BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2306_g1_i1 len=1590 path=[1:0-812 814:813-1589]

Length=1590
                                                                      Score     E

ref|XP_009606227.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    630   0.0      
ref|XP_009604109.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    630   0.0      
ref|XP_009797161.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    625   0.0      
gb|ACF17641.1|  putative branched-chain alpha-keto acid dehydroge...    625   0.0      Capsicum annuum
ref|XP_003604926.1|  2-oxoisovalerate dehydrogenase subunit beta        622   0.0      
gb|AFK44061.1|  unknown                                                 620   0.0      
ref|XP_006359200.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    620   0.0      
ref|XP_004228950.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    616   0.0      
ref|NP_001239825.1|  uncharacterized protein LOC100802853               615   0.0      
ref|XP_011089704.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    615   0.0      
ref|XP_004506580.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    612   0.0      
ref|XP_003520965.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    608   0.0      
ref|XP_007014022.1|  Branched-chain alpha-keto acid decarboxylase...    607   0.0      
ref|XP_002523400.1|  2-oxoisovalerate dehydrogenase, putative           607   0.0      Ricinus communis
ref|XP_006445563.1|  hypothetical protein CICLE_v10015660mg             607   0.0      
ref|XP_002285753.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    605   0.0      Vitis vinifera
ref|XP_008351288.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    602   0.0      
ref|XP_008384355.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    602   0.0      
ref|XP_008366128.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    602   0.0      
ref|XP_009376111.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    602   0.0      
ref|XP_011025117.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    600   0.0      
ref|XP_002304849.1|  hypothetical protein POPTR_0003s20830g             600   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP30628.1|  hypothetical protein JCGZ_16193                         600   0.0      
ref|XP_006305217.1|  hypothetical protein CARUB_v10009583mg             599   0.0      
ref|XP_010032844.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    597   0.0      
ref|XP_008450996.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    596   0.0      
ref|XP_004144063.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    596   0.0      
gb|KFK38675.1|  hypothetical protein AALP_AA3G145900                    596   0.0      
ref|XP_006407215.1|  hypothetical protein EUTSA_v10021009mg             596   0.0      
ref|NP_187954.1|  branched chain alpha-keto acid dehydrogenase E1...    595   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501164.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    595   0.0      
ref|XP_010552302.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    595   0.0      
emb|CAN61041.1|  hypothetical protein VITISV_037525                     593   0.0      Vitis vinifera
ref|XP_009339200.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    594   0.0      
ref|NP_175947.1|  branched-chain alpha-keto acid decarboxylase E1...    594   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462401.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    593   0.0      
gb|AAC64005.1|  branched-chain alpha-keto acid decarboxylase E1 b...    593   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004294943.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    593   0.0      
ref|XP_009413882.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    593   0.0      
ref|XP_002891838.1|  BCDH BETA1                                         593   0.0      
ref|XP_010534847.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    592   0.0      
ref|XP_009106875.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    592   0.0      
ref|XP_010480084.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    592   0.0      
ref|XP_008221362.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    592   0.0      
ref|XP_007205405.1|  hypothetical protein PRUPE_ppa007575mg             592   0.0      
ref|XP_006392631.1|  hypothetical protein EUTSA_v10011610mg             592   0.0      
emb|CDP18579.1|  unnamed protein product                                593   0.0      
ref|XP_006826304.1|  hypothetical protein AMTR_s00004p00075280          590   0.0      
ref|NP_001141206.1|  uncharacterized protein LOC100273293               588   0.0      Zea mays [maize]
ref|XP_010909032.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    587   0.0      
ref|NP_001241785.1|  3-methyl-2-oxobutanoate dehydrogenase              588   0.0      
ref|XP_002884967.1|  hypothetical protein ARALYDRAFT_478729             587   0.0      
ref|XP_010257699.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    587   0.0      
ref|XP_006445562.1|  hypothetical protein CICLE_v10015660mg             586   0.0      
ref|XP_004955572.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    585   0.0      
dbj|BAJ90424.1|  predicted protein                                      585   0.0      
ref|NP_001058989.1|  Os07g0170100                                       583   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010909031.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    582   0.0      
ref|XP_003557527.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    582   0.0      
ref|XP_010673455.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    583   0.0      
gb|ACR36340.1|  unknown                                                 580   0.0      Zea mays [maize]
ref|XP_006658312.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    573   0.0      
emb|CDY10556.1|  BnaC03g70580D                                          571   0.0      
emb|CDY02436.1|  BnaA08g00430D                                          563   0.0      
ref|XP_001772587.1|  predicted protein                                  556   0.0      
ref|XP_010103093.1|  2-oxoisovalerate dehydrogenase subunit beta        553   0.0      
gb|KHG18913.1|  bkdB                                                    548   0.0      
gb|KHG18914.1|  bkdB                                                    546   0.0      
ref|XP_011025118.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    525   0.0      
ref|XP_007014025.1|  Branched-chain alpha-keto acid decarboxylase...    522   8e-180   
ref|XP_007014026.1|  Branched-chain alpha-keto acid decarboxylase...    522   1e-179   
ref|XP_010909036.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    519   4e-179   
gb|KGN66346.1|  hypothetical protein Csa_1G599400                       519   1e-178   
ref|XP_010909033.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    513   8e-177   
ref|XP_010909035.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    512   3e-176   
ref|XP_002973790.1|  hypothetical protein SELMODRAFT_100348             508   3e-175   
ref|XP_010909037.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    507   2e-174   
ref|XP_002983606.1|  hypothetical protein SELMODRAFT_118501             506   2e-174   
ref|XP_008805370.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    499   2e-171   
ref|XP_006576608.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    496   3e-171   
gb|EYU39280.1|  hypothetical protein MIMGU_mgv1a012352mg                495   1e-170   
ref|XP_008805369.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    487   2e-166   
ref|XP_006445561.1|  hypothetical protein CICLE_v10015660mg             477   8e-163   
ref|XP_007014024.1|  Branched-chain alpha-keto acid decarboxylase...    475   2e-162   
gb|KDO54502.1|  hypothetical protein CISIN_1g017410mg                   474   2e-161   
ref|XP_008366129.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    473   2e-161   
ref|XP_008384356.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    473   3e-161   
emb|CBJ32712.1|  Branched chain alpha-keto acid dehydrogenase E1 ...    477   1e-160   
gb|KCW52336.1|  hypothetical protein EUGRSUZ_J01753                     469   1e-159   
gb|EPS60890.1|  hypothetical protein M569_13911                         467   2e-159   
ref|XP_003724225.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    468   7e-159   
ref|XP_008605775.1|  2-oxoisovalerate dehydrogenase subunit beta,...    468   1e-158   
ref|XP_009829616.1|  2-oxoisovalerate dehydrogenase subunit beta,...    462   2e-156   
ref|XP_008873308.1|  2-oxoisovalerate dehydrogenase subunit beta,...    461   6e-156   
ref|XP_002946840.1|  hypothetical protein VOLCADRAFT_56472              458   5e-155   
emb|CDS07709.1|  hypothetical protein LRAMOSA01658                      460   6e-155   
ref|XP_009529584.1|  hypothetical protein PHYSODRAFT_561567             456   1e-154   
gb|EPB84905.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    457   1e-154   
ref|XP_004368155.1|  branched-chain alpha-KETO ACID decarboxylase...    459   2e-154   
emb|CDH48749.1|  3-methyl-2-oxobutanoate dehydrogenase                  458   4e-154   
ref|XP_008901567.1|  2-oxoisovalerate dehydrogenase subunit beta,...    455   6e-154   
dbj|GAM26834.1|  hypothetical protein SAMD00019534_100090               456   9e-154   
ref|XP_002909050.1|  2-oxoisovalerate dehydrogenase subunit beta,...    456   1e-153   
emb|CEG69275.1|  Putative 2-oxoisovalerate dehydrogenase subunit ...    456   2e-153   
emb|CEG65488.1|  Putative 2-oxoisovalerate dehydrogenase subunit ...    456   2e-153   
ref|XP_008901565.1|  2-oxoisovalerate dehydrogenase subunit beta,...    455   2e-153   
gb|EIE84947.1|  hypothetical protein RO3G_09657                         455   5e-153   
ref|XP_005643202.1|  Thiamin diphosphate-binding protein                452   2e-152   
gb|EYC33495.1|  hypothetical protein Y032_0002g828                      452   4e-152   
emb|CCI41764.1|  unnamed protein product                                449   2e-151   
emb|CCI41763.1|  unnamed protein product                                448   3e-151   
emb|CCI41765.1|  unnamed protein product                                450   3e-151   
gb|KFM67493.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    450   3e-151   
ref|XP_010909038.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    447   4e-151   
gb|KDO30998.1|  2-oxoisovalerate dehydrogenase subunit beta             448   5e-151   
ref|XP_007014023.1|  Branched-chain alpha-keto acid decarboxylase...    443   2e-150   
ref|XP_006270491.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    446   2e-150   
gb|EXX65842.1|  hypothetical protein RirG_129530                        449   2e-150   
ref|XP_006034474.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    446   2e-150   
ref|XP_006132027.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    446   2e-150   
ref|XP_004541711.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    448   3e-150   
ref|XP_002154798.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    446   5e-150   
ref|XP_005741369.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    447   5e-150   
ref|XP_004357690.1|  3-methyl-2-oxobutanoate dehydrogenase              447   5e-150   
ref|XP_007903241.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    447   5e-150   
ref|XP_647496.1|  3-methyl-2-oxobutanoate dehydrogenase                 446   6e-150   Dictyostelium discoideum AX4
ref|XP_010706000.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    445   6e-150   
ref|XP_003292570.1|  3-methyl-2-oxobutanoate dehydrogenase              446   6e-150   
ref|XP_006794901.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    447   8e-150   
ref|XP_005518218.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   8e-150   
ref|XP_007090204.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   1e-149   
ref|XP_005421213.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   1e-149   
ref|XP_002936254.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    446   1e-149   
ref|XP_008493582.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   1e-149   
ref|XP_005506787.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   1e-149   
ref|XP_003986385.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    446   2e-149   
ref|XP_010001384.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   2e-149   
ref|XP_005025308.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   2e-149   
gb|EMC90171.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    444   2e-149   
ref|XP_008638434.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   2e-149   
ref|XP_007059940.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   3e-149   
ref|XP_009905725.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   3e-149   
ref|XP_009885764.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   3e-149   
ref|XP_009563064.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   3e-149   
ref|XP_010298415.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   4e-149   
ref|XP_009473900.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   5e-149   
ref|XP_009933918.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   5e-149   
ref|XP_009644370.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   5e-149   
ref|XP_005153208.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   5e-149   
ref|XP_005684511.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   6e-149   
ref|XP_003453523.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   7e-149   
ref|XP_006626367.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    445   7e-149   
ref|XP_009092396.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   7e-149   
ref|XP_009331403.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   7e-149   
ref|XP_004893083.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    444   1e-148   
ref|XP_005485991.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   1e-148   
ref|XP_005984222.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-148   
ref|XP_009666589.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-148   
ref|XP_005229316.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-148   
ref|XP_007668914.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-148   
ref|XP_005324821.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-148   
ref|XP_007257328.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   2e-148   
ref|XP_010742898.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   2e-148   
gb|ERG84621.1|  2-oxoisovalerate dehydrogenase subunit                  442   2e-148   
ref|XP_009957173.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-148   
gb|EFB14598.1|  hypothetical protein PANDA_004408                       443   3e-148   Ailuropoda melanoleuca
ref|NP_989988.1|  2-oxoisovalerate dehydrogenase subunit beta, mi...    443   3e-148   Gallus gallus [bantam]
ref|XP_008061528.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   3e-148   
ref|XP_006182159.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   3e-148   
ref|XP_002916344.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    443   4e-148   
ref|XP_004610175.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   4e-148   
ref|XP_007620163.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   5e-148   
ref|XP_005870015.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   5e-148   
ref|XP_005299662.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   5e-148   
gb|AAI58862.1|  Branched chain keto acid dehydrogenase E1, beta p...    442   5e-148   Rattus norvegicus [brown rat]
ref|XP_009910804.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   6e-148   
ref|XP_005596859.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   6e-148   
ref|XP_003796781.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   7e-148   
ref|XP_006510848.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   8e-148   
ref|XP_532213.2|  PREDICTED: 2-oxoisovalerate dehydrogenase subun...    442   8e-148   Canis lupus familiaris [dogs]
ref|XP_005044151.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   9e-148   
emb|CDJ83464.1|  Transketolase domain containing protein                441   9e-148   
ref|NP_954665.1|  2-oxoisovalerate dehydrogenase subunit beta, mi...    439   1e-147   Mus musculus [mouse]
ref|XP_008901566.1|  2-oxoisovalerate dehydrogenase subunit beta,...    440   1e-147   
ref|XP_004752872.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    442   1e-147   
ref|XP_007440380.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   1e-147   
ref|NP_001108310.1|  branched chain keto acid dehydrogenase E1, b...    441   1e-147   Xenopus laevis [clawed frog]
dbj|BAG65195.1|  unnamed protein product                                438   2e-147   Homo sapiens [man]
ref|XP_003404146.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   2e-147   
sp|P21839.2|ODBB_BOVIN  RecName: Full=2-oxoisovalerate dehydrogen...    441   2e-147   Bos taurus [bovine]
gb|AAI18381.1|  Branched chain keto acid dehydrogenase E1, beta p...    441   2e-147   Bos taurus [bovine]
ref|NP_062140.1|  2-oxoisovalerate dehydrogenase subunit beta, mi...    441   2e-147   Rattus norvegicus [brown rat]
ref|XP_008322008.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   3e-147   
ref|XP_003474801.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   3e-147   
gb|KFM25320.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    439   3e-147   
ref|XP_010852891.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   3e-147   
ref|XP_008683087.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   3e-147   
ref|XP_006143409.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   3e-147   
ref|XP_003500031.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   4e-147   
ref|WP_013345865.1|  2-oxoisovalerate dehydrogenase subunit beta        437   4e-147   
ref|XP_005377734.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   4e-147   
ref|XP_010629419.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   4e-147   
ref|XP_010971148.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   4e-147   
ref|XP_008805371.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   4e-147   
ref|XP_003965942.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   4e-147   
gb|EPQ10020.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    440   4e-147   
ref|XP_006053485.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoisovale...    440   4e-147   
ref|XP_002746806.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   5e-147   Callithrix jacchus [common marmoset]
ref|XP_006090418.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   6e-147   
ref|XP_004386115.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   6e-147   
ref|XP_010629420.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   6e-147   
ref|XP_006715605.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   6e-147   
ref|XP_004450630.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    440   6e-147   
ref|XP_006214405.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   7e-147   
ref|XP_005073744.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   7e-147   
ref|XP_004673701.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   8e-147   
ref|XP_007536748.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   8e-147   
ref|XP_006985424.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   8e-147   
ref|XP_002714592.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   9e-147   Oryctolagus cuniculus [domestic rabbit]
ref|XP_009203844.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   1e-146   
ref|XP_004628328.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   1e-146   
ref|XP_007949459.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   1e-146   
ref|NP_776932.1|  2-oxoisovalerate dehydrogenase subunit beta, mi...    439   1e-146   Bos taurus [bovine]
emb|CDP93992.1|  Protein Bm3652, isoform a                              438   1e-146   
ref|XP_007456686.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   1e-146   
ref|XP_006873338.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   1e-146   
ref|XP_007168024.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    439   1e-146   
pdb|1DTW|B  Chain B, Human Branched-Chain Alpha-Keto Acid Dehydro...    437   2e-146   
ref|XP_006926421.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoisovale...    439   2e-146   
gb|AAA51410.1|  branched chain alpha-keto acid dehydrogenase E1-b...    437   2e-146   Bos taurus [bovine]
ref|XP_003740039.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   2e-146   
gb|EFW40113.2|  branched chain keto acid dehydrogenase E1 beta po...    438   2e-146   
gb|ERG82267.1|  2-oxoisovalerate dehydrogenase subunit                  436   2e-146   
ref|XP_008555713.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   2e-146   
pdb|2J9F|B  Chain B, Human Branched-Chain Alpha-Ketoacid Dehydrog...    436   3e-146   
ref|XP_002189416.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    441   3e-146   Taeniopygia guttata
gb|EFA77230.1|  RabGAP/TBC domain-containing protein                    460   3e-146   Polysphondylium pallidum PN500
ref|WP_036545912.1|  2-oxoisovalerate dehydrogenase                     435   3e-146   
ref|XP_003769285.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    438   4e-146   
ref|XP_008120105.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    438   4e-146   
ref|XP_003258317.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   5e-146   
ref|NP_001116691.1|  2-oxoisovalerate dehydrogenase subunit beta,...    437   6e-146   Sus scrofa [pigs]
ref|NP_000047.1|  2-oxoisovalerate dehydrogenase subunit beta, mi...    437   6e-146   Homo sapiens [man]
ref|XP_004422116.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   6e-146   
ref|XP_008967691.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   6e-146   
ref|XP_009449868.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   7e-146   
gb|AAV38888.1|  branched chain keto acid dehydrogenase E1, beta p...    437   8e-146   
ref|XP_009203841.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   9e-146   
ref|XP_003923310.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   9e-146   
ref|XP_006898491.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    437   9e-146   
ref|XP_005552545.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   1e-145   
ref|XP_005347612.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   1e-145   
emb|CDW80587.1|  UNKNOWN                                                434   2e-145   
ref|XP_010386836.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   2e-145   
emb|CAA36685.1|  unnamed protein product                                435   2e-145   Homo sapiens [man]
ref|XP_004270138.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   2e-145   
emb|CCA15080.1|  2oxoisovalerate dehydrogenase subunit beta putative    434   3e-145   
pdb|1OLX|B  Chain B, Roles Of His291-alpha And His146-beta' In Th...    434   3e-145   
ref|XP_006243512.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    436   3e-145   
ref|XP_009014553.1|  hypothetical protein HELRODRAFT_98557              435   3e-145   
gb|EFO24001.2|  2-oxoisovalerate dehydrogenase subunit beta             434   5e-145   
ref|WP_025820434.1|  2-oxoisovalerate dehydrogenase                     432   5e-145   
ref|XP_002741809.2|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    432   6e-145   Saccoglossus kowalevskii
ref|XP_003140071.1|  2-oxoisovalerate dehydrogenase subunit beta        432   6e-145   
gb|ELT94594.1|  hypothetical protein CAPTEDRAFT_225843                  434   6e-145   
ref|XP_006678665.1|  hypothetical protein BATDEDRAFT_88045              434   8e-145   
gb|KHN71958.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    441   9e-145   
ref|NP_001233071.1|  uncharacterized protein LOC100165320               433   1e-144   
ref|XP_005809711.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    433   1e-144   
ref|XP_007564638.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    433   2e-144   
ref|WP_021817635.1|  2-oxoisovalerate dehydrogenase subunit beta        431   2e-144   
gb|EJY74080.1|  RabGAP/TBC domain-containing protein                    433   2e-144   
ref|XP_001448134.1|  hypothetical protein                               431   3e-144   Paramecium tetraurelia strain d4-2
ref|XP_008275831.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    432   5e-144   
gb|EOA97259.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    429   6e-144   
ref|XP_001444042.1|  hypothetical protein                               430   8e-144   Paramecium tetraurelia strain d4-2
gb|KFV73305.1|  hypothetical protein N307_12035                         428   8e-144   
ref|WP_011759824.1|  2-oxoisovalerate dehydrogenase subunit beta        429   9e-144   
ref|XP_005706185.1|  2-oxoisovalerate dehydrogenase E1 component,...    430   1e-143   
ref|WP_013051319.1|  2-oxoisovalerate dehydrogenase subunit beta        429   1e-143   
ref|XP_009055945.1|  hypothetical protein LOTGIDRAFT_178544             428   1e-143   
gb|KFR09368.1|  hypothetical protein Y956_07889                         427   1e-143   
emb|CDJ89071.1|  Zinc finger and Transketolase domain containing ...    442   2e-143   
ref|WP_011637397.1|  2-oxoisovalerate dehydrogenase subunit beta        428   2e-143   
ref|XP_008430151.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    430   3e-143   
gb|ESA06802.1|  hypothetical protein GLOINDRAFT_33696                   427   3e-143   
dbj|BAL45907.1|  transketolase, central region                          427   6e-143   
ref|WP_019934306.1|  2-oxoisovalerate dehydrogenase subunit beta        427   6e-143   
ref|XP_004024279.1|  hypothetical protein IMG5_196650                   427   7e-143   
ref|WP_036522318.1|  2-oxoisovalerate dehydrogenase                     426   1e-142   
ref|XP_004086675.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    428   2e-142   
ref|XP_002112870.1|  hypothetical protein TRIADDRAFT_25751              426   2e-142   
emb|CDJ50268.1|  branched-chain alpha-keto acid dehydrogenase E1 ...    425   3e-142   
gb|KIH45102.1|  Transketolase protein                                   424   3e-142   
ref|XP_003885351.1|  Transketolase central region, related              428   3e-142   
ref|XP_009860514.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    426   6e-142   
ref|XP_002673227.1|  predicted protein                                  423   7e-142   
ref|XP_002178678.1|  predicted protein                                  424   8e-142   
ref|XP_005831762.1|  hypothetical protein GUITHDRAFT_152862             424   8e-142   
ref|XP_009499053.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    424   9e-142   
gb|ACH85323.1|  branched chain ketoacid dehydrogenase E1 beta pol...    426   9e-142   
ref|XP_007134078.1|  hypothetical protein PHAVU_010G0177000g            421   1e-141   
ref|XP_001032071.2|  2-oxoisovalerate dehydrogenase beta subunit,...    425   1e-141   
ref|WP_023265283.1|  central region                                     423   2e-141   
ref|WP_011397493.1|  2-oxoisovalerate dehydrogenase subunit beta        423   2e-141   
ref|WP_007648246.1|  2-oxoisovalerate dehydrogenase subunit beta        423   3e-141   
ref|WP_037418512.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase       422   3e-141   
ref|WP_011622791.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    422   3e-141   
ref|XP_004524208.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    424   4e-141   
ref|NP_001074122.1|  2-oxoisovalerate dehydrogenase subunit beta,...    424   5e-141   
gb|KEK28313.1|  transketolase, central region                           422   5e-141   
ref|XP_005851352.1|  hypothetical protein CHLNCDRAFT_48446              422   5e-141   
ref|WP_035160270.1|  2-oxoisovalerate dehydrogenase                     422   5e-141   
gb|ELK00122.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    424   6e-141   
emb|CDQ64759.1|  unnamed protein product                                424   7e-141   
ref|WP_025887401.1|  2-oxoisovalerate dehydrogenase                     421   8e-141   
gb|KDD73200.1|  transketolase                                           421   9e-141   
ref|WP_028304371.1|  2-oxoisovalerate dehydrogenase                     421   1e-140   
ref|WP_011072331.1|  2-oxoisovalerate dehydrogenase subunit beta        421   1e-140   
gb|EPZ36043.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    421   1e-140   
gb|KFH66493.1|  2-oxoisovalerate dehydrogenase E1 component, beta...    424   1e-140   
gb|ERE76262.1|  2-oxoisovalerate dehydrogenase subunit beta             422   2e-140   
ref|XP_002287126.1|  alpha-keto acid dehydrogenase                      421   2e-140   
ref|WP_035593391.1|  2-oxoisovalerate dehydrogenase                     421   2e-140   
ref|XP_008883493.1|  pyruvate dehydrogenase E1 component, beta su...    424   2e-140   
ref|WP_039033007.1|  2-oxoisovalerate dehydrogenase                     420   3e-140   
ref|WP_028117468.1|  2-oxoisovalerate dehydrogenase                     420   3e-140   
ref|WP_039181783.1|  2-oxoisovalerate dehydrogenase                     420   3e-140   
ref|WP_012277322.1|  2-oxoisovalerate dehydrogenase subunit beta        420   3e-140   
ref|WP_012155481.1|  2-oxoisovalerate dehydrogenase subunit beta        420   4e-140   
ref|XP_010902632.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    422   5e-140   
ref|WP_016855002.1|  2-oxoisovalerate dehydrogenase subunit beta        419   5e-140   
ref|XP_974707.1|  PREDICTED: 2-oxoisovalerate dehydrogenase subun...    421   5e-140   
ref|XP_002436268.1|  branched chain alpha-keto acid dehydrogenase...    422   5e-140   
ref|WP_014291773.1|  2-oxoisovalerate dehydrogenase subunit beta        419   6e-140   
ref|WP_013332127.1|  2-oxoisovalerate dehydrogenase subunit beta        419   6e-140   
ref|WP_004579049.1|  2-oxoisovalerate dehydrogenase, E1 component...    419   7e-140   
ref|WP_014610632.1|  2-oxoisovalerate dehydrogenase subunit beta        419   7e-140   
ref|XP_002364640.1|  branched-chain alpha-keto acid dehydrogenase...    422   8e-140   
ref|WP_012089197.1|  2-oxoisovalerate dehydrogenase subunit beta        419   9e-140   
ref|WP_028779908.1|  2-oxoisovalerate dehydrogenase                     419   1e-139   
ref|WP_028759982.1|  2-oxoisovalerate dehydrogenase                     419   1e-139   
ref|WP_006081587.1|  2-oxoisovalerate dehydrogenase subunit beta        419   1e-139   
ref|WP_011919255.1|  2-oxoisovalerate dehydrogenase subunit beta        419   1e-139   
ref|WP_037439655.1|  2-oxoisovalerate dehydrogenase                     419   1e-139   
ref|WP_016913922.1|  2-oxoisovalerate dehydrogenase subunit beta        418   2e-139   
ref|WP_009097565.1|  2-oxoisovalerate dehydrogenase subunit beta        418   2e-139   
ref|XP_008137855.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    419   3e-139   
ref|XP_004011172.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    420   3e-139   
ref|WP_016415240.1|  2-oxoisovalerate dehydrogenase subunit beta        417   4e-139   
ref|WP_033076468.1|  2-oxoisovalerate dehydrogenase                     417   4e-139   
ref|WP_012142672.1|  2-oxoisovalerate dehydrogenase subunit beta        417   4e-139   
ref|WP_024599564.1|  2-oxoisovalerate dehydrogenase                     417   5e-139   
ref|XP_005717634.1|  branched-chain alpha-keto acid decarboxylase...    419   5e-139   
ref|WP_028300148.1|  2-oxoisovalerate dehydrogenase                     417   5e-139   
ref|WP_012139143.1|  2-oxoisovalerate dehydrogenase, E1 component...    417   5e-139   
ref|WP_011789421.1|  2-oxoisovalerate dehydrogenase subunit beta        417   6e-139   
ref|XP_004833554.1|  transketolase, pyridine binding domain conta...    418   6e-139   
ref|WP_027335803.1|  2-oxoisovalerate dehydrogenase                     417   6e-139   
ref|WP_028670649.1|  2-oxoisovalerate dehydrogenase                     417   7e-139   
ref|WP_008044413.1|  2-oxoisovalerate dehydrogenase subunit beta        417   7e-139   
ref|XP_011190685.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    418   8e-139   
ref|WP_007616127.1|  2-oxoisovalerate dehydrogenase E1 component,...    416   9e-139   
ref|WP_009724314.1|  2-oxoisovalerate dehydrogenase subunit beta        416   9e-139   
gb|KGA02339.1|  2-oxoisovalerate dehydrogenase                          416   1e-138   
emb|CDJ37838.1|  branched-chain alpha-keto acid dehydrogenase E1 ...    419   1e-138   
ref|WP_038483977.1|  2-oxoisovalerate dehydrogenase                     416   1e-138   
ref|WP_007114321.1|  2-oxoisovalerate dehydrogenase subunit beta        416   1e-138   
ref|XP_008683082.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    420   1e-138   
ref|WP_008956882.1|  2-oxoisovalerate dehydrogenase subunit beta        416   2e-138   
ref|WP_020743608.1|  2-oxoglutarate dehydrogenase complex, dehydr...    416   2e-138   
ref|XP_006445564.1|  hypothetical protein CICLE_v10015660mg             414   2e-138   
ref|WP_009835004.1|  2-oxoisovalerate dehydrogenase subunit beta        415   2e-138   
gb|KFB51752.1|  AGAP007531-PA-like protein                              417   2e-138   
ref|WP_002962936.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    415   3e-138   
ref|WP_024612489.1|  2-oxoisovalerate dehydrogenase                     415   3e-138   
ref|XP_005777399.1|  hypothetical protein EMIHUDRAFT_457636             416   3e-138   
ref|WP_014577016.1|  2-oxoisovalerate dehydrogenase subunit beta        415   3e-138   
ref|WP_008171214.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    415   3e-138   
ref|WP_028114911.1|  2-oxoisovalerate dehydrogenase                     415   3e-138   
ref|WP_009287805.1|  MULTISPECIES: Transketolase-like, pyrimidine...    415   3e-138   
ref|WP_037436972.1|  2-oxoisovalerate dehydrogenase                     414   4e-138   
ref|WP_014949532.1|  2-oxoisovalerate dehydrogenase subunit beta        415   4e-138   
ref|WP_007586846.1|  2-oxoisovalerate dehydrogenase subunit beta        414   4e-138   
gb|ACO11334.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    416   4e-138   
gb|KFQ78989.1|  hypothetical protein N335_08933                         412   4e-138   
ref|WP_040186910.1|  2-oxoisovalerate dehydrogenase                     414   5e-138   
ref|WP_028108913.1|  2-oxoisovalerate dehydrogenase                     414   5e-138   
ref|WP_008938284.1|  2-oxoisovalerate dehydrogenase, E1 component...    414   5e-138   
ref|WP_008133725.1|  2-oxoisovalerate dehydrogenase subunit beta        414   5e-138   
ref|WP_016900373.1|  2-oxoisovalerate dehydrogenase subunit beta        414   6e-138   
ref|WP_015048479.1|  2-oxoisovalerate dehydrogenase subunit beta        414   6e-138   
ref|WP_036968262.1|  2-oxoisovalerate dehydrogenase                     414   7e-138   
ref|WP_024605566.1|  2-oxoisovalerate dehydrogenase                     414   7e-138   
ref|XP_001621337.1|  hypothetical protein NEMVEDRAFT_v1g222088          413   8e-138   
ref|WP_025255280.1|  2-oxoisovalerate dehydrogenase                     414   9e-138   
ref|WP_012324903.1|  2-oxoisovalerate dehydrogenase subunit beta        414   9e-138   
gb|AIF98973.1|  2-oxoisovalerate dehydrogenase                          414   9e-138   
ref|WP_012518445.1|  2-oxoisovalerate dehydrogenase subunit beta        414   9e-138   
ref|XP_009497719.1|  2-oxoisovalerate dehydrogenase E1 component,...    416   1e-137   
ref|XP_001992969.1|  GH13348                                            413   1e-137   
gb|KIN12910.1|  2-oxoisovalerate dehydrogenase                          414   1e-137   
ref|WP_033028368.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase       414   1e-137   
ref|WP_036202919.1|  2-oxoisovalerate dehydrogenase                     414   1e-137   
ref|WP_030073126.1|  2-oxoisovalerate dehydrogenase                     413   1e-137   
ref|WP_039220227.1|  2-oxoisovalerate dehydrogenase                     413   1e-137   
gb|KFZ56959.1|  hypothetical protein N321_12548                         412   1e-137   
ref|XP_308350.2|  AGAP007531-PA                                         415   1e-137   
ref|XP_006510850.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    412   1e-137   
ref|XP_009807578.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    411   1e-137   
ref|WP_019018031.1|  2-oxoisovalerate dehydrogenase subunit beta        413   1e-137   
ref|WP_010552682.1|  2-oxoisovalerate dehydrogenase subunit beta        413   1e-137   
ref|WP_011865724.1|  2-oxoisovalerate dehydrogenase subunit beta        413   2e-137   
ref|WP_007153585.1|  2-oxoisovalerate dehydrogenase subunit beta        413   2e-137   
ref|XP_001864856.1|  2-oxoisovalerate dehydrogenase subunit beta,...    415   2e-137   
gb|KFV51633.1|  hypothetical protein N328_09200                         411   2e-137   
ref|WP_005503426.1|  2-oxoisovalerate dehydrogenase subunit beta        413   2e-137   
ref|WP_018916239.1|  2-oxoisovalerate dehydrogenase subunit beta        413   2e-137   
ref|WP_014998387.1|  2-oxoisovalerate dehydrogenase subunit beta        413   2e-137   
ref|WP_006955708.1|  2-oxoisovalerate dehydrogenase subunit beta        413   2e-137   
ref|WP_008466735.1|  2-oxoisovalerate dehydrogenase subunit beta        412   2e-137   
ref|XP_010289476.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    411   2e-137   
ref|WP_008844644.1|  2-oxoisovalerate dehydrogenase E1 component,...    412   2e-137   
ref|WP_033080846.1|  2-oxoisovalerate dehydrogenase                     412   3e-137   
ref|WP_013464999.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    412   3e-137   
ref|WP_011496228.1|  2-oxoisovalerate dehydrogenase subunit beta        412   3e-137   
ref|WP_022992373.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    412   3e-137   
ref|WP_010390106.1|  2-oxoisovalerate dehydrogenase subunit beta        412   3e-137   
ref|WP_019029908.1|  2-oxoisovalerate dehydrogenase subunit beta        412   3e-137   
ref|WP_007104573.1|  2-oxoisovalerate dehydrogenase E1 component,...    412   3e-137   
ref|WP_035555603.1|  2-oxoisovalerate dehydrogenase                     412   3e-137   
ref|WP_027830717.1|  2-oxoisovalerate dehydrogenase                     412   3e-137   
ref|WP_023006709.1|  2-oxoisovalerate dehydrogenase subunit beta        412   4e-137   
gb|ETN63553.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    414   5e-137   
gb|KFD57188.1|  hypothetical protein M513_02073                         417   5e-137   
ref|XP_011213738.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    413   5e-137   
ref|XP_006510849.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    412   5e-137   
ref|WP_027848650.1|  2-oxoisovalerate dehydrogenase                     412   6e-137   
ref|WP_010628494.1|  2-oxoisovalerate dehydrogenase subunit beta        412   6e-137   
gb|ELR51303.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    410   6e-137   
ref|WP_026321185.1|  2-oxoisovalerate dehydrogenase                     412   6e-137   
ref|WP_014421619.1|  2-oxoisovalerate dehydrogenase subunit beta        412   6e-137   
ref|WP_018981733.1|  2-oxoisovalerate dehydrogenase subunit beta        412   6e-137   
ref|WP_035490263.1|  2-oxoisovalerate dehydrogenase                     411   7e-137   
gb|KIH61451.1|  Transketolase, pyridine binding domain protein          428   7e-137   
gb|ETN92886.1|  2-oxoisovalerate dehydrogenase subunit beta             412   7e-137   
ref|XP_010164984.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    409   7e-137   
ref|WP_024033553.1|  2-oxoisovalerate dehydrogenase subunit beta        411   8e-137   
ref|WP_009839845.1|  2-oxoisovalerate dehydrogenase subunit beta        411   9e-137   
gb|EFX69339.1|  hypothetical protein DAPPUDRAFT_300984                  412   1e-136   
emb|CDR94247.1|  branched-chain alpha-keto acid dehydrogenase E1 ...    412   1e-136   
ref|XP_005536806.1|  branched-chain alpha-keto acid decarboxylase...    416   1e-136   
ref|WP_011784873.1|  2-oxoisovalerate dehydrogenase subunit beta        410   1e-136   
ref|WP_023008310.1|  2-oxoisovalerate dehydrogenase subunit beta        410   1e-136   
ref|XP_004580597.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    415   2e-136   
ref|WP_008171138.1|  2-oxoisovalerate dehydrogenase subunit beta        410   2e-136   
ref|WP_023399392.1|  pyruvate/2-oxoglutarate dehydrogenase comple...    410   2e-136   
ref|WP_008113791.1|  2-oxoisovalerate dehydrogenase subunit beta        410   2e-136   
ref|WP_027313773.1|  2-oxoisovalerate dehydrogenase                     410   2e-136   
ref|WP_007375763.1|  branched-chain alpha-keto acid dehydrogenase...    410   3e-136   
ref|WP_039609848.1|  2-oxoisovalerate dehydrogenase                     410   3e-136   
ref|WP_005493882.1|  Branched-chain alpha-keto acid dehydrogenase...    410   3e-136   
ref|WP_029773603.1|  2-oxoisovalerate dehydrogenase                     410   3e-136   
ref|WP_020912698.1|  Transketolase, central region:Transketolase,...    409   3e-136   
ref|WP_004586666.1|  2-oxoisovalerate dehydrogenase subunit beta        410   3e-136   
ref|XP_005902818.1|  PREDICTED: 2-oxoisovalerate dehydrogenase su...    408   4e-136   
ref|XP_009689749.1|  transketolase subunit                              411   4e-136   
ref|WP_029653515.1|  2-oxoisovalerate dehydrogenase                     409   4e-136   
gb|ABR27280.1|  3-methyl-2-oxobutanoate dehydrogenase                   411   4e-136   
emb|CDJ33027.1|  branched-chain alpha-keto acid dehydrogenase E1 ...    410   4e-136   
ref|WP_008127400.1|  2-oxoisovalerate dehydrogenase subunit beta        409   5e-136   
ref|WP_007635683.1|  2-oxoisovalerate dehydrogenase E1 component,...    409   6e-136   
ref|WP_011042419.1|  2-oxoisovalerate dehydrogenase subunit beta        409   6e-136   
ref|XP_006305216.1|  hypothetical protein CARUB_v10009583mg             407   6e-136   
ref|WP_039037069.1|  2-oxoisovalerate dehydrogenase                     409   7e-136   
ref|WP_010556445.1|  2-oxoisovalerate dehydrogenase subunit beta        409   8e-136   
ref|WP_031382969.1|  2-oxoisovalerate dehydrogenase                     409   9e-136   
ref|XP_001610741.1|  branched-chain alpha-keto acid dehydrogenase...    409   9e-136   
ref|WP_011328309.1|  2-oxoisovalerate dehydrogenase subunit beta        408   1e-135   
ref|WP_010604720.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    408   1e-135   
ref|WP_026374865.1|  2-oxoisovalerate dehydrogenase                     408   1e-135   
ref|XP_001743290.1|  hypothetical protein                               408   1e-135   
ref|WP_010372719.1|  2-oxoisovalerate dehydrogenase subunit beta        408   2e-135   
emb|CEF67552.1|  2-oxoisovalerate dehydrogenase subunit beta, mit...    409   2e-135   
ref|WP_006793035.1|  2-oxoisovalerate dehydrogenase subunit beta        407   2e-135   
gb|EKC31869.1|  2-oxoisovalerate dehydrogenase subunit beta, mito...    410   2e-135   
ref|WP_016709661.1|  2-oxoisovalerate dehydrogenase subunit beta        407   2e-135   
ref|WP_033538434.1|  2-oxoisovalerate dehydrogenase                     407   3e-135   
dbj|BAN65134.1|  branched-chain alpha-keto acid dehydrogenase E1 ...    408   3e-135   
ref|WP_033093943.1|  2-oxoisovalerate dehydrogenase                     407   4e-135   
ref|WP_028761898.1|  2-oxoisovalerate dehydrogenase                     407   4e-135   
ref|WP_008306440.1|  MULTISPECIES: 2-oxoisovalerate dehydrogenase...    407   5e-135   
gb|AAA73899.1|  branched chain alpha-keto acid dehydrogenase E1-b...    408   6e-135   
ref|WP_027851475.1|  2-oxoisovalerate dehydrogenase                     406   6e-135   
ref|WP_014108883.1|  2-oxoisovalerate dehydrogenase subunit beta        406   7e-135   
ref|WP_007991187.1|  2-oxoisovalerate dehydrogenase E1 component,...    406   7e-135   
ref|WP_017429007.1|  2-oxoisovalerate dehydrogenase subunit beta        406   9e-135   
ref|WP_028772174.1|  2-oxoisovalerate dehydrogenase                     406   9e-135   
gb|EWG99403.1|  2-oxoisovalerate dehydrogenase subunit beta             406   1e-134   
ref|WP_024596865.1|  2-oxoisovalerate dehydrogenase                     406   1e-134   



>ref|XP_009606227.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=363

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/363 (88%), Positives = 337/363 (93%), Gaps = 2/363 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE--SGKSSMNLFSAVNQALHIALDTD  369
             MA S RR+G L  +  + + RGFSS+V +     E  S   S+NLF+A+NQALHIALD+D
Sbjct  1     MASSFRRIGKLASISSKNQSRGFSSTVDQTLKKSEGISPSKSVNLFTAINQALHIALDSD  60

Query  370   PRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  549
             PR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ
Sbjct  61    PRAYVFGEDVGFGGVFRCTTGLADRFGKQRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  120

Query  550   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVP  729
             FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVP
Sbjct  121   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVP  180

Query  730   GIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMRE  909
             GIKVVIPRSP QAKGLLLSSIRDPNPVVFFEPK LYR+AVEEVPE DYMLPLSEAEV+RE
Sbjct  181   GIKVVIPRSPHQAKGLLLSSIRDPNPVVFFEPKMLYRMAVEEVPEDDYMLPLSEAEVIRE  240

Query  910   GSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSH  1089
             GSDITLVGWGAQLS M++ACIEA KEGISCELIDLKTL+PWDKETVEASVKKTGRLLVSH
Sbjct  241   GSDITLVGWGAQLSTMEQACIEAAKEGISCELIDLKTLIPWDKETVEASVKKTGRLLVSH  300

Query  1090  EAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKST  1269
             EAP+TGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFY+PTKNKILDAIKST
Sbjct  301   EAPVTGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYLPTKNKILDAIKST  360

Query  1270  VNY  1278
             VNY
Sbjct  361   VNY  363



>ref|XP_009604109.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=365

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/363 (88%), Positives = 337/363 (93%), Gaps = 2/363 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE--SGKSSMNLFSAVNQALHIALDTD  369
             MA S RR+G L  +  + + RGFSS+V +     E  S   S+NLF+A+NQALHIALD+D
Sbjct  3     MASSFRRIGKLASISSKNQSRGFSSTVDQTLKKSEGISPSKSVNLFTAINQALHIALDSD  62

Query  370   PRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  549
             PR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ
Sbjct  63    PRAYVFGEDVGFGGVFRCTTGLADRFGKQRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  122

Query  550   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVP  729
             FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVP
Sbjct  123   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVP  182

Query  730   GIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMRE  909
             GIKVVIPRSP QAKGLLLSSIRDPNPVVFFEPK LYR+AVEEVPE DYMLPLSEAEV+RE
Sbjct  183   GIKVVIPRSPHQAKGLLLSSIRDPNPVVFFEPKMLYRMAVEEVPEDDYMLPLSEAEVIRE  242

Query  910   GSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSH  1089
             GSDITLVGWGAQLS M++ACIEA KEGISCELIDLKTL+PWDKETVEASVKKTGRLLVSH
Sbjct  243   GSDITLVGWGAQLSTMEQACIEAAKEGISCELIDLKTLIPWDKETVEASVKKTGRLLVSH  302

Query  1090  EAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKST  1269
             EAP+TGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFY+PTKNKILDAIKST
Sbjct  303   EAPVTGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYLPTKNKILDAIKST  362

Query  1270  VNY  1278
             VNY
Sbjct  363   VNY  365



>ref|XP_009797161.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Nicotiana sylvestris]
Length=363

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/363 (87%), Positives = 335/363 (92%), Gaps = 2/363 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE--SGKSSMNLFSAVNQALHIALDTD  369
             MA S RR+G L  +  + + R FSS+V +     E  S   S+NLF+A+NQALHIALD+D
Sbjct  1     MASSFRRIGKLATISSKNQSRRFSSTVDQTLKKSEGISPSKSVNLFTAINQALHIALDSD  60

Query  370   PRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  549
             PR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ
Sbjct  61    PRAYVFGEDVGFGGVFRCTTGLADRFGKQRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  120

Query  550   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVP  729
             FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVP
Sbjct  121   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVP  180

Query  730   GIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMRE  909
             GIKVVIPRSP QAKGLLLSSIRDPNPVVFFEPK LYR+AVEEVPE DYMLPLSEAEV+RE
Sbjct  181   GIKVVIPRSPHQAKGLLLSSIRDPNPVVFFEPKMLYRMAVEEVPEDDYMLPLSEAEVIRE  240

Query  910   GSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSH  1089
             GSDITLVGWGAQLS M++ACIEA KEGISCELIDLKTL+PWDKETVEASVKKTGRLLVSH
Sbjct  241   GSDITLVGWGAQLSTMEQACIEAAKEGISCELIDLKTLIPWDKETVEASVKKTGRLLVSH  300

Query  1090  EAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKST  1269
             EAP+TGGFGAEISASIVERCF RLEAPVARVCGLDTPFPLVFEPFY+PTKNKILDAIKST
Sbjct  301   EAPVTGGFGAEISASIVERCFMRLEAPVARVCGLDTPFPLVFEPFYLPTKNKILDAIKST  360

Query  1270  VNY  1278
             VNY
Sbjct  361   VNY  363



>gb|ACF17641.1| putative branched-chain alpha-keto acid dehydrogenase E1 beta 
subunit [Capsicum annuum]
Length=361

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/363 (87%), Positives = 338/363 (93%), Gaps = 4/363 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGK-W-RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTD  369
             M  + RR+G L  +  + + W RGFSS+V  E+  Q S   S+NLFSA+NQALHIALD+D
Sbjct  1     MGSNFRRIGKLASISSKNQSWSRGFSSTV--ERSDQLSPSKSVNLFSAINQALHIALDSD  58

Query  370   PRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  549
             PRSYVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ
Sbjct  59    PRSYVFGEDVGFGGVFRCTTGLADRFGKQRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQ  118

Query  550   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVP  729
             FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVP
Sbjct  119   FADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVP  178

Query  730   GIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMRE  909
             GIKVVIPRSP QAKGLLLSSIRDPNPVVFFEPK LYR+AVEEVPE DYMLPLSEAEV+RE
Sbjct  179   GIKVVIPRSPQQAKGLLLSSIRDPNPVVFFEPKLLYRMAVEEVPEDDYMLPLSEAEVLRE  238

Query  910   GSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSH  1089
             G+DITLVGWGAQLS+M++AC+EA KEGISCELIDLKTL+PWDKETVEASVKKTGRLLVSH
Sbjct  239   GTDITLVGWGAQLSIMEQACVEAAKEGISCELIDLKTLIPWDKETVEASVKKTGRLLVSH  298

Query  1090  EAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKST  1269
             EAP+TGGFGAEISASI ERCFTRLEAPVARVCGLDTPFPLVFEPFY+PTKNKILDAIKS+
Sbjct  299   EAPVTGGFGAEISASIAERCFTRLEAPVARVCGLDTPFPLVFEPFYLPTKNKILDAIKSS  358

Query  1270  VNY  1278
             VNY
Sbjct  359   VNY  361



>ref|XP_003604926.1| 2-oxoisovalerate dehydrogenase subunit beta [Medicago truncatula]
 gb|AES87123.1| branched chain alpha-keto acid dehydrogenase E1 beta subunit 
[Medicago truncatula]
Length=358

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/361 (86%), Positives = 338/361 (94%), Gaps = 3/361 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR  375
             M+  ++R+G    ++ R   RG S+S+V++    E+G  S+NL+SAVNQALHIALDTDPR
Sbjct  1     MSPCVKRLGKWVSLVSR---RGLSTSIVQKDAAAENGVKSLNLYSAVNQALHIALDTDPR  57

Query  376   SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFA  555
             +YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFA
Sbjct  58    AYVFGEDVGFGGVFRCTTGLADRFGKKRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFA  117

Query  556   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  735
             DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR PYGAVGHGGHYHSQSPEAFFCHVPGI
Sbjct  118   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRTPYGAVGHGGHYHSQSPEAFFCHVPGI  177

Query  736   KVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             KVVIPRSP +AKGLLLS IRDPNP+VFFEPKWLYRLAVEEVPEGDYMLPLSEAEV+REGS
Sbjct  178   KVVIPRSPKEAKGLLLSCIRDPNPIVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVIREGS  237

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DITLVGWGAQLS+M++AC++AEKEGISCELIDLKTL+PWDKETVEASVKKTGRLL+SHEA
Sbjct  238   DITLVGWGAQLSIMEQACVDAEKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHEA  297

Query  1096  PITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN  1275
             P+TGGFGAEISASI+ERCF+RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTV+
Sbjct  298   PVTGGFGAEISASILERCFSRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVS  357

Query  1276  Y  1278
             Y
Sbjct  358   Y  358



>gb|AFK44061.1| unknown [Medicago truncatula]
Length=358

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/361 (86%), Positives = 337/361 (93%), Gaps = 3/361 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR  375
             M+  ++R+G    ++ R   RG S+S+V++    E+G  S+NL+SAVNQALHIALDTDPR
Sbjct  1     MSPCVKRLGKWVSLVSR---RGLSTSIVQKDAAAENGVKSLNLYSAVNQALHIALDTDPR  57

Query  376   SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFA  555
             +YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFA
Sbjct  58    AYVFGEDVGFGGVFRCTTGLADRFGKKRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFA  117

Query  556   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  735
             DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR PYGAVGHGGHYHSQSPEAFFCHVPGI
Sbjct  118   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRTPYGAVGHGGHYHSQSPEAFFCHVPGI  177

Query  736   KVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             KVVIPRSP +AKGLLLS IRDPNP+VFFEPKWLYRLAVEEVPEGDYMLPLSEAEV+REGS
Sbjct  178   KVVIPRSPKEAKGLLLSCIRDPNPIVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVIREGS  237

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DITLVGWGAQLS+M++AC++AEKEGISCELIDLK L+PWDKETVEASVKKTGRLL+SHEA
Sbjct  238   DITLVGWGAQLSIMEQACVDAEKEGISCELIDLKILIPWDKETVEASVKKTGRLLISHEA  297

Query  1096  PITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN  1275
             P+TGGFGAEISASI+ERCF+RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTV+
Sbjct  298   PVTGGFGAEISASILERCFSRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVS  357

Query  1276  Y  1278
             Y
Sbjct  358   Y  358



>ref|XP_006359200.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial-like 
[Solanum tuberosum]
Length=358

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/362 (86%), Positives = 336/362 (93%), Gaps = 5/362 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGK-WRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDP  372
             M  + RR+G L  +  + +  RGFSS++ +     ++   S+NLFSA+NQALHIALD+DP
Sbjct  1     MGSNFRRIGKLAAISSKNQSCRGFSSTLNK----NDTSTKSVNLFSAINQALHIALDSDP  56

Query  373   RSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQF  552
             RSYVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQF
Sbjct  57    RSYVFGEDVGFGGVFRCTTGLADRFGKQRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQF  116

Query  553   ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG  732
             ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVPG
Sbjct  117   ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVPG  176

Query  733   IKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREG  912
             IKVVIPRSP QAKGLLLSSIRDPNPVVFFEPK LYR+AVEEVPE DYMLPLSEAEV+REG
Sbjct  177   IKVVIPRSPQQAKGLLLSSIRDPNPVVFFEPKLLYRMAVEEVPEDDYMLPLSEAEVLREG  236

Query  913   SDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHE  1092
             +DITLVGWGAQLS+M++AC+EA KEGISCELIDLKTL+PWDKE VEASVKKTGRLL+SHE
Sbjct  237   TDITLVGWGAQLSIMEQACVEAAKEGISCELIDLKTLIPWDKEMVEASVKKTGRLLISHE  296

Query  1093  APITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTV  1272
             AP+TGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFY+PTKNKILDAIKSTV
Sbjct  297   APVTGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYLPTKNKILDAIKSTV  356

Query  1273  NY  1278
             NY
Sbjct  357   NY  358



>ref|XP_004228950.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial-like 
[Solanum lycopersicum]
Length=358

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/362 (85%), Positives = 335/362 (93%), Gaps = 5/362 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGK-WRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDP  372
             M  + RR+G L  +  + +   GFSS+V +     ++   S+NLFSA+NQALHIALD+DP
Sbjct  1     MGSNFRRIGKLAAISSKNQSCMGFSSTVNK----NDTSTKSVNLFSAINQALHIALDSDP  56

Query  373   RSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQF  552
             RSYVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAMDNRA+AEIQF
Sbjct  57    RSYVFGEDVGFGGVFRCTTGLADRFGKQRVFNTPLCEQGIVGFAIGLAAMDNRAVAEIQF  116

Query  553   ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG  732
             ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVPG
Sbjct  117   ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVPG  176

Query  733   IKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREG  912
             IKVVIPRSP QAKGLLLSSIRDPNPVVFFEPK LYR+AVEEVP+ DYMLPLSEAEV+REG
Sbjct  177   IKVVIPRSPQQAKGLLLSSIRDPNPVVFFEPKLLYRMAVEEVPKDDYMLPLSEAEVLREG  236

Query  913   SDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHE  1092
             +DITLVGWGAQLS+M++AC+EA KEGISCELIDLKTL+PWDKETVEASVKKTGRLL+SHE
Sbjct  237   TDITLVGWGAQLSIMEQACVEAAKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHE  296

Query  1093  APITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTV  1272
             AP+TGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFY+PT NKILDAIKSTV
Sbjct  297   APVTGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYLPTTNKILDAIKSTV  356

Query  1273  NY  1278
             +Y
Sbjct  357   SY  358



>ref|NP_001239825.1| uncharacterized protein LOC100802853 [Glycine max]
 gb|ACU20861.1| unknown [Glycine max]
 gb|KHN07651.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Glycine 
soja]
Length=356

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/341 (89%), Positives = 324/341 (95%), Gaps = 0/341 (0%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             RGFS+S   +KG  E G  S+NL SA+NQALHIALDTDPRSYVFGEDV FGGVFRCTTGL
Sbjct  16    RGFSTSTSIQKGGSEEGLKSLNLCSAINQALHIALDTDPRSYVFGEDVSFGGVFRCTTGL  75

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
             AD+FGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYR
Sbjct  76    ADQFGKKRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  135

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGNQFNCGGLT+RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS +R
Sbjct  136   SGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCVR  195

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNP+VFFEPKWLYRLAVEEVPE DYMLPLSEAEV+R+GSDITLVGWGAQLS+M++AC++
Sbjct  196   DPNPIVFFEPKWLYRLAVEEVPEDDYMLPLSEAEVIRQGSDITLVGWGAQLSIMEQACLD  255

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             AEKEGISCELIDLKTL+PWDKETVEASV KTGRLLVSHEAPITGGFGAEISASIVERCF+
Sbjct  256   AEKEGISCELIDLKTLIPWDKETVEASVNKTGRLLVSHEAPITGGFGAEISASIVERCFS  315

Query  1156  RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RLEAPVAR+CGLDTPFPLVFEPFYMP+KNKILDAIKSTVNY
Sbjct  316   RLEAPVARICGLDTPFPLVFEPFYMPSKNKILDAIKSTVNY  356



>ref|XP_011089704.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Sesamum indicum]
Length=368

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/368 (86%), Positives = 336/368 (91%), Gaps = 7/368 (2%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIP--RGK----WRGFSSSVVEEKGVQESGKSS-MNLFSAVNQALHI  354
             M+ SLRR+G    +     GK      G S++  E K  QESG +  +NLFSAVNQALHI
Sbjct  1     MSSSLRRIGRFSAISSSINGKGGRCLGGLSTANEELKSGQESGGTKPINLFSAVNQALHI  60

Query  355   ALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRA  534
             ALDTDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAM NRA
Sbjct  61    ALDTDPRAYVFGEDVGFGGVFRCTTGLADRFGKRRVFNTPLCEQGIVGFAIGLAAMGNRA  120

Query  535   IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAF  714
             IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAF
Sbjct  121   IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAF  180

Query  715   FCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEA  894
             FCHVPGIKVVIPRSP QAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLSEA
Sbjct  181   FCHVPGIKVVIPRSPQQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEKDYMLPLSEA  240

Query  895   EVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGR  1074
             EV+REGSDITLVGWGAQLS+M++AC+EAEK+GISCELIDLKTL+PWDKETVEASV KTGR
Sbjct  241   EVIREGSDITLVGWGAQLSIMEQACVEAEKDGISCELIDLKTLIPWDKETVEASVNKTGR  300

Query  1075  LLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILD  1254
             LLVSHEAP+T GFGAEI+ASIVERCF RLEAPV+RVCGLDTPFPLVFEPFY+PTKNKILD
Sbjct  301   LLVSHEAPVTSGFGAEIAASIVERCFLRLEAPVSRVCGLDTPFPLVFEPFYLPTKNKILD  360

Query  1255  AIKSTVNY  1278
             AIKSTVNY
Sbjct  361   AIKSTVNY  368



>ref|XP_004506580.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Cicer arietinum]
Length=361

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/343 (88%), Positives = 326/343 (95%), Gaps = 2/343 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKG--VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTT  429
             RG S+S +++    V E+G  S+NL+SA+NQALHIALDTDPR+YVFGEDVGFGGVFRCTT
Sbjct  19    RGLSTSCIQKDAAVVAENGVKSLNLYSAINQALHIALDTDPRAYVFGEDVGFGGVFRCTT  78

Query  430   GLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFR  609
             GLADRFG+ RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFR
Sbjct  79    GLADRFGRSRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFR  138

Query  610   YRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSS  789
             YRSGNQFNCGGLTIR PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS 
Sbjct  139   YRSGNQFNCGGLTIRTPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPKQAKGLLLSC  198

Query  790   IRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC  969
             IRDPNP+VFFEPKWLYRLAVE+VPE DYMLPLSEAEV+R+G DITLVGWGAQLS+M++AC
Sbjct  199   IRDPNPIVFFEPKWLYRLAVEDVPEDDYMLPLSEAEVIRQGCDITLVGWGAQLSIMEQAC  258

Query  970   IEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERC  1149
             ++AEKEGISCELIDLKTL+PWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISASI+ERC
Sbjct  259   LDAEKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISASIIERC  318

Query  1150  FTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             F+RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  319   FSRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  361



>ref|XP_003520965.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X1 [Glycine max]
 gb|KHN17834.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Glycine 
soja]
Length=358

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/343 (88%), Positives = 323/343 (94%), Gaps = 2/343 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKGV--QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTT  429
             RGFS+S   +KG    E G  S+NL SA+NQALHIALD+DPRSYVFGEDV FGGVFRCTT
Sbjct  16    RGFSTSTSVQKGGGGSEEGLKSLNLCSAINQALHIALDSDPRSYVFGEDVSFGGVFRCTT  75

Query  430   GLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFR  609
             GLAD+FGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFR
Sbjct  76    GLADQFGKKRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFR  135

Query  610   YRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSS  789
             YRSGNQFNCGGLT+RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS 
Sbjct  136   YRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPRQAKGLLLSC  195

Query  790   IRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC  969
             IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLSEAEV+R+GSD+TLVGWGAQL++M++AC
Sbjct  196   IRDPNPVVFFEPKWLYRLAVEEVPEDDYMLPLSEAEVIRQGSDVTLVGWGAQLAIMEQAC  255

Query  970   IEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERC  1149
             ++AEKEGISCELIDLKTL+PWDKETVE+SV KTGRLLVSHEAPITGGFGAEISASIVERC
Sbjct  256   LDAEKEGISCELIDLKTLIPWDKETVESSVNKTGRLLVSHEAPITGGFGAEISASIVERC  315

Query  1150  FTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             F+RLEAPVAR+CGLDTPFPLVFEPFYMPTKNKILDAIKSTV Y
Sbjct  316   FSRLEAPVARICGLDTPFPLVFEPFYMPTKNKILDAIKSTVKY  358



>ref|XP_007014022.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 1 [Theobroma cacao]
 gb|EOY31641.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 1 [Theobroma cacao]
Length=358

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/362 (86%), Positives = 337/362 (93%), Gaps = 5/362 (1%)
 Frame = +1

Query  196   MAGSLRRMGG-LGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDP  372
             MA +LR +G  +G  +P  + R FS++  + +  Q+S KS +NL+SA+NQALHIAL+TDP
Sbjct  1     MATALRNIGRRVG--LPLCRMRPFSTATCDIEN-QQSAKS-INLYSAINQALHIALETDP  56

Query  373   RSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQF  552
             R++VFGEDV FGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQF
Sbjct  57    RTFVFGEDVSFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQF  116

Query  553   ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG  732
             ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG
Sbjct  117   ADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG  176

Query  733   IKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREG  912
             IKVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+REG
Sbjct  177   IKVVIPRSPQQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSKAEVIREG  236

Query  913   SDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHE  1092
             SDITLVGWGAQLS+M++ACI+AEK+GISCELIDLKTL+PWDKETVEASV+KTGRLLVSHE
Sbjct  237   SDITLVGWGAQLSIMEQACIDAEKDGISCELIDLKTLIPWDKETVEASVRKTGRLLVSHE  296

Query  1093  APITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTV  1272
             AP+TGGFGAEISASIVERCF RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIK+TV
Sbjct  297   APVTGGFGAEISASIVERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKATV  356

Query  1273  NY  1278
             NY
Sbjct  357   NY  358



>ref|XP_002523400.1| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis]
 gb|EEF38979.1| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis]
Length=365

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/367 (84%), Positives = 335/367 (91%), Gaps = 8/367 (2%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSS------VVEEKGVQESGKSSMNLFSAVNQALHIA  357
             MA   RR GG+       + R  S++      + +++ +QE+ KS +NL SA+NQALHIA
Sbjct  1     MATHFRRSGGI-LASSISQKRQLSAAACQGNLIHQQQRLQETSKS-LNLCSAINQALHIA  58

Query  358   LDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAI  537
             LD+DPRSYVFGEDV FGGVFRCTTGLA+RFGK+RVFNTPLCEQGIVGF IGLAAMDNRAI
Sbjct  59    LDSDPRSYVFGEDVSFGGVFRCTTGLAERFGKNRVFNTPLCEQGIVGFGIGLAAMDNRAI  118

Query  538   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFF  717
             AEIQFADYI+PAFDQIVNEAAKFRYRSGNQ+NCGGLTIRAPYGAVGHGGHYHSQSPEAFF
Sbjct  119   AEIQFADYIYPAFDQIVNEAAKFRYRSGNQYNCGGLTIRAPYGAVGHGGHYHSQSPEAFF  178

Query  718   CHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAE  897
             CHVPGIKVVIPRSP QAKGLLLS+IRDPNPV+FFEPKWLYRLAVEEVPE DYMLPLSEAE
Sbjct  179   CHVPGIKVVIPRSPWQAKGLLLSAIRDPNPVIFFEPKWLYRLAVEEVPEHDYMLPLSEAE  238

Query  898   VMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRL  1077
             V++EGSDITLVGWGAQLSVM++AC +AEK+GISCELIDLKTL+PWDKETVEASV+KTGRL
Sbjct  239   VIQEGSDITLVGWGAQLSVMEQACTDAEKDGISCELIDLKTLIPWDKETVEASVRKTGRL  298

Query  1078  LVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDA  1257
             L+SHEAPITGGFGAEISASIVERCF RLEAPVARVCGLDTPFPLVFEPFYMP KNKILDA
Sbjct  299   LISHEAPITGGFGAEISASIVERCFLRLEAPVARVCGLDTPFPLVFEPFYMPNKNKILDA  358

Query  1258  IKSTVNY  1278
             IKSTVNY
Sbjct  359   IKSTVNY  365



>ref|XP_006445563.1| hypothetical protein CICLE_v10015660mg [Citrus clementina]
 ref|XP_006488955.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Citrus sinensis]
 gb|ESR58803.1| hypothetical protein CICLE_v10015660mg [Citrus clementina]
 gb|KDO54500.1| hypothetical protein CISIN_1g017410mg [Citrus sinensis]
Length=360

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/367 (84%), Positives = 336/367 (92%), Gaps = 13/367 (4%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE------SGKSSMNLFSAVNQALHIA  357
             MA  LRR  G    + R   R  S++   ++ +Q+      SGKS +NL+SA+NQALHIA
Sbjct  1     MASGLRRFVG---SLSR---RNLSTACANKQLIQQHDGGVGSGKS-LNLYSAINQALHIA  53

Query  358   LDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAI  537
             L+TDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAM NRAI
Sbjct  54    LETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAI  113

Query  538   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFF  717
             AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT+RAPYGAVGHGGHYHSQSPEAFF
Sbjct  114   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFF  173

Query  718   CHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAE  897
             CHVPG+KVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRL+VEEVPE DYMLPLSEAE
Sbjct  174   CHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAE  233

Query  898   VMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRL  1077
             V+REGSDITLVGWGAQLS+M++AC++AEKEGISCELIDLKTL+PWDKETVEASV+KTGRL
Sbjct  234   VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRL  293

Query  1078  LVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDA  1257
             L+SHEAP+TGGFGAEISASI+ERCF RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDA
Sbjct  294   LISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDA  353

Query  1258  IKSTVNY  1278
             IKSTVNY
Sbjct  354   IKSTVNY  360



>ref|XP_002285753.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Vitis vinifera]
 emb|CBI16562.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/360 (85%), Positives = 330/360 (92%), Gaps = 7/360 (2%)
 Frame = +1

Query  202   GSLRR-MGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRS  378
             G++RR  G L F I +   R FS+S      V  +G  SMNLFSA+N AL IAL++DPR+
Sbjct  5     GTMRRSFGSLAFSISK---RAFSTS---PSPVDANGLKSMNLFSAINHALQIALESDPRA  58

Query  379   YvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFAD  558
             YVFGEDV FGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFAD
Sbjct  59    YVFGEDVSFGGVFRCTTGLADRFGKGRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFAD  118

Query  559   YIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIK  738
             YI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPE+FFCHVPGIK
Sbjct  119   YIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPESFFCHVPGIK  178

Query  739   VVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSD  918
             VVIPRSP QAKGLLLS IRDPNP+VFFEPKWLYRLAVEEVPE DYMLPLSEAEV+R+G+D
Sbjct  179   VVIPRSPKQAKGLLLSCIRDPNPIVFFEPKWLYRLAVEEVPEHDYMLPLSEAEVIRQGTD  238

Query  919   ITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAP  1098
             ITLVGWGAQL+VM++ACI+AEKEGISCELIDL+TLLPWDKETVEASV+KTGRLLVSHEAP
Sbjct  239   ITLVGWGAQLAVMEQACIDAEKEGISCELIDLRTLLPWDKETVEASVRKTGRLLVSHEAP  298

Query  1099  ITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             +TGGFGAEISAS+VERCF RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  299   VTGGFGAEISASMVERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  358



>ref|XP_008351288.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Malus domestica]
 ref|XP_008354980.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Malus domestica]
Length=363

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/333 (89%), Positives = 319/333 (96%), Gaps = 0/333 (0%)
 Frame = +1

Query  280   EEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHR  459
             +E  V+ +G  S+NL+SA+NQALHIAL+TDPRSYVFGEDV FGGVFRCTTGLADRFGK R
Sbjct  31    DEMIVRGTGSKSLNLYSAINQALHIALETDPRSYVFGEDVSFGGVFRCTTGLADRFGKQR  90

Query  460   VFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  639
             VFNTPLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG
Sbjct  91    VFNTPLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  150

Query  640   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFF  819
             GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSPLQAKGLLLS IRDPNPVVFF
Sbjct  151   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFF  210

Query  820   EPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISC  999
             EPKWLYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLSVM++AC EAE +GISC
Sbjct  211   EPKWLYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAESDGISC  270

Query  1000  ELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVAR  1179
             ELIDL+TLLPWDK+TVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPVAR
Sbjct  271   ELIDLRTLLPWDKDTVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPVAR  330

Query  1180  VCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             VCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN+
Sbjct  331   VCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNF  363



>ref|XP_008384355.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X1 [Malus domestica]
Length=370

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/329 (90%), Positives = 317/329 (96%), Gaps = 0/329 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+ +G  S+NL+SA+NQALHIAL+TDPRSYVFGEDV FGGVFRCTTGLADRFGK RVFNT
Sbjct  42    VRGTGSKSLNLYSAINQALHIALETDPRSYVFGEDVSFGGVFRCTTGLADRFGKQRVFNT  101

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  102   PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  161

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCH PG+KVVIPRSPLQAKGLLLS IRDPNPVVFFEPKW
Sbjct  162   RAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFFEPKW  221

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLSVM++AC EAEK+GISCELID
Sbjct  222   LYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAEKDGISCELID  281

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+TLLPWDK+TVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPVARVCGL
Sbjct  282   LRTLLPWDKDTVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPVARVCGL  341

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFPL+FEPFYMPTKNKILDAIKSTVN+
Sbjct  342   DTPFPLIFEPFYMPTKNKILDAIKSTVNF  370



>ref|XP_008366128.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X1 [Malus domestica]
Length=370

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/329 (90%), Positives = 317/329 (96%), Gaps = 0/329 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+ +G  S+NL+SA+NQALHIAL+TDPRSYVFGEDV FGGVFRCTTGLADRFGK RVFNT
Sbjct  42    VRGTGSKSLNLYSAINQALHIALETDPRSYVFGEDVSFGGVFRCTTGLADRFGKQRVFNT  101

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  102   PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  161

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCH PG+KVVIPRSPLQAKGLLLS IRDPNPVVFFEPKW
Sbjct  162   RAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFFEPKW  221

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLSVM++AC EAEK+GISCELID
Sbjct  222   LYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAEKDGISCELID  281

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+TLLPWDK+TVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPVARVCGL
Sbjct  282   LRTLLPWDKDTVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPVARVCGL  341

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFPL+FEPFYMPTKNKILDAIKSTVN+
Sbjct  342   DTPFPLIFEPFYMPTKNKILDAIKSTVNF  370



>ref|XP_009376111.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376119.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=366

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/333 (89%), Positives = 318/333 (95%), Gaps = 0/333 (0%)
 Frame = +1

Query  280   EEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHR  459
             +E  V+ +G  S+NL+SA+NQALHIAL+TDPRSYVFGEDV FGGVFRCTTGLADRFGK R
Sbjct  34    DEMIVRGTGSKSLNLYSAINQALHIALETDPRSYVFGEDVSFGGVFRCTTGLADRFGKQR  93

Query  460   VFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  639
             VFNTPLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG
Sbjct  94    VFNTPLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  153

Query  640   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFF  819
             GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSPLQAKGLLLS IRDPNPVVFF
Sbjct  154   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFF  213

Query  820   EPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISC  999
             EPKWLYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLSVM++AC EAE +GISC
Sbjct  214   EPKWLYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAESDGISC  273

Query  1000  ELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVAR  1179
             ELIDL+TLLPWDK TVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPVAR
Sbjct  274   ELIDLRTLLPWDKYTVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPVAR  333

Query  1180  VCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             VCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN+
Sbjct  334   VCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNF  366



>ref|XP_011025117.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X1 [Populus euphratica]
Length=368

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/369 (83%), Positives = 336/369 (91%), Gaps = 9/369 (2%)
 Frame = +1

Query  193   IMAGSLRRMGGLGFVIPRGKWRGFSSS-----VVEEK--GVQESGKSSMNLFSAVNQALH  351
             +MA SLRR G    V      R FS++     V++++   +QE+GKS +NL SA+NQALH
Sbjct  2     VMATSLRRCGRR-LVSSVFNNREFSTTCQGNKVIQQQHEQLQETGKS-LNLCSAINQALH  59

Query  352   IALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNR  531
             IAL+TDPRSYVFGEDV FGGVFRCTTGLA++FGK RVFNTPLCEQGIVGF IGLAAMDNR
Sbjct  60    IALETDPRSYVFGEDVSFGGVFRCTTGLAEKFGKKRVFNTPLCEQGIVGFGIGLAAMDNR  119

Query  532   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEA  711
             AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR PYGAVGHGGHYHSQSPEA
Sbjct  120   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRTPYGAVGHGGHYHSQSPEA  179

Query  712   FFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSE  891
             FFCHVPGIKVV+PRSP +AKGLLLS IRD NPV+FFEPKWLYRLAVEEVP+ DYMLPLSE
Sbjct  180   FFCHVPGIKVVVPRSPREAKGLLLSCIRDANPVIFFEPKWLYRLAVEEVPDNDYMLPLSE  239

Query  892   AEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTG  1071
             AEV+REGSDITLVGWGAQLS+M++AC +AEKEGISCELIDLKTL+PWDKETVEASV+KTG
Sbjct  240   AEVIREGSDITLVGWGAQLSIMEQACFDAEKEGISCELIDLKTLIPWDKETVEASVRKTG  299

Query  1072  RLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKIL  1251
             RLL+SHEAP+TGGFGAEISASIVERCF RLEAPVAR+CGLDTPFPLVFEPFY+PTKNKI+
Sbjct  300   RLLISHEAPVTGGFGAEISASIVERCFLRLEAPVARICGLDTPFPLVFEPFYVPTKNKIV  359

Query  1252  DAIKSTVNY  1278
             DAIK+TVNY
Sbjct  360   DAIKATVNY  368



>ref|XP_002304849.1| hypothetical protein POPTR_0003s20830g [Populus trichocarpa]
 gb|EEE79828.1| hypothetical protein POPTR_0003s20830g [Populus trichocarpa]
Length=368

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/369 (83%), Positives = 336/369 (91%), Gaps = 9/369 (2%)
 Frame = +1

Query  193   IMAGSLRRMGGLGFVIPRGKWRGFSSS-----VVEEK--GVQESGKSSMNLFSAVNQALH  351
             +MA SLRR G    V      R FS++     V++++   +QE+GKS +NL SA+NQALH
Sbjct  2     VMATSLRRCGRR-LVSSVFNNREFSTTCQGNKVIQQQHEQLQETGKS-LNLCSAINQALH  59

Query  352   IALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNR  531
             IAL+TDPRSYVFGEDV FGGVFRCTTGLA++FGK RVFNTPLCEQGIVGF IGLAAMDNR
Sbjct  60    IALETDPRSYVFGEDVSFGGVFRCTTGLAEKFGKKRVFNTPLCEQGIVGFGIGLAAMDNR  119

Query  532   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEA  711
             AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR PYGAVGHGGHYHSQSPEA
Sbjct  120   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRTPYGAVGHGGHYHSQSPEA  179

Query  712   FFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSE  891
             FFCHVPGIKVV+PRSP +AKGLLLS IRD NPV+FFEPKWLYRLAVEEVPE DYMLPLSE
Sbjct  180   FFCHVPGIKVVVPRSPREAKGLLLSCIRDTNPVIFFEPKWLYRLAVEEVPEHDYMLPLSE  239

Query  892   AEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTG  1071
             AEV+REGSDITLVGWGAQLS+M++AC +AEKEGISCELIDLKTL+PWDKETVEASV+KTG
Sbjct  240   AEVIREGSDITLVGWGAQLSIMEQACFDAEKEGISCELIDLKTLIPWDKETVEASVRKTG  299

Query  1072  RLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKIL  1251
             +LL+SHEAP+TGGFGAEISASIVERCF RLEAPVAR+CGLDTPFPLVFEPFY+PTKNKI+
Sbjct  300   KLLISHEAPVTGGFGAEISASIVERCFLRLEAPVARICGLDTPFPLVFEPFYVPTKNKIV  359

Query  1252  DAIKSTVNY  1278
             DAIK+TVNY
Sbjct  360   DAIKATVNY  368



>gb|KDP30628.1| hypothetical protein JCGZ_16193 [Jatropha curcas]
Length=366

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/323 (92%), Positives = 315/323 (98%), Gaps = 0/323 (0%)
 Frame = +1

Query  310   SSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQG  489
             +S+NL SA+NQALH+AL++DPRSYVFGEDV FGGVFRCTTGL +RFGK+RVFNTPLCEQG
Sbjct  44    NSLNLCSAINQALHLALESDPRSYVFGEDVRFGGVFRCTTGLVERFGKNRVFNTPLCEQG  103

Query  490   IVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGA  669
             IVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQ+NCGGLTIRAPYGA
Sbjct  104   IVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQYNCGGLTIRAPYGA  163

Query  670   VGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAV  849
             VGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRLAV
Sbjct  164   VGHGGHYHSQSPEAFFCHVPGIKVVIPRSPQQAKGLLLSCIRDPNPVVFFEPKWLYRLAV  223

Query  850   EEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLP  1029
             EEVPE DYMLPLSEAEV+REGSDITLVGWGAQLSVM++AC +AEK+GISCELIDLKTL+P
Sbjct  224   EEVPEHDYMLPLSEAEVIREGSDITLVGWGAQLSVMEQACSDAEKDGISCELIDLKTLIP  283

Query  1030  WDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPL  1209
             WDKETVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPVAR+CGLDTPFPL
Sbjct  284   WDKETVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPVARICGLDTPFPL  343

Query  1210  VFEPFYMPTKNKILDAIKSTVNY  1278
             VFEPFYMPTKNKILDAIKSTVNY
Sbjct  344   VFEPFYMPTKNKILDAIKSTVNY  366



>ref|XP_006305217.1| hypothetical protein CARUB_v10009583mg [Capsella rubella]
 gb|EOA38115.1| hypothetical protein CARUB_v10009583mg [Capsella rubella]
Length=352

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +1

Query  259   GFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLA  438
             GF SS    + V      S+NL+SA+NQALHIALD+DPRSYVFGEDVGFGGVFRCTTGLA
Sbjct  13    GFLSSGHGARSVSTETGKSLNLYSAINQALHIALDSDPRSYVFGEDVGFGGVFRCTTGLA  72

Query  439   DRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRS  618
             +RFGK+RVFNTPLCEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRS
Sbjct  73    ERFGKNRVFNTPLCEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRS  132

Query  619   GNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRD  798
             GNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRD
Sbjct  133   GNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRD  192

Query  799   PNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA  978
             PNPVVFFEPKWLYR AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL++M++AC++A
Sbjct  193   PNPVVFFEPKWLYRQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGAQLTIMEQACLDA  252

Query  979   EKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTR  1158
             EKEGISCELIDLKTLLPWDKETVEASVKKTGRLL+SHEAPITGGFGAEISA+I+ERCF +
Sbjct  253   EKEGISCELIDLKTLLPWDKETVEASVKKTGRLLISHEAPITGGFGAEISATILERCFLK  312

Query  1159  LEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             LEAPV+RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  313   LEAPVSRVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  352



>ref|XP_010032844.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Eucalyptus grandis]
 gb|KCW52335.1| hypothetical protein EUGRSUZ_J01753 [Eucalyptus grandis]
Length=365

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/329 (90%), Positives = 313/329 (95%), Gaps = 0/329 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             VQ +   S+NL SA+NQALHIALDTDPRSYVFGEDV FGGVFRCT GLADRFGK RVFNT
Sbjct  37    VQRTQNPSLNLCSAINQALHIALDTDPRSYVFGEDVSFGGVFRCTVGLADRFGKGRVFNT  96

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  97    PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  156

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IRDPNP+VFFEPKW
Sbjct  157   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPSQAKGLLLSCIRDPNPIVFFEPKW  216

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRLAVEEVPE DY LPLSEAEV+REG+DITLVGWGAQLSVM+EAC++AE +GISCELID
Sbjct  217   LYRLAVEEVPEHDYTLPLSEAEVIREGTDITLVGWGAQLSVMEEACLDAENDGISCELID  276

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             LKTLLPWDKETVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RL+APVAR+CGL
Sbjct  277   LKTLLPWDKETVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLQAPVARICGL  336

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFPLVFEPFY+PTKNKILDAIKSTVNY
Sbjct  337   DTPFPLVFEPFYLPTKNKILDAIKSTVNY  365



>ref|XP_008450996.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Cucumis melo]
Length=356

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/361 (84%), Positives = 328/361 (91%), Gaps = 5/361 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR  375
             MA  LRR   +   + R   R FS+S   +  +      SMNL+SA+NQALHIAL+TDPR
Sbjct  1     MASVLRRSQTVLNSLCR---RQFSAS--PDGNLTTHAGKSMNLYSAINQALHIALETDPR  55

Query  376   SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFA  555
             +YVFGEDVGFGGVFRCTTGLADR+GK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFA
Sbjct  56    AYVFGEDVGFGGVFRCTTGLADRYGKDRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFA  115

Query  556   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  735
             DYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI
Sbjct  116   DYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  175

Query  736   KVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             KVVIPRSP QAKGLLLS IRD NPV+FFEPKWLYRLAVEEVPE D+MLPLS+AEV+REGS
Sbjct  176   KVVIPRSPYQAKGLLLSCIRDENPVIFFEPKWLYRLAVEEVPEDDFMLPLSQAEVIREGS  235

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DITLVGWGAQLSVM++AC++AEKEGISCELIDL+TLLPWDKETVEASV+KTGRLL+SHEA
Sbjct  236   DITLVGWGAQLSVMEQACVDAEKEGISCELIDLRTLLPWDKETVEASVRKTGRLLISHEA  295

Query  1096  PITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN  1275
             P+TGGFGAEISASIVERCF RLEAP++RVCGLDTPFPLVFEPFYMPTKNKILDAIK+TV 
Sbjct  296   PVTGGFGAEISASIVERCFLRLEAPISRVCGLDTPFPLVFEPFYMPTKNKILDAIKATVK  355

Query  1276  Y  1278
             Y
Sbjct  356   Y  356



>ref|XP_004144063.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004159353.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Cucumis sativus]
Length=356

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/361 (84%), Positives = 328/361 (91%), Gaps = 5/361 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR  375
             MA  LRR   +   + R   R FS+S   +  +      SMNL+SA+NQALHIAL+TDPR
Sbjct  1     MASVLRRSQTVLNSLCR---RQFSAS--PDGNLTTHAGKSMNLYSAINQALHIALETDPR  55

Query  376   SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFA  555
             +YVFGEDVGFGGVFRCTTGLADR+GK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFA
Sbjct  56    AYVFGEDVGFGGVFRCTTGLADRYGKDRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFA  115

Query  556   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  735
             DYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI
Sbjct  116   DYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  175

Query  736   KVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             KVVIPRSP QAKGLLLS IRD NPVVFFEPKWLYRLAVEEVPE D+MLPLS+A+V+REGS
Sbjct  176   KVVIPRSPYQAKGLLLSCIRDENPVVFFEPKWLYRLAVEEVPEDDFMLPLSQADVIREGS  235

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DITLVGWGAQLSVM++ACI+AEKEGISCELIDL+TLLPWDKETVEASV+KTGRLL+SHEA
Sbjct  236   DITLVGWGAQLSVMEQACIDAEKEGISCELIDLRTLLPWDKETVEASVRKTGRLLISHEA  295

Query  1096  PITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN  1275
             P+TGGFGAEISASIVERCF RLEAP++RVCGLDTPFPLVFEPFYMPTKNKILDAIK+TV 
Sbjct  296   PVTGGFGAEISASIVERCFLRLEAPISRVCGLDTPFPLVFEPFYMPTKNKILDAIKATVK  355

Query  1276  Y  1278
             Y
Sbjct  356   Y  356



>gb|KFK38675.1| hypothetical protein AALP_AA3G145900 [Arabis alpina]
Length=357

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/329 (90%), Positives = 317/329 (96%), Gaps = 1/329 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V E+GKS MNL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+RFGK RVFNT
Sbjct  30    VSENGKS-MNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERFGKSRVFNT  88

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NR IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  89    PLCEQGIVGFGIGLAAMGNRVIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  148

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNPVVFFEPKW
Sbjct  149   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEPKW  208

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYR AVE+VPE DYM+PLSEAEV+REGSDITLVGWGAQL++M++AC++AEKEGISCELID
Sbjct  209   LYRQAVEDVPEDDYMIPLSEAEVIREGSDITLVGWGAQLTIMEQACLDAEKEGISCELID  268

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             LKTL+PWDKE VE SV+KTGRLL+SHEAP+TGGFGAEI+A+IVERCF RLEAPV+RVCGL
Sbjct  269   LKTLIPWDKEIVETSVRKTGRLLISHEAPVTGGFGAEIAATIVERCFLRLEAPVSRVCGL  328

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  329   DTPFPLVFEPFYMPTKNKILDAIKSTVNY  357



>ref|XP_006407215.1| hypothetical protein EUTSA_v10021009mg [Eutrema salsugineum]
 gb|ESQ48668.1| hypothetical protein EUTSA_v10021009mg [Eutrema salsugineum]
Length=357

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/331 (89%), Positives = 317/331 (96%), Gaps = 1/331 (0%)
 Frame = +1

Query  286   KGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVF  465
             + V E+GKS MNL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLADRFGK RVF
Sbjct  28    ENVSENGKS-MNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLADRFGKSRVF  86

Query  466   NTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  645
             NTPLCEQGIVGF IGLAAM NR IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL
Sbjct  87    NTPLCEQGIVGFGIGLAAMGNRVIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  146

Query  646   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEP  825
             TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNPVVFFEP
Sbjct  147   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEP  206

Query  826   KWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCEL  1005
             KWLYR AVE+VPE DYM+PLSEAEV+REGSDITLVGWGAQL++M++AC++AE EGISCEL
Sbjct  207   KWLYRQAVEDVPEDDYMIPLSEAEVIREGSDITLVGWGAQLTIMEQACLDAENEGISCEL  266

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDLKTL+PWDKE VE SV+KTGRLL+SHEAP+TGGFGAEISA+IVERCF RLEAPV+RVC
Sbjct  267   IDLKTLIPWDKEIVETSVRKTGRLLISHEAPVTGGFGAEISATIVERCFLRLEAPVSRVC  326

Query  1186  GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  327   GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  357



>ref|NP_187954.1| branched chain alpha-keto acid dehydrogenase E1 beta [Arabidopsis 
thaliana]
 sp|Q9LDY2.1|ODBB2_ARATH RecName: Full=2-oxoisovalerate dehydrogenase subunit beta 2, 
mitochondrial; AltName: Full=Branched-chain alpha-keto acid 
dehydrogenase E1 component beta chain; Short=BCKDE1B; Short=BCKDH 
E1-beta; AltName: Full=Protein DARK INDUCIBLE 4; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF35281.1|AF145452_1 branched chain alpha-keto acid dehydrogenase E1 beta subunit 
[Arabidopsis thaliana]
 dbj|BAB01752.1| branched chain alpha-keto acid dehydrogenase E1 beta subunit 
[Arabidopsis thaliana]
 gb|ABD85160.1| At3g13450 [Arabidopsis thaliana]
 dbj|BAF01133.1| branched chain alpha-keto acid dehydrogenase E1 beta subunit 
[Arabidopsis thaliana]
 gb|AEE75357.1| branched chain alpha-keto acid dehydrogenase E1 beta [Arabidopsis 
thaliana]
Length=358

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/331 (89%), Positives = 317/331 (96%), Gaps = 1/331 (0%)
 Frame = +1

Query  286   KGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVF  465
             + V ESGKS MNL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+RFGK RVF
Sbjct  29    ENVSESGKS-MNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERFGKSRVF  87

Query  466   NTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  645
             NTPLCEQGIVGF IGLAAM NR IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL
Sbjct  88    NTPLCEQGIVGFGIGLAAMGNRVIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  147

Query  646   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEP  825
             TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNPVVFFEP
Sbjct  148   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEP  207

Query  826   KWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCEL  1005
             KWLYR AVE+VPE DYM+PLSEAEVMREGSDITLVGWGAQL++M++AC++AE EGISCEL
Sbjct  208   KWLYRQAVEDVPEDDYMIPLSEAEVMREGSDITLVGWGAQLTIMEQACLDAENEGISCEL  267

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDLKTL+PWDKE VE SV+KTGRLL+SHEAP+TGGFGAEI+A+IVERCF RLEAPV+RVC
Sbjct  268   IDLKTLIPWDKEIVETSVRKTGRLLISHEAPVTGGFGAEIAATIVERCFLRLEAPVSRVC  327

Query  1186  GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             GLDTPFPLVFEPFYMPTKNKILDAI+STVNY
Sbjct  328   GLDTPFPLVFEPFYMPTKNKILDAIRSTVNY  358



>ref|XP_010501164.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Camelina sativa]
Length=353

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/327 (90%), Positives = 317/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GKS +NL+SA+NQALHIALD+DPRSYVFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPL
Sbjct  28    ETGKS-LNLYSAINQALHIALDSDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPL  86

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  87    CEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  146

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDPNPVVFFEPKWLY
Sbjct  147   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLY  206

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL++M++AC+EAEKEGISCELIDLK
Sbjct  207   RQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGAQLTIMEQACLEAEKEGISCELIDLK  266

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TLLPWDKETVEASVKKTGRLL+SHEAPITGGFGAEISA+I+ERCF +LEAPV RVCGLDT
Sbjct  267   TLLPWDKETVEASVKKTGRLLISHEAPITGGFGAEISATILERCFLKLEAPVTRVCGLDT  326

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIK+TVNY
Sbjct  327   PFPLVFEPFYMPTKNKILDAIKTTVNY  353



>ref|XP_010552302.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=357

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/322 (91%), Positives = 311/322 (97%), Gaps = 0/322 (0%)
 Frame = +1

Query  313   SMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGI  492
             S+NL+SA+NQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLA+RFGK RVFNTPLCEQGI
Sbjct  36    SLNLYSAINQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLAERFGKQRVFNTPLCEQGI  95

Query  493   VGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV  672
             VGF IGLAAM NRAIAEIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV
Sbjct  96    VGFGIGLAAMGNRAIAEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV  155

Query  673   GHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVE  852
             GHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNPVVFFEPKWLYR AVE
Sbjct  156   GHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEPKWLYRQAVE  215

Query  853   EVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPW  1032
             EVPE DYM PLSEAEV+REGSDITLVGWGAQL++M +AC++AEKEGISCELIDLKTL+PW
Sbjct  216   EVPEHDYMTPLSEAEVIREGSDITLVGWGAQLTIMAQACLDAEKEGISCELIDLKTLIPW  275

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             DKETVEASV KTGRLL+SHEAP+TGGFGAEISA+IVERCF RLEAPV+RVCGLDTPFPLV
Sbjct  276   DKETVEASVSKTGRLLISHEAPVTGGFGAEISATIVERCFLRLEAPVSRVCGLDTPFPLV  335

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFYMPTKNKIL+AIKSTV Y
Sbjct  336   FEPFYMPTKNKILEAIKSTVKY  357



>emb|CAN61041.1| hypothetical protein VITISV_037525 [Vitis vinifera]
Length=321

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/321 (91%), Positives = 310/321 (97%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLFSA+N AL IAL++DPR+YVFGE V FGGVFRCTTGLADRFGK RVFNTPLCEQGIV
Sbjct  1     MNLFSAINHALQIALESDPRAYVFGEXVSFGGVFRCTTGLADRFGKGRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IGLAAM NRAIAEIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG
Sbjct  61    GFGIGLAAMGNRAIAEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPE+FFCHVPGIKVVIPRSP QAKGLLLS IRDPNP+VFFEPKWLYRLAVEE
Sbjct  121   HGGHYHSQSPESFFCHVPGIKVVIPRSPKQAKGLLLSCIRDPNPIVFFEPKWLYRLAVEE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VPE DYMLPLSEAEV+R+G+DITLVGWGAQL+VM++ACI+AEKEGISCELIDL+TLLPWD
Sbjct  181   VPEHDYMLPLSEAEVIRQGTDITLVGWGAQLAVMEQACIDAEKEGISCELIDLRTLLPWD  240

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
             KETVEASV+KTGRLLVSHEAP+TGGFGAEISAS+VERCF RLEAPVARVCGLDTPFPLVF
Sbjct  241   KETVEASVRKTGRLLVSHEAPVTGGFGAEISASMVERCFLRLEAPVARVCGLDTPFPLVF  300

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             EPFYMPTKNKILDAIKSTVNY
Sbjct  301   EPFYMPTKNKILDAIKSTVNY  321



>ref|XP_009339200.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Pyrus x bretschneideri]
Length=367

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/329 (88%), Positives = 314/329 (95%), Gaps = 0/329 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+ +G  S+NL+SA+NQALH+AL+TDPRSYVFGEDV FGGVFRCTTGLADRFG  RVFNT
Sbjct  39    VRGTGSKSLNLYSAINQALHVALETDPRSYVFGEDVSFGGVFRCTTGLADRFGNQRVFNT  98

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  99    PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  158

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCH PG+KVVIPRSPLQAKGLLLS IRDPNPVVFFEPKW
Sbjct  159   RAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFFEPKW  218

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLS+M++AC EAEK+GISCELID
Sbjct  219   LYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSIMEQACKEAEKDGISCELID  278

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+TLLPWDK+TVEASV+KT RLL+SHEAP+T GFGAEISASIVERCF RLEAPVARVCGL
Sbjct  279   LRTLLPWDKDTVEASVRKTARLLISHEAPVTAGFGAEISASIVERCFLRLEAPVARVCGL  338

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFPL+FEPFYMPTKNKILDAIKSTVN+
Sbjct  339   DTPFPLIFEPFYMPTKNKILDAIKSTVNF  367



>ref|NP_175947.1| branched-chain alpha-keto acid decarboxylase E1 beta subunit 
[Arabidopsis thaliana]
 sp|Q9SAV3.1|ODBB1_ARATH RecName: Full=2-oxoisovalerate dehydrogenase subunit beta 1, 
mitochondrial; AltName: Full=Branched-chain alpha-keto acid 
dehydrogenase E1 component beta chain; Short=BCKDE1B; Short=BCKDH 
E1-beta; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD10651.1| branched-chain alpha-keto acid decarboxylase E1 beta subunit 
[Arabidopsis thaliana]
 gb|ABD59079.1| At1g55510 [Arabidopsis thaliana]
 gb|AEE33256.1| branched-chain alpha-keto acid decarboxylase E1 beta subunit 
[Arabidopsis thaliana]
Length=352

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/327 (90%), Positives = 317/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GK  +NL+SA+NQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPL
Sbjct  27    ETGKP-LNLYSAINQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPL  85

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  86    CEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  145

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDPNPVVFFEPKWLY
Sbjct  146   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLY  205

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL+VM++AC++AEKEGISCELIDLK
Sbjct  206   RQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGAQLTVMEQACLDAEKEGISCELIDLK  265

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TLLPWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISA+I+ERCF +LEAPV+RVCGLDT
Sbjct  266   TLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKLEAPVSRVCGLDT  325

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  326   PFPLVFEPFYMPTKNKILDAIKSTVNY  352



>ref|XP_010462401.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Camelina sativa]
Length=353

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/327 (90%), Positives = 318/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GKS +NL+SA+NQALHIALD+DPRS+VFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPL
Sbjct  28    ETGKS-LNLYSAINQALHIALDSDPRSFVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPL  86

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  87    CEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  146

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDPNPVVFFEPKWLY
Sbjct  147   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLY  206

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL++M++AC+EAEKEGISCELIDLK
Sbjct  207   RQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGAQLTIMEQACLEAEKEGISCELIDLK  266

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TLLPWDKETVEASVKKTGRLL+SHEAPITGGFGAEISA+I+ERCF +LEAPV+R+CGLDT
Sbjct  267   TLLPWDKETVEASVKKTGRLLISHEAPITGGFGAEISATILERCFLKLEAPVSRICGLDT  326

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIK+TVNY
Sbjct  327   PFPLVFEPFYMPTKNKILDAIKTTVNY  353



>gb|AAC64005.1| branched-chain alpha-keto acid decarboxylase E1 beta subunit 
[Arabidopsis thaliana]
Length=352

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/327 (90%), Positives = 317/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GK  +NL+SA+NQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPL
Sbjct  27    ETGKP-LNLYSAINQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPL  85

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  86    CEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  145

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDPNPVVFFEPKWLY
Sbjct  146   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLY  205

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL+VM++AC++AEKEGISCELIDLK
Sbjct  206   RQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGAQLTVMEQACLDAEKEGISCELIDLK  265

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TLLPWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISA+I+ERCF +LEAPV+RVCGLDT
Sbjct  266   TLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKLEAPVSRVCGLDT  325

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  326   PFPLVFEPFYMPTKNKILDAIKSTVNY  352



>ref|XP_004294943.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=351

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/327 (90%), Positives = 316/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GKS +NL+SA+NQALHIAL +D R+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPL
Sbjct  26    EAGKS-LNLYSAINQALHIALASDSRTYVFGEDVGFGGVFRCTTGLADRFGKKRVFNTPL  84

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGI+GF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  85    CEQGIIGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  144

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCH PGIKVVIPRSP QAKGLLLSSIRDPNPVVFFEPKWLY
Sbjct  145   PYGAVGHGGHYHSQSPEAFFCHAPGIKVVIPRSPRQAKGLLLSSIRDPNPVVFFEPKWLY  204

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             RL+VEEVPE D+MLPLSEAEV+REGSDITLVGWGAQLS+M++AC++AEK+GISCELIDL+
Sbjct  205   RLSVEEVPEHDFMLPLSEAEVIREGSDITLVGWGAQLSIMEQACLDAEKDGISCELIDLR  264

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TL+PWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISASIVE CF RLEAPV+RVCGLDT
Sbjct  265   TLIPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISASIVESCFLRLEAPVSRVCGLDT  324

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIK+TVNY
Sbjct  325   PFPLVFEPFYMPTKNKILDAIKATVNY  351



>ref|XP_009413882.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/341 (86%), Positives = 320/341 (94%), Gaps = 2/341 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             RGFSSS   EK  ++ GK  +NLFSA+NQALHIALDTDPR+YVFGEDV FGGVFRCTTGL
Sbjct  19    RGFSSSCETEKAAKD-GKP-INLFSAINQALHIALDTDPRAYVFGEDVRFGGVFRCTTGL  76

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
             ADRFG+ RVFNTPLCEQGIVGFAIGLAAM NRAIAEIQFADYI+PAFDQIVNEAAKFRYR
Sbjct  77    ADRFGRSRVFNTPLCEQGIVGFAIGLAAMGNRAIAEIQFADYIYPAFDQIVNEAAKFRYR  136

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGN+FNCGGLTIR PYGAVGHGGHYHSQSPE+FFCHVPG+KVVIPRSP QAKGLLLS IR
Sbjct  137   SGNEFNCGGLTIRTPYGAVGHGGHYHSQSPESFFCHVPGLKVVIPRSPQQAKGLLLSCIR  196

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNP +FFEPKWLYRLAVEEVPE DYMLPLSEAEV+R+GSDITLVGWGAQLSV+++AC+E
Sbjct  197   DPNPSIFFEPKWLYRLAVEEVPEHDYMLPLSEAEVIRQGSDITLVGWGAQLSVLEQACVE  256

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             A KEGISCELIDL+TL+PWDKETVEASV+KTG+LL+SHEAP+TGGFGAEISASI E CF 
Sbjct  257   AAKEGISCELIDLRTLIPWDKETVEASVRKTGKLLISHEAPVTGGFGAEISASIAESCFL  316

Query  1156  RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RLEAPVAR+CGLDTPFPLV+E FYMPTKNKILDAIK+TVNY
Sbjct  317   RLEAPVARICGLDTPFPLVYEQFYMPTKNKILDAIKATVNY  357



>ref|XP_002891838.1| BCDH BETA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68097.1| BCDH BETA1 [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/327 (90%), Positives = 317/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GK  +NL+SA+NQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPL
Sbjct  27    ETGKP-LNLYSAINQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPL  85

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGIVGF IGLAAM NRA+ EIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  86    CEQGIVGFGIGLAAMGNRAVVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  145

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDPNPVVFFEPKWLY
Sbjct  146   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLY  205

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL++M++AC++AEKEGISCELIDLK
Sbjct  206   RQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGAQLTIMEQACLDAEKEGISCELIDLK  265

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TLLPWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISA+I+ERCF +LEAPV+RVCGLDT
Sbjct  266   TLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKLEAPVSRVCGLDT  325

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  326   PFPLVFEPFYMPTKNKILDAIKSTVNY  352



>ref|XP_010534847.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Tarenaya hassleriana]
Length=357

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/341 (87%), Positives = 321/341 (94%), Gaps = 5/341 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             RG S +  E     E+G +S+NL+SAVNQALHIALDTDPRSYVFGEDVGFGGVFRCTTGL
Sbjct  22    RGLSMAASE----SEAG-NSLNLYSAVNQALHIALDTDPRSYVFGEDVGFGGVFRCTTGL  76

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
             A+RFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYI+PAFDQIVNEAAKFRYR
Sbjct  77    AERFGKQRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIYPAFDQIVNEAAKFRYR  136

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IR
Sbjct  137   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIR  196

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNPVVFFEPKWLYR AVEEVPE DYM+PLSEAEV+REG+DITLVGWGAQL++M++AC++
Sbjct  197   DPNPVVFFEPKWLYRQAVEEVPEHDYMIPLSEAEVIREGTDITLVGWGAQLTIMEQACLD  256

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             A KEGISCELIDLKTL+PWDKETVEASV+KTGRLL+SHEAPITGGFGAEISA+IVERCF 
Sbjct  257   AAKEGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEAPITGGFGAEISATIVERCFL  316

Query  1156  RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RLEAPV+RVCGLDTPFPLVFEPFYMPTKNKIL+AIKSTV Y
Sbjct  317   RLEAPVSRVCGLDTPFPLVFEPFYMPTKNKILEAIKSTVRY  357



>ref|XP_009106875.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Brassica rapa]
Length=357

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/337 (87%), Positives = 317/337 (94%), Gaps = 0/337 (0%)
 Frame = +1

Query  268   SSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRF  447
             S +V           S+NL SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+RF
Sbjct  21    SRMVSTTACDSEAVKSLNLHSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERF  80

Query  448   GKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQ  627
             GK+RVFNTPLCEQGIVGF IGLAAM NRA+ EIQFADYI+PAFDQIVNEAAKFRYRSGNQ
Sbjct  81    GKNRVFNTPLCEQGIVGFGIGLAAMGNRAVVEIQFADYIYPAFDQIVNEAAKFRYRSGNQ  140

Query  628   FNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNP  807
             FNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNP
Sbjct  141   FNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNP  200

Query  808   VVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKE  987
             VVFFEPKWLYR AVEEVPE DYM+PLS+AEV+REG+DITLVGWGAQL+VM++AC++AEKE
Sbjct  201   VVFFEPKWLYRPAVEEVPEHDYMIPLSQAEVIREGNDITLVGWGAQLTVMEQACLDAEKE  260

Query  988   GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEA  1167
             GISCELIDLKTLLPWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISA+I+ERCF +LEA
Sbjct  261   GISCELIDLKTLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKLEA  320

Query  1168  PVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PV+RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  321   PVSRVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  357



>ref|XP_010480084.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Camelina sativa]
Length=353

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/327 (90%), Positives = 317/327 (97%), Gaps = 1/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E+GKS +NL++A+NQALHIALD+DPRSYVFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPL
Sbjct  28    ETGKS-LNLYAAINQALHIALDSDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPL  86

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRA
Sbjct  87    CEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  146

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDPNPVVFFEPKWLY
Sbjct  147   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDPNPVVFFEPKWLY  206

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R AVEEVPE DY +PLSEAEV+REG+DITLVGWGAQL++M++AC+EAEKEGISCELIDLK
Sbjct  207   RQAVEEVPEHDYTIPLSEAEVIREGNDITLVGWGAQLTIMEQACLEAEKEGISCELIDLK  266

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             TLLPWDKETVEASVKKTGRLL+SHEAPITGGFGAEISA+I+ERCF +LEAPV+RVCGLDT
Sbjct  267   TLLPWDKETVEASVKKTGRLLISHEAPITGGFGAEISATILERCFLKLEAPVSRVCGLDT  326

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFEPFYMPTKNKILDAIK+TVNY
Sbjct  327   PFPLVFEPFYMPTKNKILDAIKTTVNY  353



>ref|XP_008221362.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Prunus mume]
Length=363

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/335 (88%), Positives = 319/335 (95%), Gaps = 3/335 (1%)
 Frame = +1

Query  280   EEKGVQE--SGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGK  453
             +E  VQ+  SGKS +NL+SA+NQALHIAL+TDPR+YVFGEDV FGGVFRCTTGLADRFGK
Sbjct  30    DEMMVQQIASGKS-LNLYSAINQALHIALETDPRAYVFGEDVSFGGVFRCTTGLADRFGK  88

Query  454   HRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFN  633
              RVFNTPLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFN
Sbjct  89    QRVFNTPLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFN  148

Query  634   CGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVV  813
             CGGLTIR+PYGAVGHGGHYHSQSPEAFFCH PGIKVVIPRSP QAKGLLLS IRDPNPVV
Sbjct  149   CGGLTIRSPYGAVGHGGHYHSQSPEAFFCHAPGIKVVIPRSPRQAKGLLLSCIRDPNPVV  208

Query  814   FFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGI  993
             FFEPKWLYRL+VEEVPE DYMLPLSEAE++REG+DITLVGWGAQLS+M++AC +AEK+GI
Sbjct  209   FFEPKWLYRLSVEEVPEHDYMLPLSEAEIIREGNDITLVGWGAQLSIMEQACKDAEKDGI  268

Query  994   SCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPV  1173
             SCELIDL+TLLPWDK+TVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPV
Sbjct  269   SCELIDLRTLLPWDKDTVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPV  328

Query  1174  ARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             ARVCGLDTPFPLVFEPFYMP KNKILDAIKSTVNY
Sbjct  329   ARVCGLDTPFPLVFEPFYMPNKNKILDAIKSTVNY  363



>ref|XP_007205405.1| hypothetical protein PRUPE_ppa007575mg [Prunus persica]
 gb|EMJ06604.1| hypothetical protein PRUPE_ppa007575mg [Prunus persica]
Length=363

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/335 (89%), Positives = 318/335 (95%), Gaps = 3/335 (1%)
 Frame = +1

Query  280   EEKGVQE--SGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGK  453
             +E  VQ+  SGKS +NL+SA+NQALHIAL+TDPR+YVFGEDV FGGVFRCTTGLADRFGK
Sbjct  30    DEMMVQQIASGKS-LNLYSAINQALHIALETDPRAYVFGEDVSFGGVFRCTTGLADRFGK  88

Query  454   HRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFN  633
              RVFNTPLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFN
Sbjct  89    QRVFNTPLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFN  148

Query  634   CGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVV  813
             CGGLTIR+PYGAVGHGGHYHSQSPEAFFCH PGIKVVIPRSP QAKGLLLS IRDPNPVV
Sbjct  149   CGGLTIRSPYGAVGHGGHYHSQSPEAFFCHAPGIKVVIPRSPRQAKGLLLSCIRDPNPVV  208

Query  814   FFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGI  993
             FFEPKWLYRL+VEEVPE DYMLPLSEAE++REG+DITLVGWGAQLS+M+ AC +AEKEGI
Sbjct  209   FFEPKWLYRLSVEEVPEHDYMLPLSEAEIIREGNDITLVGWGAQLSIMEHACKDAEKEGI  268

Query  994   SCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPV  1173
             SCELIDL+TLLPWDK+TVEASV+KTGRLL+SHEAP+TGGFGAEISASIVERCF RLEAPV
Sbjct  269   SCELIDLQTLLPWDKDTVEASVRKTGRLLISHEAPVTGGFGAEISASIVERCFLRLEAPV  328

Query  1174  ARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             ARVCGLDTPFPLVFEPFYMP KNKILDAIKSTVNY
Sbjct  329   ARVCGLDTPFPLVFEPFYMPNKNKILDAIKSTVNY  363



>ref|XP_006392631.1| hypothetical protein EUTSA_v10011610mg [Eutrema salsugineum]
 gb|ESQ29917.1| hypothetical protein EUTSA_v10011610mg [Eutrema salsugineum]
Length=357

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/339 (87%), Positives = 320/339 (94%), Gaps = 5/339 (1%)
 Frame = +1

Query  262   FSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLAD  441
              S+S  E   V+     S+NL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+
Sbjct  24    LSTSACESDTVK-----SLNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAE  78

Query  442   RFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSG  621
             RFGK+RVFNTPLCEQGIVGF IGLAAM NRAI EIQFADYI+PAFDQIVNEAAKFRYRSG
Sbjct  79    RFGKNRVFNTPLCEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQIVNEAAKFRYRSG  138

Query  622   NQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDP  801
             NQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLS IRDP
Sbjct  139   NQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSCIRDP  198

Query  802   NPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAE  981
             NPVVFFEPKWLYR AVEEVPE DYM+PLSEAEV++EG+DITLVGWGAQL++M++AC++AE
Sbjct  199   NPVVFFEPKWLYRQAVEEVPEHDYMIPLSEAEVIKEGNDITLVGWGAQLTIMEQACLDAE  258

Query  982   KEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRL  1161
             KEGISCELIDLKTLLPWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISA+I+ERCF +L
Sbjct  259   KEGISCELIDLKTLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKL  318

Query  1162  EAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             EAPV+RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY
Sbjct  319   EAPVSRVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  357



>emb|CDP18579.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/331 (87%), Positives = 315/331 (95%), Gaps = 0/331 (0%)
 Frame = +1

Query  286   KGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVF  465
             +G      S++NLF+A+NQAL IAL+TDPR+YVFGEDV FGGVFRCTTGLAD+FGK+RVF
Sbjct  67    QGNDNKKSSNINLFTAINQALRIALETDPRAYVFGEDVSFGGVFRCTTGLADQFGKNRVF  126

Query  466   NTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  645
             NTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL
Sbjct  127   NTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  186

Query  646   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEP  825
             TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVV+PRSP QAKGLLLS IRDPNPVVFFEP
Sbjct  187   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVVPRSPQQAKGLLLSCIRDPNPVVFFEP  246

Query  826   KWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCEL  1005
             KWLYRLAVEEVPE DYMLPLS+AEV+REG+DITLVGWGAQL++M++AC++AEK+GISCEL
Sbjct  247   KWLYRLAVEEVPENDYMLPLSQAEVIREGADITLVGWGAQLAIMEQACVDAEKDGISCEL  306

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDLKTL+PWDK+TV ASV+KTGRLL+SHEAPITGGFGAEISASIVERCF RLEAPV RVC
Sbjct  307   IDLKTLIPWDKDTVVASVRKTGRLLISHEAPITGGFGAEISASIVERCFLRLEAPVTRVC  366

Query  1186  GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             GLDTPFPLVFEPFY+PTKNK+LDAIKSTVNY
Sbjct  367   GLDTPFPLVFEPFYLPTKNKVLDAIKSTVNY  397



>ref|XP_006826304.1| hypothetical protein AMTR_s00004p00075280 [Amborella trichopoda]
 gb|ERM93541.1| hypothetical protein AMTR_s00004p00075280 [Amborella trichopoda]
Length=351

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/321 (89%), Positives = 308/321 (96%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             +NLFSA+NQAL +ALDTDPRSY+FGEDV FGGVFRCT GLAD++GKHRVFNTPLCEQGIV
Sbjct  31    INLFSAINQALDLALDTDPRSYIFGEDVRFGGVFRCTMGLADKYGKHRVFNTPLCEQGIV  90

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT+RAPYGAVG
Sbjct  91    GFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVG  150

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEAFFCHVPG+KVVIPR P QAKGLLLS IRDPNP+VFFEPKWLYRLAVEE
Sbjct  151   HGGHYHSQSPEAFFCHVPGLKVVIPRGPKQAKGLLLSCIRDPNPIVFFEPKWLYRLAVEE  210

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VPE DYM PLS+AEV+REGSDITLVGWGAQL VM++AC++A +EGISCELIDL+TL+PWD
Sbjct  211   VPEDDYMFPLSQAEVIREGSDITLVGWGAQLQVMEQACVDAAQEGISCELIDLRTLVPWD  270

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
             KETVEASV+KTGRLLVSHEAPITGGFGAEISASIVERCF RLEAP+ARVCGLDTPFPLVF
Sbjct  271   KETVEASVRKTGRLLVSHEAPITGGFGAEISASIVERCFLRLEAPIARVCGLDTPFPLVF  330

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             EPFYMPTKNKILDAIK+TVNY
Sbjct  331   EPFYMPTKNKILDAIKATVNY  351



>ref|NP_001141206.1| uncharacterized protein LOC100273293 [Zea mays]
 gb|ACF85714.1| unknown [Zea mays]
 tpg|DAA42577.1| TPA: 3-methyl-2-oxobutanoate dehydrogenase [Zea mays]
Length=363

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/328 (88%), Positives = 315/328 (96%), Gaps = 0/328 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             ++ G  ++NLF+AVNQALHIALDTDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTP
Sbjct  36    RKEGGKAVNLFTAVNQALHIALDTDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTP  95

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGI GFAIGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNCGGLTIR
Sbjct  96    LCEQGIAGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIR  155

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
              PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSP +AKGLLL+SIRDPNPVVFFEPKWL
Sbjct  156   TPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPREAKGLLLASIRDPNPVVFFEPKWL  215

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDL  1014
             YRLAVEEVPE DYMLPLSEAEV+REGSDITLVGWGAQL+V++EAC +A K+G+SCELIDL
Sbjct  216   YRLAVEEVPEEDYMLPLSEAEVIREGSDITLVGWGAQLAVLKEACEDAAKDGVSCELIDL  275

Query  1015  KTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLD  1194
             KTL+PWDKETVEASVKKTG+LLVSHEAP+TGGFGAEI+ASI ERCF RLEAPVARVCGLD
Sbjct  276   KTLVPWDKETVEASVKKTGKLLVSHEAPVTGGFGAEIAASIAERCFQRLEAPVARVCGLD  335

Query  1195  TPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             TPFPLV+EPFYMPTKNK+LDAIK+TV++
Sbjct  336   TPFPLVYEPFYMPTKNKVLDAIKATVDF  363



>ref|XP_010909032.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=353

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/354 (84%), Positives = 326/354 (92%), Gaps = 3/354 (1%)
 Frame = +1

Query  217   MGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfged  396
             + GLG  I  GK R FSS+   EK  ++     +NLFSA+NQALHIAL+TD R+YVFGED
Sbjct  3     LRGLGRRISIGK-RCFSSASEVEKRPRDG--KQINLFSAINQALHIALETDSRAYVFGED  59

Query  397   vgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAF  576
             VGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAF
Sbjct  60    VGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAF  119

Query  577   DQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRS  756
             DQIVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRS
Sbjct  120   DQIVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRS  179

Query  757   PLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGW  936
             P QAKGLLL+ IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGW
Sbjct  180   PQQAKGLLLACIRDPNPVVFFEPKWLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGW  239

Query  937   GAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFG  1116
             GAQLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFG
Sbjct  240   GAQLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFG  299

Query  1117  AEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             AEISASI ERCF RLEAPVAR+CGLDTPFPLV+EPFYMPTKNK+LDAIK+TVNY
Sbjct  300   AEISASIAERCFLRLEAPVARICGLDTPFPLVYEPFYMPTKNKVLDAIKATVNY  353



>ref|NP_001241785.1| 3-methyl-2-oxobutanoate dehydrogenase [Zea mays]
 gb|ACG41638.1| 3-methyl-2-oxobutanoate dehydrogenase [Zea mays]
Length=363

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/328 (88%), Positives = 315/328 (96%), Gaps = 0/328 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             ++ G  ++NLF+AVNQALHIALDTDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTP
Sbjct  36    RKEGGKAVNLFTAVNQALHIALDTDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTP  95

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGI GFAIGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNCGGLTIR
Sbjct  96    LCEQGIAGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIR  155

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
              PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSP +AKGLLL+SIRDPNPVVFFEPKWL
Sbjct  156   TPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPREAKGLLLASIRDPNPVVFFEPKWL  215

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDL  1014
             YRLAVEEVPE DYMLPLSEAEV+REGSDITLVGWGAQL+V++EAC +A K+G+SCELIDL
Sbjct  216   YRLAVEEVPEEDYMLPLSEAEVIREGSDITLVGWGAQLAVLKEACEDAAKDGVSCELIDL  275

Query  1015  KTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLD  1194
             KTL+PWDKETVEASVKKTG+LLVSHEAP+TGGFGAEI+ASI ERCF RLEAPVARVCGLD
Sbjct  276   KTLVPWDKETVEASVKKTGKLLVSHEAPVTGGFGAEIAASIAERCFQRLEAPVARVCGLD  335

Query  1195  TPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             TPFPLV+EPFYMPTKNK+LDAIK+T+++
Sbjct  336   TPFPLVYEPFYMPTKNKVLDAIKATIDF  363



>ref|XP_002884967.1| hypothetical protein ARALYDRAFT_478729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61226.1| hypothetical protein ARALYDRAFT_478729 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/334 (88%), Positives = 316/334 (95%), Gaps = 4/334 (1%)
 Frame = +1

Query  286   KGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVF  465
             + V ESGKS MNL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+RFGK RVF
Sbjct  28    ENVSESGKS-MNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERFGKSRVF  86

Query  466   NTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  645
             NTPLCEQGIVGF IGLAAM NR IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL
Sbjct  87    NTPLCEQGIVGFGIGLAAMGNRVIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  146

Query  646   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEP  825
             TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNPVVFFEP
Sbjct  147   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEP  206

Query  826   KWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCEL  1005
             KWLYR AVE+VPE DYM+PLSEAEV+REGSDITLVGWGAQL++M++AC++AE EGISCEL
Sbjct  207   KWLYRQAVEDVPEDDYMIPLSEAEVIREGSDITLVGWGAQLTIMEQACLDAETEGISCEL  266

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDLKTL+PWDKE VE SV+KTGRLL+SHEAP+TGGFGAEI+A+IVERCF RLEAPV+RVC
Sbjct  267   IDLKTLIPWDKEIVETSVRKTGRLLISHEAPVTGGFGAEIAATIVERCFLRLEAPVSRVC  326

Query  1186  GLDTPFPLVFEPFYMPTKNK---ILDAIKSTVNY  1278
             GLDTPFPLVFEPFYMPTKNK   ILDAIKS VNY
Sbjct  327   GLDTPFPLVFEPFYMPTKNKASFILDAIKSIVNY  360



>ref|XP_010257699.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Nelumbo nucifera]
Length=358

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/357 (82%), Positives = 329/357 (92%), Gaps = 6/357 (2%)
 Frame = +1

Query  208   LRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvf  387
             LRR   +G      K + +S++  E   +Q+SGK+ +NLF+A+NQAL IAL+TDPR+YVF
Sbjct  8     LRRFASIG-----RKGQEYSTTCDEPPKLQKSGKT-VNLFTAINQALRIALETDPRAYVF  61

Query  388   gedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIF  567
             GEDV FGGVFRCTTGL ++FG++RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYI+
Sbjct  62    GEDVSFGGVFRCTTGLVEQFGRNRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIY  121

Query  568   PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVI  747
             PAFDQ+VNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVI
Sbjct  122   PAFDQLVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVI  181

Query  748   PRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITL  927
             PRSP QAKGLLL+SIRDPNPV+FFEPKWLYRLAVEEVPE DYMLPLS+AEV+  G+DITL
Sbjct  182   PRSPNQAKGLLLASIRDPNPVIFFEPKWLYRLAVEEVPEHDYMLPLSQAEVICHGNDITL  241

Query  928   VGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITG  1107
             VGWGAQLS+M++ACI+AEK+GISCELIDLKTL+PWDKETVEASV+KTGRLLVSHEAP+TG
Sbjct  242   VGWGAQLSIMEQACIDAEKDGISCELIDLKTLIPWDKETVEASVRKTGRLLVSHEAPVTG  301

Query  1108  GFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             GFGAEISASI ERCF RLEAPVARVCGLDTPFPLVFEPF+MPTKNKILDAIK+TVNY
Sbjct  302   GFGAEISASIAERCFLRLEAPVARVCGLDTPFPLVFEPFFMPTKNKILDAIKATVNY  358



>ref|XP_006445562.1| hypothetical protein CICLE_v10015660mg [Citrus clementina]
 gb|ESR58802.1| hypothetical protein CICLE_v10015660mg [Citrus clementina]
 gb|KDO54501.1| hypothetical protein CISIN_1g017410mg [Citrus sinensis]
Length=372

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/376 (81%), Positives = 333/376 (89%), Gaps = 15/376 (4%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE------SGKSSMNLFSAVNQALHIA  357
             MA  LRR  G    + R   R  S++   ++ +Q+      SGKS +NL+SA+NQALHIA
Sbjct  1     MASGLRRFVG---SLSR---RNLSTACANKQLIQQHDGGVGSGKS-LNLYSAINQALHIA  53

Query  358   LDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAI  537
             L+TDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAM NRAI
Sbjct  54    LETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAI  113

Query  538   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFF  717
             AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT+RAPYGAVGHGGHYHSQSPEAFF
Sbjct  114   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFF  173

Query  718   CHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAE  897
             CHVPG+KVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRL+VEEVPE DYMLPLSEAE
Sbjct  174   CHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAE  233

Query  898   VMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRL  1077
             V+REGSDITLVGWGAQLS+M++AC++AEKEGISCELIDLKTL+PWDKETVEASV+KTGRL
Sbjct  234   VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRL  293

Query  1078  LVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNK--IL  1251
             L+SHEAP+TGGFGAEISASI+ERCF RLEAPVARVCGLDTPFPLVFEPFYMPTKNK   L
Sbjct  294   LISHEAPVTGGFGAEISASILERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKASCL  353

Query  1252  DAIKSTVNY*CSDAPA  1299
             ++ K    + C +  A
Sbjct  354   ESFKVPAQHCCMNLTA  369



>ref|XP_004955572.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Setaria italica]
Length=365

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/365 (81%), Positives = 328/365 (90%), Gaps = 3/365 (1%)
 Frame = +1

Query  193   IMAGSLRRMG---GLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALD  363
             + A +LR  G   G    + R  + G S+     +  +  G   +NLF+AVNQALHIALD
Sbjct  1     MAARALREAGRRRGWAAEVGRRCFSGGSAGTAVPERKEGGGGKPVNLFTAVNQALHIALD  60

Query  364   TDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAE  543
             TDPR+YVFGEDVGFGGVFRCTTGLADRFGK+RVFNTPLCEQGI GFAIGLAAM NRAIAE
Sbjct  61    TDPRAYVFGEDVGFGGVFRCTTGLADRFGKNRVFNTPLCEQGIAGFAIGLAAMGNRAIAE  120

Query  544   IQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCH  723
             IQFADYIFPAFDQIVNEAAKFRYRSGN+FNCGGLTIR PYGAVGHGGHYHSQSPEAFFCH
Sbjct  121   IQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIRTPYGAVGHGGHYHSQSPEAFFCH  180

Query  724   VPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVM  903
             VPG+KV+IPRSP +AKGLLL+SIRDPNPVVFFEPKWLYRL+VEEVPE DYMLPLS+AEV+
Sbjct  181   VPGLKVIIPRSPREAKGLLLASIRDPNPVVFFEPKWLYRLSVEEVPEEDYMLPLSQAEVI  240

Query  904   REGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLV  1083
             R+GSDITL+GWGAQL+V++EAC +A K+G+SCELIDLKTL+PWDKETVEASVKKTG+LLV
Sbjct  241   RKGSDITLIGWGAQLAVLKEACEDAAKDGVSCELIDLKTLIPWDKETVEASVKKTGKLLV  300

Query  1084  SHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIK  1263
             SHEAPITGGFGAEI+ASI ERCF RLEAPVARVCGLDTPFPLV+EPFYMPTKNK+LDAIK
Sbjct  301   SHEAPITGGFGAEIAASIAERCFQRLEAPVARVCGLDTPFPLVYEPFYMPTKNKVLDAIK  360

Query  1264  STVNY  1278
             +TVNY
Sbjct  361   ATVNY  365



>dbj|BAJ90424.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/331 (87%), Positives = 317/331 (96%), Gaps = 1/331 (0%)
 Frame = +1

Query  286   KGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVF  465
             +G   +GK+ +NLF+AVNQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLA+RFGK RVF
Sbjct  43    RGDGGAGKA-VNLFTAVNQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLAERFGKQRVF  101

Query  466   NTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGL  645
             NTPLCEQGI GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNCGGL
Sbjct  102   NTPLCEQGIAGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGL  161

Query  646   TIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEP  825
             TIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSP +AKGLLL+SIRDPNPV+FFEP
Sbjct  162   TIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPREAKGLLLASIRDPNPVIFFEP  221

Query  826   KWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCEL  1005
             KWLYRLAVEEVPEGDYMLPLS+AEV+R+GSDITLVGWGAQL+V+ +AC +A K+GISCEL
Sbjct  222   KWLYRLAVEEVPEGDYMLPLSQAEVIRKGSDITLVGWGAQLAVLAQACEDASKDGISCEL  281

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDL+TL+PWDKETVEASV KTG+LLVSHEAP+TGGFGAEI+ASI ERCF RLEAPVARVC
Sbjct  282   IDLRTLIPWDKETVEASVSKTGKLLVSHEAPVTGGFGAEIAASIAERCFQRLEAPVARVC  341

Query  1186  GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             GLDTPFPLV+E FYMPTKNKI+DAIK+TVNY
Sbjct  342   GLDTPFPLVYEQFYMPTKNKIVDAIKATVNY  372



>ref|NP_001058989.1| Os07g0170100 [Oryza sativa Japonica Group]
 dbj|BAD31791.1| putative branched-chain alpha-keto acid decarboxylase E1 beta 
subunit [Oryza sativa Japonica Group]
 dbj|BAF20903.1| Os07g0170100 [Oryza sativa Japonica Group]
 dbj|BAG97352.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66642.1| hypothetical protein OsJ_23251 [Oryza sativa Japonica Group]
Length=370

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/334 (86%), Positives = 314/334 (94%), Gaps = 0/334 (0%)
 Frame = +1

Query  277   VEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKH  456
             V E  V       +NLF+A+NQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLADRFG++
Sbjct  37    VAEGKVGGGAGKEVNLFTAINQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLADRFGRN  96

Query  457   RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNC  636
             RVFNTPLCEQGI GFA+GLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNC
Sbjct  97    RVFNTPLCEQGIAGFAVGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNC  156

Query  637   GGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVF  816
             GGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KV+IPRSP +AKGLLL+SIRDPNPVVF
Sbjct  157   GGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVIIPRSPREAKGLLLASIRDPNPVVF  216

Query  817   FEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGIS  996
             FEPKWLYRLAVEEVPE DYMLPLSEAEV+R+GSDITL+GWGAQL+V++EAC +A K+GIS
Sbjct  217   FEPKWLYRLAVEEVPEEDYMLPLSEAEVIRKGSDITLIGWGAQLAVLEEACEDAAKDGIS  276

Query  997   CELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVA  1176
             CELIDL+TL+PWDKETVEASV KTG+LLVSHEAPITGGFGAEI+ASI ERCF RLEAPVA
Sbjct  277   CELIDLRTLIPWDKETVEASVSKTGKLLVSHEAPITGGFGAEIAASITERCFQRLEAPVA  336

Query  1177  RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RVCGLDTPFPLV+E FYMPTKNK+LDAIK+TVNY
Sbjct  337   RVCGLDTPFPLVYETFYMPTKNKVLDAIKATVNY  370



>ref|XP_010909031.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=357

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/358 (83%), Positives = 326/358 (91%), Gaps = 7/358 (2%)
 Frame = +1

Query  217   MGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfged  396
             + GLG  I  GK R FSS+   EK  ++     +NLFSA+NQALHIAL+TD R+YVFGED
Sbjct  3     LRGLGRRISIGK-RCFSSASEVEKRPRDG--KQINLFSAINQALHIALETDSRAYVFGED  59

Query  397   vgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAF  576
             VGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAF
Sbjct  60    VGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAF  119

Query  577   DQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRS  756
             DQIVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRS
Sbjct  120   DQIVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRS  179

Query  757   PLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGW  936
             P QAKGLLL+ IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGW
Sbjct  180   PQQAKGLLLACIRDPNPVVFFEPKWLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGW  239

Query  937   GAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFG  1116
             GAQLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFG
Sbjct  240   GAQLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFG  299

Query  1117  AEISASIVERCFTR----LEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             AEISASI ERCF R    LEAPVAR+CGLDTPFPLV+EPFYMPTKNK+LDAIK+TVNY
Sbjct  300   AEISASIAERCFLRHGLQLEAPVARICGLDTPFPLVYEPFYMPTKNKVLDAIKATVNY  357



>ref|XP_003557527.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
[Brachypodium distachyon]
Length=373

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/322 (88%), Positives = 313/322 (97%), Gaps = 0/322 (0%)
 Frame = +1

Query  313   SMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGI  492
             ++NLF+AVNQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLADRFG++RVFNTPLCEQGI
Sbjct  52    AVNLFTAVNQALHIALETDPRSYVFGEDVGFGGVFRCTTGLADRFGRNRVFNTPLCEQGI  111

Query  493   VGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV  672
              GFAIGLAAM NRAIAE+QFADYIFPAFDQIVNEAAKFRYRSGN+FNCGGLTIR+PYGAV
Sbjct  112   AGFAIGLAAMGNRAIAEVQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIRSPYGAV  171

Query  673   GHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVE  852
             GHGGHYHSQSPEAFFCHVPG+KVVIPRSP +AKGLLL+SIRDPNPVVFFEPKWLYRL+VE
Sbjct  172   GHGGHYHSQSPEAFFCHVPGLKVVIPRSPHEAKGLLLASIRDPNPVVFFEPKWLYRLSVE  231

Query  853   EVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPW  1032
             +VPEGDYMLPLS+AEV+ +GSDITLVGWGAQL+V+++AC +A K+GISCELIDL+TL+PW
Sbjct  232   DVPEGDYMLPLSQAEVIHQGSDITLVGWGAQLAVLEQACEDAAKDGISCELIDLRTLIPW  291

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             DKETVEASV KTG+LLVSHEAPITGGFGAEI+ASI ERCF RLEAPVARVCGLDTPFPLV
Sbjct  292   DKETVEASVSKTGKLLVSHEAPITGGFGAEIAASITERCFQRLEAPVARVCGLDTPFPLV  351

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             +EPFYMPTKNKILDAIK+TVNY
Sbjct  352   YEPFYMPTKNKILDAIKATVNY  373



>ref|XP_010673455.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=402

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/336 (86%), Positives = 312/336 (93%), Gaps = 1/336 (0%)
 Frame = +1

Query  271   SVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFG  450
             ++VE     E GK  +NLFSA+NQALHIALD+DPR+YVFGEDV FGGVFRCT GLA+RFG
Sbjct  68    NIVEIDNDSEIGKP-VNLFSAINQALHIALDSDPRAYVFGEDVSFGGVFRCTIGLAERFG  126

Query  451   KHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQF  630
              +R+FNTPLCEQGIVGF IGLAAM NRAIAEIQFADYI+PAFDQIVNEAAKFRYRSGNQF
Sbjct  127   ANRIFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIYPAFDQIVNEAAKFRYRSGNQF  186

Query  631   NCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPV  810
             NCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IRDPNPV
Sbjct  187   NCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPQQAKGLLLSCIRDPNPV  246

Query  811   VFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEG  990
             +FFEPK LYR+AVE VPE DYMLPLS+AEVMREGSDITLVGWGAQL+VM+ AC EAEKEG
Sbjct  247   IFFEPKSLYRVAVERVPESDYMLPLSKAEVMREGSDITLVGWGAQLAVMEAACTEAEKEG  306

Query  991   ISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAP  1170
             ISCELIDL+TL+PWDKETVEASVKKTGRLL+SHEAP+T GFGAEI+ASIVERCF RLEAP
Sbjct  307   ISCELIDLRTLIPWDKETVEASVKKTGRLLISHEAPVTAGFGAEIAASIVERCFLRLEAP  366

Query  1171  VARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             +AR+CG DTPFPLVFEPFY+PTKNK+LDAIKSTV Y
Sbjct  367   IARICGFDTPFPLVFEPFYLPTKNKVLDAIKSTVKY  402



>gb|ACR36340.1| unknown [Zea mays]
Length=363

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/328 (87%), Positives = 311/328 (95%), Gaps = 0/328 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             ++ G  ++NLF+AVNQALHIALDTDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTP
Sbjct  36    RKEGGKAVNLFTAVNQALHIALDTDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTP  95

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGI GFAIGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNCGGLTIR
Sbjct  96    LCEQGIAGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGGLTIR  155

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
              PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSP +AKGLLL+SIRDPNPVVFFEPKWL
Sbjct  156   TPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPREAKGLLLASIRDPNPVVFFEPKWL  215

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDL  1014
             YRLAVEEVPE DYMLPLSEAEV+REGSDITLVGWGAQL+V++EAC +A K+G+SCELIDL
Sbjct  216   YRLAVEEVPEEDYMLPLSEAEVIREGSDITLVGWGAQLAVLKEACEDAAKDGVSCELIDL  275

Query  1015  KTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLD  1194
             KTL+PWDKETVEASVKKTG+LLVSHEAP+TGGFGAEI+ASI ERCF RLEAPVA VCG D
Sbjct  276   KTLVPWDKETVEASVKKTGKLLVSHEAPVTGGFGAEIAASIAERCFQRLEAPVAGVCGFD  335

Query  1195  TPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             TPFP VFEPFYMP KNK+LDAIK+TV++
Sbjct  336   TPFPFVFEPFYMPPKNKVLDAIKATVDF  363



>ref|XP_006658312.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
[Oryza brachyantha]
Length=372

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/332 (85%), Positives = 313/332 (94%), Gaps = 0/332 (0%)
 Frame = +1

Query  283   EKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRV  462
             E+ V   G   +NLF+A+NQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLADRFG++RV
Sbjct  41    ERKVGGGGGKEVNLFTAINQALHIALDTDPRSYVFGEDVGFGGVFRCTTGLADRFGRNRV  100

Query  463   FNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGG  642
             FNTPLCEQGI GFA+GLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNCGG
Sbjct  101   FNTPLCEQGIAGFAVGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGG  160

Query  643   LTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFE  822
             LTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSP +AKGLLL+SIRDPNPVVFFE
Sbjct  161   LTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPHEAKGLLLASIRDPNPVVFFE  220

Query  823   PKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCE  1002
             PKWLYRL+VE+VPE DYMLPLS+AEV+R+GSDITLVGWGAQL V+++AC +A K+GISCE
Sbjct  221   PKWLYRLSVEKVPEEDYMLPLSQAEVIRKGSDITLVGWGAQLGVLEQACEDAAKDGISCE  280

Query  1003  LIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARV  1182
             LIDL+TL+PWD+E VEASV KTG+LLVSHEAPITGGFGAEI+ASI ERCF RLEAPVARV
Sbjct  281   LIDLRTLIPWDREMVEASVSKTGKLLVSHEAPITGGFGAEIAASITERCFQRLEAPVARV  340

Query  1183  CGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             CGLDTPFPLV+E FYMPTKNK+LDAIK+TVN+
Sbjct  341   CGLDTPFPLVYETFYMPTKNKVLDAIKATVNF  372



>emb|CDY10556.1| BnaC03g70580D [Brassica napus]
Length=362

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/311 (90%), Positives = 303/311 (97%), Gaps = 0/311 (0%)
 Frame = +1

Query  313   SMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGI  492
             S+NL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+RFGK+RVFNTPLCEQGI
Sbjct  36    SLNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPLCEQGI  95

Query  493   VGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV  672
             VGF IGLAAM NRA+ EIQ ADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV
Sbjct  96    VGFGIGLAAMGNRAVVEIQVADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAV  155

Query  673   GHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVE  852
             GHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNPVVFFEPKWLYR AVE
Sbjct  156   GHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEPKWLYRQAVE  215

Query  853   EVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPW  1032
             EVPE DYM+PLS+AE++REGSDITLVGWGAQL+VM++AC++AEKEGISCELIDLKTLLPW
Sbjct  216   EVPEHDYMIPLSQAEIIREGSDITLVGWGAQLTVMEQACLDAEKEGISCELIDLKTLLPW  275

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             DKETVEASVKKTGRLL+SHEAPITGGFGAEISA+I+ERCF +LEAPV+RVCGLDTPFPLV
Sbjct  276   DKETVEASVKKTGRLLISHEAPITGGFGAEISATILERCFLKLEAPVSRVCGLDTPFPLV  335

Query  1213  FEPFYMPTKNK  1245
             FEPFYMPTKNK
Sbjct  336   FEPFYMPTKNK  346



>emb|CDY02436.1| BnaA08g00430D [Brassica napus]
Length=392

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/323 (86%), Positives = 304/323 (94%), Gaps = 0/323 (0%)
 Frame = +1

Query  268   SSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRF  447
             S +V           S+NL+SA+NQALHIAL+TDPRSYVFGEDVGFGGVFRCTTGLA+RF
Sbjct  21    SRMVSTTACDSEAVKSLNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERF  80

Query  448   GKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQ  627
             GK+RVFNTPLCEQGIVGF IGLAAM NRA+ EIQFADYI+PAFDQIVNEAAKFRYRSGNQ
Sbjct  81    GKNRVFNTPLCEQGIVGFGIGLAAMGNRAVVEIQFADYIYPAFDQIVNEAAKFRYRSGNQ  140

Query  628   FNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNP  807
             FNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP +AKGLLLSSIRDPNP
Sbjct  141   FNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNP  200

Query  808   VVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKE  987
             VVFFEPKWLYR AVE+VPE DYM+PLS+AEV+REG+DITLVGWGAQL+VM++AC++AEKE
Sbjct  201   VVFFEPKWLYRQAVEDVPEHDYMIPLSQAEVIREGNDITLVGWGAQLTVMEQACLDAEKE  260

Query  988   GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEA  1167
             GISCELIDLKTLLPWDKETVEASVKKTGRLL+SHEAP+TGGFGAEISA+I+ERCF +LEA
Sbjct  261   GISCELIDLKTLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKLEA  320

Query  1168  PVARVCGLDTPFPLVFEPFYMPT  1236
             PV+RVCGLDTPFPLVFEPFYMPT
Sbjct  321   PVSRVCGLDTPFPLVFEPFYMPT  343



>ref|XP_001772587.1| predicted protein [Physcomitrella patens]
 gb|EDQ62629.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/338 (81%), Positives = 304/338 (90%), Gaps = 0/338 (0%)
 Frame = +1

Query  265   SSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADR  444
             +  +VE +  ++   + +N+FSA+NQALH  LD+DP+SYVFGEDVGFGGVFRCTT L D+
Sbjct  3     AKDLVESEEPEKKVTNRINMFSAINQALHTVLDSDPKSYVFGEDVGFGGVFRCTTALRDK  62

Query  445   FGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGN  624
             FG+HRVFNTPLCEQ IVGF IGLA+M NRAIAEIQFADYIFPA DQIVNEAAK+RYRSGN
Sbjct  63    FGRHRVFNTPLCEQAIVGFGIGLASMGNRAIAEIQFADYIFPALDQIVNEAAKYRYRSGN  122

Query  625   QFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPN  804
              FNCGGLT+RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLL+SIRDPN
Sbjct  123   LFNCGGLTVRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPSQAKGLLLASIRDPN  182

Query  805   PVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEK  984
             PVVFFEPKWLYRLAVEEVP  DY LPLS AEVMR+GSDITLVGWGAQL++M+EAC E  K
Sbjct  183   PVVFFEPKWLYRLAVEEVPVDDYTLPLSSAEVMRKGSDITLVGWGAQLAIMEEACDEVSK  242

Query  985   EGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLE  1164
              GISCELIDL+TL+PWDKE VE SV KTGRLLVSHEAP+TGGFGAEI+ASI   CF RL+
Sbjct  243   LGISCELIDLRTLIPWDKELVEDSVNKTGRLLVSHEAPVTGGFGAEIAASITNSCFLRLQ  302

Query  1165  APVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             APV+RVCGLDTPFPLVFEPFYMPTKNKI+DAIK++VN+
Sbjct  303   APVSRVCGLDTPFPLVFEPFYMPTKNKIVDAIKASVNF  340



>ref|XP_010103093.1| 2-oxoisovalerate dehydrogenase subunit beta [Morus notabilis]
 gb|EXB94816.1| 2-oxoisovalerate dehydrogenase subunit beta [Morus notabilis]
Length=352

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/345 (81%), Positives = 307/345 (89%), Gaps = 21/345 (6%)
 Frame = +1

Query  247   GKWRGFSSSVVEEK-GVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRC  423
             G  R FSSS  ++  G   + KSSMNL+SA+NQALHIA++TDPR+Y+FGEDVGFGGVFRC
Sbjct  28    GFKREFSSSSCDDLIGNGNANKSSMNLYSAINQALHIAMETDPRAYIFGEDVGFGGVFRC  87

Query  424   TTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAK  603
             TTGLADRFGK+RVFNTPLCEQGI+GF IGLAAM                    IVNEAAK
Sbjct  88    TTGLADRFGKNRVFNTPLCEQGIIGFGIGLAAM--------------------IVNEAAK  127

Query  604   FRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLL  783
             FRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLL
Sbjct  128   FRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPKQAKGLLL  187

Query  784   SSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE  963
             SSIRDPNPVVFFEPKWLYRL+VEEVPE DYM PLSEAEV+REG+DITLVGWGAQLS+M++
Sbjct  188   SSIRDPNPVVFFEPKWLYRLSVEEVPEHDYMFPLSEAEVIREGNDITLVGWGAQLSIMEQ  247

Query  964   ACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVE  1143
             ACIEAEK+GISCELIDLKTL+PWDKETVEASV+KTGRLL+SHEA ITGGFGAEISASIVE
Sbjct  248   ACIEAEKDGISCELIDLKTLIPWDKETVEASVRKTGRLLISHEASITGGFGAEISASIVE  307

Query  1144  RCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RCF RLEAP+AR+CGLDTPFPLVFEPFY+PTKNKILDAI++TV Y
Sbjct  308   RCFLRLEAPIARICGLDTPFPLVFEPFYLPTKNKILDAIEATVKY  352



>gb|KHG18913.1| bkdB [Gossypium arboreum]
Length=347

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/356 (81%), Positives = 308/356 (87%), Gaps = 26/356 (7%)
 Frame = +1

Query  211   RRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfg  390
             RR+G LG V  R   + FS++  +  G       S+NL+SA+NQALHIAL+TD R++VFG
Sbjct  18    RRLG-LGLVRRR---KPFSTATCDGDG--NGNAKSINLYSAINQALHIALETDNRAFVFG  71

Query  391   edvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFP  570
             EDV FGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM                
Sbjct  72    EDVSFGGVFRCTTGLADRFGKARVFNTPLCEQGIVGFGIGLAAM----------------  115

Query  571   AFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIP  750
                 IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIP
Sbjct  116   ----IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIP  171

Query  751   RSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLV  930
             RSP QAKGLLLS IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLSEAEV+R+GSDITLV
Sbjct  172   RSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSEAEVIRQGSDITLV  231

Query  931   GWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGG  1110
             GWGAQLSVM++AC EAEK+GISCELIDLKTLLPWDKETVEASV+KTGR+L+SHEAP+TGG
Sbjct  232   GWGAQLSVMEQACNEAEKDGISCELIDLKTLLPWDKETVEASVRKTGRVLISHEAPVTGG  291

Query  1111  FGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             FGAEISASIVERCF RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIK+TVNY
Sbjct  292   FGAEISASIVERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKATVNY  347



>gb|KHG18914.1| bkdB [Gossypium arboreum]
 gb|KHG21750.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Gossypium 
arboreum]
Length=338

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/356 (81%), Positives = 308/356 (87%), Gaps = 26/356 (7%)
 Frame = +1

Query  211   RRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfg  390
             RR+G LG V  R   + FS++  +  G       S+NL+SA+NQALHIAL+TD R++VFG
Sbjct  9     RRLG-LGLVRRR---KPFSTATCDGDG--NGNAKSINLYSAINQALHIALETDNRAFVFG  62

Query  391   edvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFP  570
             EDV FGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM                
Sbjct  63    EDVSFGGVFRCTTGLADRFGKARVFNTPLCEQGIVGFGIGLAAM----------------  106

Query  571   AFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIP  750
                 IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIP
Sbjct  107   ----IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIP  162

Query  751   RSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLV  930
             RSP QAKGLLLS IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLSEAEV+R+GSDITLV
Sbjct  163   RSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSEAEVIRQGSDITLV  222

Query  931   GWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGG  1110
             GWGAQLSVM++AC EAEK+GISCELIDLKTLLPWDKETVEASV+KTGR+L+SHEAP+TGG
Sbjct  223   GWGAQLSVMEQACNEAEKDGISCELIDLKTLLPWDKETVEASVRKTGRVLISHEAPVTGG  282

Query  1111  FGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             FGAEISASIVERCF RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIK+TVNY
Sbjct  283   FGAEISASIVERCFLRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKATVNY  338



>ref|XP_011025118.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X2 [Populus euphratica]
Length=339

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 307/369 (83%), Gaps = 38/369 (10%)
 Frame = +1

Query  193   IMAGSLRRMGGLGFVIPRGKWRGFSSS-----VVEEK--GVQESGKSSMNLFSAVNQALH  351
             +MA SLRR G    V      R FS++     V++++   +QE+GKS +NL SA+NQALH
Sbjct  2     VMATSLRRCGRR-LVSSVFNNREFSTTCQGNKVIQQQHEQLQETGKS-LNLCSAINQALH  59

Query  352   IALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNR  531
             IAL+TDPRSYVFGEDV FGGVFRCTTGLA++FGK RVFNTPLCEQGIVGF IGLAAMDNR
Sbjct  60    IALETDPRSYVFGEDVSFGGVFRCTTGLAEKFGKKRVFNTPLCEQGIVGFGIGLAAMDNR  119

Query  532   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEA  711
             AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR PYGAVGHGGHYHSQSPEA
Sbjct  120   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRTPYGAVGHGGHYHSQSPEA  179

Query  712   FFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSE  891
             FFCHVPGIKVV+PRSP +AKGLLLS IRD NPV+FFEPKWLYRLAVEEVP+ DYMLPLSE
Sbjct  180   FFCHVPGIKVVVPRSPREAKGLLLSCIRDANPVIFFEPKWLYRLAVEEVPDNDYMLPLSE  239

Query  892   AEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTG  1071
             AEV+REGSDITLVGWGAQLS+M++AC +AEKEGISCELIDLKTL+PWDKETVEASV+KTG
Sbjct  240   AEVIREGSDITLVGWGAQLSIMEQACFDAEKEGISCELIDLKTLIPWDKETVEASVRKTG  299

Query  1072  RLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKIL  1251
             RLL+SHEAP+TGGFGAEISASIVERCF R                             I+
Sbjct  300   RLLISHEAPVTGGFGAEISASIVERCFLR-----------------------------IV  330

Query  1252  DAIKSTVNY  1278
             DAIK+TVNY
Sbjct  331   DAIKATVNY  339



>ref|XP_007014025.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 4 [Theobroma cacao]
 gb|EOY31644.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 4 [Theobroma cacao]
Length=354

 Score =   522 bits (1345),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 264/301 (88%), Positives = 285/301 (95%), Gaps = 2/301 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             R FS++  + +  Q+S KS +NL+SA+NQALHIAL+TDPR++VFGEDV FGGVFRCTTGL
Sbjct  2     RPFSTATCDIEN-QQSAKS-INLYSAINQALHIALETDPRTFVFGEDVSFGGVFRCTTGL  59

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
             ADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYR
Sbjct  60    ADRFGKSRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  119

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IR
Sbjct  120   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPQQAKGLLLSCIR  179

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+REGSDITLVGWGAQLS+M++ACI+
Sbjct  180   DPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSKAEVIREGSDITLVGWGAQLSIMEQACID  239

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             AEK+GISCELIDLKTL+PWDKETVEASV+KTGRLLVSHEAP+TGGFGAEISASIVERCF 
Sbjct  240   AEKDGISCELIDLKTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFGAEISASIVERCFL  299

Query  1156  R  1158
             R
Sbjct  300   R  300



>ref|XP_007014026.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 5 [Theobroma cacao]
 gb|EOY31645.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 5 [Theobroma cacao]
Length=380

 Score =   522 bits (1345),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 264/302 (87%), Positives = 286/302 (95%), Gaps = 2/302 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             R FS++  + +  Q+S KS +NL+SA+NQALHIAL+TDPR++VFGEDV FGGVFRCTTGL
Sbjct  2     RPFSTATCDIEN-QQSAKS-INLYSAINQALHIALETDPRTFVFGEDVSFGGVFRCTTGL  59

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
             ADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYR
Sbjct  60    ADRFGKSRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  119

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IR
Sbjct  120   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPQQAKGLLLSCIR  179

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+REGSDITLVGWGAQLS+M++ACI+
Sbjct  180   DPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSKAEVIREGSDITLVGWGAQLSIMEQACID  239

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             AEK+GISCELIDLKTL+PWDKETVEASV+KTGRLLVSHEAP+TGGFGAEISASIVERCF 
Sbjct  240   AEKDGISCELIDLKTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFGAEISASIVERCFL  299

Query  1156  RL  1161
             R+
Sbjct  300   RV  301



>ref|XP_010909036.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X5 [Elaeis guineensis]
Length=323

 Score =   519 bits (1337),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 271/352 (77%), Positives = 297/352 (84%), Gaps = 33/352 (9%)
 Frame = +1

Query  223   GLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvg  402
             GLG  I  GK R FSS+   EK  ++     +NLFSA+NQALHIAL+TD R+YVFGEDVG
Sbjct  5     GLGRRISIGK-RCFSSASEVEKRPRDG--KQINLFSAINQALHIALETDSRAYVFGEDVG  61

Query  403   fggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQ  582
             FGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAFDQ
Sbjct  62    FGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAFDQ  121

Query  583   IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPL  762
             IVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+K        
Sbjct  122   IVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLK--------  173

Query  763   QAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGA  942
                                   WLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGWGA
Sbjct  174   ----------------------WLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGWGA  211

Query  943   QLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAE  1122
             QLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFGAE
Sbjct  212   QLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFGAE  271

Query  1123  ISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             ISASI ERCF RLEAPVAR+CGLDTPFPLV+EPFYMPTKNK+LDAIK+TVNY
Sbjct  272   ISASIAERCFLRLEAPVARICGLDTPFPLVYEPFYMPTKNKVLDAIKATVNY  323



>gb|KGN66346.1| hypothetical protein Csa_1G599400 [Cucumis sativus]
Length=348

 Score =   519 bits (1336),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 271/345 (79%), Positives = 297/345 (86%), Gaps = 5/345 (1%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR  375
             MA  LRR   +   + R   R FS+S   +  +      SMNL+SA+NQALHIAL+TDPR
Sbjct  1     MASVLRRSQTVLNSLCR---RQFSAS--PDGNLTTHAGKSMNLYSAINQALHIALETDPR  55

Query  376   SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFA  555
             +YVFGEDVGFGGVFRCTTGLADR+GK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFA
Sbjct  56    AYVFGEDVGFGGVFRCTTGLADRYGKDRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFA  115

Query  556   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  735
             DYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI
Sbjct  116   DYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  175

Query  736   KVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             KVVIPRSP QAKGLLLS IRD NPVVFFEPKWLYRLAVEEVPE D+MLPLS+A+V+REGS
Sbjct  176   KVVIPRSPYQAKGLLLSCIRDENPVVFFEPKWLYRLAVEEVPEDDFMLPLSQADVIREGS  235

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DITLVGWGAQLSVM++ACI+AEKEGISCELIDL+TLLPWDKETVEASV+KTGRLL+SHEA
Sbjct  236   DITLVGWGAQLSVMEQACIDAEKEGISCELIDLRTLLPWDKETVEASVRKTGRLLISHEA  295

Query  1096  PITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYM  1230
             P+TGGFGAEISASIVERCF R       V  +  PF  +  P ++
Sbjct  296   PVTGGFGAEISASIVERCFLRQGEQNINVLHVVRPFSSLHNPIHI  340



>ref|XP_010909033.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=327

 Score =   513 bits (1322),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 271/356 (76%), Positives = 297/356 (83%), Gaps = 37/356 (10%)
 Frame = +1

Query  223   GLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvg  402
             GLG  I  GK R FSS+   EK  ++     +NLFSA+NQALHIAL+TD R+YVFGEDVG
Sbjct  5     GLGRRISIGK-RCFSSASEVEKRPRDG--KQINLFSAINQALHIALETDSRAYVFGEDVG  61

Query  403   fggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQ  582
             FGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAFDQ
Sbjct  62    FGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAFDQ  121

Query  583   IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPL  762
             IVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+K        
Sbjct  122   IVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLK--------  173

Query  763   QAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGA  942
                                   WLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGWGA
Sbjct  174   ----------------------WLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGWGA  211

Query  943   QLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAE  1122
             QLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFGAE
Sbjct  212   QLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFGAE  271

Query  1123  ISASIVERCFTR----LEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             ISASI ERCF R    LEAPVAR+CGLDTPFPLV+EPFYMPTKNK+LDAIK+TVNY
Sbjct  272   ISASIAERCFLRHGLQLEAPVARICGLDTPFPLVYEPFYMPTKNKVLDAIKATVNY  327



>ref|XP_010909035.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X4 [Elaeis guineensis]
Length=324

 Score =   512 bits (1318),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 271/354 (77%), Positives = 298/354 (84%), Gaps = 32/354 (9%)
 Frame = +1

Query  217   MGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfged  396
             + GLG  I  GK R FSS+   EK  ++  +  +NLFSA+NQALHIAL+TD R+YVFGED
Sbjct  3     LRGLGRRISIGK-RCFSSASEVEKRPRDGKQ--INLFSAINQALHIALETDSRAYVFGED  59

Query  397   vgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAF  576
             VGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAF
Sbjct  60    VGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAF  119

Query  577   DQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRS  756
             DQIVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRS
Sbjct  120   DQIVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRS  179

Query  757   PLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGW  936
             P QAKGLLL+ IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGW
Sbjct  180   PQQAKGLLLACIRDPNPVVFFEPKWLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGW  239

Query  937   GAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFG  1116
             GAQLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFG
Sbjct  240   GAQLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFG  299

Query  1117  AEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             AEISASI ERCF R                             +LDAIK+TVNY
Sbjct  300   AEISASIAERCFLR-----------------------------VLDAIKATVNY  324



>ref|XP_002973790.1| hypothetical protein SELMODRAFT_100348, partial [Selaginella 
moellendorffii]
 gb|EFJ24745.1| hypothetical protein SELMODRAFT_100348, partial [Selaginella 
moellendorffii]
Length=292

 Score =   508 bits (1308),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 259/280 (93%), Gaps = 3/280 (1%)
 Frame = +1

Query  418   RCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEA  597
             RCT+GLAD FG HRVFNTPLCEQG+VGF IGLAAM NRAIAEIQFADYIFPAFDQ     
Sbjct  16    RCTSGLADAFGTHRVFNTPLCEQGLVGFGIGLAAMGNRAIAEIQFADYIFPAFDQ---AT  72

Query  598   AKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGL  777
             AKFRYRSGN FNCGGLT+R+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPR+P QAKGL
Sbjct  73    AKFRYRSGNAFNCGGLTVRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRNPSQAKGL  132

Query  778   LLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVM  957
             LL+SIRDPNPV+FFEPKWLYRL+V+EVPEGDYMLPLS AEV+REG+DITLV WGAQL+VM
Sbjct  133   LLASIRDPNPVIFFEPKWLYRLSVDEVPEGDYMLPLSNAEVIREGTDITLVAWGAQLAVM  192

Query  958   QEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASI  1137
             Q+AC EAEKEGISCELIDL+TL+PWDKE VEASV KTG+L+VSHEAP+TGGFGAEI+A+I
Sbjct  193   QQACAEAEKEGISCELIDLRTLIPWDKELVEASVNKTGKLIVSHEAPVTGGFGAEIAATI  252

Query  1138  VERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDA  1257
              ERCF RLEAP+ARVCGLDTPFPLVFEPFYMPT NK+  A
Sbjct  253   AERCFLRLEAPIARVCGLDTPFPLVFEPFYMPTANKVSTA  292



>ref|XP_010909037.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X6 [Elaeis guineensis]
Length=314

 Score =   507 bits (1305),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 262/314 (83%), Positives = 286/314 (91%), Gaps = 3/314 (1%)
 Frame = +1

Query  217   MGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfged  396
             + GLG  I  GK R FSS+   EK  ++     +NLFSA+NQALHIAL+TD R+YVFGED
Sbjct  3     LRGLGRRISIGK-RCFSSASEVEKRPRDG--KQINLFSAINQALHIALETDSRAYVFGED  59

Query  397   vgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAF  576
             VGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAF
Sbjct  60    VGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAF  119

Query  577   DQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRS  756
             DQIVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRS
Sbjct  120   DQIVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRS  179

Query  757   PLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGW  936
             P QAKGLLL+ IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGW
Sbjct  180   PQQAKGLLLACIRDPNPVVFFEPKWLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGW  239

Query  937   GAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFG  1116
             GAQLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFG
Sbjct  240   GAQLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFG  299

Query  1117  AEISASIVERCFTR  1158
             AEISASI ERCF R
Sbjct  300   AEISASIAERCFLR  313



>ref|XP_002983606.1| hypothetical protein SELMODRAFT_118501, partial [Selaginella 
moellendorffii]
 gb|EFJ15507.1| hypothetical protein SELMODRAFT_118501, partial [Selaginella 
moellendorffii]
Length=292

 Score =   506 bits (1302),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 234/277 (84%), Positives = 258/277 (93%), Gaps = 3/277 (1%)
 Frame = +1

Query  418   RCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEA  597
             RCT+GLAD FG HRVFNTPLCEQG+VGF IGLAAM NRAIAEIQF DYIFPAFDQ     
Sbjct  16    RCTSGLADAFGTHRVFNTPLCEQGLVGFGIGLAAMGNRAIAEIQFGDYIFPAFDQ---AT  72

Query  598   AKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGL  777
             AKFRYRSGN FNCGGLT+R+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPR+P QAKGL
Sbjct  73    AKFRYRSGNAFNCGGLTVRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRNPSQAKGL  132

Query  778   LLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVM  957
             LL+SIRDPNPV+FFEPKWLYRL+V+EVPEGDYMLPLS+AEV+REG+DITLV WGAQL+VM
Sbjct  133   LLASIRDPNPVIFFEPKWLYRLSVDEVPEGDYMLPLSKAEVIREGTDITLVAWGAQLAVM  192

Query  958   QEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASI  1137
             Q+AC EAEKEGISCELIDL+TL+PWDKE VEASV KTG+L+VSHEAP+TGGFGAEI+A+I
Sbjct  193   QQACAEAEKEGISCELIDLRTLIPWDKELVEASVNKTGKLIVSHEAPVTGGFGAEIAATI  252

Query  1138  VERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKI  1248
              ERCF RLEAP+ARVCGLDTPFPLVFEPFYMPT NK+
Sbjct  253   AERCFLRLEAPIARVCGLDTPFPLVFEPFYMPTANKV  289



>ref|XP_008805370.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X2 [Phoenix dactylifera]
Length=319

 Score =   499 bits (1285),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 260/313 (83%), Positives = 283/313 (90%), Gaps = 3/313 (1%)
 Frame = +1

Query  223   GLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvg  402
             GLG  I  GK R FSS    EK   +     +NLFSA+NQALHIAL+TDPR+YVFGEDVG
Sbjct  5     GLGRGISIGK-RCFSSFSEVEKPPMDG--KPINLFSAINQALHIALETDPRAYVFGEDVG  61

Query  403   fggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQ  582
             FGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAFDQ
Sbjct  62    FGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAFDQ  121

Query  583   IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPL  762
             IVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEAFFCHVPG+KVVIPRSP 
Sbjct  122   IVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEAFFCHVPGLKVVIPRSPR  181

Query  763   QAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGA  942
             QAKGLLL+ IRD NPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGWGA
Sbjct  182   QAKGLLLACIRDSNPVVFFEPKWLYRLAVEEVPEHDYMLPLSQAEVIRQGSDITLVGWGA  241

Query  943   QLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAE  1122
             QLSV++ AC +  K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFGAE
Sbjct  242   QLSVLEHACDDVAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFGAE  301

Query  1123  ISASIVERCFTRL  1161
             ISASI ERCF R+
Sbjct  302   ISASIAERCFLRV  314



>ref|XP_006576608.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X2 [Glycine max]
Length=253

 Score =   496 bits (1277),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 233/253 (92%), Positives = 247/253 (98%), Gaps = 0/253 (0%)
 Frame = +1

Query  520   MDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ  699
             M NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT+RAPYGAVGHGGHYHSQ
Sbjct  1     MGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQ  60

Query  700   SPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYML  879
             SPEAFFCHVPGIKVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRLAVEEVPE DYML
Sbjct  61    SPEAFFCHVPGIKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEDDYML  120

Query  880   PLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASV  1059
             PLSEAEV+R+GSD+TLVGWGAQL++M++AC++AEKEGISCELIDLKTL+PWDKETVE+SV
Sbjct  121   PLSEAEVIRQGSDVTLVGWGAQLAIMEQACLDAEKEGISCELIDLKTLIPWDKETVESSV  180

Query  1060  KKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTK  1239
              KTGRLLVSHEAPITGGFGAEISASIVERCF+RLEAPVAR+CGLDTPFPLVFEPFYMPTK
Sbjct  181   NKTGRLLVSHEAPITGGFGAEISASIVERCFSRLEAPVARICGLDTPFPLVFEPFYMPTK  240

Query  1240  NKILDAIKSTVNY  1278
             NKILDAIKSTV Y
Sbjct  241   NKILDAIKSTVKY  253



>gb|EYU39280.1| hypothetical protein MIMGU_mgv1a012352mg [Erythranthe guttata]
Length=253

 Score =   495 bits (1274),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 245/253 (97%), Gaps = 0/253 (0%)
 Frame = +1

Query  520   MDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ  699
             M NRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ
Sbjct  1     MGNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ  60

Query  700   SPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYML  879
             SPEAFFCHVPGIKVVIPR+P QAKGLLLS IRDPNPVVFFEPKWLYRLAVEEVPE DYML
Sbjct  61    SPEAFFCHVPGIKVVIPRNPQQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEKDYML  120

Query  880   PLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASV  1059
             PLSEAEV+REGSDITLVGWGAQL +M++AC+EAEK+GISCELIDLKTL+PWDKETVEASV
Sbjct  121   PLSEAEVIREGSDITLVGWGAQLLIMEQACVEAEKDGISCELIDLKTLIPWDKETVEASV  180

Query  1060  KKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTK  1239
              KTGRLLVSHEAPITGGFGAEISASIV+RCF RLEAPVARVCGLDTPFPLVFEPFYMPTK
Sbjct  181   NKTGRLLVSHEAPITGGFGAEISASIVDRCFLRLEAPVARVCGLDTPFPLVFEPFYMPTK  240

Query  1240  NKILDAIKSTVNY  1278
             NKILDAIKSTV Y
Sbjct  241   NKILDAIKSTVGY  253



>ref|XP_008805369.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X1 [Phoenix dactylifera]
Length=336

 Score =   487 bits (1254),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 260/330 (79%), Positives = 283/330 (86%), Gaps = 20/330 (6%)
 Frame = +1

Query  223   GLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR---------  375
             GLG  I  GK R FSS    EK   +     +NLFSA+NQALHIAL+TDPR         
Sbjct  5     GLGRGISIGK-RCFSSFSEVEKPPMDG--KPINLFSAINQALHIALETDPRYGLCNLGVE  61

Query  376   --------SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNR  531
                     +YVFGEDVGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NR
Sbjct  62    YLWNFCPCAYVFGEDVGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNR  121

Query  532   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEA  711
             AIAEIQFADYI+PAFDQIVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEA
Sbjct  122   AIAEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEA  181

Query  712   FFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSE  891
             FFCHVPG+KVVIPRSP QAKGLLL+ IRD NPVVFFEPKWLYRLAVEEVPE DYMLPLS+
Sbjct  182   FFCHVPGLKVVIPRSPRQAKGLLLACIRDSNPVVFFEPKWLYRLAVEEVPEHDYMLPLSQ  241

Query  892   AEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTG  1071
             AEV+R+GSDITLVGWGAQLSV++ AC +  K+GISCELIDL+TL+PWDKETVEASV+KTG
Sbjct  242   AEVIRQGSDITLVGWGAQLSVLEHACDDVAKDGISCELIDLRTLIPWDKETVEASVRKTG  301

Query  1072  RLLVSHEAPITGGFGAEISASIVERCFTRL  1161
             RLLVSHEAP+TGGFGAEISASI ERCF R+
Sbjct  302   RLLVSHEAPVTGGFGAEISASIAERCFLRV  331



>ref|XP_006445561.1| hypothetical protein CICLE_v10015660mg [Citrus clementina]
 gb|ESR58801.1| hypothetical protein CICLE_v10015660mg [Citrus clementina]
Length=312

 Score =   477 bits (1228),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 249/302 (82%), Positives = 272/302 (90%), Gaps = 13/302 (4%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE------SGKSSMNLFSAVNQALHIA  357
             MA  LRR  G    + R   R  S++   ++ +Q+      SGKS +NL+SA+NQALHIA
Sbjct  1     MASGLRRFVG---SLSR---RNLSTACANKQLIQQHDGGVGSGKS-LNLYSAINQALHIA  53

Query  358   LDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAI  537
             L+TDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAM NRAI
Sbjct  54    LETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAI  113

Query  538   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFF  717
             AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT+RAPYGAVGHGGHYHSQSPEAFF
Sbjct  114   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFF  173

Query  718   CHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAE  897
             CHVPG+KVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRL+VEEVPE DYMLPLSEAE
Sbjct  174   CHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAE  233

Query  898   VMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRL  1077
             V+REGSDITLVGWGAQLS+M++AC++AEKEGISCELIDLKTL+PWDKETVEASV+KTGRL
Sbjct  234   VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRL  293

Query  1078  LV  1083
             LV
Sbjct  294   LV  295



>ref|XP_007014024.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 3 [Theobroma cacao]
 gb|EOY31643.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 3 [Theobroma cacao]
Length=280

 Score =   475 bits (1222),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/277 (87%), Positives = 262/277 (95%), Gaps = 2/277 (1%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             R FS++  + +  Q+S KS +NL+SA+NQALHIAL+TDPR++VFGEDV FGGVFRCTTGL
Sbjct  2     RPFSTATCDIEN-QQSAKS-INLYSAINQALHIALETDPRTFVFGEDVSFGGVFRCTTGL  59

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
             ADRFGK RVFNTPLCEQGIVGF IGLAAM NRAIAEIQFADYIFPAFDQIVNEAAKFRYR
Sbjct  60    ADRFGKSRVFNTPLCEQGIVGFGIGLAAMGNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  119

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IR
Sbjct  120   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPQQAKGLLLSCIR  179

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+REGSDITLVGWGAQLS+M++ACI+
Sbjct  180   DPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSKAEVIREGSDITLVGWGAQLSIMEQACID  239

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVS  1086
             AEK+GISCELIDLKTL+PWDKETVEASV+KTGRLLVS
Sbjct  240   AEKDGISCELIDLKTLIPWDKETVEASVRKTGRLLVS  276



>gb|KDO54502.1| hypothetical protein CISIN_1g017410mg [Citrus sinensis]
Length=305

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 248/301 (82%), Positives = 271/301 (90%), Gaps = 13/301 (4%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQE------SGKSSMNLFSAVNQALHIA  357
             MA  LRR  G    + R   R  S++   ++ +Q+      SGKS +NL+SA+NQALHIA
Sbjct  1     MASGLRRFVG---SLSR---RNLSTACANKQLIQQHDGGVGSGKS-LNLYSAINQALHIA  53

Query  358   LDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAI  537
             L+TDPR+YVFGEDVGFGGVFRCTTGLADRFGK RVFNTPLCEQGIVGFAIGLAAM NRAI
Sbjct  54    LETDPRAYVFGEDVGFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFAIGLAAMGNRAI  113

Query  538   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFF  717
             AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT+RAPYGAVGHGGHYHSQSPEAFF
Sbjct  114   AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTVRAPYGAVGHGGHYHSQSPEAFF  173

Query  718   CHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAE  897
             CHVPG+KVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRL+VEEVPE DYMLPLSEAE
Sbjct  174   CHVPGLKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLSVEEVPEDDYMLPLSEAE  233

Query  898   VMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRL  1077
             V+REGSDITLVGWGAQLS+M++AC++AEKEGISCELIDLKTL+PWDKETVEASV+KTGRL
Sbjct  234   VIREGSDITLVGWGAQLSIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVRKTGRL  293

Query  1078  L  1080
             L
Sbjct  294   L  294



>ref|XP_008366129.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X2 [Malus domestica]
Length=305

 Score =   473 bits (1217),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 235/263 (89%), Positives = 252/263 (96%), Gaps = 0/263 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+ +G  S+NL+SA+NQALHIAL+TDPRSYVFGEDV FGGVFRCTTGLADRFGK RVFNT
Sbjct  42    VRGTGSKSLNLYSAINQALHIALETDPRSYVFGEDVSFGGVFRCTTGLADRFGKQRVFNT  101

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  102   PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  161

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCH PG+KVVIPRSPLQAKGLLLS IRDPNPVVFFEPKW
Sbjct  162   RAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFFEPKW  221

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLSVM++AC EAEK+GISCELID
Sbjct  222   LYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAEKDGISCELID  281

Query  1012  LKTLLPWDKETVEASVKKTGRLL  1080
             L+TLLPWDK+TVEASV+KTGRLL
Sbjct  282   LRTLLPWDKDTVEASVRKTGRLL  304



>ref|XP_008384356.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X2 [Malus domestica]
Length=305

 Score =   473 bits (1217),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 235/263 (89%), Positives = 252/263 (96%), Gaps = 0/263 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+ +G  S+NL+SA+NQALHIAL+TDPRSYVFGEDV FGGVFRCTTGLADRFGK RVFNT
Sbjct  42    VRGTGSKSLNLYSAINQALHIALETDPRSYVFGEDVSFGGVFRCTTGLADRFGKQRVFNT  101

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  102   PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  161

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCH PG+KVVIPRSPLQAKGLLLS IRDPNPVVFFEPKW
Sbjct  162   RAPYGAVGHGGHYHSQSPEAFFCHAPGLKVVIPRSPLQAKGLLLSCIRDPNPVVFFEPKW  221

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRL+VEEVPE DYMLPLSEAEV+REG+DITLVGWGAQLSVM++AC EAEK+GISCELID
Sbjct  222   LYRLSVEEVPEHDYMLPLSEAEVIREGTDITLVGWGAQLSVMEQACKEAEKDGISCELID  281

Query  1012  LKTLLPWDKETVEASVKKTGRLL  1080
             L+TLLPWDK+TVEASV+KTGRLL
Sbjct  282   LRTLLPWDKDTVEASVRKTGRLL  304



>emb|CBJ32712.1| Branched chain alpha-keto acid dehydrogenase E1 beta subunit 
[Ectocarpus siliculosus]
Length=451

 Score =   477 bits (1228),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 276/327 (84%), Gaps = 0/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             E   + MNLF+AVN  L  A++TD  + VFGEDV FGGVFRCT GL ++FG  RVF++ L
Sbjct  125   EGPSTRMNLFTAVNAGLRTAMETDDTAIVFGEDVAFGGVFRCTGGLKEQFGPDRVFDSTL  184

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGI GFAIG A+M   AIAEIQFADYIFPAFDQIVNEAAKFRYRSG+QFNCGGLTIRA
Sbjct  185   CEQGIAGFAIGYASMGKTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGDQFNCGGLTIRA  244

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             P GAVGHGGHYHSQSPE++F H PG+KVV+PR+  +AKGLLL+S+R+P+PV+FFEPK LY
Sbjct  245   PCGAVGHGGHYHSQSPESYFAHTPGLKVVMPRNATEAKGLLLASVREPDPVIFFEPKILY  304

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             R +VE+VP+GDY +PL  A+VMREG+D+TLVGWGAQL VM EAC +AEKEGISCELIDL+
Sbjct  305   RTSVEDVPDGDYEVPLGVADVMREGTDVTLVGWGAQLRVMSEACDDAEKEGISCELIDLR  364

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             T+LPWD +TV  SVKKTGRL+VSHEAP TGGF AE++A + ERCF  LEAPV RVCG DT
Sbjct  365   TILPWDFDTVSRSVKKTGRLVVSHEAPRTGGFAAEVAADMQERCFLHLEAPVQRVCGYDT  424

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFPLVFE FY+P + K+LDA++  VNY
Sbjct  425   PFPLVFEKFYVPGRFKVLDAVRDAVNY  451



>gb|KCW52336.1| hypothetical protein EUGRSUZ_J01753 [Eucalyptus grandis]
Length=301

 Score =   469 bits (1206),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 249/264 (94%), Gaps = 0/264 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             VQ +   S+NL SA+NQALHIALDTDPRSYVFGEDV FGGVFRCT GLADRFGK RVFNT
Sbjct  37    VQRTQNPSLNLCSAINQALHIALDTDPRSYVFGEDVSFGGVFRCTVGLADRFGKGRVFNT  96

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IGLAAM NRA+AEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI
Sbjct  97    PLCEQGIVGFGIGLAAMGNRAVAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  156

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGLLLS IRDPNP+VFFEPKW
Sbjct  157   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPSQAKGLLLSCIRDPNPIVFFEPKW  216

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELID  1011
             LYRLAVEEVPE DY LPLSEAEV+REG+DITLVGWGAQLSVM+EAC++AE +GISCELID
Sbjct  217   LYRLAVEEVPEHDYTLPLSEAEVIREGTDITLVGWGAQLSVMEEACLDAENDGISCELID  276

Query  1012  LKTLLPWDKETVEASVKKTGRLLV  1083
             LKTLLPWDKETVEASV+KTGRLL+
Sbjct  277   LKTLLPWDKETVEASVRKTGRLLL  300



>gb|EPS60890.1| hypothetical protein M569_13911, partial [Genlisea aurea]
Length=277

 Score =   467 bits (1202),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/262 (86%), Positives = 238/262 (91%), Gaps = 14/262 (5%)
 Frame = +1

Query  418   RCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEA  597
             RCTTGLADRFGKHRVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYIFPAFDQIVNEA
Sbjct  16    RCTTGLADRFGKHRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIFPAFDQIVNEA  75

Query  598   AKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGL  777
             AKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSP QAKGL
Sbjct  76    AKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPKQAKGL  135

Query  778   LLSSIRDPNPVVFFEPK--------------WLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             LLSSIRDPNP+VFFEPK               LYRLAVE+VPE DYMLPLSEAEV+REGS
Sbjct  136   LLSSIRDPNPIVFFEPKASQVSVANPKYIFQMLYRLAVEDVPEDDYMLPLSEAEVIREGS  195

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DITLVGWGAQLSVM++AC EAEK+GI CELIDLKTL+PWDKETVEASV KTGRLL+SHEA
Sbjct  196   DITLVGWGAQLSVMEQACDEAEKDGICCELIDLKTLIPWDKETVEASVNKTGRLLISHEA  255

Query  1096  PITGGFGAEISASIVERCFTRL  1161
             P+TGGFGAE++ASI +RCF R+
Sbjct  256   PVTGGFGAEVAASIAQRCFLRV  277



>ref|XP_003724225.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform 1 [Strongylocentrotus purpuratus]
 ref|XP_796781.3| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform 2 [Strongylocentrotus purpuratus]
Length=322

 Score =   468 bits (1203),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 274/322 (85%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF A+N A+ +AL +D  + +FGEDV FGGVFRCT GLAD+ GK RVFNTPLCEQGIV
Sbjct  1     MNLFQALNNAMDVALTSDSTAVIFGEDVAFGGVFRCTVGLADKHGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+AA+   AIAEIQFADYI+PAFDQI+NEAAKFRYRSGN F+ GGLTIRAP+GAVG
Sbjct  61    GFGIGMAAVGATAIAEIQFADYIYPAFDQIINEAAKFRYRSGNMFDVGGLTIRAPWGAVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H+PG+KVVIPRSP+QAKGLLLS IRDPNP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHIPGVKVVIPRSPIQAKGLLLSCIRDPNPCIFFEPKVLYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP  DYM+PLS+AEV++EGSD+TLVGWG Q+ V++E A +  EK G+SCELIDL T+LPW
Sbjct  181   VPVKDYMIPLSKAEVLQEGSDVTLVGWGTQIHVLREVAQMAQEKLGVSCELIDLVTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             DK+T+  SV+KTGRLLV+HEAPITGGF +EI++S+ E CF +LEAP+ RVCG D+PFP +
Sbjct  241   DKDTIIKSVEKTGRLLVAHEAPITGGFASEIASSVQEECFLQLEAPIQRVCGWDSPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K + LDAIK  +NY
Sbjct  301   FEPFYLPDKWRCLDAIKKMINY  322



>ref|XP_008605775.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Saprolegnia 
diclina VS20]
 gb|EQC40931.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Saprolegnia 
diclina VS20]
Length=350

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 233/361 (65%), Positives = 285/361 (79%), Gaps = 11/361 (3%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR  375
             M  S RR+  L     R ++   S+ +V E+         MN+F+A+N A+ +A++TDP 
Sbjct  1     MLPSTRRLSTLASSTLRRQFA--STPLVTER---------MNMFTALNDAMRVAMETDPT  49

Query  376   SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFA  555
             + VFGEDV FGGVFRCT  L ++FG+ RVFN+PLCEQGI GFAIG A++   AIAEIQFA
Sbjct  50    AVVFGEDVAFGGVFRCTVDLKEQFGEDRVFNSPLCEQGIAGFAIGYASIGRTAIAEIQFA  109

Query  556   DYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGI  735
             DYIFPAFDQIVNEAAKFRYRSGNQF+CG LT RAPYGAVGHG HYHSQSPEA+F H PG+
Sbjct  110   DYIFPAFDQIVNEAAKFRYRSGNQFDCGKLTFRAPYGAVGHGAHYHSQSPEAYFAHTPGL  169

Query  736   KVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGS  915
             KVVIPR+P QAKGLLL+SIRDPNPVVFFEPK LYR +V +VP GD+ +PL +A++MR G+
Sbjct  170   KVVIPRNPTQAKGLLLASIRDPNPVVFFEPKALYRASVSDVPVGDFTVPLGQADIMRSGT  229

Query  916   DITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEA  1095
             DIT+VGWGAQ+ V+++AC  AE+ G+SCELIDL+T+ PWD +TVE SV+KTGRL+VSHEA
Sbjct  230   DITIVGWGAQMRVLEDACDMAEEAGVSCELIDLQTITPWDVDTVEQSVRKTGRLIVSHEA  289

Query  1096  PITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVN  1275
             P TGGF +EI+++I ERCF  LEAPV RVCG DTPFPL +E  Y+P   K  +AIK  VN
Sbjct  290   PKTGGFASEIASTIQERCFLNLEAPVQRVCGYDTPFPLAYEKLYLPDALKNFEAIKHAVN  349

Query  1276  Y  1278
             Y
Sbjct  350   Y  350



>ref|XP_009829616.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Aphanomyces 
astaci]
 gb|ETV80669.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Aphanomyces 
astaci]
Length=341

 Score =   462 bits (1188),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 228/341 (67%), Positives = 276/341 (81%), Gaps = 6/341 (2%)
 Frame = +1

Query  256   RGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGL  435
             R FSS+ V  K         MN+F+A+N A+ +A++TDP + VFGEDV FGGVFRCT  L
Sbjct  7     RRFSSAAVPLK------TERMNMFTALNDAMRVAMETDPTAAVFGEDVAFGGVFRCTVDL  60

Query  436   ADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYR  615
              ++FG+ RVFN+PLCEQGI GFAIG A++   AIAEIQFADYIFPAFDQIVNEAAKFRYR
Sbjct  61    REQFGEDRVFNSPLCEQGIAGFAIGYASVGRTAIAEIQFADYIFPAFDQIVNEAAKFRYR  120

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SGNQ++CG LT RAPYGAVGHG HYHSQSPEA+F H PG+KVVIPR+P+QAKGLLL+SIR
Sbjct  121   SGNQWDCGKLTFRAPYGAVGHGAHYHSQSPEAYFAHTPGLKVVIPRNPVQAKGLLLASIR  180

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNPVVFFEPK LYR +V EVP GD+ +PL +A+++R GSD+T+VGWGAQ+ V++E C  
Sbjct  181   DPNPVVFFEPKALYRASVAEVPVGDFTVPLGQADIVRSGSDVTIVGWGAQMRVLEETCDM  240

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             AE+ G+SCELIDL+T+LPWD +T+E SV+KTGRL+VSHEAP TGGF  EI+++I ERCF 
Sbjct  241   AEEAGVSCELIDLQTILPWDVDTIEQSVRKTGRLIVSHEAPRTGGFAGEIASTIQERCFL  300

Query  1156  RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              LEAP+ RV G DTPFPL  E FY+P   K  +AIK  VNY
Sbjct  301   SLEAPILRVTGYDTPFPLAHEKFYLPDALKNFEAIKKIVNY  341



>ref|XP_008873308.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Aphanomyces 
invadans]
 gb|ETV97747.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Aphanomyces 
invadans]
Length=343

 Score =   461 bits (1186),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 222/321 (69%), Positives = 269/321 (84%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + VFGEDV FGGVFRCT  L ++FG+ RVFN+PLCEQGI 
Sbjct  23    MNMFTALNDAMRVAMETDPTAAVFGEDVAFGGVFRCTVDLREQFGEDRVFNSPLCEQGIA  82

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A++   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQ++CG LT RAPYGAVG
Sbjct  83    GFAIGYASVGRTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQWDCGKLTFRAPYGAVG  142

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG HYHSQSPEA+F H PG+KVVIPR+P+QAKGLLL+SIRDPNPVVFFEPK LYR +V E
Sbjct  143   HGAHYHSQSPEAYFAHTPGLKVVIPRNPVQAKGLLLASIRDPNPVVFFEPKALYRASVAE  202

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP GD+ +PL +A+++R G+D+TLVGWGAQ+ V++E C  AE+ G+SCELIDL+T+LPWD
Sbjct  203   VPVGDFTIPLGQADIVRSGTDVTLVGWGAQMRVLEETCDMAEEAGVSCELIDLQTILPWD  262

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL+VSHEAP TGGF  EI+++I ERCF  LEAP+ RV G DTPFPL  
Sbjct  263   VDTIEQSVRKTGRLIVSHEAPRTGGFAGEIASTIQERCFLSLEAPIMRVTGYDTPFPLAH  322

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E FY+P   K  +AIK  VNY
Sbjct  323   EKFYLPDALKNFEAIKKIVNY  343



>ref|XP_002946840.1| hypothetical protein VOLCADRAFT_56472 [Volvox carteri f. nagariensis]
 gb|EFJ52066.1| hypothetical protein VOLCADRAFT_56472 [Volvox carteri f. nagariensis]
Length=342

 Score =   458 bits (1179),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 227/326 (70%), Positives = 272/326 (83%), Gaps = 1/326 (0%)
 Frame = +1

Query  304   GKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCE  483
             G   +NL +AVN AL +ALDT+ R+YVFGEDV FGGVFRCT GL +RFGK RVFNTPL E
Sbjct  17    GFKRLNLCNAVNDALTVALDTNDRAYVFGEDVSFGGVFRCTVGLLERFGKDRVFNTPLSE  76

Query  484   QGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPY  663
             QGIVGF IGLAAM + A+AEIQFADYIFPAFDQ+VNEAAK+RYRSG  FNCGGLT+RAPY
Sbjct  77    QGIVGFGIGLAAMGHTAVAEIQFADYIFPAFDQLVNEAAKYRYRSGGTFNCGGLTVRAPY  136

Query  664   GAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRL  843
             GAVGHGGHYHSQSPEA F HVPG+KVVIP SP +AKGLLLSSIR P+PVVFFEPK +YR 
Sbjct  137   GAVGHGGHYHSQSPEAVFTHVPGLKVVIPSSPAEAKGLLLSSIRAPDPVVFFEPKMMYRT  196

Query  844   AVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEK-EGISCELIDLKT  1020
             AVE+VPEGDY +PL  A V+ EG D+TLVGWG Q+ V+++A  +  K + ISCE+IDL+T
Sbjct  197   AVEDVPEGDYEVPLGVARVVVEGGDVTLVGWGQQVLVLEQAAAQLRKADDISCEVIDLRT  256

Query  1021  LLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTP  1200
             L PWD ETV ASV KTGRL+V+HEAP+TGGFGAE++A++ ERCFT LE+P  R CG+DTP
Sbjct  257   LAPWDFETVCASVSKTGRLVVAHEAPLTGGFGAEVAATVAERCFTVLESPPVRCCGVDTP  316

Query  1201  FPLVFEPFYMPTKNKILDAIKSTVNY  1278
             FPL+ EP Y+P   +++DA++  V++
Sbjct  317   FPLIMEPVYLPGVARVMDAVRGVVHF  342



>emb|CDS07709.1| hypothetical protein LRAMOSA01658 [Absidia idahoensis var. thermophila]
Length=390

 Score =   460 bits (1183),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 230/323 (71%), Positives = 270/323 (84%), Gaps = 2/323 (1%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF AVN A+ IAL TD  + VFGEDV FGGVFR TTGLA++FGK RVFNTPL EQGI 
Sbjct  68    MNLFQAVNDAMSIALATDDNAVVFGEDVSFGGVFRATTGLAEKFGKDRVFNTPLTEQGIA  127

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG+AA+ + AIAEIQFADYIFPAFDQ+VNEAAK+RYRSGNQFN GG+TIRAP  AVG
Sbjct  128   GFAIGMAAVGHTAIAEIQFADYIFPAFDQLVNEAAKYRYRSGNQFNVGGMTIRAPCSAVG  187

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEAFF H PG+K+V PRSP+QAKGLLL+SIRD NPV+FFEPK LYR AVEE
Sbjct  188   HGGHYHSQSPEAFFAHCPGLKIVTPRSPIQAKGLLLASIRDRNPVIFFEPKNLYRAAVEE  247

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKE--GISCELIDLKTLLP  1029
             VP  DY LPLS+AEV++ G D+T+VG+GAQ+  ++ A   AEK+  G+SCELIDL+T++P
Sbjct  248   VPVADYELPLSKAEVLKRGKDVTIVGYGAQMYTLENAVQLAEKKMPGLSCELIDLRTIMP  307

Query  1030  WDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPL  1209
             WD +TV  SV KTGRL+V+HEAP + G GAEIS++I+ERCF RLEAP+ RVCG DTPFPL
Sbjct  308   WDVDTVVESVNKTGRLVVAHEAPKSSGMGAEISSTIMERCFLRLEAPIQRVCGWDTPFPL  367

Query  1210  VFEPFYMPTKNKILDAIKSTVNY  1278
             +FE FYMP   +  DAIK+ VNY
Sbjct  368   IFEKFYMPNMIRCFDAIKNAVNY  390



>ref|XP_009529584.1| hypothetical protein PHYSODRAFT_561567 [Phytophthora sojae]
 gb|EGZ15835.1| hypothetical protein PHYSODRAFT_561567 [Phytophthora sojae]
Length=321

 Score =   456 bits (1174),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 265/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + +FGEDV FGGVFRC+  L ++FG  RVFN+PLCEQ I 
Sbjct  1     MNMFTAINDAMRVAMETDPSAVLFGEDVAFGGVFRCSVDLREKFGSDRVFNSPLCEQAIA  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A+    AIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+FNCG LT RAPYGAVG
Sbjct  61    GFAIGYASTGRTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFNCGKLTFRAPYGAVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR+P  AKGLLL+SIRDPNPV+F EPK LYR +V E
Sbjct  121   HGGHYHSQSPEAYFAHTPGLKVVVPRNPAAAKGLLLASIRDPNPVLFLEPKALYRASVGE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP GDY+  LSEAE++R G+D+T+VGWGAQ+ V++EAC  AE  GISCELIDL+T+ PWD
Sbjct  181   VPVGDYVQNLSEAEIVRRGTDVTVVGWGAQMRVLEEACSYAEDVGISCELIDLQTIFPWD  240

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL++SHEAP +GGF AEIS+S+ ERCF  LEAP+ RVCG DTPFPL +
Sbjct  241   ADTIEHSVRKTGRLVISHEAPKSGGFAAEISSSMQERCFLSLEAPIQRVCGYDTPFPLAY  300

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   +  +AIK  VNY
Sbjct  301   ESHYLPDALRNFEAIKKVVNY  321



>gb|EPB84905.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Mucor 
circinelloides f. circinelloides 1006PhL]
Length=333

 Score =   457 bits (1175),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/330 (69%), Positives = 272/330 (82%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
               S    MNLF AVN A+ IAL TD R+ VFGEDV FGGVFR T+GLA++FG+ RVFNTP
Sbjct  4     NNSETKKMNLFQAVNDAMSIALTTDERAVVFGEDVSFGGVFRATSGLAEQFGRDRVFNTP  63

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             L EQGI GFA+G+A++ + AIAEIQFADYIFPAFDQ+VNEAAKFRYRSGNQFN GGLTIR
Sbjct  64    LTEQGIAGFAVGMASVGHTAIAEIQFADYIFPAFDQLVNEAAKFRYRSGNQFNVGGLTIR  123

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             +P  AVGHGGHYHSQSPEAFF H PG+KVV PRSP+QAKGLLL+SIRD NPV+FFEPK L
Sbjct  124   SPSSAVGHGGHYHSQSPEAFFTHAPGLKVVTPRSPIQAKGLLLASIRDRNPVIFFEPKIL  183

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKE--GISCELI  1008
             YR AVEEVP  DY LPL +AEV+++G D+T+VG+G+Q+  ++ A   AEK+  G+SCELI
Sbjct  184   YRAAVEEVPVADYELPLGKAEVIKKGKDVTIVGYGSQIYTLENAIQLAEKKMPGLSCELI  243

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD ETV  SVKKTGRL+V+HEAP T G GAEI+A+++E CF  LEAP+ RVCG
Sbjct  244   DLRTIMPWDVETVVESVKKTGRLVVAHEAPKTAGVGAEIAATVMENCFLNLEAPIQRVCG  303

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFPLVFE FY+P+  +  DAIK+ VNY
Sbjct  304   WDTPFPLVFEKFYVPSMIRCYDAIKTAVNY  333



>ref|XP_004368155.1| branched-chain alpha-KETO ACID decarboxylase E1 beta subunit, 
putative [Acanthamoeba castellanii str. Neff]
 gb|ELR25400.1| branched-chain alpha-KETO ACID decarboxylase E1 beta subunit, 
putative [Acanthamoeba castellanii str. Neff]
Length=395

 Score =   459 bits (1181),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 277/341 (81%), Gaps = 3/341 (1%)
 Frame = +1

Query  265   SSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADR  444
             SSS  +++   E   + MN F+AVN AL IAL  DP++ +FGEDV FGGVFRCT  L ++
Sbjct  55    SSSTHQQQPQGEGEVARMNFFTAVNNALDIALGADPKAVIFGEDVAFGGVFRCTINLREK  114

Query  445   FGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQ---IVNEAAKFRYR  615
             +G  RVFNTPL EQGI GFAIG+AA+    IAE+QFADYIFPAFDQ   +VNEAAK+RYR
Sbjct  115   YGNSRVFNTPLSEQGIAGFAIGMAAVGATPIAEMQFADYIFPAFDQARALVNEAAKYRYR  174

Query  616   SGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIR  795
             SG QF+  GLT+R P GAVGHGGHYHSQSPEA+FCH PG+KVV+P +P +AKGLLLSSIR
Sbjct  175   SGGQFDVAGLTVRTPCGAVGHGGHYHSQSPEAYFCHTPGLKVVMPSTPKEAKGLLLSSIR  234

Query  796   DPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIE  975
             DPNPV+F EPK LYR AVE+VP GDY LPL +A +++EGSD+T+VGWG+QL V+ +AC  
Sbjct  235   DPNPVIFLEPKILYRSAVEDVPLGDYELPLGKARIVKEGSDVTVVGWGSQLHVLTDACGL  294

Query  976   AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             AEKEGISCELIDL+TL PWD +TVEASVKKTGRL+VSHEAP TGGF  EI ++I ERCF 
Sbjct  295   AEKEGISCELIDLRTLAPWDVDTVEASVKKTGRLVVSHEAPKTGGFAGEICSTIQERCFL  354

Query  1156  RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              LE+P+ R+CG DTPFPLVFE FY+P K K L+AI+STV++
Sbjct  355   HLESPIRRICGYDTPFPLVFEKFYVPDKLKNLEAIRSTVHF  395



>emb|CDH48749.1| 3-methyl-2-oxobutanoate dehydrogenase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=390

 Score =   458 bits (1178),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 270/323 (84%), Gaps = 2/323 (1%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF AVN A+ IAL TD  + VFGEDV FGGVFR TTGLA++FGK RVFNTPL EQGI 
Sbjct  68    MNLFQAVNDAMSIALATDDNAVVFGEDVSFGGVFRATTGLAEKFGKDRVFNTPLTEQGIA  127

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG+AA+ + AIAEIQFADYIFPAFDQ+VNEAAK+RYRSGNQFN GG+TIRAP  AVG
Sbjct  128   GFAIGMAAVGHTAIAEIQFADYIFPAFDQLVNEAAKYRYRSGNQFNVGGMTIRAPCSAVG  187

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEAFF H PG+K+V PRSP+QAKGLLL+SIRD NPV+FFEPK LYR AVEE
Sbjct  188   HGGHYHSQSPEAFFAHCPGLKIVTPRSPIQAKGLLLASIRDRNPVIFFEPKNLYRAAVEE  247

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKE--GISCELIDLKTLLP  1029
             VP  DY LPLS+AEV++ G D+T+VG+GAQ+  ++ A   AEK+  G+SCELIDL+T++P
Sbjct  248   VPVADYELPLSKAEVLKRGKDVTIVGYGAQMYTLENAVQLAEKKMPGLSCELIDLRTIMP  307

Query  1030  WDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPL  1209
             WD +TV  SV KTGRL+V+HEAP + G GAEIS++I+ERCF RLEAP+ RVCG DTPFPL
Sbjct  308   WDVDTVVESVNKTGRLVVAHEAPKSSGMGAEISSTIMERCFLRLEAPIQRVCGWDTPFPL  367

Query  1210  VFEPFYMPTKNKILDAIKSTVNY  1278
             +FE FYMP   +  DAIK+ V+Y
Sbjct  368   IFEKFYMPNMIRCFDAIKNAVDY  390



>ref|XP_008901567.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica INRA-310]
 gb|ETI52615.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica P1569]
 gb|ETK92495.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica]
 gb|ETL45904.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica]
 gb|ETL99065.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica]
 gb|ETM52219.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica]
 gb|ETN13556.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica INRA-310]
 gb|ETO76881.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica P1976]
 gb|ETP22477.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica CJ01A1]
 gb|ETP50359.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
2 [Phytophthora parasitica P10297]
Length=321

 Score =   455 bits (1170),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 267/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + +FGEDV FGGVFRC+  L ++FG  RVFN+PLCEQGI 
Sbjct  1     MNMFTAINDAMRVAMETDPSAVLFGEDVAFGGVFRCSVDLREKFGDDRVFNSPLCEQGIA  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A+    AIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+F+CG LT RAPYGAVG
Sbjct  61    GFAIGYASTGRTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFDCGKLTFRAPYGAVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR+P+ AKGLLL+SIRDPNPV+F EPK LYR +V E
Sbjct  121   HGGHYHSQSPEAYFAHTPGLKVVVPRNPVTAKGLLLASIRDPNPVLFLEPKALYRASVAE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP G+Y+  LSEAE++R G+D+T+VGWGAQ+ V++EAC  AE  GISCELIDL+T+ PWD
Sbjct  181   VPVGEYVQNLSEAEIVRRGTDVTVVGWGAQMRVLEEACGYAEDVGISCELIDLQTIFPWD  240

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL++SHEAP +GGF AEIS+SI ERCF  LEAP+ RVCG DTPFPL +
Sbjct  241   ADTIEHSVRKTGRLVISHEAPKSGGFAAEISSSIQERCFLSLEAPIQRVCGYDTPFPLAY  300

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   +  +AIK  V+Y
Sbjct  301   ESHYLPDALRNFEAIKKVVDY  321



>dbj|GAM26834.1| hypothetical protein SAMD00019534_100090 [Acytostelium subglobosum 
LB1]
Length=372

 Score =   456 bits (1174),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 226/331 (68%), Positives = 276/331 (83%), Gaps = 2/331 (1%)
 Frame = +1

Query  292   VQESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFN  468
             ++ +G++  MNLF A+N A+ ++L  D ++ VFGEDVGFGGVFRCT  L +++G  RVFN
Sbjct  42    IENAGETQKMNLFQAINNAMDLSLKADEKACVFGEDVGFGGVFRCTVDLRNKYGPKRVFN  101

Query  469   TPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT  648
             TPLCEQ I GFAIG+AA    AIAEIQFADYIFPAFDQIVNEAAK+RYRSG  FNCG LT
Sbjct  102   TPLCEQAIAGFAIGMAAQGGTAIAEIQFADYIFPAFDQIVNEAAKYRYRSGGMFNCGSLT  161

Query  649   IRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPK  828
             IRAPYGAVGHGGHYHSQSPEA+F H PG+KVV+P +P++AKGLLL+SI+D NPVVFFEPK
Sbjct  162   IRAPYGAVGHGGHYHSQSPEAYFAHTPGLKVVMPSTPIEAKGLLLASIKDKNPVVFFEPK  221

Query  829   WLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKEGISCEL  1005
              LYR AVEEVP G+Y +PL +A V++EG+DIT+VGWGAQ+ V+ +AC +  EK GISCEL
Sbjct  222   LLYRSAVEEVPVGEYEVPLGKARVVQEGTDITIVGWGAQMRVLLQACQMAKEKLGISCEL  281

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDL+T+LPWD ET+EASVKKTGRL++SHEAP TGG+ AEIS++I ERCF  LEAP+ R+C
Sbjct  282   IDLRTILPWDVETIEASVKKTGRLVISHEAPKTGGWAAEISSTIQERCFLHLEAPIQRIC  341

Query  1186  GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             G DTPFPL+FE FY+P   K  +AIK ++NY
Sbjct  342   GYDTPFPLIFERFYVPDHLKNFEAIKKSINY  372



>ref|XP_002909050.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Phytophthora infestans T30-4]
 gb|EEY57864.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Phytophthora infestans T30-4]
Length=369

 Score =   456 bits (1172),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 267/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + +FGEDV FGGVFRC+  L ++FG  RVFN+PLCEQGI 
Sbjct  49    MNMFTAINDAMRVAMETDPSAVLFGEDVAFGGVFRCSVDLREKFGDDRVFNSPLCEQGIA  108

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A+    AIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+F+CG LT RAPYGAVG
Sbjct  109   GFAIGYASTGKTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFDCGKLTFRAPYGAVG  168

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR+P+ AKGLLL+SIRDPNPV+F EPK LYR +V E
Sbjct  169   HGGHYHSQSPEAYFAHTPGLKVVVPRNPVTAKGLLLASIRDPNPVLFLEPKALYRASVAE  228

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP G+Y+  LSEAE++R G+D+T+VGWGAQ+ V++EAC  AE  GISCELIDL+T+ PWD
Sbjct  229   VPVGEYVQNLSEAEIVRRGTDVTVVGWGAQMRVLEEACGYAEDVGISCELIDLQTIFPWD  288

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL++SHEAP +GGF AEIS+SI ERCF  LEAP+ RVCG DTPFPL +
Sbjct  289   ADTIEHSVRKTGRLVISHEAPKSGGFAAEISSSIQERCFLSLEAPIQRVCGYDTPFPLSY  348

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   +  +AIK  V+Y
Sbjct  349   ESHYLPDALRNFEAIKKVVDY  369



>emb|CEG69275.1| Putative 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Rhizopus microsporus]
Length=390

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 279/350 (80%), Gaps = 2/350 (1%)
 Frame = +1

Query  235   VIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggv  414
             ++ R     F S  +       SG + MNLF AVN A+ IAL TD ++ VFGEDV FGGV
Sbjct  41    LLKRDPDEAFRSPELAHMSANNSGTTKMNLFQAVNDAMSIALTTDDKAVVFGEDVSFGGV  100

Query  415   fRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNE  594
             FR T+GLA++FG+ RVFNTPL EQGI GFAIG+AA+ + AIAEIQFADYIFPAFDQIVNE
Sbjct  101   FRATSGLAEQFGRDRVFNTPLTEQGIAGFAIGMAAVGHTAIAEIQFADYIFPAFDQIVNE  160

Query  595   AAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKG  774
             AAKFRYRSGNQFN GGLTIR+P  AVGHGGHYHSQSPEAFF H PG+K+V PRSP+QAKG
Sbjct  161   AAKFRYRSGNQFNVGGLTIRSPSSAVGHGGHYHSQSPEAFFTHCPGLKIVTPRSPIQAKG  220

Query  775   LLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSV  954
             LLL+SIRD NPV+FFEPK LYR AVEEVP GDY LPL +AE++++G+D+T+VG+G+Q+  
Sbjct  221   LLLASIRDRNPVIFFEPKILYRAAVEEVPVGDYELPLGKAEILKKGTDVTIVGYGSQIYA  280

Query  955   MQEACIEAEKE--GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEIS  1128
             ++ A   AEK   GISCELIDL+T++PWD +TV  SVKKTGRL+++HEAP TGG  AE++
Sbjct  281   LENAIQLAEKRLPGISCELIDLRTIMPWDVDTVVESVKKTGRLVIAHEAPKTGGVAAEVA  340

Query  1129  ASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             ++++E CF  LEAP+ RVCG DTPFPL FE FY+P+  +  DAIK+ + Y
Sbjct  341   STVMEHCFLNLEAPIQRVCGWDTPFPLAFEKFYVPSMVRCYDAIKTAMEY  390



>emb|CEG65488.1| Putative 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Rhizopus microsporus]
Length=390

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 279/350 (80%), Gaps = 2/350 (1%)
 Frame = +1

Query  235   VIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggv  414
             ++ R     F S  +       SG + MNLF AVN A+ IAL TD ++ VFGEDV FGGV
Sbjct  41    LLKRDPDEAFRSPELAHMSANNSGTTKMNLFQAVNDAMSIALTTDDKAVVFGEDVSFGGV  100

Query  415   fRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNE  594
             FR T+GLA++FG+ RVFNTPL EQGI GFAIG+AA+ + AIAEIQFADYIFPAFDQIVNE
Sbjct  101   FRATSGLAEQFGRDRVFNTPLTEQGIAGFAIGMAAVGHTAIAEIQFADYIFPAFDQIVNE  160

Query  595   AAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKG  774
             AAKFRYRSGNQFN GGLTIR+P  AVGHGGHYHSQSPEAFF H PG+K+V PRSP+QAKG
Sbjct  161   AAKFRYRSGNQFNVGGLTIRSPSSAVGHGGHYHSQSPEAFFTHCPGLKIVTPRSPIQAKG  220

Query  775   LLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSV  954
             LLL+SIRD NPV+FFEPK LYR AVEEVP GDY LPL +AE++++G+D+T+VG+G+Q+  
Sbjct  221   LLLASIRDRNPVIFFEPKILYRAAVEEVPVGDYELPLGKAEILKKGTDVTIVGYGSQIYA  280

Query  955   MQEACIEAEKE--GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEIS  1128
             ++ A   AEK   GISCELIDL+T++PWD +TV  SVKKTGRL+++HEAP TGG  AE++
Sbjct  281   LENAIQLAEKRLPGISCELIDLRTIMPWDVDTVVESVKKTGRLVIAHEAPKTGGVAAEVA  340

Query  1129  ASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             ++++E CF  LEAP+ RVCG DTPFPL FE FY+P+  +  DAIK+ + Y
Sbjct  341   STVMEHCFLNLEAPIQRVCGWDTPFPLAFEKFYVPSMVRCYDAIKTAMEY  390



>ref|XP_008901565.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica INRA-310]
 gb|ETI52613.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica P1569]
 gb|ETK92493.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica]
 gb|ETL45902.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica]
 gb|ETL99063.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica]
 gb|ETM52217.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica]
 gb|ETN13554.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica INRA-310]
 gb|ETO76879.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica P1976]
 gb|ETP22475.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica CJ01A1]
 gb|ETP50357.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Phytophthora 
parasitica P10297]
Length=369

 Score =   455 bits (1171),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 218/321 (68%), Positives = 267/321 (83%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + +FGEDV FGGVFRC+  L ++FG  RVFN+PLCEQGI 
Sbjct  49    MNMFTAINDAMRVAMETDPSAVLFGEDVAFGGVFRCSVDLREKFGDDRVFNSPLCEQGIA  108

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A+    AIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+F+CG LT RAPYGAVG
Sbjct  109   GFAIGYASTGRTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFDCGKLTFRAPYGAVG  168

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR+P+ AKGLLL+SIRDPNPV+F EPK LYR +V E
Sbjct  169   HGGHYHSQSPEAYFAHTPGLKVVVPRNPVTAKGLLLASIRDPNPVLFLEPKALYRASVAE  228

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP G+Y+  LSEAE++R G+D+T+VGWGAQ+ V++EAC  AE  GISCELIDL+T+ PWD
Sbjct  229   VPVGEYVQNLSEAEIVRRGTDVTVVGWGAQMRVLEEACGYAEDVGISCELIDLQTIFPWD  288

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL++SHEAP +GGF AEIS+SI ERCF  LEAP+ RVCG DTPFPL +
Sbjct  289   ADTIEHSVRKTGRLVISHEAPKSGGFAAEISSSIQERCFLSLEAPIQRVCGYDTPFPLAY  348

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   +  +AIK  V+Y
Sbjct  349   ESHYLPDALRNFEAIKKVVDY  369



>gb|EIE84947.1| hypothetical protein RO3G_09657 [Rhizopus delemar RA 99-880]
Length=391

 Score =   455 bits (1171),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 229/341 (67%), Positives = 273/341 (80%), Gaps = 2/341 (1%)
 Frame = +1

Query  262   FSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLAD  441
             F S  +       SG   MNLF AVN AL IAL TD ++ +FGEDV FGGVFR T+GLA+
Sbjct  51    FRSHELAHMSANNSGTIKMNLFQAVNDALSIALTTDDKAVIFGEDVSFGGVFRATSGLAE  110

Query  442   RFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSG  621
             +FG+ RVFNTPL EQGI GFAIG+A++ + AIAEIQFADYI+PAFDQ+VNEAAKFRYRSG
Sbjct  111   QFGRDRVFNTPLTEQGIAGFAIGMASVGHTAIAEIQFADYIYPAFDQLVNEAAKFRYRSG  170

Query  622   NQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDP  801
             NQFN GGLTIRAP  AVGHGGHYHSQSPEAFF H PG+K+V PRSP+QAKGLLL+SIRD 
Sbjct  171   NQFNVGGLTIRAPSSAVGHGGHYHSQSPEAFFTHCPGLKIVSPRSPIQAKGLLLASIRDR  230

Query  802   NPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAE  981
             NPV+FFEPK LYR AVEEVP GDY LPL +AEV+++G D+T+VG+G+Q+  ++ A   AE
Sbjct  231   NPVIFFEPKILYRAAVEEVPVGDYELPLGKAEVLKKGKDVTVVGYGSQIYALENAIQLAE  290

Query  982   KE--GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFT  1155
             K   G+SCELIDL+T++PWD +TV  SVKKTGRL+V+HEAP TGG  AEI+++I E CF 
Sbjct  291   KRMPGLSCELIDLRTIMPWDVDTVVESVKKTGRLVVAHEAPKTGGVAAEIASTITEHCFL  350

Query  1156  RLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              LEAP+ RVCG DTPFPL FE FY+P   +  DAIK TV+Y
Sbjct  351   NLEAPIQRVCGWDTPFPLAFEKFYVPNMIRCFDAIKKTVDY  391



>ref|XP_005643202.1| Thiamin diphosphate-binding protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18658.1| Thiamin diphosphate-binding protein [Coccomyxa subellipsoidea 
C-169]
Length=354

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 224/325 (69%), Positives = 265/325 (82%), Gaps = 1/325 (0%)
 Frame = +1

Query  307   KSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQ  486
             K   NL SAVN ALHIAL+ +PR+  FGEDVGFGGVFRCT GL DRFG+ RVFNTPL EQ
Sbjct  30    KHPTNLCSAVNDALHIALEQNPRALCFGEDVGFGGVFRCTVGLFDRFGRDRVFNTPLSEQ  89

Query  487   GIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYG  666
             GIVGF IG AAM    +AEIQFADYIFPAFDQIVNEAAK+RYRSG  F+CGGLT+RAPYG
Sbjct  90    GIVGFGIGTAAMGATPVAEIQFADYIFPAFDQIVNEAAKYRYRSGGDFHCGGLTVRAPYG  149

Query  667   AVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLA  846
             AVGHGGHYHSQSPEAFF HVPGIKVV+P  P +AKGLLL+SI+DP+PV+F E K LYR  
Sbjct  150   AVGHGGHYHSQSPEAFFTHVPGIKVVVPSGPKEAKGLLLASIQDPDPVIFLEAKMLYRTV  209

Query  847   VEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTL  1023
             VE+VP G Y +PL +A +   G DITLVGWG Q++V++  A +  E++GI C++IDL+TL
Sbjct  210   VEDVPTGSYTIPLGQARIAHSGGDITLVGWGQQVAVLERAAAMVQEEDGIECDIIDLRTL  269

Query  1024  LPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPF  1203
             LPWD++T+EASV KTGRLLVSHEAP+T GFGAEI A+I  RCF RLEAP  RVCG DTPF
Sbjct  270   LPWDRDTIEASVSKTGRLLVSHEAPVTSGFGAEIVAAISRRCFLRLEAPPVRVCGYDTPF  329

Query  1204  PLVFEPFYMPTKNKILDAIKSTVNY  1278
             PLVFEP Y+P+  ++ DAI+ + ++
Sbjct  330   PLVFEPLYVPSAQRVADAIRESCHF  354



>gb|EYC33495.1| hypothetical protein Y032_0002g828 [Ancylostoma ceylanicum]
Length=369

 Score =   452 bits (1163),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 268/322 (83%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNL  AVN ALHIAL  D  + VFGEDV FGGVFRC+ GL D+FG+ RVFNTPLCEQGIV
Sbjct  48    MNLCQAVNSALHIALAADDSALVFGEDVAFGGVFRCSVGLKDKFGEERVFNTPLCEQGIV  107

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A   + AIAE+QF+DYIFPA+DQ+VNEAAK+RYRSG+ FNCG LT+RA YGAVG
Sbjct  108   GFAIGAAVGGSTAIAEVQFSDYIFPAYDQLVNEAAKYRYRSGDMFNCGALTVRATYGAVG  167

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGG YHSQSPEA F H PG+KVVIPR P+QAKGLLLS IRDPNP +FFEPK LYRLA E+
Sbjct  168   HGGLYHSQSPEANFTHTPGLKVVIPRGPVQAKGLLLSCIRDPNPCIFFEPKILYRLAAED  227

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKEGISCELIDLKTLLPW  1032
             VP GDYM+PLS+A+V++EG+D+T+V W  Q+ V  EA  I  E+ G++ E+IDL+T+LPW
Sbjct  228   VPTGDYMVPLSQADVVKEGTDVTIVAWATQVHVALEAAQIAKEQLGVNVEVIDLQTILPW  287

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D++TV  SV+KTGRL+V+HEAPIT GFGAEI+AS+  RCF  LE+P+ RVCG DTPFP V
Sbjct  288   DEDTVVKSVEKTGRLIVTHEAPITSGFGAEIAASVQRRCFLHLESPIERVCGFDTPFPHV  347

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             +EPFY+PTK +++DAIK ++NY
Sbjct  348   YEPFYLPTKWRLIDAIKKSMNY  369



>emb|CCI41764.1| unnamed protein product [Albugo candida]
Length=333

 Score =   449 bits (1155),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 261/321 (81%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+ +A+N AL IAL  DP S VFGEDV FGGVFRCT GL   FG  RVFN PLCEQGIV
Sbjct  13    MNMVTAINDALRIALSADPTSIVFGEDVAFGGVFRCTMGLKHEFGSDRVFNFPLCEQGIV  72

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG AA+ + AIAEIQFADYIFPAFDQIV+EAAK+RYRSG +F+CG LT+RAPYGAVG
Sbjct  73    GFAIGYAAVGHTAIAEIQFADYIFPAFDQIVSEAAKYRYRSGGEFSCGKLTVRAPYGAVG  132

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR P++AKGLLL+SIRD NPV+F EPK  YR  V E
Sbjct  133   HGGHYHSQSPEAYFSHTPGLKVVMPRDPIKAKGLLLASIRDDNPVIFLEPKAFYRATVAE  192

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP GDY+ PL  AE++R G+D+T+VGWGAQ+ ++++AC  A K GISCELIDL+T+LPWD
Sbjct  193   VPLGDYIEPLERAEIVRRGNDVTIVGWGAQVKLLEKACDMANKIGISCELIDLQTILPWD  252

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
               T+E SV+KTGRL+VSHEAP T GF AEI+A+I ERCF  LEAP+ R+CG D PFPL+F
Sbjct  253   ARTIEQSVRKTGRLVVSHEAPKTSGFAAEIAATIQERCFLSLEAPIQRICGYDAPFPLIF  312

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   KI +AIK T+ +
Sbjct  313   EKHYLPDTLKIFEAIKKTMQF  333



>emb|CCI41763.1| unnamed protein product [Albugo candida]
Length=321

 Score =   448 bits (1153),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 261/321 (81%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+ +A+N AL IAL  DP S VFGEDV FGGVFRCT GL   FG  RVFN PLCEQGIV
Sbjct  1     MNMVTAINDALRIALSADPTSIVFGEDVAFGGVFRCTMGLKHEFGSDRVFNFPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG AA+ + AIAEIQFADYIFPAFDQIV+EAAK+RYRSG +F+CG LT+RAPYGAVG
Sbjct  61    GFAIGYAAVGHTAIAEIQFADYIFPAFDQIVSEAAKYRYRSGGEFSCGKLTVRAPYGAVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR P++AKGLLL+SIRD NPV+F EPK  YR  V E
Sbjct  121   HGGHYHSQSPEAYFSHTPGLKVVMPRDPIKAKGLLLASIRDDNPVIFLEPKAFYRATVAE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP GDY+ PL  AE++R G+D+T+VGWGAQ+ ++++AC  A K GISCELIDL+T+LPWD
Sbjct  181   VPLGDYIEPLERAEIVRRGNDVTIVGWGAQVKLLEKACDMANKIGISCELIDLQTILPWD  240

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
               T+E SV+KTGRL+VSHEAP T GF AEI+A+I ERCF  LEAP+ R+CG D PFPL+F
Sbjct  241   ARTIEQSVRKTGRLVVSHEAPKTSGFAAEIAATIQERCFLSLEAPIQRICGYDAPFPLIF  300

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   KI +AIK T+ +
Sbjct  301   EKHYLPDTLKIFEAIKKTMQF  321



>emb|CCI41765.1| unnamed protein product [Albugo candida]
Length=369

 Score =   450 bits (1157),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 261/321 (81%), Gaps = 0/321 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+ +A+N AL IAL  DP S VFGEDV FGGVFRCT GL   FG  RVFN PLCEQGIV
Sbjct  49    MNMVTAINDALRIALSADPTSIVFGEDVAFGGVFRCTMGLKHEFGSDRVFNFPLCEQGIV  108

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG AA+ + AIAEIQFADYIFPAFDQIV+EAAK+RYRSG +F+CG LT+RAPYGAVG
Sbjct  109   GFAIGYAAVGHTAIAEIQFADYIFPAFDQIVSEAAKYRYRSGGEFSCGKLTVRAPYGAVG  168

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR P++AKGLLL+SIRD NPV+F EPK  YR  V E
Sbjct  169   HGGHYHSQSPEAYFSHTPGLKVVMPRDPIKAKGLLLASIRDDNPVIFLEPKAFYRATVAE  228

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP GDY+ PL  AE++R G+D+T+VGWGAQ+ ++++AC  A K GISCELIDL+T+LPWD
Sbjct  229   VPLGDYIEPLERAEIVRRGNDVTIVGWGAQVKLLEKACDMANKIGISCELIDLQTILPWD  288

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
               T+E SV+KTGRL+VSHEAP T GF AEI+A+I ERCF  LEAP+ R+CG D PFPL+F
Sbjct  289   ARTIEQSVRKTGRLVVSHEAPKTSGFAAEIAATIQERCFLSLEAPIQRICGYDAPFPLIF  348

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   KI +AIK T+ +
Sbjct  349   EKHYLPDTLKIFEAIKKTMQF  369



>gb|KFM67493.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, partial 
[Stegodyphus mimosarum]
Length=378

 Score =   450 bits (1158),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 261/324 (81%), Gaps = 1/324 (0%)
 Frame = +1

Query  310   SSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQG  489
             + MNLF +V  AL  AL  DP + VFGEDV FGGVFRCT GL D++G+ R+FNTPLCEQG
Sbjct  55    ARMNLFQSVTNALDTALGVDPSAVVFGEDVAFGGVFRCTVGLQDKYGRDRIFNTPLCEQG  114

Query  490   IVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGA  669
             IVGF IGLA     AIAEIQFADYIFPAFDQ+ NEAAK RYRSGN+FNCGGLT+RAPYGA
Sbjct  115   IVGFGIGLAIAGATAIAEIQFADYIFPAFDQLTNEAAKLRYRSGNEFNCGGLTVRAPYGA  174

Query  670   VGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAV  849
             VGHG  YHSQSPE+FF H+PG+KVVIPR PL+AKGLLLS IRD NP +FFEPK LYR AV
Sbjct  175   VGHGALYHSQSPESFFAHIPGLKVVIPRGPLKAKGLLLSCIRDKNPCIFFEPKVLYRTAV  234

Query  850   EEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKEGISCELIDLKTLL  1026
             E+VP  DY LPLS+AE++ EG D+T++GWG Q+ V++E C +  +K  +SCELIDL T+ 
Sbjct  235   EQVPLKDYTLPLSQAEILIEGDDVTVIGWGTQVHVLREVCQLAQDKLNVSCELIDLVTVH  294

Query  1027  PWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFP  1206
             PWDKET+  SVKKTGRLLV+HEAP+TGGFGAEI+A+I   CF  LEAP+ RV G D PFP
Sbjct  295   PWDKETIINSVKKTGRLLVAHEAPLTGGFGAEIAATIQNECFLNLEAPIQRVTGYDAPFP  354

Query  1207  LVFEPFYMPTKNKILDAIKSTVNY  1278
              +FEPFY+P K + LDAIK  +N+
Sbjct  355   HIFEPFYIPNKWRCLDAIKKLINF  378



>ref|XP_010909038.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial-like 
isoform X7 [Elaeis guineensis]
Length=305

 Score =   447 bits (1150),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 274/358 (77%), Gaps = 59/358 (16%)
 Frame = +1

Query  217   MGGLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfged  396
             + GLG  I  GK R FSS+   EK  ++     +NLFSA+NQALHIAL+TD R+YVFGED
Sbjct  3     LRGLGRRISIGK-RCFSSASEVEKRPRDG--KQINLFSAINQALHIALETDSRAYVFGED  59

Query  397   vgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAF  576
             VGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM NRAIAEIQFADYI+PAF
Sbjct  60    VGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAMGNRAIAEIQFADYIYPAF  119

Query  577   DQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRS  756
             DQ                                                    VVIPRS
Sbjct  120   DQ----------------------------------------------------VVIPRS  127

Query  757   PLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGW  936
             P QAKGLLL+ IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+AEV+R+GSDITLVGW
Sbjct  128   PQQAKGLLLACIRDPNPVVFFEPKWLYRLAVEEVPERDYMLPLSQAEVIRQGSDITLVGW  187

Query  937   GAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFG  1116
             GAQLSV++ AC EA K+GISCELIDL+TL+PWDKETVEASV+KTGRLLVSHEAP+TGGFG
Sbjct  188   GAQLSVLERACDEAAKDGISCELIDLRTLIPWDKETVEASVRKTGRLLVSHEAPVTGGFG  247

Query  1117  AEISASIVERCFTR----LEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             AEISASI ERCF R    LEAPVAR+CGLDTPFPLV+EPFYMPTKNK+LDAIK+TVNY
Sbjct  248   AEISASIAERCFLRHGLQLEAPVARICGLDTPFPLVYEPFYMPTKNKVLDAIKATVNY  305



>gb|KDO30998.1| 2-oxoisovalerate dehydrogenase subunit beta [Saprolegnia parasitica 
CBS 223.65]
Length=344

 Score =   448 bits (1153),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 264/321 (82%), Gaps = 6/321 (2%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + VFGEDV FGGVFRCT  L ++FG+ RVFN+PLCEQGI 
Sbjct  30    MNMFTALNDAMRVAMETDPTAVVFGEDVAFGGVFRCTVDLKEKFGEDRVFNSPLCEQGIA  89

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A++   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQF+CG LT RAPYGAVG
Sbjct  90    GFAIGYASIGRTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFDCGKLTFRAPYGAVG  149

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG HYHSQSPEA+F H PG+KVVIPR+P QAKGLLL+SIRDPNPVVFFEPK LYR +V +
Sbjct  150   HGAHYHSQSPEAYFAHTPGLKVVIPRNPTQAKGLLLASIRDPNPVVFFEPKALYRASVSD  209

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP GD+ +PL +A++MR G+DIT+VGWGAQ+ V+++AC  AE+ G+SCELIDL+T+ PWD
Sbjct  210   VPVGDFTVPLGQADIMRSGTDITIVGWGAQMRVLEDACDMAEEAGVSCELIDLQTITPWD  269

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL+       TGGF +EI+++I ERCF  LEAP+ RVCG DTPFPL +
Sbjct  270   VDTIEQSVRKTGRLIK------TGGFASEIASTIQERCFLNLEAPIQRVCGYDTPFPLAY  323

Query  1216  EPFYMPTKNKILDAIKSTVNY  1278
             E  Y+P   K  +AIK  VNY
Sbjct  324   EKLYLPDALKNFEAIKHAVNY  344



>ref|XP_007014023.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 2, partial [Theobroma cacao]
 gb|EOY31642.1| Branched-chain alpha-keto acid decarboxylase E1 beta subunit, 
BETA1 isoform 2, partial [Theobroma cacao]
Length=243

 Score =   443 bits (1139),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = +1

Query  355   ALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRA  534
             AL+TDPR++VFGEDV FGGVFRCTTGLADRFGK RVFNTPLCEQGIVGF IGLAAM NRA
Sbjct  1     ALETDPRTFVFGEDVSFGGVFRCTTGLADRFGKSRVFNTPLCEQGIVGFGIGLAAMGNRA  60

Query  535   IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAF  714
             IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAF
Sbjct  61    IAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAF  120

Query  715   FCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEA  894
             FCHVPGIKVVIPRSP QAKGLLLS IRDPNPVVFFEPKWLYRLAVEEVPE DYMLPLS+A
Sbjct  121   FCHVPGIKVVIPRSPQQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEHDYMLPLSKA  180

Query  895   EVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGR  1074
             EV+REGSDITLVGWGAQLS+M++ACI+AEK+GISCELIDLKTL+PWDKETVEASV+KTGR
Sbjct  181   EVIREGSDITLVGWGAQLSIMEQACIDAEKDGISCELIDLKTLIPWDKETVEASVRKTGR  240

Query  1075  LL  1080
             LL
Sbjct  241   LL  242



>ref|XP_006270491.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Alligator mississippiensis]
Length=322

 Score =   446 bits (1147),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPVQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+T+V WG Q+ V++E A +  EK G+SCE+IDLKT+LPW
Sbjct  181   VPVEPYYIPLSQAEVLQEGSDVTMVAWGTQVHVIKEVATMAQEKLGVSCEIIDLKTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF AEIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFAAEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRQMINY  322



>gb|EXX65842.1| hypothetical protein RirG_129530 [Rhizophagus irregularis DAOM 
197198w]
Length=412

 Score =   449 bits (1156),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 271/349 (78%), Gaps = 2/349 (1%)
 Frame = +1

Query  238   IPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvf  417
             I   +     +S +   GV       MN+F A+N A+ IAL TD  + +FGEDV FGGVF
Sbjct  64    IKSTQEEALKNSELMNTGVANGETKKMNMFQAINDAMGIALTTDETAVIFGEDVAFGGVF  123

Query  418   RCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEA  597
             RCT GLA+ FG+ RVFNTPL EQGIVGF IG+AA+ + AIAEIQFADYIFPAFDQ+VNEA
Sbjct  124   RCTLGLAEMFGRDRVFNTPLSEQGIVGFGIGMAAVGHTAIAEIQFADYIFPAFDQLVNEA  183

Query  598   AKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGL  777
             AK+RYRSG  FN GGLT+R+P  AVGHGGHYHSQSPEA+F H PG+ VV+PRSP+QAKGL
Sbjct  184   AKYRYRSGGLFNVGGLTVRSPCSAVGHGGHYHSQSPEAYFTHTPGLIVVMPRSPIQAKGL  243

Query  778   LLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVM  957
             LL+SIRD NPV+F EPK LYR AVEEVP GDY LPL +AE+++ G D+T+VG+G+QL  +
Sbjct  244   LLASIRDRNPVIFLEPKILYRAAVEEVPVGDYELPLGKAEILKSGKDVTVVGYGSQLYTL  303

Query  958   QEACIEAEKE--GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISA  1131
             + A   AEK+  G+SCELIDL++L PWD +TV  SV KTGRL++SHEAP T GF AE++ 
Sbjct  304   ENAIKLAEKDIPGLSCELIDLRSLSPWDVDTVANSVNKTGRLVISHEAPQTSGFAAEVAT  363

Query  1132  SIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             SI+ERCF RLEAP+ RVCGLDTPFPL+FE FY+P   K  DAIK  VNY
Sbjct  364   SIMERCFLRLEAPIQRVCGLDTPFPLIFEKFYVPDMTKCYDAIKEVVNY  412



>ref|XP_006034474.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Alligator sinensis]
 ref|XP_006034475.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Alligator sinensis]
Length=322

 Score =   446 bits (1147),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPVQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+T+V WG Q+ V+++ A +  EK G+SCE+IDLKT+LPW
Sbjct  181   VPVESYYIPLSQAEVLQEGSDVTMVAWGTQVHVIKDVATMAQEKLGVSCEIIDLKTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF AEIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFAAEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRQMINY  322



>ref|XP_006132027.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Pelodiscus sinensis]
Length=341

 Score =   446 bits (1148),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  20    MNLFQSITSALDNALSRDPTAVIFGEDVAFGGVFRCTVGLQDKYGKDRVFNTPLCEQGIV  79

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  80    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  139

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  140   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKVLYRAAVEQ  199

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  +K G+SCE+IDLKT+LPW
Sbjct  200   VPVEPYYIPLSQAEVLQEGSDVTLVAWGTQVHVIREVATMAQDKLGVSCEVIDLKTILPW  259

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  260   DNETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  319

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  320   FEPFYIPDKWKCYDAVRKMINY  341



>ref|XP_004541711.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Maylandia zebra]
 ref|XP_005924371.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Haplochromis burtoni]
Length=386

 Score =   448 bits (1152),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 262/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  65    MNLFQSITSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  124

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN F+CG LTIRAP+G VG
Sbjct  125   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNMFDCGNLTIRAPWGCVG  184

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PG+KVVIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  185   HGSLYHSQSPEAFFAHCPGLKVVIPRSPIQAKGLLLSCIADKNPCIFFEPKILYRAAVEQ  244

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VPE  Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  245   VPEDPYTIPLSQAEVLQEGSDVTLVAWGTQIHVLKEVASMAQEKLGVSCEVIDLQTILPW  304

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  305   DIETVCKSVVKTGRLLISHEAPVTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  364

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  +AIK  +NY
Sbjct  365   FEPFYIPDKWKCFEAIKKMINY  386



>ref|XP_002154798.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Hydra vulgaris]
Length=360

 Score =   446 bits (1148),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 228/337 (68%), Positives = 264/337 (78%), Gaps = 1/337 (0%)
 Frame = +1

Query  271   SVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFG  450
             S V EK         MNLF AV  AL +AL+TD  + +FGEDV FGGVFRCT GLAD++G
Sbjct  24    SFVPEKIPIAGETKKMNLFQAVTNALDLALETDKTALIFGEDVKFGGVFRCTMGLADKYG  83

Query  451   KHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQF  630
               RVFNTPLCEQGIVGF IG+A   + AIAEIQFADYI+PAFDQIVNEAAKFRYRSGN F
Sbjct  84    TSRVFNTPLCEQGIVGFGIGVAVAGSTAIAEIQFADYIYPAFDQIVNEAAKFRYRSGNLF  143

Query  631   NCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPV  810
             NCG LTIRAP GAVGHG  YHSQ PEA F H PG+KVVIPRSP Q KGLLL+SIRDPNPV
Sbjct  144   NCGSLTIRAPCGAVGHGALYHSQMPEAHFSHTPGLKVVIPRSPSQTKGLLLASIRDPNPV  203

Query  811   VFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKE  987
             +F EPK LYR AVEEVP  DY LPLS+AEV+ EGSD+TLVGWG Q  V+++A  +  EK 
Sbjct  204   IFLEPKILYRQAVEEVPLKDYELPLSKAEVVVEGSDVTLVGWGTQFHVLRDAAQMAKEKH  263

Query  988   GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEA  1167
             GISCE+IDL+T+LPWD+ET+  SV KTGRL+++HEAPITGGFG EI+A+I E CF  LEA
Sbjct  264   GISCEVIDLRTILPWDEETIIKSVSKTGRLVIAHEAPITGGFGGEIAATIQENCFLSLEA  323

Query  1168  PVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             P+ RVCG DTPF  VFEPFY+P K +  +A+    ++
Sbjct  324   PIQRVCGHDTPFAHVFEPFYLPDKFRCFEAVMKVTSF  360



>ref|XP_005741369.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Pundamilia nyererei]
Length=386

 Score =   447 bits (1151),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 262/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  65    MNLFQSITSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  124

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN F+CG LTIRAP+G VG
Sbjct  125   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNMFDCGNLTIRAPWGCVG  184

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PG+KVVIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  185   HGSLYHSQSPEAFFAHCPGLKVVIPRSPIQAKGLLLSCIADKNPCIFFEPKILYRAAVEQ  244

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VPE  Y +PLS+AE+++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  245   VPEDPYTIPLSQAEILQEGSDVTLVAWGTQIHVLKEVASMAQEKLGVSCEVIDLQTILPW  304

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  305   DIETVCKSVVKTGRLLISHEAPVTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  364

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  +AIK  +NY
Sbjct  365   FEPFYIPDKWKCFEAIKKMINY  386



>ref|XP_004357690.1| 3-methyl-2-oxobutanoate dehydrogenase [Dictyostelium fasciculatum]
 gb|EGG19419.1| 3-methyl-2-oxobutanoate dehydrogenase [Dictyostelium fasciculatum]
Length=381

 Score =   447 bits (1150),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 233/375 (62%), Positives = 283/375 (75%), Gaps = 14/375 (4%)
 Frame = +1

Query  196   MAGSLRRMGGLGFVIPRGKWRGFSSSVVEEKG------------VQESGKSS-MNLFSAV  336
             +  SL R    G +      RGF +S V   G            +  +G++  MNLF A+
Sbjct  7     LTQSLLRYTSNGAITKNASSRGFHTSKVLLAGGPSTPINYPSLEIPNAGETQKMNLFQAI  66

Query  337   NQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLA  516
             N A+ I+L TD ++ VFGEDVGFGGVFRC+  L +++G  RVFNTPLCEQGI GFAIGLA
Sbjct  67    NNAMDISLRTDEKACVFGEDVGFGGVFRCSVDLRNKYGAKRVFNTPLCEQGIAGFAIGLA  126

Query  517   AMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHS  696
             A    AIAEIQFADYIFPAFDQIVNEAAK+RYRSG QF+CG LT R+PYGAVGHGGHYHS
Sbjct  127   AQGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGGQFDCGSLTFRSPYGAVGHGGHYHS  186

Query  697   QSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYM  876
             QSPE++F   PG+KVV+P +P++AKGLLL+SIRD NPVVFFEPK LYR AVE+VP GDY 
Sbjct  187   QSPESYFAQTPGLKVVMPATPIEAKGLLLASIRDKNPVVFFEPKLLYRSAVEDVPIGDYE  246

Query  877   LPLSEAEVMREGSDITLVGWGAQLSV-MQEACIEAEKEGISCELIDLKTLLPWDKETVEA  1053
             + L  A +++EGSD+TLVGWGAQ+ V MQ A +  EK G+S ELIDL+T+LPWD E VE 
Sbjct  247   IELGRARIVQEGSDLTLVGWGAQMKVLMQAAQMAKEKLGLSIELIDLRTILPWDVECVEK  306

Query  1054  SVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMP  1233
             SVKKTGRL++SHEAP TGG+ AEIS++I ERCF  LE+P+ RVCG DTPFPL+FE FY+P
Sbjct  307   SVKKTGRLIISHEAPKTGGWAAEISSAIQERCFLHLESPIQRVCGYDTPFPLIFEKFYLP  366

Query  1234  TKNKILDAIKSTVNY  1278
                K  +AIK ++NY
Sbjct  367   DHLKNFEAIKKSINY  381



>ref|XP_007903241.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Callorhinchus milii]
Length=382

 Score =   447 bits (1150),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF ++   L   L  DP + VFGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  54    QYGPTQKMNLFQSITSGLDNVLAKDPSAVVFGEDVAFGGVFRCTVGLRDKYGKERVFNTP  113

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+R+RSGN F CGGLTIR
Sbjct  114   LCEQGIVGFGIGVAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRFRSGNLFECGGLTIR  173

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H+PGIKVVIPRSP+QAKGLLLS I D NP +FFEPK L
Sbjct  174   APWGCVGHGSLYHSQSPEAFFSHIPGIKVVIPRSPVQAKGLLLSCIEDKNPCIFFEPKIL  233

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ VM+E A +  EK G+SCE+ID
Sbjct  234   YRAAVEQVPVEAYHIPLSQAEVLQEGSDVTLVAWGTQVHVMREVATMAQEKLGVSCEVID  293

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             LKT+LPWD ETV  SV KTGRLL+SHEAP+TGGF AEIS+++ E CF  LEAP+ RVCG 
Sbjct  294   LKTILPWDIETVCKSVVKTGRLLISHEAPVTGGFSAEISSTVQEECFLNLEAPINRVCGY  353

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP VFEPFY+P K K  DAI+  +NY
Sbjct  354   DTPFPHVFEPFYIPDKWKCFDAIRKMINY  382



>ref|XP_647496.1| 3-methyl-2-oxobutanoate dehydrogenase [Dictyostelium discoideum 
AX4]
 sp|Q55FN7.1|ODBB_DICDI RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; 
AltName: Full=3-methyl-2-oxobutanoate dehydrogenase; 
AltName: Full=Branched-chain alpha-keto acid dehydrogenase 
E1 component beta chain; Short=BCKDE1B; Short=BCKDH E1-beta; 
Flags: Precursor [Dictyostelium discoideum]
 gb|EAL73463.1| 3-methyl-2-oxobutanoate dehydrogenase [Dictyostelium discoideum 
AX4]
Length=370

 Score =   446 bits (1148),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 266/325 (82%), Gaps = 1/325 (0%)
 Frame = +1

Query  307   KSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQ  486
             K  MNLF A+N  + IA+  D ++ VFGEDVGFGGVFRCT GL D++G  RVFNTPLCEQ
Sbjct  46    KQKMNLFQAINNGMDIAMQKDSKAVVFGEDVGFGGVFRCTVGLRDKYGASRVFNTPLCEQ  105

Query  487   GIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYG  666
             GI GFAIGLAA     IAEIQFADYIFPAFDQIVNEAAK+RYRSG QF+CG LTIR+PYG
Sbjct  106   GIAGFAIGLAAQGATPIAEIQFADYIFPAFDQIVNEAAKYRYRSGGQFDCGSLTIRSPYG  165

Query  667   AVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLA  846
             AVGHGGHYHSQSPE++F H PG+KVVIP +P++AKGLLL+SIR+ +PV+FFEPK +YR A
Sbjct  166   AVGHGGHYHSQSPESYFGHTPGLKVVIPSTPIEAKGLLLASIREKDPVIFFEPKLMYRSA  225

Query  847   VEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKEGISCELIDLKTL  1023
             VEEVP GDY +PL +A +++EG DIT++GWGAQ+ V+ +A  +  EK GISCELIDL+T+
Sbjct  226   VEEVPIGDYEIPLGKARIVKEGKDITIIGWGAQMRVLLQAVNMAEEKLGISCELIDLRTI  285

Query  1024  LPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPF  1203
              PWD ETV  SVKKTGR+++SHEAP TGG+ AEISA+I ERCF  LEAP+ RVCG DTPF
Sbjct  286   QPWDVETVVESVKKTGRVVISHEAPKTGGWAAEISATIQERCFLHLEAPIQRVCGYDTPF  345

Query  1204  PLVFEPFYMPTKNKILDAIKSTVNY  1278
             PL+FE FY+P   K  ++IK T+ Y
Sbjct  346   PLIFEKFYVPDHLKNFESIKKTMVY  370



>ref|XP_010706000.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Meleagris gallopavo]
Length=322

 Score =   445 bits (1144),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV+R+GSD+TLV WG Q+ V++E  + A EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLRQGSDVTLVAWGTQVHVIKEVAVMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ET+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETICKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_003292570.1| 3-methyl-2-oxobutanoate dehydrogenase [Dictyostelium purpureum]
 gb|EGC30897.1| 3-methyl-2-oxobutanoate dehydrogenase [Dictyostelium purpureum]
Length=357

 Score =   446 bits (1147),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 267/325 (82%), Gaps = 1/325 (0%)
 Frame = +1

Query  307   KSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQ  486
             K  MNLF A+N A+ IAL  DP++ +FGEDVGFGGVFRCT GL +++G +RVFNTPLCEQ
Sbjct  33    KQKMNLFQALNNAMDIALQKDPKAVIFGEDVGFGGVFRCTVGLREKYGANRVFNTPLCEQ  92

Query  487   GIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYG  666
             GI GF IGLAA     IAEIQFADYIFPAFDQIVNEAAK+RYRSG QF+CG LTIR+PYG
Sbjct  93    GIAGFGIGLAAQGATPIAEIQFADYIFPAFDQIVNEAAKYRYRSGGQFDCGSLTIRSPYG  152

Query  667   AVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLA  846
             AVGHGGHYHSQSPE++F   PG+KVVIP +P++AKGLLL+SIR+ +PV+FFEPK +YR A
Sbjct  153   AVGHGGHYHSQSPESYFGQTPGLKVVIPSTPIEAKGLLLASIREKDPVIFFEPKLMYRSA  212

Query  847   VEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSV-MQEACIEAEKEGISCELIDLKTL  1023
             VEEVP GDY +PL +A +++EG DITL+GWGAQ+ V +Q A +  EK GIS ELIDL+T+
Sbjct  213   VEEVPVGDYEIPLGKARIVKEGKDITLIGWGAQMRVLLQAANMAEEKLGISVELIDLRTI  272

Query  1024  LPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPF  1203
              PWD ETV  SVKKTGR+++SHEAP TGG+ AEISA+I ERCF  LEAP+ RVCG DTPF
Sbjct  273   QPWDVETVINSVKKTGRVVISHEAPKTGGWAAEISATIQERCFLHLEAPIQRVCGYDTPF  332

Query  1204  PLVFEPFYMPTKNKILDAIKSTVNY  1278
             PL+FE FY+P   K  ++IK T++Y
Sbjct  333   PLIFEKFYLPDHLKNFESIKKTIHY  357



>ref|XP_006794901.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Neolamprologus brichardi]
Length=386

 Score =   447 bits (1149),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 262/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  65    MNLFQSITSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  124

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN F+CG LTIRAP+G VG
Sbjct  125   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNMFDCGNLTIRAPWGCVG  184

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PG+K+VIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  185   HGSLYHSQSPEAFFAHCPGLKIVIPRSPIQAKGLLLSCIADKNPCIFFEPKILYRAAVEQ  244

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VPE  Y +PLS+AE+++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  245   VPEDPYTIPLSQAEILQEGSDVTLVAWGTQIHVLKEVASMAQEKLGVSCEVIDLQTILPW  304

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  305   DIETVCKSVVKTGRLLISHEAPVTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  364

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  +AIK  +NY
Sbjct  365   FEPFYIPDKWKCFEAIKKMINY  386



>ref|XP_005518218.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Pseudopodoces humilis]
Length=322

 Score =   444 bits (1143),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVASMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ARVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIARVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_007090204.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Panthera tigris altaica]
 ref|XP_007090205.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Panthera tigris altaica]
Length=322

 Score =   444 bits (1142),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ VM+E A +  EK G+SCE+IDLKT+LPW
Sbjct  181   VPVEPYHIPLSQAEVIQEGSDVTLVAWGTQVHVMREVASMAQEKLGVSCEVIDLKTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DMDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005421213.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Geospiza fortis]
Length=322

 Score =   444 bits (1142),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ARVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIARVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRRMINY  322



>ref|XP_002936254.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Xenopus (Silurana) tropicalis]
Length=375

 Score =   446 bits (1147),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 262/329 (80%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF ++N AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  47    QYGTTQKMNLFQSINSALDNTLSRDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  106

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     +IAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  107   LCEQGIVGFGIGVAVAGATSIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  166

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PGIKVVIPRSP+QAKGLLLS I D NP +FFEPK L
Sbjct  167   APWGCVGHGALYHSQSPEAFFAHAPGIKVVIPRSPIQAKGLLLSCIEDKNPCIFFEPKIL  226

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EG+DITL+ WG Q+ V++E  + A EK G+SCE+ID
Sbjct  227   YRAAVEQVPVEPYYIPLSQAEVIQEGTDITLLSWGTQVHVIREVAVMAQEKLGLSCEVID  286

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD ETV  SV KTGRLL+SHEAP+TGGF +EISA++ E CF  LEAP+ARVCG 
Sbjct  287   LRTILPWDVETVCKSVSKTGRLLISHEAPVTGGFASEISATVQEECFLNLEAPIARVCGY  346

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  347   DTPFPHIFEPFYIPDKWKCYDALRKMINY  375



>ref|XP_008493582.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Calypte anna]
 gb|KFP02048.1| hypothetical protein N300_01113 [Calypte anna]
Length=322

 Score =   444 bits (1141),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A   + AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGSTAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAALAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005506787.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Columba livia]
Length=322

 Score =   444 bits (1141),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYTIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVASMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ RVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPITRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA+++ +NY
Sbjct  301   FEPFYIPDKWKCYDALRNMINY  322



>ref|XP_003986385.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Felis catus]
 ref|XP_006931926.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Felis catus]
Length=392

 Score =   446 bits (1148),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/330 (68%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ VM+E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYHIPLSQAEVIQEGSDVTLVAWGTQVHVMREVASMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DLKT+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLKTILPWDMDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_010001384.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Chaetura pelagica]
 gb|KFU84497.1| hypothetical protein M959_03747 [Chaetura pelagica]
Length=322

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A   + AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGSTAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAALAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005025308.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X3 [Anas platyrhynchos]
Length=322

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV+++GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQQGSDVTMVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>gb|EMC90171.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, partial 
[Columba livia]
Length=327

 Score =   444 bits (1141),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  6     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  65

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  66    GFGIGIAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  125

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  126   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  185

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  186   VPVEPYTIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVASMAQEKLGVSCEVIDLRTILPW  245

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ RVCG DTPFP +
Sbjct  246   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPITRVCGYDTPFPHI  305

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA+++ +NY
Sbjct  306   FEPFYIPDKWKCYDALRNMINY  327



>ref|XP_008638434.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Corvus brachyrhynchos]
 ref|XP_010403245.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Corvus cornix cornix]
 gb|KFO64082.1| hypothetical protein N302_15545 [Corvus brachyrhynchos]
Length=322

 Score =   443 bits (1140),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVATMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_007059940.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Chelonia mydas]
 ref|XP_007059941.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Chelonia mydas]
Length=322

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNTLSRDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDLKT+LPW
Sbjct  181   VPVEPYYIPLSQAEVLQEGSDVTLVAWGTQVHVIREVATMAQEKLGVSCEVIDLKTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D E V  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTEAVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_009905725.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Picoides pubescens]
Length=322

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP+QAKGLLLS I D NP +FFEPK LYR AVEE
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPVQAKGLLLSCIEDKNPCIFFEPKILYRAAVEE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVASMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV+KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVEKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_009885764.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Charadrius vociferus]
 gb|KGL95304.1| hypothetical protein N301_04180 [Charadrius vociferus]
Length=322

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_009563064.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Cuculus canorus]
 gb|KFO79037.1| hypothetical protein N303_02327 [Cuculus canorus]
Length=322

 Score =   443 bits (1139),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA+++ +NY
Sbjct  301   FEPFYIPDKWKCYDALRNMINY  322



>ref|XP_010298415.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Balearica regulorum gibbericeps]
 gb|KFO09728.1| hypothetical protein N312_11878 [Balearica regulorum gibbericeps]
Length=322

 Score =   442 bits (1138),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_009473900.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Nipponia nippon]
 gb|KFM09833.1| hypothetical protein AS27_06455 [Aptenodytes forsteri]
Length=322

 Score =   442 bits (1138),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_009933918.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Opisthocomus hoazin]
 gb|KFR11504.1| hypothetical protein N306_02164 [Opisthocomus hoazin]
Length=322

 Score =   442 bits (1138),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRRMINY  322



>ref|XP_009644370.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Egretta garzetta]
 gb|KFP21907.1| hypothetical protein Z169_16070 [Egretta garzetta]
Length=322

 Score =   442 bits (1137),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005153208.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Melopsittacus undulatus]
Length=322

 Score =   442 bits (1137),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGTLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVDPYYIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ET+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETICKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DAI   +NY
Sbjct  301   FEPFYIPDKWKCYDAILKMINY  322



>ref|XP_005684511.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Capra hircus]
Length=322

 Score =   442 bits (1137),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV+REGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVIREGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_003453523.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Oreochromis niloticus]
Length=386

 Score =   444 bits (1143),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 261/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF ++  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  58    QYGPTQKMNLFQSITSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  117

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN F+CG LTIR
Sbjct  118   LCEQGIVGFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNLFDCGNLTIR  177

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PG+K+VIPR P+QAKGLLLS I D NP +FFEPK L
Sbjct  178   APWGCVGHGALYHSQSPEAFFAHCPGLKIVIPRGPIQAKGLLLSCIADKNPCIFFEPKIL  237

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VPE  Y +PLS+AE+++EGSD+TLV WG Q+ V++E A +  EK G+SCE+ID
Sbjct  238   YRAAVEQVPEEPYTIPLSQAEILQEGSDVTLVSWGTQIHVLKEVASMAQEKLGVSCEVID  297

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD ETV  SV KTGRLL+SHEAP+TGGF AEIS+++ E CF  LEAP++RVCG 
Sbjct  298   LQTILPWDIETVCKSVVKTGRLLISHEAPVTGGFAAEISSTVQEECFLNLEAPISRVCGY  357

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY P K K  +AIK  +NY
Sbjct  358   DTPFPHIFEPFYTPDKWKCFEAIKKMINY  386



>ref|XP_006626367.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Lepisosteus oculatus]
Length=393

 Score =   445 bits (1144),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 258/329 (78%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MN F ++  AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  65    QHGQTQKMNFFQSITSALDNTLANDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  124

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYI+PAFDQIVNEAAK+RYRSGN F+CG LTIR
Sbjct  125   LCEQGIVGFGIGIAVTGATAIAEIQFADYIYPAFDQIVNEAAKYRYRSGNLFDCGSLTIR  184

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PG+K+VIPRSP+QAKGLLLS I D NP +FFEPK L
Sbjct  185   APWGCVGHGSLYHSQSPEAFFAHCPGLKIVIPRSPVQAKGLLLSCIADNNPCIFFEPKIL  244

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y  PLS+AEV+REGSD+TLV WG Q+ VM+E A +  EK G+SCE+ID
Sbjct  245   YRAAVEQVPVEPYQTPLSQAEVLREGSDVTLVAWGTQVHVMKEVANMAQEKLGVSCEVID  304

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ RVCG 
Sbjct  305   LQTILPWDTETVCKSVAKTGRLLISHEAPVTGGFASEISSTVQEECFLNLEAPITRVCGY  364

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA+K  +NY
Sbjct  365   DTPFPHIFEPFYIPDKWKCFDAVKKMINY  393



>ref|XP_009092396.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Serinus canaria]
Length=322

 Score =   442 bits (1136),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNTLAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPIEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ARVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIARVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRRMINY  322



>ref|XP_009331403.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Pygoscelis adeliae]
 gb|KFW73551.1| hypothetical protein AS28_12094 [Pygoscelis adeliae]
Length=322

 Score =   442 bits (1136),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TL+ WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLIAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_004893083.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X1 [Heterocephalus glaber]
 ref|XP_004893084.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X2 [Heterocephalus glaber]
 ref|XP_004860353.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X1 [Heterocephalus glaber]
 ref|XP_004860354.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X2 [Heterocephalus glaber]
 gb|EHB08381.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Heterocephalus 
glaber]
Length=392

 Score =   444 bits (1142),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 224/334 (67%), Positives = 267/334 (80%), Gaps = 2/334 (1%)
 Frame = +1

Query  283   EKGVQESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHR  459
             ++  QE G++  MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK R
Sbjct  59    DRESQEHGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDR  118

Query  460   VFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  639
             VFNTPLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG
Sbjct  119   VFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCG  178

Query  640   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFF  819
              LTIR+P+G VGHGG YHSQ PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FF
Sbjct  179   SLTIRSPWGCVGHGGLYHSQCPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFF  238

Query  820   EPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGIS  996
             EPK LYR AVE+VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E  + A EK G+S
Sbjct  239   EPKILYRAAVEQVPVEPYTIPLSQAEVIQEGSDITLVAWGTQVHVIREVALMAREKLGVS  298

Query  997   CELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVA  1176
             CE+IDL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++
Sbjct  299   CEIIDLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIS  358

Query  1177  RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  359   RVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_005485991.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Zonotrichia albicollis]
Length=322

 Score =   441 bits (1135),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ G+D+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYKIPLSQAEVLQTGNDVTMVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ARVCG DTPFP +
Sbjct  241   DTDTVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIARVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRRMINY  322



>ref|XP_005984222.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Pantholops hodgsonii]
 ref|XP_005984223.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Pantholops hodgsonii]
Length=322

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV+REG+D+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVIREGTDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_009666589.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Struthio camelus australis]
 gb|KFV77927.1| hypothetical protein N308_11538 [Struthio camelus australis]
Length=322

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPVQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVATMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005229316.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Falco peregrinus]
Length=322

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNTLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_007668914.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Ornithorhynchus anatinus]
Length=322

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +V+ AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSVSSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   + +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDLKT+LPW
Sbjct  181   VPIDPFYIPLSQAEVLQEGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLKTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVETVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FE FY+P K K  DA++  +NY
Sbjct  301   FETFYIPDKWKCYDALRKMINY  322



>ref|XP_005324821.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Ictidomys tridecemlineatus]
Length=322

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IGLA     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGLAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDLKT++PW
Sbjct  181   VPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLKTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_007257328.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Astyanax mexicanus]
Length=386

 Score =   443 bits (1140),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  65    MNLFQSITSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  124

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN ++CG LTIRAP+G VG
Sbjct  125   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNLYDCGNLTIRAPWGCVG  184

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEA+F H PG+KVV+PR P+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  185   HGSLYHSQSPEAYFAHCPGLKVVVPRGPVQAKGLLLSCIADENPCIFFEPKILYRAAVEQ  244

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y LPLS+AEV++EGSD+TLV WG Q+ VM+E A +  EK G+SCE+IDL+T+LPW
Sbjct  245   VPTEPYHLPLSQAEVVQEGSDVTLVAWGTQVHVMREVATMAQEKLGVSCEVIDLQTILPW  304

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF AEIS+SI E+CF  LEAP+ARVCG DTPFP +
Sbjct  305   DIETVCKSVVKTGRLLISHEAPVTGGFAAEISSSIQEQCFLNLEAPIARVCGYDTPFPHI  364

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  +A+K  +NY
Sbjct  365   FEPFYIPDKWKCFEAVKRMINY  386



>ref|XP_010742898.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Larimichthys crocea]
Length=392

 Score =   443 bits (1140),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 261/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF +V  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  64    QYGPTQKMNLFQSVTSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  123

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYI+PAFDQIVNEAAK+RYRSGN F+CG LTIR
Sbjct  124   LCEQGIVGFGIGVAVAGATAIAEIQFADYIYPAFDQIVNEAAKYRYRSGNMFDCGNLTIR  183

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PGIKVVIPR P+QAKGLLLS I D NP +FFEPK L
Sbjct  184   APWGCVGHGSLYHSQSPEAFFAHCPGIKVVIPRGPVQAKGLLLSCIADKNPCIFFEPKIL  243

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AE+++EGSD+TLV WG Q+ VM+E A +  EK G+SCELID
Sbjct  244   YRAAVEQVPVEAYTIPLSQAEILQEGSDVTLVAWGTQIHVMREVADMAQEKLGVSCELID  303

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD ETV  SV KTGRLL+SHEAP+TGGF AEIS+++ E CF  LEAP++RVCG 
Sbjct  304   LQTILPWDVETVCKSVVKTGRLLISHEAPVTGGFAAEISSAVQEECFLNLEAPISRVCGY  363

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  +AI+  +NY
Sbjct  364   DTPFPHIFEPFYIPDKWKCFEAIRRMINY  392



>gb|ERG84621.1| 2-oxoisovalerate dehydrogenase subunit [Ascaris suum]
Length=365

 Score =   442 bits (1137),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 259/324 (80%), Gaps = 1/324 (0%)
 Frame = +1

Query  310   SSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQG  489
             S MNL  AVN A+ IAL +DP + +FGEDV FGGVFRC+ GL +++GK RVFNTPLCEQG
Sbjct  42    SKMNLCQAVNNAMDIALKSDPSTCLFGEDVAFGGVFRCSVGLQEKYGKDRVFNTPLCEQG  101

Query  490   IVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGA  669
             I GF IGLA     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG  F+CG LTIRA +GA
Sbjct  102   IAGFGIGLAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGGLFDCGKLTIRATWGA  161

Query  670   VGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAV  849
             VGHG  YHSQSPE +F H PG+K+VIPR P+QAKGLLLS IRD +P +FFEPK LYR AV
Sbjct  162   VGHGALYHSQSPEGYFAHTPGLKIVIPRGPIQAKGLLLSCIRDEDPCLFFEPKLLYRTAV  221

Query  850   EEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKEGISCELIDLKTLL  1026
             EEVP GDY L LS+AEV+REG D+T+VGWG QL ++ EA  I  E+ G +CE+IDLKT+L
Sbjct  222   EEVPVGDYQLELSKAEVVREGKDLTMVGWGTQLHILMEAAQIAKERFGANCEVIDLKTIL  281

Query  1027  PWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFP  1206
             PWD +TV  SV KTGRLL+SHEAP+T GF AEI A+I ERCF  LEAP+ RVCG DTPFP
Sbjct  282   PWDADTVAESVTKTGRLLISHEAPVTCGFAAEIGATIQERCFLNLEAPITRVCGWDTPFP  341

Query  1207  LVFEPFYMPTKNKILDAIKSTVNY  1278
              V+EPFY+PTK +++DAI    N+
Sbjct  342   HVYEPFYLPTKWRVVDAINKLSNF  365



>ref|XP_009957173.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Leptosomus discolor]
 gb|KFQ15954.1| hypothetical protein N330_11678 [Leptosomus discolor]
Length=322

 Score =   441 bits (1133),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVAGMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>gb|EFB14598.1| hypothetical protein PANDA_004408 [Ailuropoda melanoleuca]
Length=388

 Score =   443 bits (1139),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  59    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  118

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  119   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  178

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  179   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  238

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  239   LYRAAVEQVPVEPYNVPLSQAEVIQEGSDITLVAWGTQVHVIREVAAMAQEKLGVSCEVI  298

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  299   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  358

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  359   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  388



>ref|NP_989988.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Gallus gallus]
 dbj|BAB32666.1| branched-chain alpha-keto acid dehydrogenase E1-beta subunit 
[Gallus gallus]
Length=392

 Score =   443 bits (1140),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  71    MNLFQSITSALDNALAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  130

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  131   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRAPWGCVG  190

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  191   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  250

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV+R+GSD+TLV WG Q+ V++E  + A EK G+SCE+IDL+T+LPW
Sbjct  251   VPVEPYNIPLSQAEVLRQGSDVTLVAWGTQVHVIKEVAVMAQEKLGVSCEVIDLRTILPW  310

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ET+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  311   DTETICKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  370

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  371   FEPFYIPDKWKCYDALRKMINY  392



>ref|XP_008061528.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Tarsius syrichta]
Length=322

 Score =   440 bits (1132),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVIQEGSDITLVAWGTQVHVVREVASMAKEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_006182159.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Camelus ferus]
 ref|XP_010995852.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Camelus dromedarius]
Length=322

 Score =   440 bits (1132),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVVKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_002916344.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Ailuropoda melanoleuca]
Length=395

 Score =   443 bits (1139),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  66    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  125

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  126   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  185

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  186   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  245

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  246   LYRAAVEQVPVEPYNVPLSQAEVIQEGSDITLVAWGTQVHVIREVAAMAQEKLGVSCEVI  305

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  306   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  365

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  366   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  395



>ref|XP_004610175.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Sorex araneus]
Length=322

 Score =   440 bits (1132),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 261/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLARDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I+D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIQDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEIIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ARVCG DTPFP +
Sbjct  241   DVETVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIARVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_007620163.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Cricetulus griseus]
 gb|ERE76261.1| 2-oxoisovalerate dehydrogenase subunit beta [Cricetulus griseus]
Length=322

 Score =   440 bits (1131),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEIIDLRTIVPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DMDTVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005870015.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, 
partial [Myotis brandtii]
Length=339

 Score =   441 bits (1133),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  10    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  69

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYI+PAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  70    PLCEQGIVGFGIGIAVTGATAIAEIQFADYIYPAFDQIVNEAAKYRYRSGDLFNCGSLTI  129

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  130   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  189

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  190   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  249

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  250   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  309

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  310   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  339



>ref|XP_005299662.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Chrysemys picta bellii]
Length=381

 Score =   442 bits (1137),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  60    MNLFQSITSALDNTLSRDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  119

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  120   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  179

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  180   HGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  239

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDLKT+LPW
Sbjct  240   VPVEPYYIPLSQAEVLQEGSDVTLVAWGTQVHVIREVATMAQEKLGVSCEVIDLKTILPW  299

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D E V  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  300   DTEAVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  359

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  360   FEPFYIPDKWKCYDALRKMINY  381



>gb|AAI58862.1| Branched chain keto acid dehydrogenase E1, beta polypeptide [Rattus 
norvegicus]
Length=390

 Score =   442 bits (1137),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 231/374 (62%), Positives = 277/374 (74%), Gaps = 14/374 (4%)
 Frame = +1

Query  199   AGSLRRMGGL-------GFVIPRGKWRGFSSSVV------EEKGVQESGKSSMNLFSAVN  339
             AG+ RR  GL       GF+ P G        V       + + +Q      MNLF ++ 
Sbjct  17    AGAERRRRGLRCAALVQGFLQPAGDDASQKRRVAHFTFQPDPESLQYGQTQKMNLFQSIT  76

Query  340   QALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAA  519
              AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIVGF IG+A 
Sbjct  77    SALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAV  136

Query  520   MDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ  699
                 AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VGHG  YHSQ
Sbjct  137   TGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQ  196

Query  700   SPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYML  879
             SPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+VP   Y +
Sbjct  197   SPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKI  256

Query  880   PLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEAS  1056
             PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PWD +TV  S
Sbjct  257   PLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKS  316

Query  1057  VKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPT  1236
             V KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +FEPFY+P 
Sbjct  317   VIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPD  376

Query  1237  KNKILDAIKSTVNY  1278
             K K  DA++  +NY
Sbjct  377   KWKCYDALRKMINY  390



>ref|XP_009910804.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Haliaeetus albicilla]
 ref|XP_010564053.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Haliaeetus leucocephalus]
 gb|KFP99153.1| hypothetical protein N329_04320 [Haliaeetus albicilla]
Length=322

 Score =   440 bits (1131),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNTLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ F+CG LTIRAP+G VG
Sbjct  61    GFGIGVAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFDCGNLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPVEPYNIPLSQAEVLQTGSDVTLVAWGTQVHVIKEVAAMAQEKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DTETVCKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_005596859.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Equus caballus]
 ref|XP_005596860.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Equus caballus]
 ref|XP_005596861.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X3 [Equus caballus]
 ref|XP_008514518.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Equus przewalskii]
 ref|XP_008514519.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Equus przewalskii]
 ref|XP_008514520.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Equus przewalskii]
 ref|XP_008514521.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Equus przewalskii]
Length=392

 Score =   442 bits (1137),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 278/374 (74%), Gaps = 17/374 (5%)
 Frame = +1

Query  202   GSLRRMGGLGFVIPRG------------KWRGFSSSVVEE--KGVQESGKSSMNLFSAVN  339
             G  RR+ G G  +PRG            +WR  +    +   + ++      MNLF AV 
Sbjct  21    GHWRRLRGAG--LPRGFLQPASAGEDAAQWRRVAHFTFQPDPEPLEYGQTQKMNLFQAVT  78

Query  340   QALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAA  519
              AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIVGF IG+A 
Sbjct  79    SALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAV  138

Query  520   MDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ  699
                 AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VGHG  YHSQ
Sbjct  139   TGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGAVYHSQ  198

Query  700   SPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYML  879
             SPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+VP   Y +
Sbjct  199   SPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYNI  258

Query  880   PLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEAS  1056
             PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PWD +TV  S
Sbjct  259   PLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIIPWDVDTVCKS  318

Query  1057  VKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPT  1236
             V KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP VFEPFY+P 
Sbjct  319   VIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHVFEPFYIPD  378

Query  1237  KNKILDAIKSTVNY  1278
             K K  DA++  +NY
Sbjct  379   KWKCYDALRKMINY  392



>ref|XP_003796781.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Otolemur garnettii]
Length=322

 Score =   439 bits (1130),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYTIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_006510848.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Mus musculus]
 sp|Q6P3A8.2|ODBB_MOUSE RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; 
AltName: Full=Branched-chain alpha-keto acid dehydrogenase 
E1 component beta chain; Short=BCKDE1B; Short=BCKDH 
E1-beta; Flags: Precursor [Mus musculus]
 pir||S39807 3-methyl-2-oxobutanoate dehydrogenase (lipoamide) (EC 1.2.4.4) 
- mouse
 gb|EDL26477.1| branched chain ketoacid dehydrogenase E1, beta polypeptide [Mus 
musculus]
Length=390

 Score =   442 bits (1136),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 231/374 (62%), Positives = 278/374 (74%), Gaps = 14/374 (4%)
 Frame = +1

Query  199   AGSLRRMGGL-------GFVIPRGKWRGFSSSVV------EEKGVQESGKSSMNLFSAVN  339
             AG+ RR  GL       GF+ P G+       V       + + +Q      MNLF ++ 
Sbjct  17    AGAERRRCGLRCAALVQGFLQPGGEDTAQKRRVAHFTFHPDPESLQYGQTQKMNLFQSIT  76

Query  340   QALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAA  519
              AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIVGF IG+A 
Sbjct  77    SALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAV  136

Query  520   MDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQ  699
                 AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VGHG  YHSQ
Sbjct  137   TGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQ  196

Query  700   SPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYML  879
             SPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+VP   Y +
Sbjct  197   SPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKI  256

Query  880   PLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEAS  1056
             PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PWD +TV  S
Sbjct  257   PLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPWDVDTVCKS  316

Query  1057  VKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPT  1236
             V KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +FEPFY+P 
Sbjct  317   VIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPD  376

Query  1237  KNKILDAIKSTVNY  1278
             K K  DA++  +NY
Sbjct  377   KWKCYDALRKMINY  390



>ref|XP_532213.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X3 [Canis lupus familiaris]
 ref|XP_005627622.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Canis lupus familiaris]
Length=387

 Score =   442 bits (1136),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  58    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  117

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  118   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  177

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  178   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDRNPCIFFEPKI  237

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  238   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  297

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  298   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  357

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  358   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  387



>ref|XP_005044151.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, 
partial [Ficedula albicollis]
Length=358

 Score =   441 bits (1133),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 263/329 (80%), Gaps = 2/329 (1%)
 Frame = +1

Query  298   ESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             E G++  MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  30    EYGQTQKMNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  89

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  90    LCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIR  149

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PGIKVVIPRSPLQAKGLLLS I D NP +FFEPK L
Sbjct  150   APWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPLQAKGLLLSCIEDKNPCIFFEPKIL  209

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++ GSD+T+V WG Q+ V++E A +  EK G+SCE+ID
Sbjct  210   YRAAVEQVPVEPYNIPLSQAEVLQTGSDVTMVAWGTQVHVIKEVAAMAQEKLGVSCEVID  269

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD ETV  SV KTGRL++SHEAP+TGGF +EIS+++ E CF  LEAP+ RVCG 
Sbjct  270   LRTILPWDTETVCKSVAKTGRLMISHEAPLTGGFASEISSTVQEECFLNLEAPITRVCGY  329

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  330   DTPFPHIFEPFYIPDKWKCYDALRRMINY  358



>emb|CDJ83464.1| Transketolase domain containing protein [Haemonchus contortus]
Length=369

 Score =   441 bits (1134),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 267/340 (79%), Gaps = 1/340 (0%)
 Frame = +1

Query  262   FSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLAD  441
             F S V  E          MN+  AVN ALHIA++TD  + VFGEDV FGGVFRC+ GL D
Sbjct  30    FPSGVKPEIASVGGPTEKMNVCQAVNSALHIAMETDKTAVVFGEDVAFGGVFRCSVGLKD  89

Query  442   RFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSG  621
             ++G+ RVFNTPLCEQGIVGF IG+A   + AIAE+QF+DYIFPA+DQ+VNEAAK+RYRSG
Sbjct  90    KYGEDRVFNTPLCEQGIVGFGIGVAVGGSTAIAEVQFSDYIFPAYDQLVNEAAKYRYRSG  149

Query  622   NQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDP  801
               FNCG LT+R+ YGAVGHGG YHSQSPEA F H PG+KVV+PR P+QAKGLLLS IRDP
Sbjct  150   GMFNCGALTVRSTYGAVGHGGLYHSQSPEAHFTHTPGLKVVVPRGPVQAKGLLLSCIRDP  209

Query  802   NPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAE  981
             NP +FFEPK LYRLA E+ P GDY +PLS+AE++ EGSD+T+V WG Q+ V  EA   A+
Sbjct  210   NPCIFFEPKVLYRLAAEDTPTGDYTIPLSQAEIVLEGSDMTVVAWGTQVHVALEAAQLAK  269

Query  982   KE-GISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTR  1158
              + G+S E+IDL T+LPWD++TV  SV+KTGRL+V+HEAP+T GFGAEI A+I  RCF  
Sbjct  270   DQLGLSVEVIDLATILPWDEDTVVKSVEKTGRLIVTHEAPVTSGFGAEIVATIQRRCFLH  329

Query  1159  LEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             LE+P+ RVCG DTPFP V+EPFY+PTK +I DAIK ++ Y
Sbjct  330   LESPIERVCGFDTPFPHVYEPFYLPTKWRIFDAIKKSIKY  369



>ref|NP_954665.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Mus 
musculus]
 gb|AAH64099.1| Branched chain ketoacid dehydrogenase E1, beta polypeptide [Mus 
musculus]
Length=322

 Score =   439 bits (1129),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIVPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_008901566.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica INRA-310]
 gb|ETI52614.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica P1569]
 gb|ETK92494.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica]
 gb|ETL45903.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica]
 gb|ETL99064.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica]
 gb|ETM52218.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica]
 gb|ETN13555.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica INRA-310]
 gb|ETO76880.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica P1976]
 gb|ETP22476.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica CJ01A1]
 gb|ETP50358.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, variant 
1 [Phytophthora parasitica P10297]
Length=356

 Score =   440 bits (1132),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 256/301 (85%), Gaps = 0/301 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MN+F+A+N A+ +A++TDP + +FGEDV FGGVFRC+  L ++FG  RVFN+PLCEQGI 
Sbjct  49    MNMFTAINDAMRVAMETDPSAVLFGEDVAFGGVFRCSVDLREKFGDDRVFNSPLCEQGIA  108

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GFAIG A+    AIAEIQFADYIFPAFDQIVNEAAKFRYRSGN+F+CG LT RAPYGAVG
Sbjct  109   GFAIGYASTGRTAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNEFDCGKLTFRAPYGAVG  168

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PR+P+ AKGLLL+SIRDPNPV+F EPK LYR +V E
Sbjct  169   HGGHYHSQSPEAYFAHTPGLKVVVPRNPVTAKGLLLASIRDPNPVLFLEPKALYRASVAE  228

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWD  1035
             VP G+Y+  LSEAE++R G+D+T+VGWGAQ+ V++EAC  AE  GISCELIDL+T+ PWD
Sbjct  229   VPVGEYVQNLSEAEIVRRGTDVTVVGWGAQMRVLEEACGYAEDVGISCELIDLQTIFPWD  288

Query  1036  KETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVF  1215
              +T+E SV+KTGRL++SHEAP +GGF AEIS+SI ERCF  LEAP+ RVCG DTPFPL +
Sbjct  289   ADTIEHSVRKTGRLVISHEAPKSGGFAAEISSSIQERCFLSLEAPIQRVCGYDTPFPLAY  348

Query  1216  E  1218
             E
Sbjct  349   E  349



>ref|XP_004752872.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Mustela putorius furo]
 ref|XP_004788950.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Mustela putorius furo]
Length=392

 Score =   442 bits (1136),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_007440380.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X1 [Python bivittatus]
 ref|XP_007440381.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X2 [Python bivittatus]
Length=371

 Score =   441 bits (1133),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 217/329 (66%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D+FGK RVFNTP
Sbjct  43    QYGQTQKMNLFQSITSALDNALSRDPTAVIFGEDVSFGGVFRCTVGLRDKFGKDRVFNTP  102

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYI+PAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  103   LCEQGIVGFGIGIAVTGATAIAEIQFADYIYPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  162

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PG+KVV+PR P++AKGLLLS I D NP +FFEPK +
Sbjct  163   APWGCVGHGALYHSQSPEAFFAHCPGLKVVVPRGPIEAKGLLLSCIEDKNPCIFFEPKIM  222

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV+++GSD+TLV WG Q+ V++E  + A EK G+SCE+ID
Sbjct  223   YRAAVEQVPVDPYCIPLSQAEVLQDGSDVTLVAWGTQVHVIKEVAVMAQEKLGVSCEIID  282

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             LKT+LPWD ETV  SV KTGRLL++HEAP+TGGF +EIS+++ E CF  LEAP+ RVCG 
Sbjct  283   LKTILPWDVETVCKSVAKTGRLLITHEAPVTGGFASEISSTVQEECFLNLEAPITRVCGY  342

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  343   DTPFPHIFEPFYIPDKWKCYDAVRKMINY  371



>ref|NP_001108310.1| branched chain keto acid dehydrogenase E1, beta polypeptide [Xenopus 
laevis]
 gb|AAI58211.1| LOC100137712 protein [Xenopus laevis]
Length=375

 Score =   441 bits (1133),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 262/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +++ AL   L  DP + +FGEDV FGGVFRCT GL D++G  RVFNTPLCEQG+V
Sbjct  54    MNLFQSIHSALDNTLARDPTAVIFGEDVAFGGVFRCTVGLRDKYGNDRVFNTPLCEQGVV  113

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A   + +IAEIQFADYIFPAFDQIVNEAAK+RYRSG+ F+CG LTIRAP+G VG
Sbjct  114   GFGIGVAVAGSTSIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFDCGSLTIRAPWGCVG  173

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF HVPGIKVVIPRSP+QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  174   HGALYHSQSPEAFFAHVPGIKVVIPRSPIQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  233

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EG+D+TL+ WG Q+ V++E  + A EK G+SCE+IDL+T+LPW
Sbjct  234   VPVEPYYIPLSQAEVLQEGTDVTLISWGTQVHVIREVALMAQEKLGLSCEVIDLRTILPW  293

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EISA++ E CF  LEAP+ARVCG DTPFP +
Sbjct  294   DVETVCKSVTKTGRLLISHEAPVTGGFASEISATVQEECFLNLEAPIARVCGYDTPFPHI  353

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  354   FEPFYIPDKWKCYDALRKMINY  375



>dbj|BAG65195.1| unnamed protein product [Homo sapiens]
Length=322

 Score =   438 bits (1127),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR A EE
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +T+  SV KTGRLL+SHEAP+TGGF +EIS++++E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVLEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_003404146.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Loxodonta africana]
Length=393

 Score =   441 bits (1134),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  64    QEYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  123

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  124   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  183

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  184   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  243

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  244   LYRAAVEQVPVESYYIPLSQAEVIQEGSDITLVAWGTQVHVIREVASMAQEKLGVSCEVI  303

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  304   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  363

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  364   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  393



>sp|P21839.2|ODBB_BOVIN RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; 
AltName: Full=Branched-chain alpha-keto acid dehydrogenase 
E1 component beta chain; Short=BCKDE1B; Short=BCKDH 
E1-beta; Flags: Precursor [Bos taurus]
Length=392

 Score =   441 bits (1134),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>gb|AAI18381.1| Branched chain keto acid dehydrogenase E1, beta polypeptide [Bos 
taurus]
Length=392

 Score =   441 bits (1133),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|NP_062140.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Rattus norvegicus]
 sp|P35738.3|ODBB_RAT RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; 
AltName: Full=Branched-chain alpha-keto acid dehydrogenase 
E1 component beta chain; Short=BCKDE1B; Short=BCKDH 
E1-beta; Flags: Precursor [Rattus norvegicus]
 gb|EDL77651.1| branched chain keto acid dehydrogenase E1, beta polypeptide [Rattus 
norvegicus]
Length=390

 Score =   441 bits (1133),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 264/334 (79%), Gaps = 1/334 (0%)
 Frame = +1

Query  280   EEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHR  459
             + + +Q      MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK R
Sbjct  57    DPESLQYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDR  116

Query  460   VFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  639
             VFNTPLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG
Sbjct  117   VFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCG  176

Query  640   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFF  819
              LTIRAP+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FF
Sbjct  177   SLTIRAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFF  236

Query  820   EPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGIS  996
             EPK LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+S
Sbjct  237   EPKILYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVS  296

Query  997   CELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVA  1176
             CE+IDL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++
Sbjct  297   CEVIDLRTIVPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIS  356

Query  1177  RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  357   RVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY  390



>ref|XP_008322008.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Cynoglossus semilaevis]
Length=392

 Score =   441 bits (1133),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 258/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +V  AL   L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  71    MNLFQSVTSALDNTLANDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  130

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ F+CG LTIRAP+G VG
Sbjct  131   GFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFDCGNLTIRAPWGCVG  190

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PG+KVVIPR P+QAKGLLLS I D NP +FFEPK +YR AVE+
Sbjct  191   HGSLYHSQSPEAFFAHAPGLKVVIPRGPVQAKGLLLSCIADKNPCIFFEPKIMYRAAVEQ  250

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCELIDL+T+LPW
Sbjct  251   VPVESYTIPLSQAEVLQEGSDVTLVAWGTQVHVLREVANLAQEKLGVSCELIDLQTILPW  310

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D ETV  SV KTGRLL+SHEAP+TGGF +EIS+S+ E CF  LEAP+ RVCG DTPFP +
Sbjct  311   DVETVCKSVVKTGRLLISHEAPVTGGFASEISSSVQEECFLNLEAPITRVCGYDTPFPHI  370

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  +AIK  +NY
Sbjct  371   FEPFYIPDKWKCFEAIKKMINY  392



>ref|XP_003474801.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Cavia porcellus]
Length=392

 Score =   441 bits (1133),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             Q+ G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    QDHGQTQKMNLFQAITSALDNSLARDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQ PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RAPWGCVGHGALYHSQCPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYSIPLSQAEVLQEGSDITLVAWGTQVHVIREVASMAREKLGVSCEII  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>gb|KFM25320.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Auxenochlorella 
protothecoides]
Length=360

 Score =   439 bits (1130),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/355 (64%), Positives = 271/355 (76%), Gaps = 4/355 (1%)
 Frame = +1

Query  205   SLRRMGGLGFVIPRGKWRGFSSSVVE-EKGVQESGKSSMNLFSAVNQALHIALDTDPRSY  381
             ++ R  GLG V   G  RG +++V + E          MNL SAVN ALHIA+D +P++ 
Sbjct  3     AILRAPGLGAVW--GTVRGLATAVRQAEPATAGLDAKQMNLCSAVNDALHIAMDENPKTL  60

Query  382   vfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADY  561
             VFGEDV FGGVFRCT GLA++ GKHRVFNTPLCEQGIVGF IG AA     I EIQFADY
Sbjct  61    VFGEDVSFGGVFRCTVGLAEKHGKHRVFNTPLCEQGIVGFGIGAAAQGYSPIVEIQFADY  120

Query  562   IFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKV  741
             IFPAFDQI NEAAK+R+RSG +F+ GGLTIR PYGAVGHGGHYHSQSPEAFF H+PGIKV
Sbjct  121   IFPAFDQITNEAAKYRFRSGGEFDVGGLTIRTPYGAVGHGGHYHSQSPEAFFTHIPGIKV  180

Query  742   VIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDI  921
             V+P  P + KGLLLS+IRDPNPVV FE K LYR AVE+VP GDY +PL  A + R GSD+
Sbjct  181   VMPSGPRETKGLLLSAIRDPNPVVVFEAKMLYRTAVEDVPTGDYSIPLGRARIARAGSDV  240

Query  922   TLVGWGAQLSVMQEACIE-AEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAP  1098
             TLVGWG Q+ V+++A  E A  +GI  E+IDL+TLLPWD + V ASV+KTGRL+VSHEAP
Sbjct  241   TLVGWGQQVLVLEQAAKELAASDGIEAEVIDLRTLLPWDADAVAASVEKTGRLVVSHEAP  300

Query  1099  ITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIK  1263
             +T GFGAEI A+I +RCF  LEAP  R+ G DTPFPLV EP Y+P   +++D ++
Sbjct  301   LTSGFGAEIVAAISDRCFYSLEAPPLRIAGYDTPFPLVCEPLYLPGVQRVVDGVR  355



>ref|XP_010852891.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Bison bison bison]
Length=392

 Score =   440 bits (1132),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAREKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_008683087.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X6 [Ursus maritimus]
Length=392

 Score =   440 bits (1132),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    REYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNVPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_006143409.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Tupaia chinensis]
Length=322

 Score =   437 bits (1125),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T+LPW
Sbjct  181   VPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAREKLGVSCEVIDLRTILPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_003500031.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Cricetulus griseus]
 ref|XP_007638908.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Cricetulus griseus]
 ref|XP_007638909.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Cricetulus griseus]
Length=390

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 229/373 (61%), Positives = 277/373 (74%), Gaps = 12/373 (3%)
 Frame = +1

Query  181   WC*EIMAGSLRRMGGLGFVIPRGKWRGFSSSVV------EEKGVQESGKSSMNLFSAVNQ  342
             WC    AG ++     GF+ P G+       V       + + +Q      MNLF ++  
Sbjct  23    WCGPRCAGLVQ-----GFLQPGGEDAAQKRRVAHFTFQPDPESLQYGQTQKMNLFQSITS  77

Query  343   ALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAM  522
             AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIVGF IG+A  
Sbjct  78    ALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVT  137

Query  523   DNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQS  702
                AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VGHG  YHSQS
Sbjct  138   GATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQS  197

Query  703   PEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLP  882
             PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+VP   Y +P
Sbjct  198   PEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIP  257

Query  883   LSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEASV  1059
             LS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PWD +TV  SV
Sbjct  258   LSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEIIDLRTIVPWDMDTVCKSV  317

Query  1060  KKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTK  1239
              KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +FEPFY+P K
Sbjct  318   VKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDK  377

Query  1240  NKILDAIKSTVNY  1278
              K  DA++  +NY
Sbjct  378   WKCYDALRKMINY  390



>ref|WP_013345865.1| 2-oxoisovalerate dehydrogenase subunit beta [Ferrimonas balearica]
 ref|YP_003913633.1| transketolase central region [Ferrimonas balearica DSM 9799]
 gb|ADN76559.1| Transketolase central region [Ferrimonas balearica DSM 9799]
Length=325

 Score =   437 bits (1125),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 259/324 (80%), Gaps = 1/324 (0%)
 Frame = +1

Query  310   SSMNLFSAVNQALHIALDTDPRSY-vfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQ  486
             + MNL  A+N AL IA+  D R      +   FGGVFR T  L D+FGK R FNTPL EQ
Sbjct  2     AQMNLLQAINNALDIAMAADERVLCFGEDVGHFGGVFRATAKLQDKFGKARCFNTPLTEQ  61

Query  487   GIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYG  666
             GI+GFA GLAA  +R +AEIQFADYIFPAFDQIVNE+AKFRYRSGN+FN GGLTIR PYG
Sbjct  62    GIIGFANGLAAQGHRPVAEIQFADYIFPAFDQIVNESAKFRYRSGNEFNVGGLTIRTPYG  121

Query  667   AVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLA  846
                 GGHYHSQSPEA+F   PG+KVV+PR+P QAKGLLL+SIRD NPVVFFEPK LYR +
Sbjct  122   GGIAGGHYHSQSPEAYFTQTPGLKVVVPRNPHQAKGLLLASIRDDNPVVFFEPKRLYRAS  181

Query  847   VEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLL  1026
             V EVPE DY LPLSEAEV++ G+DITL+GWGAQ+ +++ A   AE  GISCE+IDL+TLL
Sbjct  182   VGEVPEEDYQLPLSEAEVVKPGTDITLLGWGAQMELIENAAKRAEAMGISCEIIDLRTLL  241

Query  1027  PWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFP  1206
             PWD +TV ASV+KTGRLL+SHEAP+TGGF  EI+A+I ERCF  LE+P+ARVCGLDTP+P
Sbjct  242   PWDVDTVAASVEKTGRLLISHEAPLTGGFAGEIAAAIQERCFLYLESPIARVCGLDTPYP  301

Query  1207  LVFEPFYMPTKNKILDAIKSTVNY  1278
             L+ E  +M  ++KI +AIK++VN+
Sbjct  302   LMLEKEHMANEHKIFEAIKASVNF  325



>ref|XP_005377734.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
isoform X1 [Chinchilla lanigera]
Length=322

 Score =   437 bits (1125),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQ PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQCPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYNIPLSQAEVIQEGSDITLVAWGTQVHVIREVASMAREKLGVSCEVIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_010629419.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Fukomys damarensis]
Length=392

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 266/334 (80%), Gaps = 2/334 (1%)
 Frame = +1

Query  283   EKGVQESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHR  459
             ++  QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK R
Sbjct  59    DRESQEHGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDR  118

Query  460   VFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCG  639
             VFNTPLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG
Sbjct  119   VFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCG  178

Query  640   GLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFF  819
              LTIR+P+G VGHG  YHSQ PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FF
Sbjct  179   NLTIRSPWGCVGHGALYHSQCPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFF  238

Query  820   EPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGIS  996
             EPK LYR AVE+VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+S
Sbjct  239   EPKILYRAAVEQVPVEPYNIPLSQAEVIQEGSDITLVAWGTQVHVIREVASMAREKLGVS  298

Query  997   CELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVA  1176
             CE+IDL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++
Sbjct  299   CEIIDLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIS  358

Query  1177  RVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  359   RVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_010971148.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Camelus bactrianus]
Length=392

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +1

Query  298   ESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             E G++  MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  64    EYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  123

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  124   LCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  183

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             +P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK L
Sbjct  184   SPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKIL  243

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+ID
Sbjct  244   YRAAVEQVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVID  303

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG 
Sbjct  304   LRTILPWDVDTVCKSVVKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGY  363

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  364   DTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_008805371.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial 
isoform X3 [Phoenix dactylifera]
Length=316

 Score =   437 bits (1124),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 264/330 (80%), Gaps = 40/330 (12%)
 Frame = +1

Query  223   GLGFVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPR---------  375
             GLG  I  GK R FSS    EK   +     +NLFSA+NQALHIAL+TDPR         
Sbjct  5     GLGRGISIGK-RCFSSFSEVEKPPMDG--KPINLFSAINQALHIALETDPRYGLCNLGVE  61

Query  376   --------SYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNR  531
                     +YVFGEDVGFGGVFRCTTGLADRFG++RVFNTPLCEQGI GFAIGLAAM   
Sbjct  62    YLWNFCPCAYVFGEDVGFGGVFRCTTGLADRFGRNRVFNTPLCEQGIAGFAIGLAAM---  118

Query  532   AIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEA  711
                              IVNEAAKFRYRSGNQFNCGGLTIR+PYGAVGHGGHYHSQSPEA
Sbjct  119   -----------------IVNEAAKFRYRSGNQFNCGGLTIRSPYGAVGHGGHYHSQSPEA  161

Query  712   FFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSE  891
             FFCHVPG+KVVIPRSP QAKGLLL+ IRD NPVVFFEPKWLYRLAVEEVPE DYMLPLS+
Sbjct  162   FFCHVPGLKVVIPRSPRQAKGLLLACIRDSNPVVFFEPKWLYRLAVEEVPEHDYMLPLSQ  221

Query  892   AEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTG  1071
             AEV+R+GSDITLVGWGAQLSV++ AC +  K+GISCELIDL+TL+PWDKETVEASV+KTG
Sbjct  222   AEVIRQGSDITLVGWGAQLSVLEHACDDVAKDGISCELIDLRTLIPWDKETVEASVRKTG  281

Query  1072  RLLVSHEAPITGGFGAEISASIVERCFTRL  1161
             RLLVSHEAP+TGGFGAEISASI ERCF R+
Sbjct  282   RLLVSHEAPVTGGFGAEISASIAERCFLRV  311



>ref|XP_003965942.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Takifugu rubripes]
Length=392

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF +V  AL   L +DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  64    QYGPTQKMNLFQSVTSALDNTLASDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  123

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN F+CG LTIR
Sbjct  124   LCEQGIVGFGIGVAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNLFDCGKLTIR  183

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PGIKVVIPR P+QAKGLLLS I D NP +FFEPK L
Sbjct  184   APWGCVGHGSLYHSQSPEAFFAHCPGIKVVIPRGPVQAKGLLLSCIADMNPCIFFEPKIL  243

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+A+V++EGSD+TLV WG Q+ VM+E A +  EK G+SCE+ID
Sbjct  244   YRAAVEQVPVEAYTIPLSQADVLQEGSDVTLVAWGTQVHVMREVASMAQEKLGVSCEVID  303

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ RVCG 
Sbjct  304   LQTILPWDIDTVCKSVAKTGRLLISHEAPVTGGFASEISSTVQEECFLNLEAPIRRVCGY  363

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  +AIK  +NY
Sbjct  364   DTPFPHIFEPFYIPDKWKCFEAIKRMINY  392



>gb|EPQ10020.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Myotis 
brandtii]
Length=387

 Score =   440 bits (1131),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 219/335 (65%), Positives = 264/335 (79%), Gaps = 1/335 (0%)
 Frame = +1

Query  277   VEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKH  456
             V ++ +       MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK 
Sbjct  53    VGDEALAAGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKD  112

Query  457   RVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNC  636
             RVFNTPLCEQGIVGF IG+A     AIAEIQFADYI+PAFDQIVNEAAK+RYRSG+ FNC
Sbjct  113   RVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIYPAFDQIVNEAAKYRYRSGDLFNC  172

Query  637   GGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVF  816
             G LTIR+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +F
Sbjct  173   GSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIF  232

Query  817   FEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGI  993
             FEPK LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+
Sbjct  233   FEPKILYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGV  292

Query  994   SCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPV  1173
             SCE+IDL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+
Sbjct  293   SCEVIDLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPI  352

Query  1174  ARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             +RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  353   SRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY  387



>ref|XP_006053485.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoisovalerate dehydrogenase 
subunit beta, mitochondrial [Bubalus bubalis]
Length=392

 Score =   440 bits (1132),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVATMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_002746806.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Callithrix jacchus]
 ref|XP_008992947.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Callithrix jacchus]
Length=322

 Score =   437 bits (1124),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EG D+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYNIPLSQAEVIQEGRDVTLVAWGTQVHVIREVASMAKEKLGVSCEIIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS++I E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTIQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_006090418.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Myotis lucifugus]
Length=392

 Score =   440 bits (1131),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    QEYGQTQKMNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYI+PAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIYPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_004386115.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Trichechus manatus latirostris]
Length=395

 Score =   440 bits (1131),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  66    QEYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  125

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  126   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  185

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  186   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  245

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AV++VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  246   LYRAAVQQVPVEPYYIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  305

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  306   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  365

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  366   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  395



>ref|XP_010629420.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Fukomys damarensis]
Length=322

 Score =   437 bits (1124),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGNLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQ PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQCPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSDITLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYNIPLSQAEVIQEGSDITLVAWGTQVHVIREVASMAREKLGVSCEIIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_006715605.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Homo sapiens]
 dbj|BAH14916.1| unnamed protein product [Homo sapiens]
Length=322

 Score =   437 bits (1124),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR A EE
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_004450630.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform 1 [Dasypus novemcinctus]
 ref|XP_004450631.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform 2 [Dasypus novemcinctus]
Length=395

 Score =   440 bits (1131),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  74    MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  133

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  134   GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  193

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  194   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  253

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  254   VPVEPYYIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEIIDLRTIIPW  313

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  314   DVDTVCKSVTKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  373

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  374   FEPFYIPDKWKCYDALRKMINY  395



>ref|XP_006214405.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Vicugna pacos]
Length=392

 Score =   439 bits (1130),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +1

Query  298   ESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             E G++  MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  64    EYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  123

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  124   LCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  183

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             +P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK L
Sbjct  184   SPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKIL  243

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+ID
Sbjct  244   YRAAVEQVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVID  303

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG 
Sbjct  304   LRTILPWDVDTVCKSVVKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGY  363

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  364   DTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_005073744.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Mesocricetus auratus]
Length=390

 Score =   439 bits (1130),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 229/373 (61%), Positives = 277/373 (74%), Gaps = 12/373 (3%)
 Frame = +1

Query  181   WC*EIMAGSLRRMGGLGFVIPRGKWRGFSSSVV------EEKGVQESGKSSMNLFSAVNQ  342
             WC    AG ++     GF+ P G+       V       + + +Q      MNLF ++  
Sbjct  23    WCGPRCAGLVQ-----GFLPPGGEGAAQKRRVAHFTFQPDPESLQYGQTQKMNLFQSITS  77

Query  343   ALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAM  522
             AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIVGF IG+A  
Sbjct  78    ALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVT  137

Query  523   DNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQS  702
                AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VGHG  YHSQS
Sbjct  138   GATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVGHGALYHSQS  197

Query  703   PEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLP  882
             PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+VP   Y +P
Sbjct  198   PEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIP  257

Query  883   LSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEASV  1059
             LS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PWD +TV  SV
Sbjct  258   LSQAEVIQEGSDVTLVAWGTQVHVIREVASMAREKLGVSCEIIDLRTIVPWDVDTVCKSV  317

Query  1060  KKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTK  1239
              KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +FEPFY+P K
Sbjct  318   VKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDK  377

Query  1240  NKILDAIKSTVNY  1278
              K  DA++  +NY
Sbjct  378   WKCYDALRKMINY  390



>ref|XP_004673701.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Condylura cristata]
 ref|XP_004673702.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Condylura cristata]
Length=392

 Score =   439 bits (1130),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             QE G++  MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    QEYGQTQKMNLFQAVTSALDNSLARDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AE+++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYKIPLSQAEIIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_007536748.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Erinaceus europaeus]
Length=392

 Score =   439 bits (1130),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
              E G++  MNLF AV  AL  +L  DP + VFGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    HEYGQTQKMNLFQAVTSALDNSLARDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_006985424.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Peromyscus maniculatus bairdii]
Length=390

 Score =   439 bits (1130),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             Q+ G++  MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  61    QQYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  120

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  121   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  180

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  181   RAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  240

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  241   LYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEII  300

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+ PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  301   DLRTIAPWDMDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  360

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  361   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  390



>ref|XP_002714592.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Oryctolagus cuniculus]
Length=392

 Score =   439 bits (1130),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 220/331 (66%), Positives = 265/331 (80%), Gaps = 2/331 (1%)
 Frame = +1

Query  292   VQESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFN  468
              +E G++  MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFN
Sbjct  62    TREYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFN  121

Query  469   TPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLT  648
             TPLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LT
Sbjct  122   TPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLT  181

Query  649   IRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPK  828
             IR+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK
Sbjct  182   IRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPK  241

Query  829   WLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCEL  1005
              LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+
Sbjct  242   ILYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAQEKLGVSCEI  301

Query  1006  IDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVC  1185
             IDL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVC
Sbjct  302   IDLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVC  361

Query  1186  GLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             G DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  362   GYDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_009203844.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Papio anubis]
Length=322

 Score =   436 bits (1122),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR A E+
Sbjct  121   HGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_004628328.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Octodon degus]
Length=322

 Score =   436 bits (1122),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF A+  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  1     MNLFQAITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIRAP+G VG
Sbjct  61    GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRAPWGCVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQ PEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  121   HGALYHSQCPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  181   VPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAREKLGVSCEVIDLRTIVPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  241   DVDTVCKSVIKTGRLLLSHEAPLTGGFASEISSTVQEECFLHLEAPISRVCGYDTPFPHI  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  301   FEPFYIPDKWKCYDALRKMINY  322



>ref|XP_007949459.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Orycteropus afer afer]
Length=395

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/355 (64%), Positives = 273/355 (77%), Gaps = 4/355 (1%)
 Frame = +1

Query  220   GGLGFVIPRGKWRGFSSSVVEEKGVQESGKSS-MNLFSAVNQALHIALDTDPRSYvfged  396
              G G  + R K   F+     E   QE G++  MNLF ++  AL  +L  DP + +FGED
Sbjct  43    AGCGEAVQRRKVSHFTFQPDPE--CQEYGQTQKMNLFQSITSALDNSLAKDPTAVIFGED  100

Query  397   vgfggvfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAF  576
             V FGGVFRCT GL D++GK RVFNTPLCEQGIVGF IG+A     AIAEIQFADYIFPAF
Sbjct  101   VAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAF  160

Query  577   DQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRS  756
             DQIVNEAAK+RYRSG+ FNCG LTIR+P+G VGHG  YHSQSPEAFF H PGIKVV+PRS
Sbjct  161   DQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRS  220

Query  757   PLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGW  936
             P QAKGLLLS I D NP +FFEPK LYR AVE+VP   Y +PLS+AEV++EGSD+TLV W
Sbjct  221   PFQAKGLLLSCIEDKNPCIFFEPKVLYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAW  280

Query  937   GAQLSVMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGF  1113
             G Q+ V++E A +  EK G+SCE+IDL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF
Sbjct  281   GTQVHVIREVASMAREKLGVSCEVIDLRTIIPWDVDTVCKSVSKTGRLLISHEAPLTGGF  340

Query  1114  GAEISASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              +EIS+++ E CF  LEAP++RVCG DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  341   ASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY  395



>ref|NP_776932.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Bos taurus]
 gb|AAA30407.1| branched-chain alpha-ketoacid dehydrogenase [Bos taurus]
Length=392

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 261/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEA-CIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E   +  EK G+SCE+I
Sbjct  243   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVDAMAQEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>emb|CDP93992.1| Protein Bm3652, isoform a [Brugia malayi]
Length=366

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/324 (67%), Positives = 262/324 (81%), Gaps = 1/324 (0%)
 Frame = +1

Query  310   SSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQG  489
             S MNL  A+N A+ IA+ +D  + +FGEDV FGGVFRCT GL +++GK RVFNTP+CEQG
Sbjct  41    SKMNLCQAINNAIDIAMGSDSSTCLFGEDVAFGGVFRCTVGLQEKYGKDRVFNTPICEQG  100

Query  490   IVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGA  669
             I GF IGLA   + AIAEIQFADYIFPAFDQIVNEAAK+RYRSGN FNCG LTIRA +GA
Sbjct  101   IAGFGIGLAVCGSTAIAEIQFADYIFPAFDQIVNEAAKYRYRSGNLFNCGKLTIRATWGA  160

Query  670   VGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAV  849
             VGHGG YHSQSPEA+F H PG+KVV+PR P+QAKGLLLS IR+ NP +FFEPK LYR AV
Sbjct  161   VGHGGLYHSQSPEAYFTHTPGLKVVVPRGPIQAKGLLLSCIRNENPCIFFEPKLLYRAAV  220

Query  850   EEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKE-GISCELIDLKTLL  1026
             E+VP GDY   L +AEV++EG DIT+V WG QL V  +A   AE+E G+SCE+IDL+T+L
Sbjct  221   EDVPIGDYETELEQAEVVKEGKDITVVSWGTQLHVALDAAKVAEEEIGVSCEVIDLRTIL  280

Query  1027  PWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFP  1206
             PWD +TV  SVKKTG L+++HEAPIT GF AEIS  + ERCF  LEAP++RVCG DTPFP
Sbjct  281   PWDIDTVAKSVKKTGHLIITHEAPITSGFAAEISTKVQERCFFHLEAPISRVCGWDTPFP  340

Query  1207  LVFEPFYMPTKNKILDAIKSTVNY  1278
              +FEPFY+PTK +I++AIK  +++
Sbjct  341   HIFEPFYLPTKWRIIEAIKKLIDF  364



>ref|XP_007456686.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Lipotes vexillifer]
Length=392

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +1

Query  298   ESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             E G++  MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  64    EYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  123

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  124   LCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  183

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             +P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK L
Sbjct  184   SPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKIL  243

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+ID
Sbjct  244   YRAAVEQVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAHEKLGVSCEVID  303

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T++PWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG 
Sbjct  304   LRTIIPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGY  363

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  364   DTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_006873338.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Chrysochloris asiatica]
Length=395

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 266/330 (81%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  66    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  125

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  126   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  185

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I+D NP +FFEPK 
Sbjct  186   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIQDKNPCIFFEPKI  245

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  246   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEII  305

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  306   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  365

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  366   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  395



>ref|XP_007168024.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Balaenoptera acutorostrata scammoni]
Length=392

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 264/329 (80%), Gaps = 2/329 (1%)
 Frame = +1

Query  298   ESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             E G++  M+LF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  64    EYGQTQKMDLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  123

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  124   LCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  183

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             +P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK L
Sbjct  184   SPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKIL  243

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+ID
Sbjct  244   YRAAVEQVPTEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVID  303

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             L+T++PWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG 
Sbjct  304   LRTIIPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGY  363

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  364   DTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>pdb|1DTW|B Chain B, Human Branched-Chain Alpha-Keto Acid Dehydrogenase
 pdb|1OLS|B Chain B, Roles Of His291-Alpha And His146-Beta' In The Reductive 
Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid 
Dehydrogenase
 pdb|1OLU|B Chain B, Roles Of His291-Alpha And His146-Beta' In The Reductive 
Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid 
Dehydrogenase
 pdb|1V11|B Chain B, Crosstalk Between Cofactor Binding And The Phosphorylation 
Loop Conformation In The Bckd Machine
 pdb|1V16|B Chain B, Crosstalk Between Cofactor Binding And The Phosphorylation 
Loop Conformation In The Bckd Machine
 pdb|1V1M|B Chain B, Crosstalk Between Cofactor Binding And The Phosphorylation 
Loop Conformation In The Bckd Machine
 pdb|1V1R|B Chain B, Crosstalk Between Cofactor Binding And The Phosphorylation 
Loop Conformation In The Bckd Machine
 pdb|1U5B|B Chain B, Crystal Structure Of The Human Mitochondrial Branched-Chain 
Alpha- Ketoacid Dehydrogenase
 pdb|1X7W|B Chain B, Crystal Structure Of The Human Mitochondrial Branched-Chain 
Alpha- Ketoacid Dehydrogenase
 pdb|1X7X|B Chain B, Crystal Structure Of The Human Mitochondrial Branched-Chain 
Alpha- Ketoacid Dehydrogenase
 pdb|1X7Y|B Chain B, Crystal Structure Of The Human Mitochondrial Branched-chain 
Alpha- Ketoacid Dehydrogenase
 pdb|1X7Z|B Chain B, Crystal Structure Of The Human Mitochondrial Branched-Chain 
Alpha- Ketoacid Dehydrogenase
 pdb|1X80|B Chain B, Crystal Structure Of The Human Mitochondrial Branched-chain 
Alpha- Ketoacid Dehydrogenase
 pdb|1WCI|B Chain B, Reactivity Modulation Of Human Branched-chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BEU|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BEV|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BEW|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BFB|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BFC|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BFD|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BFE|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
 pdb|2BFF|B Chain B, Reactivity Modulation Of Human Branched-Chain Alpha- 
Ketoacid Dehydrogenase By An Internal Molecular Switch
Length=342

 Score =   437 bits (1123),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  13    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  72

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  73    PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  132

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  133   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  192

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  193   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  252

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  253   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  312

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  313   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  342



>ref|XP_006926421.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoisovalerate dehydrogenase 
subunit beta, mitochondrial [Pteropus alecto]
Length=393

 Score =   439 bits (1128),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  64    REYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  123

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  124   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  183

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  184   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  243

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EG+D+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  244   LYRAAVEQVPVEPYNIPLSQAEVIQEGNDVTLVAWGTQVHVIREVASMAQEKLGVSCEVI  303

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  304   DLRTILPWDVDTVCKSVVKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  363

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  364   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  393



>gb|AAA51410.1| branched chain alpha-keto acid dehydrogenase E1-beta subunit, 
partial [Bos taurus]
Length=369

 Score =   437 bits (1125),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  40    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  99

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  100   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  159

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  160   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  219

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+  ++E A +  EK G+SCE+I
Sbjct  220   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHEIREVAAMAQEKLGVSCEVI  279

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD +TV  SV KTGRLLVSHEAP+TGGF +EIS+++ E+CF  LEAP++RVCG
Sbjct  280   DLRTILPWDVDTVCKSVIKTGRLLVSHEAPLTGGFASEISSTVQEQCFLNLEAPISRVCG  339

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  340   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  369



>ref|XP_003740039.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Metaseiulus occidentalis]
Length=364

 Score =   437 bits (1125),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/327 (66%), Positives = 258/327 (79%), Gaps = 0/327 (0%)
 Frame = +1

Query  298   ESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPL  477
             +     +N++ ++  AL IAL  DP + +FGEDV FGGVFRCT GL +++G  RVFNTPL
Sbjct  38    QGNSEKLNMYQSITSALDIALSKDPTAVIFGEDVAFGGVFRCTVGLQEKYGSDRVFNTPL  97

Query  478   CEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRA  657
             CEQGI GFAIG+A   + AIAE+QFADYIFPAFDQIVNEAAKFRYR+GNQF+ G LTIR 
Sbjct  98    CEQGIAGFAIGVAVSGSTAIAEMQFADYIFPAFDQIVNEAAKFRYRTGNQFDVGSLTIRT  157

Query  658   PYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLY  837
             P GAVGHG  YHSQ  E +F H PG+K+VIPR P QAKGLLLS IRDPNP +FFEPK LY
Sbjct  158   PCGAVGHGALYHSQMTEGYFAHCPGLKLVIPRGPTQAKGLLLSCIRDPNPCIFFEPKILY  217

Query  838   RLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLK  1017
             RL+ EEVP  D+ +PLS+AEV+R G DIT+V WG Q+ V  E C  AEKEGI CELIDL+
Sbjct  218   RLSQEEVPVDDFSIPLSQAEVVRPGKDITIVSWGTQVHVANEVCDLAEKEGIECELIDLQ  277

Query  1018  TLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDT  1197
             T+LPWDK+TV  SVK+TGRL+V+HEA +T GFGAEI+ASI E CF  LE+PV RV G DT
Sbjct  278   TILPWDKKTVAESVKRTGRLIVTHEASLTAGFGAEIAASIQEECFLYLESPVKRVTGYDT  337

Query  1198  PFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             PFP VFEPFY+PTK K+LDA++ ++ Y
Sbjct  338   PFPHVFEPFYLPTKWKLLDAVRKSLKY  364



>gb|EFW40113.2| branched chain keto acid dehydrogenase E1 beta polypeptide [Capsaspora 
owczarzaki ATCC 30864]
Length=379

 Score =   438 bits (1126),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/322 (69%), Positives = 268/322 (83%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNL+ AVN A++I L TDP S VFGEDV FGGVFRCT  LA R G  RVFN+PLCEQGIV
Sbjct  58    MNLYQAVNDAMNITLATDPTSVVFGEDVAFGGVFRCTLDLAKRHGADRVFNSPLCEQGIV  117

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+AA    AIAEIQFADYIFPAFDQ+VNEAAK+RYRSG+ FN G LT+RAP GAVG
Sbjct  118   GFGIGMAAAGATAIAEIQFADYIFPAFDQLVNEAAKYRYRSGDLFNVGKLTVRAPCGAVG  177

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGGHYHSQSPEA+F H PG+KVV+PRSP+QAKGLLL++IRD NPVVFFEPK +YR AVE+
Sbjct  178   HGGHYHSQSPEAYFAHTPGLKVVVPRSPIQAKGLLLAAIRDQNPVVFFEPKIMYRTAVEQ  237

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP GDY LPLS+AE+++EGSD+TLVGWG QL V++E A +  EK G+ CE+IDL+T++PW
Sbjct  238   VPIGDYTLPLSQAEIVQEGSDVTLVGWGTQLHVLRETAKLAEEKLGVKCEVIDLRTIMPW  297

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +T+E SV KTGRLL++HEAP++GGF  EI+++I +RCF RLEAP+ RVCG DTPFPL+
Sbjct  298   DVDTIEKSVNKTGRLLIAHEAPLSGGFAGEIASTIQDRCFLRLEAPIQRVCGWDTPFPLI  357

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FE FYMP   +  +AIK  +NY
Sbjct  358   FEKFYMPDTLRCFEAIKKMINY  379



>gb|ERG82267.1| 2-oxoisovalerate dehydrogenase subunit [Ascaris suum]
Length=322

 Score =   436 bits (1120),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 256/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNL  AVN A+ IAL +DP + +FGEDV FGGVFRC+ GL  ++GK RVFNTPLCEQGI 
Sbjct  1     MNLCQAVNNAMDIALKSDPSACLFGEDVAFGGVFRCSVGLQKKYGKDRVFNTPLCEQGIA  60

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IGLA     AIAE+QFADYIFPAFDQIVNEAAK+RYRSG  F+CG LT+RA +GAVG
Sbjct  61    GFGIGLAVAGATAIAEVQFADYIFPAFDQIVNEAAKYRYRSGGLFDCGKLTVRATWGAVG  120

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HGG YHSQSPE +F H PG+K+VIPR P+QAKGLLLS IRD +P +FFEPK LYR AVEE
Sbjct  121   HGGLYHSQSPEGYFAHTPGLKIVIPRGPIQAKGLLLSCIRDDDPCLFFEPKMLYRTAVEE  180

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEAEKEGISCELIDLKTLLPW  1032
             VP GDY L LS+AE +R+G D+TLVGWG QL ++ EA  I  E+ G SCE+IDLKT+LPW
Sbjct  181   VPIGDYQLELSKAEAIRDGKDVTLVGWGTQLHILMEAAEIANEQFGASCEVIDLKTVLPW  240

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTG LLVSHEAP+T GF AEI  +I ERCF  LEAP+ RVCG DTPFP V
Sbjct  241   DVDTVAESVTKTGHLLVSHEAPVTCGFAAEIGTTIQERCFLNLEAPIMRVCGWDTPFPHV  300

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             +EPFY+PTK +++DAIK   N+
Sbjct  301   YEPFYLPTKWRVVDAIKKLSNF  322



>ref|XP_008555713.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Microplitis demolitor]
Length=375

 Score =   437 bits (1125),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 268/350 (77%), Gaps = 1/350 (0%)
 Frame = +1

Query  232   FVIPRGKWRGFSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfgg  411
             ++      R    S V +K         +N++ AVN+AL IAL+ DP S VFGEDV FGG
Sbjct  26    YLTKNANIRTLHFSFVPDKKTHAGETKKINMYQAVNEALAIALEKDPNSVVFGEDVAFGG  85

Query  412   vfRCTTGLADRFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVN  591
             VFRCT GL +RFG +RVFNTPL EQGI+GF IGLA     AIAEIQFADYIFPAFDQ+VN
Sbjct  86    VFRCTVGLKERFGNNRVFNTPLSEQGIIGFGIGLANQGVAAIAEIQFADYIFPAFDQLVN  145

Query  592   EAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAK  771
             EAAK RYRSGN F+CG LT+RAP GAVGHG  YHSQSPEA+F H PG+KVV+PR P+QAK
Sbjct  146   EAAKMRYRSGNAFDCGKLTVRAPCGAVGHGALYHSQSPEAYFAHTPGLKVVVPRGPIQAK  205

Query  772   GLLLSSIRDPNPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLS  951
             GLLLS I DP+P + FEPK LYRLAV++VP  D+ +P+ +AE++REG  ITLVGWG+Q+ 
Sbjct  206   GLLLSCIEDPDPCLIFEPKALYRLAVDDVPTNDFKIPIGKAEILREGDSITLVGWGSQVH  265

Query  952   VMQE-ACIEAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEIS  1128
             ++ E A I  EK G SCE+IDL ++LPWD ETV  SVKKTGR++++HEAP+T GFG+E+S
Sbjct  266   ILLETADIVKEKLGASCEVIDLISILPWDIETVTKSVKKTGRVVIAHEAPLTNGFGSEVS  325

Query  1129  ASIVERCFTRLEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             A+I E CF  LEAP+ RV G DTPFPLVFEPFY+P K +  DAIK T+N+
Sbjct  326   ATIQEACFLNLEAPIQRVTGWDTPFPLVFEPFYLPDKWRCFDAIKKTLNF  375



>pdb|2J9F|B Chain B, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase 
E1b
 pdb|2J9F|D Chain D, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase 
E1b
Length=350

 Score =   436 bits (1122),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  13    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  72

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  73    PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  132

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  133   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  192

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  193   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  252

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  253   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  312

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  313   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  342



>ref|XP_002189416.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Taeniopygia guttata]
Length=481

 Score =   441 bits (1135),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF ++  AL  AL  DP + VFGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  152   REYGQTQKMNLFQSITSALDNALAKDPTAVVFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  211

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  212   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  271

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             RAP+G VGHG  YHSQSPEAFF H PGIK+VIPRSPLQAKGLLLS I D NP +FFEPK 
Sbjct  272   RAPWGCVGHGALYHSQSPEAFFAHCPGIKIVIPRSPLQAKGLLLSCIEDKNPCIFFEPKI  331

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++ G+D+T+V WG Q+ V++E A +  EK G+SCE+I
Sbjct  332   LYRAAVEQVPVEPYNIPLSQAEVLQTGNDVTMVAWGTQVHVIKEVAAMAQEKLGVSCEVI  391

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T+LPWD ET+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP+ARVCG
Sbjct  392   DLRTILPWDTETICKSVAKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPIARVCG  451

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  452   YDTPFPHIFEPFYIPDKWKCYDALRRMINY  481



>gb|EFA77230.1| RabGAP/TBC domain-containing protein [Polysphondylium pallidum 
PN500]
Length=1103

 Score =   460 bits (1184),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 232/340 (68%), Positives = 279/340 (82%), Gaps = 5/340 (1%)
 Frame = +1

Query  262   FSSSVVEEKGVQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLAD  441
             + S+V+E  G  E+ K  MNLF A+N A+ I+L TD ++ +FGEDVGFGGVFRCT  L D
Sbjct  768   YPSAVIENAG--ETQK--MNLFQAINNAMDISLRTDEKACIFGEDVGFGGVFRCTVDLRD  823

Query  442   RFGKHRVFNTPLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSG  621
             ++G  RVFNTPLCEQGI GFAIG+AA    AIAEIQFADYIFPAFDQIVNEAAK+RYRSG
Sbjct  824   KYGAKRVFNTPLCEQGIAGFAIGMAAQGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSG  883

Query  622   NQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDP  801
              QF+CG +T RAPYGAVGHGGHYHSQSPE++F H PG+KVV+P +P++AKGLLL+SIRD 
Sbjct  884   GQFDCGSVTFRAPYGAVGHGGHYHSQSPESYFAHTPGLKVVMPNTPVEAKGLLLASIRDK  943

Query  802   NPVVFFEPKWLYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEAC-IEA  978
             NPVVFFEPK LYR AVEEVP GDY +PL +A V++EGSDIT+VGWG+Q+ V+ +A  +  
Sbjct  944   NPVVFFEPKLLYRSAVEEVPIGDYEIPLGKARVVQEGSDITIVGWGSQMRVLNQAVHMAK  1003

Query  979   EKEGISCELIDLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTR  1158
             EK GISCELIDL+T+LPWD E VEASVKKTGRL++SHEAP TGG+ AEIS++I ERCF  
Sbjct  1004  EKLGISCELIDLRTILPWDVEAVEASVKKTGRLIISHEAPKTGGWAAEISSTIQERCFLH  1063

Query  1159  LEAPVARVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             LEAP+ R+CG DTPFPL+FE FY+P   K  +AIK +V Y
Sbjct  1064  LEAPIQRICGYDTPFPLIFERFYVPDHLKNFEAIKKSVKY  1103



>ref|WP_036545912.1| 2-oxoisovalerate dehydrogenase [Nitrincola lacisaponensis]
 gb|KDE39875.1| Branched-chain alpha-keto acid dehydrogenase, E1 component, beta 
subunit [Nitrincola lacisaponensis]
Length=325

 Score =   435 bits (1119),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 257/324 (79%), Gaps = 1/324 (0%)
 Frame = +1

Query  310   SSMNLFSAVNQALHIALDTDPRSY-vfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQ  486
             S MNL  A+N AL IA+ TDP +     +   FGGVFR T+ L ++FGK R FNTPL EQ
Sbjct  2     SKMNLLQAINNALDIAMSTDPSALCFGEDVGHFGGVFRATSHLQEKFGKARCFNTPLTEQ  61

Query  487   GIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYG  666
             GI+GFA G+AA    AIAEIQFADYIFPAFDQIVNE+AKFRYRSGNQF+ GGLTIR PYG
Sbjct  62    GILGFANGIAAQGMTAIAEIQFADYIFPAFDQIVNESAKFRYRSGNQFDVGGLTIRTPYG  121

Query  667   AVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLA  846
                +G HYHSQSPEA+F H PG+K+V+PR+P QAKGLLL+SIRDPNPV+FFEPK LYR A
Sbjct  122   GGINGAHYHSQSPEAYFTHTPGLKIVVPRNPEQAKGLLLASIRDPNPVIFFEPKKLYRAA  181

Query  847   VEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEAEKEGISCELIDLKTLL  1026
             V EVP+ DY LPL +AEV+REGSDITLV WGAQ+  +++A   AEK+GISCELIDL++LL
Sbjct  182   VGEVPDEDYQLPLGQAEVVREGSDITLVAWGAQMEAIEQAAQLAEKDGISCELIDLRSLL  241

Query  1027  PWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFP  1206
             PWD++T+  SV+KTGRL+++HEAP T GFGAEI+ASI E CF  LE+P+ RV GLDTPFP
Sbjct  242   PWDRDTLAHSVRKTGRLIINHEAPKTSGFGAEIAASIQEACFLHLESPILRVTGLDTPFP  301

Query  1207  LVFEPFYMPTKNKILDAIKSTVNY  1278
             L  E  YMP   K  +AI +++NY
Sbjct  302   LALEKEYMPDHLKTYEAILASMNY  325



>ref|XP_003769285.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Sarcophilus harrisii]
Length=395

 Score =   438 bits (1126),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTP
Sbjct  67    QYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTP  126

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCGGLTIR
Sbjct  127   LCEQGIVGFGIGIAVNGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGGLTIR  186

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQ PEAFF H PGIK+V+PRSP QAKGLLLS I D NP +FFEPK L
Sbjct  187   APWGCVGHGALYHSQCPEAFFAHCPGIKIVVPRSPFQAKGLLLSCIEDKNPCIFFEPKIL  246

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+ID
Sbjct  247   YRAAVEQVPVEPYYIPLSQAEVLQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVID  306

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             LKT+LPWD ETV  SV KTGRL++SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG 
Sbjct  307   LKTILPWDIETVCKSVAKTGRLMISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGY  366

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FE FY+P K K  DA++  +NY
Sbjct  367   DTPFPHIFETFYIPDKWKCYDALRKMINY  395



>ref|XP_008120105.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Anolis carolinensis]
 ref|XP_003215740.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Anolis carolinensis]
 ref|XP_008120114.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Anolis carolinensis]
 ref|XP_008120119.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Anolis carolinensis]
Length=398

 Score =   438 bits (1126),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  295   QESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTP  474
             Q      MNLF ++  AL  AL  DP + +FGEDV FGGVFRCT GL D++GK R+FNTP
Sbjct  70    QYGQTQKMNLFQSITSALDNALARDPTAVIFGEDVSFGGVFRCTVGLRDKYGKDRIFNTP  129

Query  475   LCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIR  654
             LCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR
Sbjct  130   LCEQGIVGFGIGVAVAGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIR  189

Query  655   APYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWL  834
             AP+G VGHG  YHSQSPEAFF H PG+KVV+PR P++AKGLLLS I D NP +FFEPK L
Sbjct  190   APWGCVGHGALYHSQSPEAFFAHCPGLKVVVPRGPIEAKGLLLSCIEDKNPCIFFEPKIL  249

Query  835   YRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQEACIEA-EKEGISCELID  1011
             YR AVE+VP   Y +PLS+AEV++ GSD+TLV WG Q+ V++E  + A EK G+SCE+ID
Sbjct  250   YRAAVEQVPVEPYYIPLSQAEVLQSGSDVTLVAWGTQVHVIKEVAVMAQEKLGVSCEVID  309

Query  1012  LKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGL  1191
             LKT++PWD ET+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG 
Sbjct  310   LKTIIPWDAETICKSVTKTGRLLISHEAPVTGGFASEISSTVQEECFLNLEAPISRVCGY  369

Query  1192  DTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
             DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  370   DTPFPHIFEPFYIPDKWKCYDALRKMINY  398



>ref|XP_003258317.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Nomascus leucogenys]
Length=391

 Score =   437 bits (1125),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  62    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  121

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  122   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  181

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  182   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  241

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  242   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  301

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  302   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  361

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  362   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  391



>ref|NP_001116691.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial [Sus 
scrofa]
 gb|ACA43008.1| branched chain keto acid dehydrogenase E1 beta polypeptide [Sus 
scrofa]
Length=396

 Score =   437 bits (1125),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 261/330 (79%), Gaps = 1/330 (0%)
 Frame = +1

Query  292   VQESGKSSMNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             V+      MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  67    VEYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  126

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  127   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  186

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK 
Sbjct  187   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKI  246

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  247   LYRAAVEQVPIEPYTIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAREKLGVSCEVI  306

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  S  KTGRLLVSHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  307   DLRTIIPWDVDTVCKSAIKTGRLLVSHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  366

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  367   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  396



>ref|NP_000047.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Homo sapiens]
 ref|NP_898871.1| 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial precursor 
[Homo sapiens]
 ref|XP_001147541.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Pan troglodytes]
 ref|XP_009449866.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Pan troglodytes]
 sp|P21953.2|ODBB_HUMAN RecName: Full=2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; 
AltName: Full=Branched-chain alpha-keto acid dehydrogenase 
E1 component beta chain; Short=BCKDE1B; Short=BCKDH 
E1-beta; Flags: Precursor [Homo sapiens]
 gb|AAA51812.1| branched chain alpha-keto acid dehydrogenase E1-beta subunit 
[Homo sapiens]
 dbj|BAA14389.1| E-1-beta subunit of branched chain alpha-keto acid dehydrogenase 
[Homo sapiens]
 gb|AAB16763.1| branched chain alpha-ketoacid dehydrogenase E1 beta subunit [Homo 
sapiens]
 gb|AAH40139.1| Branched chain keto acid dehydrogenase E1, beta polypeptide [Homo 
sapiens]
 gb|AAV38866.1| branched chain keto acid dehydrogenase E1, beta polypeptide (maple 
syrup urine disease) [Homo sapiens]
 gb|AAX41176.1| branched chain keto acid dehydrogenase E1 beta polypeptide [synthetic 
construct]
 gb|EAW48696.1| branched chain keto acid dehydrogenase E1, beta polypeptide (maple 
syrup urine disease), isoform CRA_a [Homo sapiens]
 gb|EAW48697.1| branched chain keto acid dehydrogenase E1, beta polypeptide (maple 
syrup urine disease), isoform CRA_a [Homo sapiens]
 dbj|BAF82666.1| unnamed protein product [Homo sapiens]
 dbj|BAI47276.1| branched chain keto acid dehydrogenase E1, beta polypeptide [synthetic 
construct]
 gb|AIC48351.1| BCKDHB, partial [synthetic construct]
Length=392

 Score =   437 bits (1124),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_004422116.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform 1 [Ceratotherium simum simum]
 ref|XP_004422117.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform 2 [Ceratotherium simum simum]
Length=392

 Score =   437 bits (1124),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF AV  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  71    MNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  130

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  131   GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  190

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  191   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQ  250

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS AEV++EGSD+TL+ WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  251   VPVEPYSIPLSRAEVIQEGSDVTLIAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIIPW  310

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  311   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  370

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  371   FEPFYIPDKWKCYDALRKMINY  392



>ref|XP_008967691.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Pan paniscus]
Length=392

 Score =   437 bits (1124),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_009449868.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X2 [Pan troglodytes]
Length=392

 Score =   437 bits (1124),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>gb|AAV38888.1| branched chain keto acid dehydrogenase E1, beta polypeptide (maple 
syrup urine disease) [synthetic construct]
 gb|AAX42758.1| branched chain keto acid dehydrogenase E1 beta polypeptide [synthetic 
construct]
Length=393

 Score =   437 bits (1123),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A EEVP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +T+  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_009203841.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Papio anubis]
 ref|XP_009203842.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Papio anubis]
 ref|XP_009203843.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
isoform X1 [Papio anubis]
Length=392

 Score =   437 bits (1123),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 220/330 (67%), Positives = 264/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF +V  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  63    REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  122

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  123   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  182

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  183   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  242

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR A E+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  243   LYRAAAEQVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVI  302

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG
Sbjct  303   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCG  362

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  363   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  392



>ref|XP_003923310.2| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial 
[Saimiri boliviensis boliviensis]
Length=418

 Score =   437 bits (1125),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 221/330 (67%), Positives = 265/330 (80%), Gaps = 2/330 (1%)
 Frame = +1

Query  295   QESGKSS-MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNT  471
             +E G++  MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNT
Sbjct  89    REYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNT  148

Query  472   PLCEQGIVGFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTI  651
             PLCEQGIVGF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTI
Sbjct  149   PLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTI  208

Query  652   RAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKW  831
             R+P+G VGHG  YHSQSPEAFF H PGIKVVIPRSP QAKGLLLS I D NP +FFEPK 
Sbjct  209   RSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKI  268

Query  832   LYRLAVEEVPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELI  1008
             LYR AVE+VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+I
Sbjct  269   LYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEII  328

Query  1009  DLKTLLPWDKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCG  1188
             DL+T++PWD +TV  SV KTGRLL+SHEAP+TGGF +EIS++I E CF  LEAP++RVCG
Sbjct  329   DLRTIIPWDVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTIQEECFLNLEAPISRVCG  388

Query  1189  LDTPFPLVFEPFYMPTKNKILDAIKSTVNY  1278
              DTPFP +FEPFY+P K K  DA++  +NY
Sbjct  389   YDTPFPHIFEPFYIPDKWKCYDALRKMINY  418



>ref|XP_006898491.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial-like 
[Elephantulus edwardii]
Length=395

 Score =   437 bits (1123),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 217/322 (67%), Positives = 260/322 (81%), Gaps = 1/322 (0%)
 Frame = +1

Query  316   MNLFSAVNQALHIALDTDPRSYvfgedvgfggvfRCTTGLADRFGKHRVFNTPLCEQGIV  495
             MNLF ++  AL  +L  DP + +FGEDV FGGVFRCT GL D++GK RVFNTPLCEQGIV
Sbjct  74    MNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV  133

Query  496   GFAIGLAAMDNRAIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVG  675
             GF IG+A     AIAEIQFADYIFPAFDQIVNEAAK+RYRSG+ FNCG LTIR+P+G VG
Sbjct  134   GFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVG  193

Query  676   HGGHYHSQSPEAFFCHVPGIKVVIPRSPLQAKGLLLSSIRDPNPVVFFEPKWLYRLAVEE  855
             HG  YHSQSPEAFF H PGIKVV+PRSP QAKGLLLS I D NP +FFEPK LYR AVE+
Sbjct  194   HGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDRNPCIFFEPKILYRAAVEQ  253

Query  856   VPEGDYMLPLSEAEVMREGSDITLVGWGAQLSVMQE-ACIEAEKEGISCELIDLKTLLPW  1032
             VP   Y +PLS+AEV++EGSD+TLV WG Q+ V++E A +  EK G+SCE+IDL+T++PW
Sbjct  254   VPVEPYNIPLSQAEVLQEGSDVTLVAWGTQVHVIREVASMAQEKLGVSCEVIDLRTIIPW  313

Query  1033  DKETVEASVKKTGRLLVSHEAPITGGFGAEISASIVERCFTRLEAPVARVCGLDTPFPLV  1212
             D +TV  SV KTGRLL+SHEAP+TGGF +EIS+++ E CF  LEAP++RVCG DTPFP +
Sbjct  314   DVDTVCKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHI  373

Query  1213  FEPFYMPTKNKILDAIKSTVNY  1278
             FEPFY+P K K  DA++  +NY
Sbjct  374   FEPFYIPDKWKCYDALRKMINY  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4552834497888