+
Sbjct  3    TLLLIFSIFTLPSFLTITEAVYLYHVCSNTTTFTPNSTFQSNVNRLLSTLSSNSNRSTGF  62

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CVA  T +  E CP     ++WYD+C+L+Y
Sbjct  63   YNATVQTPNNAVYGLFLCRGDVVGTDACETCVATVTAEAPERCPIEKQVVIWYDDCMLRY  122

Query  419  SEDDFFGEIDDVNKFYMANGEEAK---DPKSFMQKTKQLLTRLADKAALLKSSYAAGVED  589
            S++ FF    +    YM N + A    D   F +     +T +A + +     +A     
Sbjct  123  SDESFFSTSAESPSLYMWNTQNASGITDQNLFNKVLAATVTEVAAQTSNSSHMFATKETS  182

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            + G   +YG  QCT+DL   DC  CL +A  + P+    +  GGRV++ SCN R+E YPF
Sbjct  183  VSGFITLYGFGQCTQDLLSGDCNWCLLEAATQTPR----SNAGGRVLKPSCNLRFEIYPF  238

Query  770  YKGA  781
            Y  A
Sbjct  239  YSSA  242



>emb|CBI38478.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 100/181 (55%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + +AG+ +DKV  +ALCRGDV  T C+SC+ D+  ++  LCP     I WYD C+L+
Sbjct  66   GFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTRLCPNQKEAIGWYDGCMLR  125

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS D  FG+      F M N +   + + F Q    L+  L  KAA    +  +A    +
Sbjct  126  YSNDSIFGKAQTSPTFTMWNLQNVSNVEDFNQVLGNLMASLRSKAASGDWRRKFATEEAN  185

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DLS   C  CL  AI E+P CC   K  GRV++ SCN RY TY F
Sbjct  186  VTSFQSIYGLMQCTPDLSELSCSNCLEGAINEIPTCCNRRK-AGRVVKPSCNLRYATYHF  244

Query  770  Y  772
            Y
Sbjct  245  Y  245



>ref|XP_009357385.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=662

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 131/241 (54%), Gaps = 9/241 (4%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GY  241
            ++L + SI  + +  T   A  L H C N  T   +S FQ N+N LL  LSSN  R+ G+
Sbjct  3    TVLLIFSILTLPSFLTNTEADYLYHVCPNTTTFTRNSTFQSNVNRLLSTLSSNANRSTGF  62

Query  242  SSGTAGKCTDKVYGLALCRGDVSTTD-CKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
             + T     + VYGL LCRGDV  TD C++CVA AT +  + CP     ++WYD+C+L+Y
Sbjct  63   YNATVQTPNNAVYGLFLCRGDVVGTDACETCVATATAEAPQRCPVEKEVVIWYDDCMLRY  122

Query  419  SEDDFFGEIDDVNKFYMANGEEAK---DPKSFMQKTKQLLTRLADKAALLKSSYAAGVED  589
            S + FF   DD    YM N + A    D   F +     +T +A + +     +A    +
Sbjct  123  SNESFFSRADDKPVVYMWNKQNASSIVDQNRFNEVLAATVTEVAAQTSNSSHKFATKETN  182

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            + G   +YG  QCT+DLS  DC  CL  A  ++P+    +  GGRV++ SCN R+E YPF
Sbjct  183  VSGFLTLYGFGQCTQDLSSGDCNWCLLGAATQIPR----SSAGGRVLKPSCNLRFEVYPF  238

Query  770  Y  772
            Y
Sbjct  239  Y  239



>ref|XP_004295243.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Fragaria vesca subsp. vesca]
Length=367

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 127/245 (52%), Gaps = 12/245 (5%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-G  238
            F LLP+L I   +    P       HFC+N  +  P+S +Q NLN LL +L+SN  R+ G
Sbjct  9    FVLLPVLLICVCIEAQAP---TYRYHFCSNTTSFTPNSSYQSNLNLLLSSLTSNATRDIG  65

Query  239  Y---SSGTAGKCTDKVYGLALCRGDVSTTDCKSCVAD-ATTKIRELCPKNNGGIVWYDNC  406
            +    +G     T+ VYG  LCRGD++   C+ CVA  A   ++  CP     I+WYD C
Sbjct  66   FYYTRAGVLNSTTEVVYGSFLCRGDLTPELCQECVATIAKDGVQTFCPLGKIAIIWYDEC  125

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAA  577
            +L+Y+   F   +D+  +  M N     DP  F Q   + +  L   A+   S    YA 
Sbjct  126  MLRYTNQSFLNRMDEAPRVSMWNIGNISDPTRFTQLLAETINGLVAPASNAPSGAKKYAK  185

Query  578  GVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYE  757
              E+      +Y L QCT DLS   C  CL  AIA+LP CC T K GGRV+  SCN RYE
Sbjct  186  KEENFTDFQQLYSLVQCTPDLSSTSCDTCLRGAIAQLPGCC-TGKQGGRVLYPSCNVRYE  244

Query  758  TYPFY  772
             YPFY
Sbjct  245  IYPFY  249



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 126/229 (55%), Gaps = 6/229 (3%)
 Frame = +2

Query  110  TPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRN-GYSSGTAGKCT-DKVYG  283
            T  A   L H C N  T  P+S ++ NLN  L +LSSN  R+ G+ + TAG+   D  YG
Sbjct  18   TESAPGYLYHICPNTTTFNPNSSYETNLNFALSSLSSNATRDTGFYNVTAGRTPPDVAYG  77

Query  284  LALCRGDVSTTDCKSCVADATTK-IRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNK  460
            L LCRGDV++  C+ CVA A  + +R+ C      I+WYD C+L+YS + FF ++ +  +
Sbjct  78   LFLCRGDVTSQVCQDCVATAVNETVRQRCRGFKQAIIWYDECMLRYSNESFFSQVSESPR  137

Query  461  FYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVEDIGGSSVIYGLTQCTR  634
              M N +   +P  F Q     L  +  +A   +S   +A   E+  G   +Y L QCT 
Sbjct  138  VSMWNTQNITEPDQFNQVLGDTLDSIRTQAVNDQSGKKFATKEENFTGFQRVYSLVQCTP  197

Query  635  DLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYKGA  781
            DLS + C +CL   IA LP CCG  K G RV+  SCN RYE YPFY+  
Sbjct  198  DLSPDQCDRCLIGTIAILPDCCG-GKQGARVLFPSCNVRYELYPFYQSV  245



>gb|KDO37425.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=418

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 128/243 (53%), Gaps = 6/243 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR-NG  238
            FSL  +  ++F  +    +      H C+  A    +S ++KNLN LL ++ +N  R NG
Sbjct  9    FSLFLIYLLSFQFSFTVAVDREYATHVCSTTANFTRNSTYEKNLNLLLSSIPTNASRGNG  68

Query  239  YSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            +SSG    TAG+  ++VYGL LCRGD +T+DC+ CV  A   + +LCP +   I+WY  C
Sbjct  69   FSSGFFNATAGQDPNRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAEC  128

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LL+YS+   F  +       + N +   D     +     ++++  +A      +A    
Sbjct  129  LLRYSDQSIFSTMATSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKRFATRKA  188

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            +      +Y L QCT DLS  DC  CL  A+A LP CC + K GGRV+  SCN RYE YP
Sbjct  189  NFTTFQTLYSLAQCTPDLSSSDCNTCLRGAVARLPSCC-SGKQGGRVLFPSCNVRYELYP  247

Query  767  FYK  775
            FY 
Sbjct  248  FYN  250



>ref|XP_002874837.1| hypothetical protein ARALYDRAFT_911789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51096.1| hypothetical protein ARALYDRAFT_911789 [Arabidopsis lyrata subsp. 
lyrata]
Length=340

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 126/248 (51%), Gaps = 14/248 (6%)
 Frame = +2

Query  65   SLLPLLSIAFILALHTPMAAAQ---LRHFCANFATSPPDSRFQKnlntllgnlssntPRN  235
            S + L+SI F + L    +A     L H C N  T   +S +    N      S ++P  
Sbjct  7    SSVSLISIFFFMILKAVSSATNPIYLYHICPNTTTYSRNSTY--LTNLRTVLSSLSSPNA  64

Query  236  GYSS----GTAGKCTD--KVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWY  397
             Y+S     TAG+  D  +VYG+ LCRGDVS   C+ C+A A  +    CP+    ++WY
Sbjct  65   AYASRFDNATAGEENDNNRVYGVFLCRGDVSAEICRDCLAFAVNETLYRCPREKVAVIWY  124

Query  398  DNCLLKYSEDDFFGEIDDVNKFYMANGEEAKDPK--SFMQKTKQLLTRLADKAALLKSSY  571
            D C+L+YS     G++      ++ N +   + +   F +    LL  +A KAA     +
Sbjct  125  DECMLRYSNQSIVGQMRIRPAVFLTNKQNITENQVSRFNESLPALLIDVAVKAASSSRKF  184

Query  572  AAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
            A    +      IY L QCT DL+ +DC+ CL  AI  LP+CC  + VGGRVI  SC+FR
Sbjct  185  ATEKANFTVFQTIYSLVQCTPDLTNQDCESCLRQAINWLPRCCDRS-VGGRVIAPSCSFR  243

Query  752  YETYPFYK  775
            YE YPFY 
Sbjct  244  YELYPFYN  251



>gb|KDO37598.1| hypothetical protein CISIN_1g008238mg [Citrus sinensis]
Length=573

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 126/244 (52%), Gaps = 10/244 (4%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFC-ANFATSPPDSRFQKnlntllgnlssntPR-N  235
            F  +  LSI+F  +           H C ANF     +S +Q N N LL +L +N  R N
Sbjct  15   FLFVIYLSISFQSSFTAAADPTYAYHVCSANFTG---NSTYQTNRNLLLSSLPTNASRGN  71

Query  236  GYSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            GYSSG    T G+  +KVYGL LCRGD + + C+ CV  AT  + + CP     I+WYD 
Sbjct  72   GYSSGFYNETTGQDPNKVYGLFLCRGDQTASSCQDCVTFATRDLVQRCPDGKQTIIWYDQ  131

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGV  583
            CLL+YS    F  +D V    + N +   D   F Q    L++++ ++A      +A   
Sbjct  132  CLLRYSNRSIFSTMDTVPYVSLLNTQNVTDRGRFNQILASLMSQVVNQAVNNSRKFATRT  191

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +      +Y L QCT DLS  DC  CL  AIAELP CC + K G +V+  SC  RYE Y
Sbjct  192  ANFTALQTLYSLAQCTPDLSSSDCNVCLQAAIAELPNCC-SGKTGAQVLIPSCIVRYEFY  250

Query  764  PFYK  775
            PFY 
Sbjct  251  PFYN  254



>ref|XP_002894412.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70671.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 140/256 (55%), Gaps = 20/256 (8%)
 Frame = +2

Query  53   SKPFSLLPLLSIAFIL-----ALHTPMAAAQLRHFCANF-ATSPPDSRFQKnlntllgnl  214
            ++  S++ L+ +A +L      L      A L+H C N       DS ++ N+  LL  +
Sbjct  3    NRHVSVILLVVVAMLLFFIQGVLSLNQTNAYLQHICVNSDGIYKSDSSYESNVKHLLEFM  62

Query  215  ssntPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVW  394
            SS     G++SGT+   ++ +Y    CRGDVS + C+SC+  A + IR  CP N G I+W
Sbjct  63   SSPLDY-GFTSGTS---SNDIYAKFQCRGDVSESKCRSCLTTAFSAIRRRCPNNKGRIIW  118

Query  395  YDNCLLKYSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-  568
            YDNC+L  S    + ++D  + FY+ N ++   + KSF + T  LL +L +KA   +   
Sbjct  119  YDNCVLDLSSIYTYDKVDYKHSFYVYNAKDVSGNTKSFNKNTNTLLYKLKEKATRKEQEQ  178

Query  569  ------YAAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVI  730
                  YA G E + G+  +Y + QCT+DLS ++C  CL   + +LP+CC   K GGRV 
Sbjct  179  YTKDYMYATGEESL-GTMKLYAMVQCTQDLSIKNCSVCLDWIMGKLPRCCN-GKQGGRVY  236

Query  731  QGSCNFRYETYPFYKG  778
              +CNFRYE YPF K 
Sbjct  237  NPNCNFRYELYPFCKN  252



>gb|KDO37424.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=437

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 128/243 (53%), Gaps = 6/243 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR-NG  238
            FSL  +  ++F  +    +      H C+  A    +S ++KNLN LL ++ +N  R NG
Sbjct  9    FSLFLIYLLSFQFSFTVAVDREYATHVCSTTANFTRNSTYEKNLNLLLSSIPTNASRGNG  68

Query  239  YSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            +SSG    TAG+  ++VYGL LCRGD +T+DC+ CV  A   + +LCP +   I+WY  C
Sbjct  69   FSSGFFNATAGQDPNRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAEC  128

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LL+YS+   F  +       + N +   D     +     ++++  +A      +A    
Sbjct  129  LLRYSDQSIFSTMATSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKRFATRKA  188

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            +      +Y L QCT DLS  DC  CL  A+A LP CC + K GGRV+  SCN RYE YP
Sbjct  189  NFTTFQTLYSLAQCTPDLSSSDCNTCLRGAVARLPSCC-SGKQGGRVLFPSCNVRYELYP  247

Query  767  FYK  775
            FY 
Sbjct  248  FYN  250



>ref|XP_004290148.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=263

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 123/231 (53%), Gaps = 3/231 (1%)
 Frame = +2

Query  86   IAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPRNGYSSGTAGKC  265
            I  +L++ +  AA  +  FC N +     S    N++ LL  L S TP  G+S+ + GK 
Sbjct  11   ILLVLSICSIEAADPMADFCNNDSKISKSSTISANIDALLAQLVSKTPSTGFSATSYGKG  70

Query  266  TDKVYGLALCRGDV-STTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGE  442
              +VYGLA CRGDV  + DC SC+ DA  +IR+ CP      +WYD C LKYS   F GE
Sbjct  71   QAQVYGLAQCRGDVVGSKDCSSCIQDAAKEIRQRCPDQAAATIWYDFCFLKYSNKSFTGE  130

Query  443  IDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS-SYAAGVEDIGGSSVIYGL  619
            +D        N +   DP+ F++K   L+  +  +A + K+  +  G   +   S +Y  
Sbjct  131  VDTSYGIIFYNVQNVTDPEKFVKKLGALVDDIKAQAVVPKNLGFGKGETKLSPLSTLYAF  190

Query  620  TQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             QCTRDL+ +DC +CL  A+      CG  + G RV+ GSC  RYE YP +
Sbjct  191  GQCTRDLAKQDCTQCLAIAVGNYETICGNRR-GCRVLYGSCYVRYELYPIF  240



>gb|KHN02663.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=633

 Score =   148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 104/181 (57%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+ TDKV  + LCRGDV   +C+SC+ DA   + + CP     I++YDNC+L+
Sbjct  62   GFYNFSYGQNTDKVNAIGLCRGDVEPDECRSCLNDARGNLTQRCPNQKKAIIYYDNCMLR  121

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVEDIG  595
            YS    FG ++     ++ N   A D + F Q  + L++ L D+AA   S      +D  
Sbjct  122  YSNTTIFGVMETSPALFLGNTVNATDAEQFNQVLQTLMSNLTDRAASGDSRRKYATDDTT  181

Query  596  GSSV--IYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
             +S   IYGL QCT DLSG DC  CL  AI  +  CC + K GGRVI+ SCN R+E  PF
Sbjct  182  AASFQRIYGLVQCTPDLSGLDCSSCLVGAIENIQDCC-SGKRGGRVIRPSCNVRFELGPF  240

Query  770  Y  772
            Y
Sbjct  241  Y  241



>gb|KDO37426.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=438

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 128/243 (53%), Gaps = 6/243 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR-NG  238
            FSL  +  ++F  +    +      H C+  A    +S ++KNLN LL ++ +N  R NG
Sbjct  9    FSLFLIYLLSFQFSFTVAVDREYATHVCSTTANFTRNSTYEKNLNLLLSSIPTNASRGNG  68

Query  239  YSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            +SSG    TAG+  ++VYGL LCRGD +T+DC+ CV  A   + +LCP +   I+WY  C
Sbjct  69   FSSGFFNATAGQDPNRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAEC  128

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LL+YS+   F  +       + N +   D     +     ++++  +A      +A    
Sbjct  129  LLRYSDQSIFSTMATSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKRFATRKA  188

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            +      +Y L QCT DLS  DC  CL  A+A LP CC + K GGRV+  SCN RYE YP
Sbjct  189  NFTTFQTLYSLAQCTPDLSSSDCNTCLRGAVARLPSCC-SGKQGGRVLFPSCNVRYELYP  247

Query  767  FYK  775
            FY 
Sbjct  248  FYN  250



>ref|XP_006299328.1| hypothetical protein CARUB_v10015485mg [Capsella rubella]
 gb|EOA32226.1| hypothetical protein CARUB_v10015485mg [Capsella rubella]
Length=259

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 106/188 (56%), Gaps = 10/188 (5%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ +G  G     +Y    CR D S + C+SC+  A + +R  CP N G I+WYDNCLL 
Sbjct  73   GFVNGAGGDGPTNIYAKIQCRPDASESICRSCINTALSDLRRKCPNNKGRIIWYDNCLLD  132

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPK-SFMQKTKQLLTRLADKAALLKS-------SY  571
             S     GEID    FYM N ++    K +F + TK+LL  L +KA   K         Y
Sbjct  133  ISSIFSLGEIDYRYIFYMYNAKDVSSNKIAFNKNTKELLCELKEKAINKKELPYRRDYLY  192

Query  572  AAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
            AAG E++ G++ +Y + QCT+DLS  +C  CL   + +LP+CC   K GGRV+  SC FR
Sbjct  193  AAGAENL-GTTKLYAMVQCTKDLSAFNCSVCLDGIMEKLPKCC-NGKQGGRVLSPSCGFR  250

Query  752  YETYPFYK  775
            YE YPF +
Sbjct  251  YELYPFVR  258



>ref|XP_006449123.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
 gb|ESR62363.1| hypothetical protein CICLE_v10018168mg, partial [Citrus clementina]
Length=250

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 101/181 (56%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+  D+V  +ALCRGDV+   C+SC+  +  ++R+ CP     ++WYD C+L+
Sbjct  66   GFYTASYGRNNDQVNAMALCRGDVNPNSCRSCIKTSAVELRKHCPNQKEAVIWYDYCMLR  125

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVED  589
            YS   FFG ++    F+M N     D  +F +    LL  L +KAA   +   +A G   
Sbjct  126  YSNRYFFGNMEFGPWFWMYNLHNVSDATTFNRDVATLLNILKNKAASGDNCRKFATGNAT  185

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
               S  IY L QCT DL  + C  CL +A A LP+CC   + GGRVI  SCNFRYE   F
Sbjct  186  TTNSLTIYALVQCTPDLEKQQCIDCLNNATALLPKCCD-GRQGGRVIAPSCNFRYEIGRF  244

Query  770  Y  772
            Y
Sbjct  245  Y  245



>ref|XP_007025946.1| Cysteine-rich protein, putative [Theobroma cacao]
 gb|EOY28568.1| Cysteine-rich protein, putative [Theobroma cacao]
Length=664

 Score =   148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 126/231 (55%), Gaps = 6/231 (3%)
 Frame = +2

Query  95   ILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntl--lgnlssntPRNGYSSGTAGKCT  268
            +L+  +  A     H+C N  +  P+S +Q N+  L    + + ++ +NG+ + TAG+  
Sbjct  16   LLSFSSEAAPTYSSHYCDNSTSFTPNSTYQANIKALLFSLSSNISSGKNGFYNTTAGQDP  75

Query  269  DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEID  448
            + VYG  LCRGDVS   C+ CVA A+++I   C     G++WYD C ++YS+ + F  + 
Sbjct  76   NLVYGTFLCRGDVSANLCQDCVASASSEITRRCLMEKMGVIWYDECTVRYSDQNIFSTVR  135

Query  449  DVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVEDIGGSSVIYGL  619
            +V     ++     D   F Q    ++  L ++AA    S   +AAG  +   S  +Y L
Sbjct  136  EVPGMDKSSSASITDKDRFNQLLVSVMKILENRAAYEDKSGKKFAAGEANFTSSQTLYSL  195

Query  620  TQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFY  772
             QCT DL+   C +CL  AIA LP CC   K GGRV+  SCN RYET+PFY
Sbjct  196  VQCTPDLTDALCFRCLQSAIATLPMCCD-GKQGGRVLLPSCNIRYETFPFY  245



>ref|XP_010247032.1| PREDICTED: uncharacterized protein LOC104590182 [Nelumbo nucifera]
Length=1289

 Score =   150 bits (380),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 128/242 (53%), Gaps = 10/242 (4%)
 Frame = +2

Query  68   LLPLLSIAFI-LALHTPMAAAQLRHFC--ANFATSPPDSRFQ-KnlntllgnlssntPRN  235
            L+PL+S+  I L L +        HFC   N+ +   +S +Q      L    S+   +N
Sbjct  640  LIPLVSLILIRLGLSSAQQPNYTYHFCFGGNYTS---NSTYQTNLNLLLSSLSSNAALQN  696

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + TAG   D  YGL LC GDV++  C++CV  A+ +I + CP     I+WYD CLL+
Sbjct  697  GFYNTTAGLNPDIAYGLFLCEGDVTSEVCQNCVITASKEIMQRCPNKKEAIIWYDLCLLR  756

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGVED  589
            YS    F  +  +    + N     +P  F Q    L+  L  +AAL  S+  +A G  +
Sbjct  757  YSNQSIFSTMQQIPGVSLLNINNITNPDRFNQILGDLMNSLVRRAALDPSTGMFATGEAN  816

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  IYGL QCT D+S  DC  CL  A++++P+CC   K GGRV++ SC  RYE YPF
Sbjct  817  FTSFLKIYGLVQCTPDISDTDCNICLTGAVSDIPRCCN-GKQGGRVLRPSCYIRYEIYPF  875

Query  770  YK  775
            Y+
Sbjct  876  YQ  877


 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 101/184 (55%), Gaps = 3/184 (2%)
 Frame = +2

Query  230  RNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            +NG+ + TAG   +  YGL LCRGDV++  C++CV  A+ +I + CP     I+WYD CL
Sbjct  61   QNGFYNTTAGLNPNTAYGLFLCRGDVTSEVCQNCVEAASKEILQRCPNKKEAIIWYDLCL  120

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS--YAAGV  583
            L+YS    F  +       + N     +P  F Q    L+  L  +AAL  S+  +A G 
Sbjct  121  LRYSNQSIFSTMQQSPGVSLLNINNITNPDRFNQILGDLMNSLVRRAALDPSTGMFATGE  180

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
             +      +YGL QCT D+S  DC  CL +A+ ++P CC   K GGRV++ SC  RYE  
Sbjct  181  ANFTSFQQVYGLVQCTPDISQSDCNICLAEAVGQIPICCN-GKRGGRVLRPSCYIRYEID  239

Query  764  PFYK  775
             FY+
Sbjct  240  LFYQ  243



>gb|KDO37427.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=467

 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 128/243 (53%), Gaps = 6/243 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR-NG  238
            FSL  +  ++F  +    +      H C+  A    +S ++KNLN LL ++ +N  R NG
Sbjct  9    FSLFLIYLLSFQFSFTVAVDREYATHVCSTTANFTRNSTYEKNLNLLLSSIPTNASRGNG  68

Query  239  YSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            +SSG    TAG+  ++VYGL LCRGD +T+DC+ CV  A   + +LCP +   I+WY  C
Sbjct  69   FSSGFFNATAGQDPNRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAEC  128

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LL+YS+   F  +       + N +   D     +     ++++  +A      +A    
Sbjct  129  LLRYSDQSIFSTMATSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKRFATRKA  188

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            +      +Y L QCT DLS  DC  CL  A+A LP CC + K GGRV+  SCN RYE YP
Sbjct  189  NFTTFQTLYSLAQCTPDLSSSDCNTCLRGAVARLPSCC-SGKQGGRVLFPSCNVRYELYP  247

Query  767  FYK  775
            FY 
Sbjct  248  FYN  250



>gb|KDO60896.1| hypothetical protein CISIN_1g036866mg [Citrus sinensis]
Length=254

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 101/182 (55%), Gaps = 2/182 (1%)
 Frame = +2

Query  230  RNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            + GY + + GK  DKV+GLA CRGDV + DC SC+ DA  +IR+ C       +WYD C 
Sbjct  54   KTGYIATSYGKDQDKVFGLAQCRGDVDSKDCASCIQDAAKQIRQRCVNQADARIWYDYCF  113

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVE  586
            L+Y+ ++F G++D     +  N E   DPKSF ++   L+  +  +A + K+     G  
Sbjct  114  LRYNTENFVGKVDTSFGIFYYNVENVTDPKSFNKELGALMDEIRSQAVVPKNEGLGKGET  173

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             +     +Y L QCTRDLS  DC +CL  A+   P  C   K G RV+  SC  RYE YP
Sbjct  174  TLSPFVTLYALVQCTRDLSQIDCAQCLAIAVGNFPNFCNNKK-GCRVLYSSCYVRYELYP  232

Query  767  FY  772
            F+
Sbjct  233  FF  234



>ref|XP_006437221.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
 gb|ESR50461.1| hypothetical protein CICLE_v10032523mg [Citrus clementina]
Length=254

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 101/182 (55%), Gaps = 2/182 (1%)
 Frame = +2

Query  230  RNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            + GY + + GK  DKV+GLA CRGDV + DC SC+ DA  +IR+ C       +WYD C 
Sbjct  54   KTGYIATSYGKDQDKVFGLAQCRGDVDSKDCASCIQDAAKQIRQRCVNQADARIWYDYCF  113

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAGVE  586
            L+Y+ ++F G++D     +  N E   DPKSF ++   L+  +  +A + K+     G  
Sbjct  114  LRYNTENFVGKVDTSFGIFYYNVENVTDPKSFNKELGALMDEIRSQAVVPKNEGLGKGET  173

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
             +     +Y L QCTRDLS  DC +CL  A+   P  C   K G RV+  SC  RYE YP
Sbjct  174  TLSPFVTLYALVQCTRDLSQIDCAQCLAIAVGNFPNFCNNKK-GCRVLYSSCYVRYELYP  232

Query  767  FY  772
            F+
Sbjct  233  FF  234



>gb|AFK33693.1| unknown [Lotus japonicus]
Length=261

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 122/244 (50%), Gaps = 7/244 (3%)
 Frame = +2

Query  44   MAYSKPFSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssn  223
            + Y   FSLL  +SIA    L  P+       FC          +   N++ LL      
Sbjct  3    LLYKIIFSLLLCISIAESQDLSGPLG-----EFCNENTKISSGGKLSANIDKLLAEFILK  57

Query  224  tPRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDN  403
            TP  G+ + + G   D+VYGLA CRGDVST DC +C+ DA  +IR+ CP      +WYD 
Sbjct  58   TPSTGFVATSYGNNQDQVYGLAQCRGDVSTQDCSNCIQDAAKQIRQKCPNQVDARIWYDY  117

Query  404  CLLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS-YAAG  580
            C L+Y+   F G++D     +  N +   DP+ F ++   L+ ++  +A   K+     G
Sbjct  118  CFLRYNNKSFIGDVDTSFGIFYFNVKNVTDPEGFNKELGSLMGKIRGQAVKPKAQGLGKG  177

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
              ++     +Y L QCTRDLS   C +CL  A++  P  C   K G RV+  SC  RYE 
Sbjct  178  KTNLSPFLTLYALVQCTRDLSEISCAQCLAVAVSNFPTFCDNRK-GCRVLYSSCYVRYEL  236

Query  761  YPFY  772
            YPF+
Sbjct  237  YPFF  240



>ref|XP_010036760.1| PREDICTED: cysteine-rich repeat secretory protein 55-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW48396.1| hypothetical protein EUGRSUZ_K02100 [Eucalyptus grandis]
Length=263

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 97/183 (53%), Gaps = 2/183 (1%)
 Frame = +2

Query  227  PRNGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            P  G+ + + G   DKVYGLA CRGDVS  DC SC+ DA  +IR+LCP      +WYD C
Sbjct  60   PSTGFLTTSYGSGNDKVYGLAQCRGDVSQDDCSSCIQDAGKQIRQLCPDQADARIWYDYC  119

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRL-ADKAALLKSSYAAGV  583
             L+Y +  F GE+D  +  +  N E   DP+ F ++  +L+ R+ AD             
Sbjct  120  FLRYDDKTFIGEVDTYSGIFYINVENVTDPEKFNKELGRLMDRIEADAVVPENRGLGKSK  179

Query  584  EDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETY  763
              +     +Y L QCTRDL    C +CL  A+   P  C + K G RV+  SC  RYE Y
Sbjct  180  TKLTPFITLYALVQCTRDLPKLSCAQCLAIAVGNFPGICNSRK-GCRVLYSSCYVRYELY  238

Query  764  PFY  772
            PF+
Sbjct  239  PFF  241



>ref|XP_010089691.1| hypothetical protein L484_006313 [Morus notabilis]
 gb|EXB38214.1| hypothetical protein L484_006313 [Morus notabilis]
Length=386

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 100/181 (55%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G  +DKVY +ALCRGD     C+SC+ D+T  + + C      + WYDNC+L+
Sbjct  68   GFYNLSYGNSSDKVYTIALCRGDAKPDACRSCLNDSTLLLPQRCRDQKEAVGWYDNCMLR  127

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVED  589
            YS    FG ++    FYM + +   D   F +K + L+ +L ++AA   S   +A G + 
Sbjct  128  YSNRSMFGIVETSQIFYMWSVQNVTDADGFYEKLRTLINQLKNQAAAGDSLRKFATGNDT  187

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  IY L QCT DLS E C  CL      +PQCCG  K GGRVI  SCN RYE Y F
Sbjct  188  TPEFKTIYALVQCTPDLSKEQCNNCLDSVFGYIPQCCG-GKKGGRVIGPSCNVRYEDYLF  246

Query  770  Y  772
            Y
Sbjct  247  Y  247



>emb|CAN80208.1| hypothetical protein VITISV_010567 [Vitis vinifera]
Length=614

 Score =   147 bits (371),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 100/181 (55%), Gaps = 4/181 (2%)
 Frame = +2

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            + + TAG+  D VYGL LCRGDV+   C++CV  A+ +I   CP     I WYD C+ +Y
Sbjct  68   FHNQTAGQAPDMVYGLYLCRGDVTDAVCQNCVQTASQEILTKCPNRKEXISWYDQCMFRY  127

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVED  589
            S    F  +++      +N  E +DP  F Q   + +  L +KA    S    +  G   
Sbjct  128  SNRSIFSIMEERPSVTGSNELEMEDPDRFDQIVNETMVGLIEKATYNSSERDMFETGEAK  187

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
               S+ IYGL QCT DLSG DC++CL +  + +P CC   K G R++  SCNFRYE YPF
Sbjct  188  FNASTKIYGLAQCTPDLSGSDCRRCLENIFSRIPNCC-YGKQGARILGPSCNFRYEVYPF  246

Query  770  Y  772
            Y
Sbjct  247  Y  247



>ref|XP_003635466.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=675

 Score =   147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 100/181 (55%), Gaps = 3/181 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + +AG+ +DKV  +ALCRGDV  T C+SC+ D+  ++  LCP     I WYD C+L+
Sbjct  66   GFYNFSAGQNSDKVNAIALCRGDVMPTACRSCINDSRIQLTRLCPNQKEAIGWYDGCMLR  125

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGVED  589
            YS D  FG+      F M N +   + + F Q    L+  L  KAA    +  +A    +
Sbjct  126  YSNDSIFGKAQTSPTFTMWNLQNVSNVEDFNQVLGNLMASLRSKAASGDWRRKFATEEAN  185

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
            +     IYGL QCT DLS   C  CL  AI E+P CC   K  GRV++ SCN RY TY F
Sbjct  186  VTSFQSIYGLMQCTPDLSELSCSNCLEGAINEIPTCCNRRK-AGRVVKPSCNLRYATYHF  244

Query  770  Y  772
            Y
Sbjct  245  Y  245



>ref|XP_007143203.1| hypothetical protein PHAVU_007G052500g [Phaseolus vulgaris]
 gb|ESW15197.1| hypothetical protein PHAVU_007G052500g [Phaseolus vulgaris]
Length=682

 Score =   147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 100/182 (55%), Gaps = 3/182 (2%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+ + + G+  DKV  + LCRGDV   +C+SC+ DA   I +LCP      ++YDNCLL+
Sbjct  78   GFYNFSHGQNADKVNAIGLCRGDVEPNECRSCLKDAGGNITQLCPNQKEATIYYDNCLLR  137

Query  416  YSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS--SYAAGVED  589
            YS    FG +D    FYMAN   A +   F +    LL  L  KAA   S   YA   + 
Sbjct  138  YSNHSIFGVLDISPDFYMANPNNATEVVEFNRVLDDLLKELKGKAASGDSRRKYATDNDT  197

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
                  IYGL QC+ DL+  DC  CL +AI  +P CC   + GGRV+  SCN RYE Y F
Sbjct  198  TMNFQTIYGLLQCSPDLTQTDCNDCLDEAITRIPTCCDDRR-GGRVVGPSCNIRYENYRF  256

Query  770  YK  775
            Y+
Sbjct  257  YE  258



>ref|NP_001238492.1| cysteine-rich protein precursor [Glycine max]
 gb|ACM89479.1| cysteine-rich protein [Glycine max]
Length=667

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 7/185 (4%)
 Frame = +2

Query  239  YSSGTAGKCT---DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            +S+ T G  T   D+VYGL +CRGDV +  C+ CV +AT ++R  C      ++WYD C 
Sbjct  66   FSNNTVGLGTSPSDRVYGLFMCRGDVPSALCQQCVVNATGRLRSQCSLAKQAVIWYDECT  125

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLK---SSYAAG  580
            ++YS   FF  +D   +  + N     +  SFM+   Q + R AD+AA        YA  
Sbjct  126  VRYSNRSFFSTVDTRPRVGLLNTANISNQDSFMRLLFQTINRTADEAANFSVGLKKYAVN  185

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
              +I G   +Y L QCT DLS E+C+ CL   I +LP CC   K GGRV+  SCN RYE 
Sbjct  186  QANISGFQSLYCLAQCTPDLSQENCRSCLSGVIGDLPWCC-QGKQGGRVLYPSCNVRYEL  244

Query  761  YPFYK  775
            YPFY+
Sbjct  245  YPFYR  249



>gb|KHN30448.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=669

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 103/185 (56%), Gaps = 7/185 (4%)
 Frame = +2

Query  239  YSSGTAGKCT---DKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            +S+ T G  T   D+VYGL +CRGDV +  C+ CV +AT ++R  C      ++WYD C 
Sbjct  68   FSNNTVGLGTSPSDRVYGLFMCRGDVPSALCQQCVVNATGRLRSQCSLAKQAVIWYDECT  127

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLK---SSYAAG  580
            ++YS   FF  +D   +  + N     +  SFM+   Q + R AD+AA        YA  
Sbjct  128  VRYSNRSFFSTVDTRPRVGLLNTANISNQDSFMRLLFQTINRTADEAANFSVGLKKYAVN  187

Query  581  VEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
              +I G   +Y L QCT DLS E+C+ CL   I +LP CC   K GGRV+  SCN RYE 
Sbjct  188  QANISGFQSLYCLAQCTPDLSQENCRSCLSGVIGDLPWCC-QGKQGGRVLYPSCNVRYEL  246

Query  761  YPFYK  775
            YPFY+
Sbjct  247  YPFYR  251



>gb|KHG16271.1| Cysteine-rich receptor-like protein kinase 25 [Gossypium arboreum]
Length=662

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 122/223 (55%), Gaps = 12/223 (5%)
 Frame = +2

Query  131  LRHFCANFATSPPDSRFQKnlntllgnlssntPRNGY-SSGTAGKC-TDKVYGLALCRGD  304
            L H C N     P+S ++ NLN LL +L+SN     +  + T GK  +D VYGL LCRGD
Sbjct  27   LLHNCPNTTIFSPNSTYETNLNRLLISLTSNATAGSFFHNATTGKHNSDIVYGLFLCRGD  86

Query  305  VSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKYSEDDFFGEIDDVNKFYMANGEE  484
            VST  C+ CV+ AT  + + CP     ++WYDNCL+ YS    F  ++ V KFY+ N   
Sbjct  87   VSTKGCQDCVSTATKDVIQRCPVEKTAVIWYDNCLIHYSNQSIFSTLEVVPKFYLINTGN  146

Query  485  AKDPKSFMQKTKQLLTRLADKAALLKS------SYAAGVEDIGGSSVIYGLTQCTRDLSG  646
              + + F Q    L T + D AAL  +       +A    ++     +Y L QCT DL+ 
Sbjct  147  VSNQERFNQI---LATTMNDGAALALNDTLPLKKFATREANVSRFQTLYSLLQCTPDLTT  203

Query  647  EDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPFYK  775
             DC  CL  AIA+LP CC   K GGRV+  SC+ RYE YPFY 
Sbjct  204  SDCNTCLRGAIADLPNCCD-GKQGGRVLTPSCSIRYELYPFYN  245



>emb|CBI39033.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   147 bits (370),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 100/181 (55%), Gaps = 4/181 (2%)
 Frame = +2

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            + + TAG+  D VYGL LCRGDV+   C++CV  A+ +I   CP     I WYD C+ +Y
Sbjct  68   FHNQTAGQAPDMVYGLYLCRGDVTDAVCQNCVQTASQEILTKCPNRKEVISWYDQCMFRY  127

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVED  589
            S    F  +++      +N  E +DP  F Q   + +  + +KA    S    +  G   
Sbjct  128  SNRSIFSIMEERPSVTGSNELEMEDPDRFDQIVNETMVGMIEKATYNSSERDMFETGEAK  187

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
               S+ IYGL QCT DLSG DC++CL +  + +P CC   K G R++  SCNFRYE YPF
Sbjct  188  FNASTKIYGLAQCTPDLSGSDCRRCLENIFSRIPNCC-YGKQGARILGPSCNFRYEVYPF  246

Query  770  Y  772
            Y
Sbjct  247  Y  247



>ref|XP_006377265.1| hypothetical protein POPTR_0011s03300g [Populus trichocarpa]
 gb|ERP55062.1| hypothetical protein POPTR_0011s03300g [Populus trichocarpa]
Length=257

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 132/247 (53%), Gaps = 7/247 (3%)
 Frame = +2

Query  59   PFSLLPLLSIAFILALHTPMAAAQL-RHFC-ANFATSPPDSRFQKnlntllgnlssntPR  232
            P  LL   S  FI  L   MA   L +HFC  N      +S ++ NL+ L+ + SS+T  
Sbjct  5    PSKLLFFFSPVFIHLLVLTMAQTNLLQHFCIENHGNFSANSDYKSNLDRLISSFSSDTNN  64

Query  233  N-GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCL  409
            + G+ +G+ G+  DK Y ++LCRGD     C+SC+ +++  + +LCP      +WYD+C+
Sbjct  65   DYGFYTGSFGENIDKAYAISLCRGDKKPETCRSCIKNSSQVLSQLCPNQKEAYIWYDDCM  124

Query  410  LKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAAL--LKSSYAAGV  583
            L+Y+    F  ++    F+M N     D   F +    LL RL + AAL   +  +AAG 
Sbjct  125  LRYANHTIFNSMEFGPYFWMYNPVNVTDENEFNEVLNALLGRLINFAALGDSRRKFAAGN  184

Query  584  EDIGGS-SVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYET  760
                 S   +Y L QCT DL+ + C  CL  AI  +P CC + + GGRV+  SC+FRYE 
Sbjct  185  ATAEKSQQTMYALVQCTPDLTQQQCSDCLNQAIKLIPTCC-SKRQGGRVVSPSCHFRYEK  243

Query  761  YPFYKGA  781
             PFY  A
Sbjct  244  DPFYDLA  250



>ref|NP_180720.1| putative cysteine-rich repeat secretory protein 10 [Arabidopsis 
thaliana]
 sp|Q9SIP6.1|CRR10_ARATH RecName: Full=Putative cysteine-rich repeat secretory protein 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD24839.1| receptor kinase, putative [Arabidopsis thaliana]
 gb|AEC08568.1| putative cysteine-rich repeat secretory protein 10 [Arabidopsis 
thaliana]
Length=255

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 108/188 (57%), Gaps = 10/188 (5%)
 Frame = +2

Query  236  GYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLK  415
            G+  G  G  +   Y  A CRGD S + C+SC+  A + I   CP N G I+WYDNC L 
Sbjct  69   GFIHGVGGADSSTYYIKAQCRGDASESKCRSCLFTAFSGILRRCPNNRGRIIWYDNCFLY  128

Query  416  YSEDDFFGEIDDVNKFYMANGEEAK-DPKSFMQKTKQLLTRLADKAALLKSS-------Y  571
             SE   + +ID  +  Y+ N ++   + K F + TK LL +L +KA   +         Y
Sbjct  129  ISEIYTYEKIDFKHYLYLHNAKDVSGNKKLFNKNTKALLDKLKEKAIRKEQEPYTRDYMY  188

Query  572  AAGVEDIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFR  751
            AAG E + G++ +YG+ QCT+DLS ++C  CL   IA+LP+CC   K GGRV+  SC FR
Sbjct  189  AAGEESL-GTTKLYGMMQCTQDLSVKNCSVCLDSIIAKLPRCC-NGKQGGRVLNPSCTFR  246

Query  752  YETYPFYK  775
            YE YPF K
Sbjct  247  YELYPFVK  254



>ref|XP_010655874.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=661

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 100/181 (55%), Gaps = 4/181 (2%)
 Frame = +2

Query  239  YSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLLKY  418
            + + TAG+  D VYGL LCRGDV+   C++CV  A+ +I   CP     I WYD C+ +Y
Sbjct  68   FHNQTAGQAPDMVYGLYLCRGDVTDAVCQNCVQTASQEILTKCPNRKEVISWYDQCMFRY  127

Query  419  SEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSS---YAAGVED  589
            S    F  +++      +N  E +DP  F Q   + +  + +KA    S    +  G   
Sbjct  128  SNRSIFSIMEERPSVTGSNELEMEDPDRFDQIVNETMVGMIEKATYNSSERDMFETGEAK  187

Query  590  IGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYPF  769
               S+ IYGL QCT DLSG DC++CL +  + +P CC   K G R++  SCNFRYE YPF
Sbjct  188  FNASTKIYGLAQCTPDLSGSDCRRCLENIFSRIPNCC-YGKQGARILGPSCNFRYEVYPF  246

Query  770  Y  772
            Y
Sbjct  247  Y  247



>ref|XP_010931306.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=681

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 107/185 (58%), Gaps = 3/185 (2%)
 Frame = +2

Query  233  NGYSSGTAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNCLL  412
            NG+++ + G   +++YGLALCRGDV+ ++C+SC+  A+  + +LCP N G I+WYD C+L
Sbjct  66   NGFATASTGLAPNQIYGLALCRGDVNISECQSCLNTASKDVLQLCPYNKGAIIWYDPCML  125

Query  413  KYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKS-SYAAG-VE  586
            +YS   F    ++  + +M N +   D   F +   +L+  +AD AA   +  +A G V 
Sbjct  126  RYSNQSFLSSYNNSGQVFMWNTQNVTDRDKFDKLLTELIDAIADYAAYNSTRRFATGEVN  185

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
                   IYGL QCT D+ G  C++CL   I  +P+     + GGRV+   C FRYE Y 
Sbjct  186  FTKAFPTIYGLAQCTPDMPGSQCRRCLQGLINYIPKWFA-GRQGGRVLGPRCTFRYELYT  244

Query  767  FYKGA  781
            FY GA
Sbjct  245  FYNGA  249



>gb|KDO37423.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=571

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 128/243 (53%), Gaps = 6/243 (2%)
 Frame = +2

Query  62   FSLLPLLSIAFILALHTPMAAAQLRHFCANFATSPPDSRFQKnlntllgnlssntPR-NG  238
            FSL  +  ++F  +    +      H C+  A    +S ++KNLN LL ++ +N  R NG
Sbjct  9    FSLFLIYLLSFQFSFTVAVDREYATHVCSTTANFTRNSTYEKNLNLLLSSIPTNASRGNG  68

Query  239  YSSG----TAGKCTDKVYGLALCRGDVSTTDCKSCVADATTKIRELCPKNNGGIVWYDNC  406
            +SSG    TAG+  ++VYGL LCRGD +T+DC+ CV  A   + +LCP +   I+WY  C
Sbjct  69   FSSGFFNATAGQDPNRVYGLFLCRGDQTTSDCQDCVTFAARDVLQLCPVSKETILWYAEC  128

Query  407  LLKYSEDDFFGEIDDVNKFYMANGEEAKDPKSFMQKTKQLLTRLADKAALLKSSYAAGVE  586
            LL+YS+   F  +       + N +   D     +     ++++  +A      +A    
Sbjct  129  LLRYSDQSIFSTMATSPTVSLLNTQNVTDQGRLNELVGTQMSQVVTQAVSNTKRFATRKA  188

Query  587  DIGGSSVIYGLTQCTRDLSGEDCKKCLYDAIAELPQCCGTAKVGGRVIQGSCNFRYETYP  766
            +      +Y L QCT DLS  DC  CL  A+A LP CC + K GGRV+  SCN RYE YP
Sbjct  189  NFTTFQTLYSLAQCTPDLSSSDCNTCLRGAVARLPSCC-SGKQGGRVLFPSCNVRYELYP  247

Query  767  FYK  775
            FY 
Sbjct  248  FYN  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2543375957792