BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23065_g1_i1 len=1089 path=[1:0-1088]

Length=1089
                                                                      Score     E

emb|CDP10609.1|  unnamed protein product                                111   8e-25   
ref|XP_004174178.1|  PREDICTED: uncharacterized protein LOC101227635    103   4e-22   
gb|KGN59201.1|  hypothetical protein Csa_3G780530                       103   7e-22   
ref|XP_008442912.1|  PREDICTED: uncharacterized protein LOC103486674    102   2e-21   
gb|KCW90467.1|  hypothetical protein EUGRSUZ_A02595                     100   3e-21   
ref|XP_010024630.1|  PREDICTED: uncharacterized protein LOC104415086    100   6e-21   
ref|XP_002532542.1|  conserved hypothetical protein                   94.7    9e-19   Ricinus communis
ref|XP_010109196.1|  hypothetical protein L484_002234                 93.2    3e-18   
ref|XP_009627621.1|  PREDICTED: uncharacterized protein LOC104118140  90.9    1e-17   
ref|XP_010262978.1|  PREDICTED: protein YLS9-like                     90.1    2e-17   
ref|XP_010553583.1|  PREDICTED: protein YLS9                          81.6    3e-14   
ref|XP_007027951.1|  Hydroxyproline-rich glycoprotein family prot...  81.3    4e-14   
ref|XP_008387106.1|  PREDICTED: protein YLS9-like                     80.1    7e-14   
ref|XP_010313380.1|  PREDICTED: protein YLS9-like                     79.3    1e-13   
ref|XP_010248447.1|  PREDICTED: uncharacterized protein LOC104591349  77.4    5e-13   
ref|XP_010262977.1|  PREDICTED: protein YLS9-like                     76.6    1e-12   
emb|CDX78099.1|  BnaA09g32940D                                        76.3    3e-12   
emb|CDX73634.1|  BnaC08g23690D                                        75.5    5e-12   
ref|XP_009115946.1|  PREDICTED: protein YLS9-like                     75.1    7e-12   
gb|EYU18126.1|  hypothetical protein MIMGU_mgv1a026169mg              75.1    8e-12   
ref|XP_009136679.1|  PREDICTED: protein YLS9-like                     74.3    1e-11   
gb|EYU38691.1|  hypothetical protein MIMGU_mgv1a020389mg              73.9    1e-11   
ref|XP_011046454.1|  PREDICTED: uncharacterized protein LOC105141060  74.3    1e-11   
emb|CDY29083.1|  BnaC07g32890D                                        72.8    4e-11   
ref|XP_002309246.2|  hydroxyproline-rich glycoprotein                 72.0    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009776837.1|  PREDICTED: uncharacterized protein LOC104226526  70.9    1e-10   
ref|XP_002876145.1|  hypothetical protein ARALYDRAFT_906612           70.9    2e-10   
ref|XP_009776839.1|  PREDICTED: uncharacterized protein LOC104226528  70.1    2e-10   
ref|NP_190814.1|  hydroxyproline-rich glycoprotein family protein     70.5    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009627615.1|  PREDICTED: uncharacterized protein LOC104118138  70.1    3e-10   
ref|XP_006339163.1|  PREDICTED: uncharacterized protein LOC102584777  69.7    5e-10   
ref|XP_002272164.2|  PREDICTED: protein YLS9 isoform X2               68.6    5e-10   Vitis vinifera
ref|XP_010651846.1|  PREDICTED: protein YLS9 isoform X1               68.2    1e-09   
gb|EYU19400.1|  hypothetical protein MIMGU_mgv1a022723mg              66.6    1e-09   
ref|XP_009804809.1|  PREDICTED: uncharacterized protein LOC104249968  67.8    2e-09   
emb|CAN79941.1|  hypothetical protein VITISV_027780                   65.5    2e-09   Vitis vinifera
ref|XP_011088964.1|  PREDICTED: protein YLS9                          67.0    3e-09   
ref|XP_009788019.1|  PREDICTED: uncharacterized protein LOC104235889  67.0    4e-09   
ref|XP_008243643.1|  PREDICTED: uncharacterized protein LOC103341864  65.9    4e-09   
ref|XP_010096846.1|  hypothetical protein L484_001755                 65.5    8e-09   
ref|XP_006361097.1|  PREDICTED: uncharacterized protein At1g08160...  65.1    1e-08   
ref|XP_010031557.1|  PREDICTED: protein YLS9                          65.1    1e-08   
gb|KDO70598.1|  hypothetical protein CISIN_1g046217mg                 65.5    1e-08   
gb|KFK34492.1|  hypothetical protein AALP_AA5G152600                  65.1    2e-08   
ref|XP_006854675.1|  hypothetical protein AMTR_s00030p00210920        64.3    2e-08   
ref|XP_008356964.1|  PREDICTED: uncharacterized protein LOC103420694  64.3    2e-08   
ref|XP_008373057.1|  PREDICTED: uncharacterized protein LOC103436409  63.9    2e-08   
ref|XP_007216512.1|  hypothetical protein PRUPE_ppa025743mg           63.9    2e-08   
ref|XP_009593206.1|  PREDICTED: uncharacterized protein LOC104089902  64.3    3e-08   
ref|XP_009801147.1|  PREDICTED: protein YLS9-like                     63.5    4e-08   
ref|XP_007203254.1|  hypothetical protein PRUPE_ppa019542mg           62.8    4e-08   
ref|XP_004487460.1|  PREDICTED: uncharacterized protein LOC101495270  62.8    4e-08   
ref|XP_010555798.1|  PREDICTED: protein YLS9-like                     63.9    4e-08   
ref|XP_006362851.1|  PREDICTED: uncharacterized protein At1g08160...  62.8    6e-08   
ref|XP_006290371.1|  hypothetical protein CARUB_v10017684mg           63.5    6e-08   
ref|XP_008240741.1|  PREDICTED: uncharacterized protein LOC103339247  62.8    6e-08   
ref|XP_008353627.1|  PREDICTED: protein YLS9-like                     62.4    6e-08   
ref|XP_009606948.1|  PREDICTED: protein YLS9-like                     62.8    6e-08   
ref|XP_009356952.1|  PREDICTED: uncharacterized protein At1g08160...  62.0    6e-08   
ref|XP_004241340.1|  PREDICTED: protein YLS9-like                     62.8    7e-08   
ref|XP_009349009.1|  PREDICTED: protein YLS9-like                     62.4    7e-08   
ref|XP_009369914.1|  PREDICTED: protein YLS9-like                     62.4    7e-08   
gb|KEH38989.1|  late embryogenesis abundant protein                   62.0    9e-08   
ref|XP_006403802.1|  hypothetical protein EUTSA_v10010982mg           62.8    9e-08   
ref|XP_008243645.1|  PREDICTED: uncharacterized protein LOC103341867  63.5    1e-07   
ref|XP_004172133.1|  PREDICTED: uncharacterized protein At1g08160...  61.6    2e-07   
ref|XP_007205847.1|  hypothetical protein PRUPE_ppa011071mg           61.2    2e-07   
ref|XP_006408687.1|  hypothetical protein EUTSA_v10002076mg           61.6    2e-07   
ref|XP_003543419.1|  PREDICTED: uncharacterized protein LOC100780672  61.6    2e-07   
ref|XP_004140265.1|  PREDICTED: uncharacterized protein At1g08160...  60.8    2e-07   
ref|XP_002322792.1|  hydroxyproline-rich glycoprotein                 61.2    2e-07   Populus trichocarpa [western balsam poplar]
gb|KFK32407.1|  hypothetical protein AALP_AA6G237800                  60.5    3e-07   
ref|XP_010487808.1|  PREDICTED: protein YLS9-like                     60.5    3e-07   
ref|XP_010557439.1|  PREDICTED: protein YLS9-like                     60.5    3e-07   
ref|XP_009349088.1|  PREDICTED: protein YLS9-like                     60.5    4e-07   
ref|XP_008449592.1|  PREDICTED: uncharacterized protein At1g08160     60.1    5e-07   
ref|NP_565642.1|  late embryogenesis abundant hydroxyproline-rich...  60.1    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009605492.1|  PREDICTED: protein YLS9-like                     60.1    5e-07   
ref|XP_008391967.1|  PREDICTED: uncharacterized protein At1g08160...  60.1    5e-07   
ref|XP_007016047.1|  Late embryogenesis abundant (LEA) hydroxypro...  59.3    5e-07   
gb|KDP36126.1|  hypothetical protein JCGZ_08770                       60.1    6e-07   
ref|XP_010503988.1|  PREDICTED: uncharacterized protein LOC104781090  60.1    7e-07   
ref|XP_009776258.1|  PREDICTED: protein YLS9-like                     59.3    8e-07   
ref|XP_002874099.1|  hypothetical protein ARALYDRAFT_910289           58.5    9e-07   
ref|XP_010426861.1|  PREDICTED: uncharacterized protein LOC104711796  59.7    1e-06   
ref|XP_008392042.1|  PREDICTED: uncharacterized protein LOC103454227  58.9    1e-06   
ref|XP_010248449.1|  PREDICTED: protein YLS9-like                     58.2    2e-06   
ref|XP_010480378.1|  PREDICTED: protein YLS9-like                     57.0    3e-06   
ref|XP_002879078.1|  hypothetical protein ARALYDRAFT_481623           57.8    3e-06   
ref|XP_006304143.1|  hypothetical protein CARUB_v10010132mg           57.8    3e-06   
ref|XP_010685426.1|  PREDICTED: protein YLS9-like                     57.8    3e-06   
ref|XP_008351503.1|  PREDICTED: uncharacterized protein At1g08160...  57.8    3e-06   
ref|XP_008245745.1|  PREDICTED: uncharacterized protein At1g08160...  56.6    3e-06   
ref|XP_010912375.1|  PREDICTED: protein YLS9-like                     57.8    4e-06   
ref|XP_008385491.1|  PREDICTED: uncharacterized protein At1g08160...  56.6    4e-06   
emb|CDX77105.1|  BnaC04g39000D                                        57.0    4e-06   
ref|XP_009350003.1|  PREDICTED: uncharacterized protein LOC103941519  58.2    4e-06   
ref|XP_006481532.1|  PREDICTED: protein YLS9-like isoform X1          57.4    5e-06   
ref|XP_009349979.1|  PREDICTED: uncharacterized protein LOC103941503  56.6    5e-06   
ref|XP_008243646.1|  PREDICTED: uncharacterized protein LOC103341868  57.4    6e-06   
ref|XP_009140785.1|  PREDICTED: uncharacterized protein LOC103864770  56.6    6e-06   
emb|CDX71465.1|  BnaC04g17000D                                        56.6    7e-06   
ref|XP_010457962.1|  PREDICTED: protein YLS9-like                     56.6    7e-06   
ref|XP_010932709.1|  PREDICTED: uncharacterized protein LOC105053306  57.4    7e-06   
ref|XP_010942912.1|  PREDICTED: uncharacterized protein LOC105060767  55.8    8e-06   
gb|KEH24231.1|  transmembrane protein, putative                       57.0    8e-06   
ref|XP_006430078.1|  hypothetical protein CICLE_v10013405mg           56.6    9e-06   
ref|XP_007162964.1|  hypothetical protein PHAVU_001G195100g           56.6    1e-05   
ref|XP_008243455.1|  PREDICTED: uncharacterized protein At1g08160...  56.2    1e-05   
ref|NP_197678.1|  late embryogenesis abundant hydroxyproline-rich...  55.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006430077.1|  hypothetical protein CICLE_v10013330mg           55.1    1e-05   
ref|XP_007015707.1|  Late embryogenesis abundant hydroxyproline-r...  55.5    1e-05   
ref|XP_008243644.1|  PREDICTED: protein YLS9-like                     55.5    2e-05   
emb|CDY30561.1|  BnaA04g15720D                                        55.5    2e-05   
gb|KEH24229.1|  late embryogenesis abundant protein                   55.5    2e-05   
gb|KDO58253.1|  hypothetical protein CISIN_1g043833mg                 55.1    2e-05   
ref|XP_006424127.1|  hypothetical protein CICLE_v10029176mg           55.1    2e-05   
ref|XP_006481533.1|  PREDICTED: protein YLS9-like isoform X2          55.1    2e-05   
gb|KDP29882.1|  hypothetical protein JCGZ_19149                       55.1    3e-05   
ref|XP_007204469.1|  hypothetical protein PRUPE_ppa022527mg           55.1    3e-05   
ref|XP_007150037.1|  hypothetical protein PHAVU_005G120800g           55.1    3e-05   
ref|XP_006400795.1|  hypothetical protein EUTSA_v10015654mg           53.9    3e-05   
ref|XP_008777695.1|  PREDICTED: uncharacterized protein LOC103697582  53.9    4e-05   
ref|XP_010521631.1|  PREDICTED: protein YLS9-like                     54.3    4e-05   
ref|XP_009103588.1|  PREDICTED: protein YLS9-like                     54.3    4e-05   
gb|KFK44298.1|  hypothetical protein AALP_AA1G239800                  54.3    4e-05   
ref|XP_004301661.1|  PREDICTED: uncharacterized protein LOC101294768  53.9    4e-05   
gb|KHG10449.1|  hypothetical protein F383_15951                       54.3    5e-05   
ref|XP_009371484.1|  PREDICTED: uncharacterized protein At1g08160...  53.9    6e-05   
emb|CDP06857.1|  unnamed protein product                              53.9    6e-05   
gb|EPS67655.1|  hypothetical protein M569_07117                       53.9    6e-05   
ref|XP_009374790.1|  PREDICTED: uncharacterized protein At1g08160...  53.5    6e-05   
emb|CDY04485.1|  BnaA07g13110D                                        53.5    8e-05   
ref|XP_009419494.1|  PREDICTED: protein YLS9-like                     53.5    9e-05   
emb|CDX96759.1|  BnaA08g23020D                                        53.5    9e-05   
gb|KFK32426.1|  hypothetical protein AALP_AA6G240400                  53.5    1e-04   
ref|XP_008387108.1|  PREDICTED: uncharacterized protein LOC103449562  53.1    1e-04   
ref|XP_008340121.1|  PREDICTED: uncharacterized protein LOC103403078  53.9    1e-04   
ref|XP_010520485.1|  PREDICTED: protein YLS9                          53.1    1e-04   
ref|XP_008799741.1|  PREDICTED: protein YLS9-like                     53.1    1e-04   
ref|XP_010031558.1|  PREDICTED: protein YLS9-like                     52.8    1e-04   
ref|XP_010454565.1|  PREDICTED: uncharacterized protein At1g08160...  52.4    1e-04   
gb|ABK23490.1|  unknown                                               52.4    1e-04   Picea sitchensis
ref|XP_011010004.1|  PREDICTED: protein YLS9-like                     52.8    1e-04   
ref|XP_006408666.1|  hypothetical protein EUTSA_v10002079mg           52.8    1e-04   
gb|KDO70597.1|  hypothetical protein CISIN_1g026507mg                 52.8    1e-04   
ref|XP_010908042.1|  PREDICTED: uncharacterized protein At1g08160...  52.0    1e-04   
gb|EYU36037.1|  hypothetical protein MIMGU_mgv1a017876mg              52.4    2e-04   
ref|XP_007202522.1|  hypothetical protein PRUPE_ppa010944mg           52.0    2e-04   
ref|XP_006342981.1|  PREDICTED: uncharacterized protein LOC102587456  52.8    2e-04   
ref|XP_009798502.1|  PREDICTED: uncharacterized protein LOC104244724  52.4    2e-04   
gb|KHN42909.1|  hypothetical protein glysoja_046984                   52.0    2e-04   
ref|XP_006481586.1|  PREDICTED: protein YLS9-like                     51.6    3e-04   
ref|XP_009359238.1|  PREDICTED: uncharacterized protein LOC103949837  52.4    3e-04   
ref|XP_009416878.1|  PREDICTED: protein YLS9-like                     52.0    3e-04   
ref|XP_008807076.1|  PREDICTED: uncharacterized protein At1g08160...  50.8    3e-04   
ref|XP_007205939.1|  hypothetical protein PRUPE_ppa011745mg           50.8    3e-04   
ref|XP_008226754.1|  PREDICTED: uncharacterized protein At1g08160...  50.8    4e-04   
ref|XP_008387109.1|  PREDICTED: uncharacterized protein LOC103449563  50.1    4e-04   
ref|XP_003537109.1|  PREDICTED: uncharacterized protein LOC100780240  51.6    4e-04   
ref|XP_009620973.1|  PREDICTED: uncharacterized protein LOC104112683  51.6    4e-04   
ref|XP_006385614.1|  hydroxyproline-rich glycoprotein                 51.2    4e-04   
ref|XP_009414842.1|  PREDICTED: protein YLS9-like                     51.2    5e-04   
gb|KDO40068.1|  hypothetical protein CISIN_1g036189mg                 50.8    5e-04   
ref|XP_004301934.1|  PREDICTED: uncharacterized protein At1g08160...  50.8    5e-04   
ref|XP_006430079.1|  hypothetical protein CICLE_v10012623mg           50.8    5e-04   
ref|XP_007203710.1|  hypothetical protein PRUPE_ppa019255mg           49.7    7e-04   
ref|XP_004494246.1|  PREDICTED: uncharacterized protein LOC101501676  50.8    8e-04   
ref|XP_010421086.1|  PREDICTED: uncharacterized protein At1g08160...  50.1    8e-04   
ref|XP_010248691.1|  PREDICTED: uncharacterized protein LOC104591528  50.1    8e-04   
ref|XP_011011008.1|  PREDICTED: uncharacterized protein At1g08160     49.7    9e-04   
ref|XP_009349991.1|  PREDICTED: uncharacterized protein LOC103941512  50.1    0.001   



>emb|CDP10609.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 108/212 (51%), Gaps = 4/212 (2%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFS  516
            YY+SA LP ++  +P      AR+ L +++ L++ T+  SL T++  GS VP F V +F+
Sbjct  52   YYSSAQLP-NISPQPSKGYEFARLALIIMIVLMVCTITFSLFTWLFLGSGVPDFKVESFN  110

Query  515  VPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNA  336
            VP F++++ +L   W+ N +V+N N    + F  ++  + Y   L+   M++P  L+   
Sbjct  111  VPYFDIANSTLKARWETNITVKNTNQKSRISFPHIQGYLVYRNRLVDAAMIDPLHLEGKT  170

Query  335  KMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMT  156
            +  L A  S P  R  GN  E    +   E      L+F + L++ AT+ SGS  SR   
Sbjct  171  EASLRANFSLPDPR--GNLPEASVVDAMGEGRKIGILDFYLRLDMRATYVSGSYWSRETM  228

Query  155  FTVSCYGLTAHFKDP-GVGVWDGVKPSCTVLF  63
              V C  L  +F  P G G W+G    C+  +
Sbjct  229  LRVICGDLWVNFPAPIGGGTWNGTSGECSTYY  260



>ref|XP_004174178.1| PREDICTED: uncharacterized protein LOC101227635 [Cucumis sativus]
Length=241

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 96/193 (50%), Gaps = 6/193 (3%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R I+  L+ L+      S++T+IV    +P F V +FSV +FN+S  + +G W  + +VE
Sbjct  51   RGIVTALILLVAVMTLSSIITWIVLRPQIPVFKVDSFSVSNFNISKLNYSGNWNGSLTVE  110

Query  449  NPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREP  270
            NPNH L V  ER++S V Y E  LA    +PF +       +  +++S +  D GN  E 
Sbjct  111  NPNHKLTVNIERIQSFVNYKENTLAMSYADPFFIDVEKSSQMRVKLTSSSPDDPGNWLET  170

Query  269  PWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDP----GVG  102
              +E   +   S  + F +       F+SGS  +RR+   V C  L   F  P    GV 
Sbjct  171  --EEKVGQEKASGTVSFNLRFFAWTAFRSGSWWTRRIVMKVFCEDLKLAFTGPAATHGVY  228

Query  101  VWDGVKPSCTVLF  63
            + D    +C+VLF
Sbjct  229  LADAHSKTCSVLF  241



>gb|KGN59201.1| hypothetical protein Csa_3G780530 [Cucumis sativus]
Length=292

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 96/193 (50%), Gaps = 6/193 (3%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R I+  L+ L+      S++T+IV    +P F V +FSV +FN+S  + +G W  + +VE
Sbjct  102  RGIVTALILLVAVMTLSSIITWIVLRPQIPVFKVDSFSVSNFNISKLNYSGNWNGSLTVE  161

Query  449  NPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREP  270
            NPNH L V  ER++S V Y E  LA    +PF +       +  +++S +  D GN  E 
Sbjct  162  NPNHKLTVNIERIQSFVNYKENTLAMSYADPFFIDVEKSSQMRVKLTSSSPDDPGNWLET  221

Query  269  PWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDP----GVG  102
              +E   +   S  + F +       F+SGS  +RR+   V C  L   F  P    GV 
Sbjct  222  --EEKVGQEKASGTVSFNLRFFAWTAFRSGSWWTRRIVMKVFCEDLKLAFTGPAATHGVY  279

Query  101  VWDGVKPSCTVLF  63
            + D    +C+VLF
Sbjct  280  LADAHSKTCSVLF  292



>ref|XP_008442912.1| PREDICTED: uncharacterized protein LOC103486674 [Cucumis melo]
Length=293

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 99/195 (51%), Gaps = 12/195 (6%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R I+  L+ L+      S++T+I+    VP F V +FSV +FN+S  + +G W A+ +V+
Sbjct  103  RGIVAALILLVAIMTLSSIITWIILRPEVPVFKVDSFSVSNFNISKLNYSGNWDASVTVQ  162

Query  449  NPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREP  270
            NPNH L+V  ER++S V Y +  LA    +PF L       +  +++S +  D GN    
Sbjct  163  NPNHKLNVNMERIQSFVDYKQNTLAMSYADPFFLDVEKSGQMKVKLTSSSPDDPGN----  218

Query  269  PWKEMKSELDDSR---DLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVG-  102
             W E + +L   R    + F +      TF++GS  +RR+   VSC  +   F  P  G 
Sbjct  219  -WLETEEKLGRERATGTVSFNLRFFAWTTFRTGSWWTRRVVMRVSCEDMKLVFTGPAAGH  277

Query  101  ---VWDGVKPSCTVL  66
               + D    +C+VL
Sbjct  278  AVYLADEHSKTCSVL  292



>gb|KCW90467.1| hypothetical protein EUGRSUZ_A02595, partial [Eucalyptus grandis]
Length=198

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 99/200 (50%), Gaps = 7/200 (4%)
 Frame = -2

Query  653  PRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGT  474
            P+     AR IL  L FL++ +  +S++ YIV    +P F V AFSV +FN+S+    G+
Sbjct  2    PQRTSGFARGILAALTFLVVASCTISVIMYIVLRPQIPEFYVTAFSVTNFNISNSVPMGS  61

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNE--FLLANKMVEPFELKRNAKMVLPARISSPA  300
            W AN +V+N N  L   FER++S VYY++    L+      F L+R    V+ A+++   
Sbjct  62   WDANVTVDNKNQKLKAYFERIQSYVYYDDPRTFLSWSTEPAFSLERKTSGVIHAKMT---  118

Query  299  TRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
            T DG   R    +EM  E      + F + L ++ TFKSG   +      V C GL   F
Sbjct  119  TIDGEQPRAAALEEMDEERRKG-TVVFGLGLGLMGTFKSGWWWTSHFGMRVYCDGLDVGF  177

Query  119  -KDPGVGVWDGVKPSCTVLF  63
                G G   G  P   V++
Sbjct  178  VGASGTGSLRGGNPRQCVVY  197



>ref|XP_010024630.1| PREDICTED: uncharacterized protein LOC104415086 [Eucalyptus grandis]
Length=281

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 97/194 (50%), Gaps = 7/194 (4%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
             AR IL  L FL++ +  +S++ YIV    +P F V AFSV +FN+S+    G+W AN +
Sbjct  91   FARGILAALTFLVVASCTISVIMYIVLRPQIPEFYVTAFSVTNFNISNSVPMGSWDANVT  150

Query  455  VENPNHGLDVMFERVESMVYYNE--FLLANKMVEPFELKRNAKMVLPARISSPATRDGGN  282
            V+N N  L   FER++S VYY++    L+      F L+R    V+ A+++   T DG  
Sbjct  151  VDNKNQKLKAYFERIQSYVYYDDPRTFLSWSTEPAFSLERKTSGVIHAKMT---TIDGEQ  207

Query  281  EREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-KDPGV  105
             R    +EM  E      + F + L ++ TFKSG   +      V C GL   F    G 
Sbjct  208  PRAAALEEMDEERRKG-TVVFGLGLGLMGTFKSGWWWTSHFGMRVYCDGLDVGFVGASGT  266

Query  104  GVWDGVKPSCTVLF  63
            G   G  P   V++
Sbjct  267  GSLRGGNPRQCVVY  280



>ref|XP_002532542.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29836.1| conserved hypothetical protein [Ricinus communis]
Length=305

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 99/196 (51%), Gaps = 8/196 (4%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKI-LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAF  519
            YYN+       + +P  +I    R I+  LVFL++ T A+S+  +I+    +P F V   
Sbjct  93   YYNTQ----MYQTQPECRINGFLRGIIGGLVFLLILTCAISIFMWIILRPVIPVFHVNNL  148

Query  518  SVPSFNLSDK-SLAGTWQANFSVENPNHGLDVMFERVESMVYYNE-FLLANKMVEPFELK  345
            SV +FNLS   +    W AN +V NPN  L V F+++E  +YYNE  LLA     PF L+
Sbjct  149  SVSNFNLSSSPTFHANWDANITVGNPNTKLKVYFDQIEVFIYYNEDDLLATSFSNPFFLE  208

Query  344  RNAKMVLPARI-SSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLS  168
                 V+ A++ ++ A R           +M  +   + ++ F + + + +TFKSGS  +
Sbjct  209  TGGNSVVQAKLEANNADRKQAGVGSWVVDKMAKDKSTTGNVTFDIRMALWSTFKSGSWWA  268

Query  167  RRMTFTVSCYGLTAHF  120
            R +T  V C  L   F
Sbjct  269  RHVTIRVYCEDLVVSF  284



>ref|XP_010109196.1| hypothetical protein L484_002234 [Morus notabilis]
 gb|EXC21224.1| hypothetical protein L484_002234 [Morus notabilis]
Length=308

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 99/195 (51%), Gaps = 7/195 (4%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
              R  L +++ LI  T  +S++T++V    +P F V  F+V   N+S    +  W A+ +
Sbjct  115  FVRGFLAMIITLITITCVVSIITWLVLRPEIPVFHVDKFAVSGLNISGPEFSAKWDASVT  174

Query  455  VENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNER  276
            VENPNH L +  E+V+  VYY E  L++  V+P  L+  ++  +  ++++  T      R
Sbjct  175  VENPNHKLKIYLEQVQGFVYYKENFLSSSPVDPMLLETRSRNSIAMKLATNNTEQHLVGR  234

Query  275  EPPWKEMKSELDDSRD-LEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGV-G  102
               W E     + S   + F + + VLATFKSG+  +R  +  V C  L  +F    + G
Sbjct  235  ---WVEEDIAKERSGGAVSFNLRMLVLATFKSGAWWTRHASMKVFCEDLKVNFVGGEISG  291

Query  101  VWD--GVKPSCTVLF  63
            V D  G KP   V++
Sbjct  292  VLDIGGGKPEDCVVY  306



>ref|XP_009627621.1| PREDICTED: uncharacterized protein LOC104118140 [Nicotiana tomentosiformis]
Length=261

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 107/212 (50%), Gaps = 13/212 (6%)
 Frame = -2

Query  692  YNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSV  513
            Y + PLP +V  E R     ARV+LCL+VFLIL    MS++ + VF S  P   V +F V
Sbjct  54   YPARPLP-YVSPEVRQGFSFARVMLCLMVFLILFASLMSMVAWSVFSSYWPTIKVESFVV  112

Query  512  PSFNLSDKS-LAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLL-ANKMVEPFELKRN  339
             SF +S+ S L   W+   SV+N NH   ++ E+ ES + Y   +L    +V+  E+ + 
Sbjct  113  RSFEISNGSLLKANWETKVSVKNTNHRSSIVVEQAESSLVYKYVVLDTTSLVDHLEIAKE  172

Query  338  AKMVLPARISSPATRDGGNEREPPWKEMKSEL--DDSR-DLEFQVALEVLATFKSGSDLS  168
            + ++L    + P ++     R      + +E+  D  R  + F + ++V   FKSG  L 
Sbjct  173  STLMLLDAFAFPNSK-----RSFTGDSVHNEMAKDQGRGHILFDLKIDVQVIFKSGV-LE  226

Query  167  RRMTFTVSCYGLTAHFKDPG-VGVWDGVKPSC  75
            +R    V C  +  +F++   +  WDG K  C
Sbjct  227  KRNKIRVYCEKIKLNFQNGSPIPTWDGSKSEC  258



>ref|XP_010262978.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=242

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 97/211 (46%), Gaps = 8/211 (4%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFS  516
            YYN  P P H        I   R    LL  ++   +  S +T++VF   +P F + +FS
Sbjct  36   YYNPQPQPYHPPSHDNCCISCLRCSFILLCSVVFAMLLFSYITWLVFQPELPEFRIDSFS  95

Query  515  VPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNA  336
            VP+F +S+  L   W+   S  NPN  + +M++ + + + Y   +L + ++ PF L++  
Sbjct  96   VPTFKISNLELTAKWEVAMSANNPNKNMALMYDGLNTGLMYGSSILTSVLLTPFYLEKMN  155

Query  335  KMVLPARISSPATRDGGNEREPPWKEMKSELDDSRD-LEFQVALEVLATFKSGSDLSRRM  159
               L A++   +    G   E      K  +D SR  + F + +  +ATF +GS +S+  
Sbjct  156  HTALQAKMVVYSENMKGFLVE------KMAMDRSRGFMNFNLKMTAMATFMAGSWMSKTR  209

Query  158  TFTVSCYGLTAHFK-DPGVGVWDGVKPSCTV  69
              TV C  L   F    G+G   G    C V
Sbjct  210  AVTVYCENLNVEFSATTGMGTLMGGPRHCLV  240



>ref|XP_010553583.1| PREDICTED: protein YLS9 [Tarenaya hassleriana]
Length=295

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 98/216 (45%), Gaps = 26/216 (12%)
 Frame = -2

Query  695  YYNSAPLP-PHVEFEPRPKILLA------RVILCLLVFLILGTVAMSLLTYIVFGSAVPF  537
            YY S P P P++ ++ +     A      R IL  L+ L++     +++T++     +P 
Sbjct  72   YYGSPPSPSPYMTYQYQANRSSAASAGFVRGILTGLIILVVILCLSTVVTWLALRPQLPI  131

Query  536  FDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYY------NEFLLA  375
            F V  F+V  FN S       W AN +VENPN  L   F R++ +VY+      +EF LA
Sbjct  132  FSVTHFTVSGFNASQPDFTAQWTANLTVENPNTKLGAYFNRIQGLVYHQNSVGEDEF-LA  190

Query  374  NKMVEPFELKRNAKMVLPARISSPATRDGGNERE---PPW--KEMKSELDDSRDLEFQVA  210
                 P  L+    + +  R ++      G + E   PPW  +EM  E + S  + F + 
Sbjct  191  MGFFTPLHLETKKTVEIGERFTA------GEKEEPEVPPWVAEEMMKEREGSGTVSFSLR  244

Query  209  LEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVG  102
            + V  TFK+ +   R     V C  L A F D G G
Sbjct  245  IAVWVTFKTEAWGERERGLKVICDKLKAGF-DGGSG  279



>ref|XP_007027951.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY08453.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=303

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 86/176 (49%), Gaps = 10/176 (6%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
             AR I+  +  LI+ T   SL+T++V    +P F V   SV +FN S   +A TW  N +
Sbjct  113  FARGIIAAMFVLIVLTCLSSLITWVVLRPEIPVFHVDNMSVSNFNTSTPFMA-TWDTNLT  171

Query  455  VENPNHGLDVMFER-VESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            +ENPNH L +  ++ V +M Y +E  L +  + P  ++   K  + A IS   T      
Sbjct  172  LENPNHKLRLYLDKIVGAMFYDDEDSLGSSWLNPIFMETKTKTTMNAIIS---TNGSAQN  228

Query  278  REPPWKEMKSELDDSR---DLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
              P W  +  E+   R    L F + + + ATFK+GS  +R +   V C  L  +F
Sbjct  229  AVPIW--LTQEMSKDRATGSLTFALRIRIWATFKTGSWWTRSLVIRVLCDDLKVNF  282



>ref|XP_008387106.1| PREDICTED: protein YLS9-like [Malus domestica]
Length=259

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 96/216 (44%), Gaps = 21/216 (10%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFS  516
            YYN  P  P   F  +P IL   +I  + VF I+  +    ++++     +P F V + +
Sbjct  56   YYNPQPNGP---FRSKPTILCRIMIAAVAVFTIMSII--FFISWLALRPQLPKFQVESAT  110

Query  515  VPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVE-SMVYYNEFLLANKMVEPFEL-KR  342
            V   N +      TW       NPNH L + ++R+E S++Y +E LL    + PF L KR
Sbjct  111  VSPLNATGSEXTATWDFTLLAANPNHKLTIFYDRLEASLIYKDEVLLTXAALPPFVLAKR  170

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDL  171
            N   V    I+    R   ++      E+  E+ D +D   + F V +  L  FKSG   
Sbjct  171  NQTRV---NINLATVRGYVDD------EVAREIADGKDRGSVRFGVGVAALVRFKSGVFQ  221

Query  170  SRRMTFTVSCYGL--TAHFKDPGVGVWDGVKPSCTV  69
            +RR    V C G+  T   ++ G G   G    C V
Sbjct  222  TRRRLLRVFCDGVEFTGFARNNGTGTLTGQASPCQV  257



>ref|XP_010313380.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=256

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 96/200 (48%), Gaps = 14/200 (7%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVI-LCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAF  519
            YY + P      ++ +   LL RVI + +   +I GT    L  +++F   +P F V + 
Sbjct  50   YYQNNPYYQPNHYDAQRNTLLRRVIGMAIACMVIAGTFVFIL--WLIFRPRIPEFRVDSL  107

Query  518  SVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRN  339
            SV + NL++  ++G W   F+V NPN  + + ++ V + V+Y++  L++  V PF  ++ 
Sbjct  108  SVSNLNLTNSLISGKWDLRFTVRNPNKKMTLYYDDVAAAVFYDDVSLSDTTVPPFFQEKR  167

Query  338  AKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRM  159
            A+    AR +S AT  G       + +M  E      + F V +     F+SG+  +RR 
Sbjct  168  AET---ARQASFAT-AGAYVNNRAFDQMNKERSQKGAIGFNVRIVARVRFRSGAWRARRR  223

Query  158  TFTVSCYGLTAHFKDPGVGV  99
               V C       KD  VGV
Sbjct  224  FIRVYC-------KDLSVGV  236



>ref|XP_010248447.1| PREDICTED: uncharacterized protein LOC104591349 [Nelumbo nucifera]
Length=258

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 98/216 (45%), Gaps = 21/216 (10%)
 Frame = -2

Query  695  YYNSAPL--PPHVEFEPRPKILLARVILCLL-VFLILGTVAMSLLTYIVFGSAVPFFDVA  525
            YYN+ P   PP   ++ R      R I  ++ VFLI+G  A++ + ++V    VP F V 
Sbjct  55   YYNTNPYYTPP---YDQRRTTFFRRFIAAIIAVFLIIG--AITFIVWLVLHPHVPEFRVD  109

Query  524  AFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELK  345
            + SV S N+++  + G W   F+V NPN  + V ++ + S ++Y    L++  + P    
Sbjct  110  SVSVSSLNINNSQVTGNWDVGFTVRNPNKKMSVHYDNMFSTLFYRRQSLSDTSLPPLSQG  169

Query  344  RNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSR---DLEFQVALEVLATFKSGSD  174
            +  +  + AR ++ +   G         +  S L   R    + F V +     FK+G+ 
Sbjct  170  KKNETTVRARFAASSGYIG---------DAASALASDRSSGSVSFNVNIGAWVWFKAGAW  220

Query  173  LSRRMTFTVSCYGLTAHF-KDPGVGVWDGVKPSCTV  69
             +RR    V C  L   F  +   GV  G   +C V
Sbjct  221  RTRRHLLRVFCEDLKVGFSSNTQTGVLSGGPKNCEV  256



>ref|XP_010262977.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=259

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/220 (25%), Positives = 96/220 (44%), Gaps = 19/220 (9%)
 Frame = -2

Query  692  YNSAPLPPHVEFEPRP---------KILLARVILCLLVFLILGTVAMSLLTYIVFGSAVP  540
            Y  A  PP V + P P         +    R ++ L+V + L    ++ + +++    +P
Sbjct  45   YPYAAPPPAVYYNPNPYSTPFYDQRRTAFLRRLISLMVVVFLIMAGITFIMWLIIRPHLP  104

Query  539  FFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVE  360
             F + + SV SFN++   + G W  +F+V NPN  + V ++ +ES  YY    L++  V 
Sbjct  105  EFRLNSASVSSFNVNATQVTGDWNLDFTVRNPNKKMSVYYDHIESTFYYRGAQLSDTFVA  164

Query  359  PFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDD--SRDLEFQVALEVLATFK  186
            PF   +  +  +  + ++ +       +  P    K+   D  S ++ F V +     FK
Sbjct  165  PFSQGKKNETTMQVKFAAAS-------QYVPESSAKALASDRSSGEVGFNVRIWAWVWFK  217

Query  185  SGSDLSRRMTFTVSCYGLTAHF-KDPGVGVWDGVKPSCTV  69
             G   +R     V C  +   F  + GVGV  G   +C V
Sbjct  218  CGGWRTRMHYLRVFCDNVKIGFSSNRGVGVLSGGPTNCKV  257



>emb|CDX78099.1| BnaA09g32940D [Brassica napus]
Length=302

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 91/189 (48%), Gaps = 16/189 (8%)
 Frame = -2

Query  656  EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
             P P      ++  L+V ++L  ++ ++ T++V    +P F V +FSV +FNL+    + 
Sbjct  101  RPAPSGFFRGILTGLIVLVVLLCISTTI-TWLVLRPQIPVFSVTSFSVSNFNLTRPVFSA  159

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFL-----LANKMVEPFELKRNAKMVLPARI  312
             W AN +VENPN  L+  F+R+++ +Y    +     LA    +P  ++    + +   +
Sbjct  160  QWMANLTVENPNTKLNGYFDRIQAFIYNQNAIEEDDFLAMAFFQPVSVQTKKSVSIGETL  219

Query  311  SSPATRDGGNERE--PPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVS  144
            ++     GG E+   P W  +EMK E D    + F + + V  TFK+    +R     V 
Sbjct  220  TA-----GGKEQPKVPSWVGEEMKKERDTGM-VSFDLRMLVWVTFKTDGWSARERGLKVF  273

Query  143  CYGLTAHFK  117
            C  L   F+
Sbjct  274  CGKLKVAFE  282



>emb|CDX73634.1| BnaC08g23690D [Brassica napus]
Length=302

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 86/180 (48%), Gaps = 15/180 (8%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R IL  L+ L++     + +T++V    +P F V +FSV +FNL+    +  W AN +VE
Sbjct  109  RGILTGLIVLVVLLCISTTITWLVLRPQIPVFSVTSFSVSNFNLTGPVFSAQWTANLTVE  168

Query  449  NPNHGLDVMFERVESMVYYNEFL-----LANKMVEPFELKRNAKMVLPARISSPATRDGG  285
            NPN  L+  F+R+++ +Y    +     LA    +P  ++      +   +++     GG
Sbjct  169  NPNTKLNGYFDRIQAFIYNQNAIGEDDFLAMAFFQPVSVETKKSASIGETLTA-----GG  223

Query  284  NERE--PPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
             E+   P W  +EMK E D    + F + + V  TFK+    +R     V C  L   F+
Sbjct  224  KEQPKVPSWVGEEMKKERDTGM-VSFDLRMLVWVTFKTDGWSARERGLKVFCGKLKVAFE  282



>ref|XP_009115946.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=302

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 90/189 (48%), Gaps = 16/189 (8%)
 Frame = -2

Query  656  EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
             P P      ++  L+V ++L  ++ ++ T++V    +P F V +FSV +FNL+    + 
Sbjct  101  RPAPSGFFRGILTGLIVLVVLLCISTTI-TWLVLRPQIPVFSVTSFSVSNFNLTGPVFSA  159

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFL-----LANKMVEPFELKRNAKMVLPARI  312
             W AN +VENPN  L+  F+R+++ +Y    +     LA    +P  +     + +   +
Sbjct  160  QWTANLTVENPNTKLNGYFDRIQAFIYNQNAIEEDDFLAMAFFQPVSVATKKLVFIGETL  219

Query  311  SSPATRDGGNERE--PPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVS  144
            ++     GG E+   P W  +EMK E D    + F + + V  TFK+    +R     V 
Sbjct  220  TA-----GGKEQPKVPSWVGEEMKKERDTGM-VSFDLRMLVWVTFKTDGWSARERGLKVF  273

Query  143  CYGLTAHFK  117
            C  L   F+
Sbjct  274  CGKLKVAFE  282



>gb|EYU18126.1| hypothetical protein MIMGU_mgv1a026169mg, partial [Erythranthe 
guttata]
Length=304

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 93/201 (46%), Gaps = 5/201 (2%)
 Frame = -2

Query  695  YYNS--APLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            YY     PL P             RV+L L++ L+     MSL+ + +FG+ +P F+VA+
Sbjct  87   YYQQHYKPLVPLNNNNDSDSSSFGRVMLILMIVLVASMCMMSLVMWFLFGTYIPEFEVAS  146

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
              V +F  +D +L GTW+   SV N N  L V F+RV S ++Y E LL    ++PF++ +
Sbjct  147  LKVSNFTATDTTLTGTWEVELSVTNTNKELAVNFDRVMSSIFYKEALLGISTLQPFQVDQ  206

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRD-LEFQVALEVLATFKSGSDLSR  165
              +  +    S PA +   + +   W       D S   + F + L +   F + + + R
Sbjct  207  MNRSTV--NFSMPAEQKPNDMKLQSWVLPTLSQDQSNGVVVFSLRLAMKTNFTTANLVYR  264

Query  164  RMTFTVSCYGLTAHFKDPGVG  102
            +    V C  +   F   G G
Sbjct  265  QENLRVLCENVQVVFTVGGKG  285



>ref|XP_009136679.1| PREDICTED: protein YLS9-like [Brassica rapa]
 emb|CDX90601.1| BnaA03g41800D [Brassica napus]
Length=300

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 94/202 (47%), Gaps = 14/202 (7%)
 Frame = -2

Query  695  YYNSAPLPPHVE--FEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            YY S+  PP     ++  P     R IL  LVF+ +     + +T++V    +P F V  
Sbjct  84   YYGSS-YPPQQNPVYQTPPPSGFFRGILTGLVFIAVFLCISTTITWLVLRPQIPVFSVTN  142

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYN-----EFLLANKMVEP  357
            FSV +FNL++   +  + AN +VENPN  L   F R++  +Y       E  LA +  +P
Sbjct  143  FSVSNFNLTEPVFSAQFTANLTVENPNTKLTSYFNRIQGFIYNQNAVAEEDFLAMEYFQP  202

Query  356  FELKRNAKMVLPARISSPATRDGGNEREPPW--KEMKSELDDSRDLEFQVALEVLATFKS  183
              ++    +++   +++      G  + P W  +EMK E  D+  + F + + V  TFK+
Sbjct  203  VYVETKKSVLIGETLTAGGE---GQRKVPSWVGEEMKKE-RDTGTVSFNLWMAVSVTFKT  258

Query  182  GSDLSRRMTFTVSCYGLTAHFK  117
                +R     V C  L   F+
Sbjct  259  DGWSARERGLKVFCGKLKVAFE  280



>gb|EYU38691.1| hypothetical protein MIMGU_mgv1a020389mg, partial [Erythranthe 
guttata]
Length=287

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
              R++L L+V L+     MSL T++++G+ VP F+VA+  V +F+ ++ +L GTW A+  
Sbjct  116  FGRMMLILMVVLVAAMCMMSLATWLLYGTYVPEFEVASLKVSNFSATNTTLRGTWIADVI  175

Query  455  VENPNHGLDVMFERVESMVYYNEFLL  378
            V NPN  L V FERV S+V+Y   ++
Sbjct  176  VYNPNEELAVNFERVRSLVFYKGVIV  201



>ref|XP_011046454.1| PREDICTED: uncharacterized protein LOC105141060 [Populus euphratica]
Length=296

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (47%), Gaps = 11/177 (6%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
             +R  L  ++FL L     S++ ++V    +P F V  FSV + N +  +    W+AN +
Sbjct  105  FSRCFLTTIIFLTLLIFTSSIIMWLVLRPQLPVFHVDNFSVSNLNATLPTFTANWEANLT  164

Query  455  VENPNHGLDVMFERVESMVYYNE-FLLANKMV-EPFELKRNAKMVLPARISSPATRDGGN  282
            V NPN  L + F  +++ V+Y E +LLA+ +   PF L+     V+ A++S        N
Sbjct  165  VRNPNTKLKIEFSELQNFVFYEEDYLLASAITSRPFSLETKTSDVINAKLSE------NN  218

Query  281  EREPPWKEMKSELDDSR---DLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
            +  P    +  +L   R    + F   + V  TF+SG    R ++  V C  L   F
Sbjct  219  KDNPVENWVVDKLAKERRNGSVSFNFRMLVWTTFRSGLWWKRHLSMKVMCEDLQVTF  275



>emb|CDY29083.1| BnaC07g32890D [Brassica napus]
Length=300

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 94/202 (47%), Gaps = 14/202 (7%)
 Frame = -2

Query  695  YYNSAPLPPHVE--FEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            YY S+  PP     ++  P     R IL  LV + +     + +T++V    +P F V  
Sbjct  84   YYGSS-YPPQQNPVYQTPPPSGFFRGILTGLVVIAVFLCLSTTITWLVLRPQIPVFSVTN  142

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYN-----EFLLANKMVEP  357
            FSV +FNL++   +  + AN +VENPN  L   F R++  +Y       E  LA +  +P
Sbjct  143  FSVSNFNLTEPVFSAQFTANLTVENPNTKLTSYFNRIQGFIYSQNAVAEEDFLAMEYFQP  202

Query  356  FELKRNAKMVLPARISSPATRDGGNEREPPW--KEMKSELDDSRDLEFQVALEVLATFKS  183
              ++    +++   +++    + G  + P W  +EMK E  D+  + F + + V  TFK+
Sbjct  203  VYVETKKSVLIGETLTA---GEKGQRKVPSWVGEEMKKE-RDTGTVSFNLWMAVSVTFKT  258

Query  182  GSDLSRRMTFTVSCYGLTAHFK  117
                +R     V C  L   F+
Sbjct  259  DGWSARERGLKVFCGKLKVAFE  280



>ref|XP_002309246.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE92769.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=287

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 83/174 (48%), Gaps = 5/174 (3%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
             +R  L  ++FL L     S++ ++V    +P F V  FSV + N +  +    W+AN +
Sbjct  96   FSRCFLTTIIFLTLLIFTSSIIMWLVLRPQLPVFHVDNFSVSNLNATLPTFTANWEANLT  155

Query  455  VENPNHGLDVMFERVESMVYYNE-FLLANKMV-EPFELKRNAKMVLPARISSPATRDGGN  282
            V NPN  L + F  +++ V+Y E +LLA+ +   PF L+     V+ A++S    +D   
Sbjct  156  VRNPNTRLKIEFSELQNFVFYEEDYLLASAITSRPFSLETKTSGVINAKLSE-NNKDNLV  214

Query  281  EREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
            E     K  K   + S    F++   V  TF+SG    R ++  V C  +   F
Sbjct  215  ENWVVDKLAKERSNGSVSFNFRML--VWTTFRSGLWWKRNLSIKVMCEDIQVTF  266



>ref|XP_009776837.1| PREDICTED: uncharacterized protein LOC104226526 [Nicotiana sylvestris]
Length=279

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 83/181 (46%), Gaps = 9/181 (5%)
 Frame = -2

Query  656  EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
            E   +    R +  +++ LI+G +  SL+ +++FG+  P F + +  VPS  +++ S+ G
Sbjct  84   ENNSRASFGRYMTTMMLILIIGMIMFSLVIWLLFGTEKPEFHLVSMQVPSLMVTNTSILG  143

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPAT  297
             WQ N S++N N  L +      + + Y   +LA   V+PF+L   +  +L + +++ A 
Sbjct  144  NWQVNVSMKNSNKDLGIKLNNGNTAILYKTNVLAETPVDPFKLASQSSAILFSNLTTSAG  203

Query  296  R--DGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAH  123
               D G   E   +     L        Q+ L +  T K+ S   R     + C  +  H
Sbjct  204  TFLDKGILAEATGERNNGVL----KFTLQIYLGIQYTSKTESKNER---LRIYCNDVKVH  256

Query  122  F  120
            F
Sbjct  257  F  257



>ref|XP_002876145.1| hypothetical protein ARALYDRAFT_906612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52404.1| hypothetical protein ARALYDRAFT_906612 [Arabidopsis lyrata subsp. 
lyrata]
Length=295

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 11/180 (6%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
              R I   L+ +++     + +T+++    +P F V  FSV +FNL+    +  W AN +
Sbjct  100  FVRGIFTGLIVIVVLLCISTTITWLILRPRIPLFSVNNFSVSNFNLTGPVFSAQWTANLT  159

Query  455  VENPNHGLDVMFERVESMVYYNEFL-----LANKMVEPFELKRNAKMVLPARISSPATRD  291
            +EN N  L   F+R++ ++Y+   +     LA     P  ++    +V+   +++    D
Sbjct  160  IENQNTKLKGYFDRIQGLIYHQNAVGEDDFLATAFFPPVFVETKKSVVIGETLTA---GD  216

Query  290  GGNEREPPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
                + P W  +EMK E  D+  + F + + V  TFK+    +R     V C  L   F+
Sbjct  217  KEQPKVPSWVGEEMKKE-RDTGTVSFNLRMAVWVTFKTDGWAARERGLKVFCGKLKVGFE  275



>ref|XP_009776839.1| PREDICTED: uncharacterized protein LOC104226528 [Nicotiana sylvestris]
Length=274

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 97/209 (46%), Gaps = 7/209 (3%)
 Frame = -2

Query  692  YNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSV  513
            Y + PLP +V  E       ARV+LCL+VFLIL    MS++ + VF S  P   V +F V
Sbjct  67   YPARPLP-YVSPEVSQGFSFARVMLCLMVFLILFASLMSMVAWSVFSSEWPTIKVESFVV  125

Query  512  PSFNLSDKS-LAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLL-ANKMVEPFELKRN  339
             SF +S+ S L    +   SV+N NH   ++    E+ + Y   +L     V+  E+ + 
Sbjct  126  RSFEISNGSLLKANLETKVSVKNTNHRSSIVVLYAENTLLYKYVVLDTTSSVDHLEIAKE  185

Query  338  AKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRM  159
            + ++L    + P ++      +    EM  +      L F + ++V   FKS     +R 
Sbjct  186  STVMLLDAFALPNSKRSFTG-DSVLNEMAKDQGRGHIL-FDLKIDVQVIFKSRV-YEKRN  242

Query  158  TFTVSCYGLTAHFKD-PGVGVWDGVKPSC  75
               V C  +  +F++   +  WDG K  C
Sbjct  243  KIRVYCEKIKLNFQNGSTIPTWDGSKSEC  271



>ref|NP_190814.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 emb|CAB43432.1| putative protein [Arabidopsis thaliana]
 gb|AEE78948.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
Length=300

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 85/181 (47%), Gaps = 13/181 (7%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFS  456
              R I   L+ L++     + +T++V    +P F V  FSV +FN++    +  W AN +
Sbjct  105  FVRGIFTGLIVLVVLLCISTTITWLVLRPQIPLFSVNNFSVSNFNVTGPVFSAQWTANLT  164

Query  455  VENPNHGLDVMFERVESMVYY------NEFLLANKMVEPFELKRNAKMVLPARISSPATR  294
            +EN N  L   F+R++ +VY+      +EF LA    +P  ++    +V+   +++    
Sbjct  165  IENQNTKLKGYFDRIQGLVYHQNAVGEDEF-LATAFFQPVFVETKKSVVIGETLTA---G  220

Query  293  DGGNEREPPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
            D    + P W   EMK E  ++  + F + + V  TFK+    +R     V C  L   F
Sbjct  221  DKEQPKVPSWVVDEMKKE-RETGTVTFSLRMAVWVTFKTDGWAARESGLKVFCGKLKVGF  279

Query  119  K  117
            +
Sbjct  280  E  280



>ref|XP_009627615.1| PREDICTED: uncharacterized protein LOC104118138 [Nicotiana tomentosiformis]
 ref|XP_009627616.1| PREDICTED: uncharacterized protein LOC104118138 [Nicotiana tomentosiformis]
 ref|XP_009627617.1| PREDICTED: uncharacterized protein LOC104118138 [Nicotiana tomentosiformis]
Length=286

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = -2

Query  656  EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
            E   +    R +  +++ LI+G +  SL+ +++FG+  P F + +  V S  ++  S+ G
Sbjct  91   ENNSRASFGRYMTTMMLILIIGMIMFSLVIWLLFGTEKPEFHLVSIQVSSLMITSTSILG  150

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI-SSPA  300
             WQ N S++N N+ LD+     ++ + Y   +LA   V+PF L   +  +L + + +SP 
Sbjct  151  NWQVNVSMKNSNNDLDIKLNTGKTAILYKTNVLAETPVDPFNLASQSSTILFSNLTTSPG  210

Query  299  T  297
            T
Sbjct  211  T  211



>ref|XP_006339163.1| PREDICTED: uncharacterized protein LOC102584777 [Solanum tuberosum]
Length=299

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 92/195 (47%), Gaps = 12/195 (6%)
 Frame = -2

Query  653  PRPKIL-LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD--KSL  483
            PR KI+   RV+ CL+V LIL      ++      +  P F+V +F V SFN+S+    L
Sbjct  87   PRRKIMTFCRVLFCLIVVLILSFTIFFVVRIWKNYAYYPSFEVVSFIVHSFNISNPTNKL  146

Query  482  AGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR--NAKMVLPARIS  309
               W+ + SV N N  +++ F+ + + + YN  LL +    PF + R  NAK  + + I 
Sbjct  147  TVDWEVDVSVRNSNRKVEISFDYISTSLMYNLQLLESSFSAPFNVSRKSNAKFHVDSNIP  206

Query  308  SP-ATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGL  132
            +P   + GG        EM  +L    +L   + +E       G++   +    +SC  L
Sbjct  207  NPNQVKIGGLVVN----EMARDLRRGYNLLIDLRIEA-KIINQGTNSRYKRELYLSCDDL  261

Query  131  TAHFKDP-GVGVWDG  90
              +FK+   +  WDG
Sbjct  262  ILNFKNSTSLPEWDG  276



>ref|XP_002272164.2| PREDICTED: protein YLS9 isoform X2 [Vitis vinifera]
Length=240

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 58/107 (54%), Gaps = 4/107 (4%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS  495
            PP+    PR   L   +   +  F+I+GT+    + ++V    +P+F VA+ S+ SFN+S
Sbjct  47   PPYSS--PRATFLRRFLAAMIAFFIIVGTII--FIVWLVLRPRLPYFSVASASLSSFNVS  102

Query  494  DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF  354
               L+G W  +F V NPN  + + ++R+ES + Y    L+   + PF
Sbjct  103  ASQLSGEWNISFDVRNPNKKISISYDRIESSIAYKSATLSQTTIAPF  149



>ref|XP_010651846.1| PREDICTED: protein YLS9 isoform X1 [Vitis vinifera]
Length=263

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 4/109 (4%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLV--FLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFN  501
            P H      P+    R  L  ++  F+I+GT+    + ++V    +P+F VA+ S+ SFN
Sbjct  43   PYHAPPYSSPRATFLRRFLAAMIAFFIIVGTII--FIVWLVLRPRLPYFSVASASLSSFN  100

Query  500  LSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF  354
            +S   L+G W  +F V NPN  + + ++R+ES + Y    L+   + PF
Sbjct  101  VSASQLSGEWNISFDVRNPNKKISISYDRIESSIAYKSATLSQTTIAPF  149



>gb|EYU19400.1| hypothetical protein MIMGU_mgv1a022723mg, partial [Erythranthe 
guttata]
Length=203

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R++L L++ L++    MSL T+ ++G+ VP F+V +  V +F  ++ +L GTW A+  V 
Sbjct  1    RLMLILMIVLVVAMCMMSLATWFLYGTYVPEFEVTSLRVSNFTATNTTLRGTWNADVIVY  60

Query  449  NPNHGLDVMFERVESMVYY  393
            NPN  L V F+ + S+V+Y
Sbjct  61   NPNEELAVDFQGIRSLVFY  79



>ref|XP_009804809.1| PREDICTED: uncharacterized protein LOC104249968 [Nicotiana sylvestris]
Length=288

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 86/197 (44%), Gaps = 8/197 (4%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS-LAGT  474
            R  +   RV+ CL+  +ILG +   ++ +  F    P F+V +F V SF +S+ S L   
Sbjct  92   RKSLTFCRVLFCLIFIIILGIIITLVVIWWKFLPYEPRFEVVSFVVNSFEISNSSKLRAD  151

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATR  294
            W+   +V NPN  +D+  E + + + Y   LL      PF+L + ++  + A    P   
Sbjct  152  WEIEMNVYNPNKKVDIKLEHIATSLMYKYTLLETSFSAPFKLNKKSEATIRADFDIP---  208

Query  293  DGGNEREPPWKEMKSELDDSR--DLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
               N +E     +     D R   L F + +E       G+   RR T  V C  L   F
Sbjct  209  -NSNHKEMGGLVVNDIARDRRKGHLSFDLRIEAKILHIEGNKSRRRKTVYVICEDLNLEF  267

Query  119  KD-PGVGVWDGVKPSCT  72
            K+   +  WDG    CT
Sbjct  268  KNSSSLPNWDGYIVECT  284



>emb|CAN79941.1| hypothetical protein VITISV_027780 [Vitis vinifera]
Length=145

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -2

Query  605  FLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDV  426
            F+I+GT+    + ++V    +P+F VA+ S+ SFN+S   L+G W  +F V NPN  + +
Sbjct  5    FIIVGTII--FIVWLVLRPRLPYFSVASASLSSFNVSASQLSGEWNISFDVRNPNKKISI  62

Query  425  MFERVESMVYYNEFLLANKMVEPF  354
             ++R+ES + Y    L+   + PF
Sbjct  63   SYDRIESSIAYKSATLSQTTIAPF  86



>ref|XP_011088964.1| PREDICTED: protein YLS9 [Sesamum indicum]
 ref|XP_011088965.1| PREDICTED: protein YLS9 [Sesamum indicum]
 ref|XP_011088966.1| PREDICTED: protein YLS9 [Sesamum indicum]
Length=258

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 95/202 (47%), Gaps = 10/202 (5%)
 Frame = -2

Query  656  EPRPKIL----LARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDK  489
            +P P I+      R +L  ++ LI+   A++ + ++V    +P F V +FSV +F L + 
Sbjct  59   QPDPNIVRRATFLRRVLAFVIGLIVVFAAITFIVWLVLRPQLPEFRVDSFSVSNFTLGNN  118

Query  488  SL-AGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
            SL A T +   +  NPN  + + ++ ++++V+Y  +LL++ ++ PF      +  L A  
Sbjct  119  SLIAFTSEVRLTARNPNKKMTLSYDHIQAVVFYKSWLLSDTIIPPFSQGTKNETSLTANF  178

Query  311  SSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGL  132
            ++     G     P    + SE  ++ ++ F + +     FK+ +  +RR    V C  L
Sbjct  179  AA----AGSFLDRPAVDGINSERRNNGNVGFNLRVVSSVRFKAKAWRTRRRFLKVFCGDL  234

Query  131  TAHFKDPGV-GVWDGVKPSCTV  69
                +  G+ G   G    C V
Sbjct  235  AVGIQSNGMSGTLIGGPRQCRV  256



>ref|XP_009788019.1| PREDICTED: uncharacterized protein LOC104235889 [Nicotiana sylvestris]
Length=282

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 86/173 (50%), Gaps = 8/173 (5%)
 Frame = -2

Query  632  ARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSV  453
             R+++ L++ L++G + +SL+ ++ FG+  P F + A SVPSF + + S+ G WQ N ++
Sbjct  96   GRLMVILMLILVVGMIMLSLVFWLFFGTEGPVFHILALSVPSFRIINSSIVGNWQVNLTM  155

Query  452  ENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELK-RNAKMVLPARISSPATRDGGNER  276
             N N    +     ++ ++Y   LLA    +P  L+ +  K +L    + P   +G    
Sbjct  156  CNMNDHSKIKVFHGKTSIFYKTNLLAVTPFDPVRLEVKGTKNMLSNLTTLP---EGNVLD  212

Query  275  EPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDL-SRRMTFTVSCYGLTAHF  120
            +    E+  + +D  D+EF + + +     S S+  S +M   V C  L   F
Sbjct  213  QLAISEISKDKNDG-DIEFSLEISLKVVLASDSEWQSHKM--MVYCNNLKVKF  262



>ref|XP_008243643.1| PREDICTED: uncharacterized protein LOC103341864 [Prunus mume]
Length=231

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 89/192 (46%), Gaps = 5/192 (3%)
 Frame = -2

Query  635  LARVI-LCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANF  459
            +AR++ +  ++ L LGT  + L  +++  +  P   + +  +P  N+S+ SL   W   F
Sbjct  37   IARLVHVHRILLLALGTFTL-LCVFMLTPTQNPKIQLDSLFMPKLNVSNMSLGANWDMAF  95

Query  458  SVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            +VENPN    V F+R+E  + Y +  LA   VEPF+L    + ++  +IS    +D    
Sbjct  96   TVENPNMVSWVQFDRIEGSILYKDNPLAIYSVEPFDLGLKEQRLMRVKISRTGLQDQPKM  155

Query  278  REPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-KDPGVG  102
            +    +EM  + +D   +  ++ +   AT+K G   +        C  L   F    G G
Sbjct  156  KVSDLEEMNRQREDGV-VSLKMEMFAWATYKKGWWGTEDAMMEAHCLDLRVGFLPKVGFG  214

Query  101  VWDGVKP-SCTV  69
             W    P +C+ 
Sbjct  215  SWISGGPMTCST  226



>ref|XP_010096846.1| hypothetical protein L484_001755 [Morus notabilis]
 gb|EXB66199.1| hypothetical protein L484_001755 [Morus notabilis]
Length=251

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 8/167 (5%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANF  459
             L R+I  ++ F I+ + ++  + ++V    +P F V + SV + N S ++L+G W   F
Sbjct  61   FLRRLIFAMIAFFII-SASVVFIVWLVLRPRIPKFWVDSVSVSNLNTSAQTLSGDWAVGF  119

Query  458  SVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            SV NPN  + + ++++ S + Y +  L+   + PF+  +  +M + A  S+       N 
Sbjct  120  SVYNPNKKMSIAYDQINSDIAYKKAFLSETRIAPFDQGKRNRMAINATFSAK------NS  173

Query  278  REPPWKEMKSELDDSRD-LEFQVALEVLATFKSGSDLSRRMTFTVSC  141
                W       D  R  + F V +     F++G    RR    V C
Sbjct  174  YVEDWVVKGISEDRGRGTVNFHVRVWARVGFRAGGWRLRRRLLRVIC  220



>ref|XP_006361097.1| PREDICTED: uncharacterized protein At1g08160-like [Solanum tuberosum]
Length=247

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 78/170 (46%), Gaps = 5/170 (3%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANF  459
             L RVI  L+   I+ T  +  + +IV    +P F V + SV + NLS+  +   W   F
Sbjct  60   FLRRVIAILVASTII-TGTILFVIWIVILPRIPEFQVDSLSVSNLNLSNSLITANWDLRF  118

Query  458  SVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            +  NPN  L + ++ + + ++Y+   +A+  V PF + R  +     R  +     G   
Sbjct  119  TARNPNKKLTLYYDEIAAAIFYDSLSIADTTVPPFFMDRVNETSQEVRFVA----SGAYV  174

Query  278  REPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLT  129
             +  ++ M  E  +   + F V +    +FK+G+  +RR    V C  L+
Sbjct  175  EKWAFEGMGKERAEKASVRFNVRMVARVSFKAGAWRARRRYLRVYCGDLS  224



>ref|XP_010031557.1| PREDICTED: protein YLS9 [Eucalyptus grandis]
 gb|KCW50899.1| hypothetical protein EUGRSUZ_J00543 [Eucalyptus grandis]
Length=245

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 89/198 (45%), Gaps = 12/198 (6%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS--LAG  477
            R   L   ++  +  F+I+GTV    + ++V    +P F+V + +V +F++S+ S  ++G
Sbjct  54   RAAFLRYFLVAVIAFFVIIGTVL--FIVWLVLQPRLPEFEVESVAVTNFSVSNASQHVSG  111

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPAT  297
             W   F V NPN  + + +  +E+ + Y    L+   ++PF+     + V+ A  ++   
Sbjct  112  DWVVRFQVANPNKKMKISYTDIEAYLSYKTESLSETRLQPFDQGTRNQTVVQASFAA---  168

Query  296  RDGGNEREPPWKEMKSELDD-SRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
                +     W       D  S  + FQV L  LA FK+G   +RR    V C  L    
Sbjct  169  ---ADSYVDNWAVSGINADRASGAVSFQVRLIALARFKAGWWRARRRVIKVVCGNLAVGL  225

Query  119  -KDPGVGVWDGVKPSCTV  69
              + G G   G    C+V
Sbjct  226  SSNNGTGKLTGGVRDCSV  243



>gb|KDO70598.1| hypothetical protein CISIN_1g046217mg [Citrus sinensis]
Length=288

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 98/214 (46%), Gaps = 16/214 (7%)
 Frame = -2

Query  674  PPHVEFE-PRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNL  498
            PPH   + P P    A ++  +++F+    +   +L +++     P F V   +V +F++
Sbjct  77   PPHCPHQDPGPPSSFA-ILTTMMLFVFFTFIVGLVLMFLIARPKFPIFHVETLAVTNFSV  135

Query  497  SDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYN--EFLLANKMVEPFE---LKRNAK  333
            ++      W+ N  VEN N G +V F+R++S +Y+N  + L ++    P +   +K N K
Sbjct  136  ANDDFTSAWEINLVVENRNFGANVHFDRIQSFIYFNTDDLLASSHFDHPTKDVTVKANEK  195

Query  332  MVLPARISSPATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSG--SDLS  168
              +  ++S   T D       P K +  E+ + R+   + F +     +  ++G     +
Sbjct  196  GTIDIKLS---TADYKQSVPAPGKRVMEEMRNIRETGVVPFSLRAFAWSQIETGLFYTET  252

Query  167  RRMTFTVSCYGLTAHFK-DPGVGVWDGVKPSCTV  69
            + +   + C  L  HF+ D G G  +G    C V
Sbjct  253  KHIQSRIICEDLKVHFEGDTGNGKLNGKSKDCVV  286



>gb|KFK34492.1| hypothetical protein AALP_AA5G152600 [Arabis alpina]
Length=296

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 79/161 (49%), Gaps = 11/161 (7%)
 Frame = -2

Query  578  SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMV  399
            + +T++V    +P F V  FSV +FN++    +  W AN +V+NPN  L   F+R++  +
Sbjct  120  TTITWLVLRPQIPAFSVTNFSVSNFNVTGPVFSAQWTANLTVDNPNTKLKGYFDRIQGFI  179

Query  398  YYNEFL-----LANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPW--KEMKSELD  240
            Y N  +     LA+   +P  ++    +++   I++   +D    + P W  ++MK E  
Sbjct  180  YNNNAITEDDFLASAFFQPVYVETKKSVMIGETITA-GEKD--QPKVPSWVGEDMKKER-  235

Query  239  DSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
            ++  + F + + V  TFK+    +R     V C  L   F+
Sbjct  236  ETGTVSFNLRMSVWVTFKTDGWSARERGLKVFCGKLKVAFE  276



>ref|XP_006854675.1| hypothetical protein AMTR_s00030p00210920 [Amborella trichopoda]
 gb|ERN16142.1| hypothetical protein AMTR_s00030p00210920 [Amborella trichopoda]
Length=252

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 68/147 (46%), Gaps = 5/147 (3%)
 Frame = -2

Query  581  MSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESM  402
            +SL+ ++V    VP + V + S+  FNLSD  L   W    +  N N  + + ++ +   
Sbjct  83   VSLIFWLVLRPKVPEYTVQSASISQFNLSDSKLTANWNVTLNSFNGNKKMGIYYDEIRVS  142

Query  401  VYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLE  222
            +YY   LL+   + PF  +     VL AR +S    DG    +   K+M ++  +  ++E
Sbjct  143  LYYGSELLSQTGLPPFYQETKNSTVLIARFAS----DGDFVGDEVGKKMSAQKGNG-NVE  197

Query  221  FQVALEVLATFKSGSDLSRRMTFTVSC  141
            F V L     F +G   +RR    V C
Sbjct  198  FNVRLAAWVRFNTGGWRTRRHVLIVLC  224



>ref|XP_008356964.1| PREDICTED: uncharacterized protein LOC103420694 [Malus domestica]
Length=253

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 83/190 (44%), Gaps = 15/190 (8%)
 Frame = -2

Query  641  ILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQAN  462
            I L+ V L ++VFL        +   +  G   P   + A SV  FN+SDK+L   W   
Sbjct  58   IFLSLVTLAIIVFLPF------IRKELTRGPQAPIVQLTALSVHKFNVSDKNLTAEWDVK  111

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGN  282
              + NPN    + F R+E  V Y +  L  K  +PF L    K  L  R+   A  +G  
Sbjct  112  LKIANPNLVSYIWFNRLEGFVLYEDRPLVVKPEKPFGLPMKTKTELHLRLRM-ANWEGD-  169

Query  281  EREPPWKEMKSE-LDDSRDL---EFQVALEVLATFKSGSDLS-RRMTFTVSCYGLTAHFK  117
              +P  K++  E +   R+L    F V + + AT++SG   S + +   + C  L   FK
Sbjct  170  --QPALKQLLLEKMKKDRELGGVRFSVQMAIWATYRSGWWWSAQHVIMNLQCLDLQIGFK  227

Query  116  DPGVGVWDGV  87
                 +  G+
Sbjct  228  PGATAIGFGI  237



>ref|XP_008373057.1| PREDICTED: uncharacterized protein LOC103436409 [Malus domestica]
Length=253

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 76/158 (48%), Gaps = 14/158 (9%)
 Frame = -2

Query  641  ILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQAN  462
            I L+ + L ++VFL L    ++L      G   P   + A SV  FN+S ++L   W   
Sbjct  58   IFLSLITLAIIVFLPLIRKELTL------GPQAPVVQLTALSVHKFNVSARNLTAEWDVI  111

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGN  282
              + NPN    V F R+E  V Y +  LA + +EPF L    K  L  R+   A  +G  
Sbjct  112  LKIANPNLLSSVWFNRLEGFVLYEDRPLAIETMEPFGLPMKTKTELHLRLRM-ANWEGD-  169

Query  281  EREPPWKE-MKSELDDSRDL---EFQVALEVLATFKSG  180
              +P  K+ M +++   R+L    F V + V AT++SG
Sbjct  170  --QPALKQGMLNKMTKDRELGCVRFSVQMAVWATYRSG  205



>ref|XP_007216512.1| hypothetical protein PRUPE_ppa025743mg [Prunus persica]
 gb|EMJ17711.1| hypothetical protein PRUPE_ppa025743mg [Prunus persica]
Length=255

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 83/179 (46%), Gaps = 15/179 (8%)
 Frame = -2

Query  641  ILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQAN  462
            I L+ V L ++VFL L    ++L      G   P  +++A ++  FN+S+ +L   W   
Sbjct  60   IFLSLVALAIVVFLPLIRKELTL------GPQAPVVELSALTIHKFNVSETNLTAEWDVK  113

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGN  282
              + NPN    + F+R+E  V Y +  LA + VEPF L    K  +  R+   A  +G  
Sbjct  114  LKIGNPNLVSQIWFDRIEGFVLYEDRTLAIEQVEPFGLPMKTKNQVRLRLRM-ANWEGD-  171

Query  281  EREPPWKE-MKSELDDSRDL---EFQVALEVLATFKSGSDLS-RRMTFTVSCYGLTAHF  120
              +P  K+ M  ++   R L    F V + + AT++S    S +R+     C  L   F
Sbjct  172  --QPALKQGMLKKMKRDRKLGGVRFSVQMAIWATYRSVWGRSAQRVIMNPQCLDLHVAF  228



>ref|XP_009593206.1| PREDICTED: uncharacterized protein LOC104089902 [Nicotiana tomentosiformis]
Length=288

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 85/197 (43%), Gaps = 8/197 (4%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS-LAGT  474
            R  +   RV+ CL+  +ILG +   ++ +  F    P F+V +F V SF +S+ S L   
Sbjct  92   RKLLTFCRVLFCLIFIIILGIIITLVVIWWKFLPYEPRFEVVSFVVNSFEISNSSKLRAD  151

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATR  294
            W+   +V+NPN  LD+ FE + + + Y   LL      PF+L + ++         P   
Sbjct  152  WEIEMNVKNPNRKLDIKFEHISTSLMYKFTLLETSFSAPFKLNKKSEATFRVDFDIP---  208

Query  293  DGGNEREPPWKEMKSELDDSRD--LEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
               N ++     +     D R   L F + +E       G+    R T  V C  L   F
Sbjct  209  -NSNHKKMGGLVVNDIARDRRKGHLSFDLRIEAKILNMEGNKGRNRKTVYVICEDLNLEF  267

Query  119  KD-PGVGVWDGVKPSCT  72
            K+   +  WDG    CT
Sbjct  268  KNSSSLPNWDGYIVECT  284



>ref|XP_009801147.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
 ref|XP_009801149.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
 ref|XP_009801150.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=258

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 16/198 (8%)
 Frame = -2

Query  692  YNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSV  513
            Y   P+P  V+   R   L   + + +   +I GT     + +++    +P F V + SV
Sbjct  57   YYQQPIPYAVQ---RATFLRRIIAIAIAAMVITGTFV--FIVWLILRPRLPEFRVDSLSV  111

Query  512  PSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAK  333
             + NLS+  ++  W   F+V NPN  L + ++ V + V+Y+   L++  V PF   + A+
Sbjct  112  SNLNLSNSLISANWDLRFTVRNPNKKLTLYYDDVAAAVFYDSASLSDTTVPPFFQDKRAE  171

Query  332  MVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTF  153
                A  ++     G       +  M  E   S  + F V +     FK+GS  +RR   
Sbjct  172  TAQKASFAT----SGSYVENRAFDGMNKERARSSAIGFDVRMVARVRFKAGSWRARRRFI  227

Query  152  TVSCYGLTAHFKDPGVGV  99
             V C       KD  VGV
Sbjct  228  RVYC-------KDLSVGV  238



>ref|XP_007203254.1| hypothetical protein PRUPE_ppa019542mg [Prunus persica]
 gb|EMJ04453.1| hypothetical protein PRUPE_ppa019542mg [Prunus persica]
Length=227

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 93/193 (48%), Gaps = 5/193 (3%)
 Frame = -2

Query  635  LARVI-LCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANF  459
            +AR++ L  ++ L LGT  + L  +++  +  P   + +  V   ++S+ SL  +W   F
Sbjct  37   IARLVQLHRILLLALGTFTL-LCVFMLTPTQTPKIQLDSLFVSKLDVSNTSLGASWDVAF  95

Query  458  SVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            +++NPN    V F+R+E  + Y +  LA   V+PF+L    + ++  +IS    ++    
Sbjct  96   TIDNPNMVSWVHFDRIEGSILYKDSPLAIYFVKPFDLGLKEQRMMHVKISMTRLQNQPAM  155

Query  278  REPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-KDPGVG  102
            +    +EM  + +D   +  ++ +   AT+K G   ++ +     C GL   F    G G
Sbjct  156  KVSDLEEMNRQREDGA-VGLKMEMFAWATYKKGWWGTQDVMMEAHCLGLRIGFLPKVGFG  214

Query  101  VWDGVKP-SCTVL  66
             W    P +C+ +
Sbjct  215  SWISGGPMTCSTV  227



>ref|XP_004487460.1| PREDICTED: uncharacterized protein LOC101495270 [Cicer arietinum]
Length=235

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 85/193 (44%), Gaps = 24/193 (12%)
 Frame = -2

Query  698  GYYNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAF  519
            GYY+  P PP     P       R     ++ L++    + ++T++V   ++P F +   
Sbjct  33   GYYD-PPTPP----RPYASRSFFRAFFATMICLVVIFGVILVITWLVLRPSLPHFTLTTL  87

Query  518  SVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRN  339
            S+ +F+ S++SL GTW  +F+V N N  + V +  + S ++Y+   +A   + PF+    
Sbjct  88   SLSNFSASNQSLTGTWHLSFNVRNANKKMSVTYNVLRSSIFYHSNYIAESPLAPFKQDTK  147

Query  338  AKMVLPARIS-------SPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSG  180
            ++  L A  S       S A  D   ++             S  + F V +   A+F+SG
Sbjct  148  SETTLNATFSAANAYLESRAVNDLNADKS------------SGSVPFDVQILASASFRSG  195

Query  179  SDLSRRMTFTVSC  141
            S   R     + C
Sbjct  196  SWRFRTRILKILC  208



>ref|XP_010555798.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=298

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (45%), Gaps = 9/155 (6%)
 Frame = -2

Query  578  SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSL-AGTWQANFSVENPNHGLDVMFERVESM  402
            ++ T+++    +P F V  FSV  FN +        W AN +VENPN  L   F R++  
Sbjct  115  TVATWLILRPQIPIFAVTHFSVSGFNGTRPDFFTAQWTANLTVENPNAKLKAYFNRIQGF  174

Query  401  VYYN-----EFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNERE-PPW--KEMKSE  246
            +Y+      + LL      P  ++      +  R S+    + G +   P W  +EM+ E
Sbjct  175  IYHQNSIGEDELLTTGFFTPVYVETKKTAAIGERFSAEKAAEKGEQPAVPGWVAEEMRKE  234

Query  245  LDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
             + +  + F + + VL TFK+    +R     V C
Sbjct  235  KESNGTVSFSLRMFVLVTFKAEGWSARERGLKVLC  269



>ref|XP_006362851.1| PREDICTED: uncharacterized protein At1g08160-like [Solanum tuberosum]
Length=257

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 81/165 (49%), Gaps = 8/165 (5%)
 Frame = -2

Query  695  YYNSAPL-PPHVEFEPRPKILLARVI-LCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            YY + P   P+  ++ +    L RVI + +   +I GT    L  +++    +P F V +
Sbjct  50   YYQNNPYYQPNNPYDAQRNTFLRRVIGMAIAAMVIAGTFVFIL--WLILRPRIPEFRVDS  107

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
             SV + NL++  ++G W   F+V NPN  + + ++ V + V+Y++  L++  V PF  ++
Sbjct  108  LSVSNLNLTNSLISGKWDLRFTVRNPNKKMTLYYDDVAAAVFYDDVSLSDTTVPPFFQEK  167

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVAL  207
             A+    AR +S AT  G       + +M  E      + F V +
Sbjct  168  RAET---ARQASFAT-AGAYVNNRAFDQMNKERSQKGAIGFNVRM  208



>ref|XP_006290371.1| hypothetical protein CARUB_v10017684mg [Capsella rubella]
 gb|EOA23269.1| hypothetical protein CARUB_v10017684mg [Capsella rubella]
Length=310

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 78/161 (48%), Gaps = 11/161 (7%)
 Frame = -2

Query  578  SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMV  399
            + +T+++    +P F +  FSV +FN++    +  W AN ++EN N  L   F+R++ ++
Sbjct  133  TTITWLILRPQIPGFSLNNFSVSNFNVTGPVFSAQWTANLTIENQNTKLKGYFDRIQGLL  192

Query  398  YYNEFL-----LANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPW--KEMKSELD  240
            Y+   +     LA+   +P  ++    +V+   +++    +    + P W  +EMK E  
Sbjct  193  YHQNAIGEDDFLASSFFQPVYVETKKSVVIGETLTA---GEKEQPKVPSWVVEEMKKE-R  248

Query  239  DSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
            D+  L F + + V  TFK+    +R     V C  L   F+
Sbjct  249  DTGTLTFNLRMAVWVTFKTDGWSARERGLKVFCGKLKVAFE  289



>ref|XP_008240741.1| PREDICTED: uncharacterized protein LOC103339247 [Prunus mume]
Length=255

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 90/201 (45%), Gaps = 20/201 (10%)
 Frame = -2

Query  641  ILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQAN  462
            I L+ V L ++VFL L    ++L      G   P  ++ A ++  FN+S+ +L   W   
Sbjct  60   IFLSLVALAIVVFLPLIRKELTL------GPQAPVVELTALTIHKFNVSETNLTAEWDVK  113

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGN  282
              + NPN    + F+R+E  V Y +  LA + VEPF L    K  +  R+      DG  
Sbjct  114  LKIGNPNLVSHIWFDRLEGFVLYEDRTLAIEQVEPFGLPMKTKNQVRLRLRM-VNWDGD-  171

Query  281  EREPPWKE-MKSELDDSRDL---EFQVALEVLATFKSGSDLS-RRMTFTVSCYGLTAHF-  120
              +P  K+ M  ++   R L    F V + + AT++S    S +R+     C  L   F 
Sbjct  172  --QPALKQGMLKKMKRDRKLGGVRFSVQMAIWATYRSVWGRSAQRVIMNPQCLDLHVAFV  229

Query  119  ---KDPGVGVWDGVKP-SCTV  69
                  G+G+  G  P +C V
Sbjct  230  PGATAIGLGILIGDVPRTCYV  250



>ref|XP_008353627.1| PREDICTED: protein YLS9-like [Malus domestica]
Length=236

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD--KSLAGTWQANFSVENPN  441
            + +F+I+G +   L+ ++V    +P F V + S+ +FN+S   +SL GTW   FSV NPN
Sbjct  57   VALFVIVGCIM--LVIWLVLRPKLPDFRVDSLSLTNFNVSSSSQSLTGTWSVGFSVYNPN  114

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPF  354
              L + +E VES ++Y + L+++   +PF
Sbjct  115  KKLSIRYEEVESSIFYGKGLISDXRSQPF  143



>ref|XP_009606948.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
 ref|XP_009606954.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
 ref|XP_009606960.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
 ref|XP_009606965.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
 ref|XP_009606972.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
 ref|XP_009606978.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=255

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 87/201 (43%), Gaps = 15/201 (7%)
 Frame = -2

Query  695  YYNSAPL--PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            YYN+ P    P+     R   L   + + +   +I G  A   + +++    +P F V +
Sbjct  48   YYNNNPYYQQPNPHAVQRATFLRRIIAIAIAAMVITG--AFIFIVWLILRPRLPEFRVDS  105

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
             SV + NLS+  ++  W   F+V NPN  L + ++ V + V+Y+   L++  V PF   +
Sbjct  106  LSVSNLNLSNSLISANWDLRFTVRNPNKKLTLYYDDVAAAVFYDSASLSDTTVPPFFQDK  165

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRR  162
             A+    A  ++     G       +  M  E   S  + F V +     FK+G+  +RR
Sbjct  166  RAETAQKASFAT----SGSYVENRAFDGMNKERARSSAIGFDVRMVARVRFKAGAWRARR  221

Query  161  MTFTVSCYGLTAHFKDPGVGV  99
                V C       KD  VGV
Sbjct  222  RFIRVYC-------KDLSVGV  235



>ref|XP_009356952.1| PREDICTED: uncharacterized protein At1g08160-like [Pyrus x bretschneideri]
Length=198

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 85/184 (46%), Gaps = 12/184 (7%)
 Frame = -2

Query  686  SAPLPPHVEFEPRPKILLARVILCLLV--FLILGTVAMSLLTYIVFGSAVPFFDVAAFSV  513
            SA  P H    PR K  L R+I  +L+   +ILG V   L+T+++       + +   S+
Sbjct  4    SASRPSHA---PRAKSNLIRIIAIVLLASIVILGLVV--LITWLIVRPKRLVYTIEEGSI  58

Query  512  PSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAK  333
             +FNL++  L+  +       NPN  + + ++ + + V YN+  LA   VEPF  +R   
Sbjct  59   QNFNLTNNHLSADFDFVIRSYNPNKRVSIYYDSIGATVNYNDQTLAFSGVEPFYQRRRNV  118

Query  332  MVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTF  153
                 + ++P+T    +  +    E +S       ++F V L+    FK G+  S   T 
Sbjct  119  TRFDVKFTAPSTALSSSVSKDLMLEKRSG-----KIQFDVWLKARIRFKVGALKSHHRTL  173

Query  152  TVSC  141
             VSC
Sbjct  174  RVSC  177



>ref|XP_004241340.1| PREDICTED: protein YLS9-like [Solanum lycopersicum]
Length=247

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 79/167 (47%), Gaps = 4/167 (2%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R ++ +LV   + T  +  + +IV    +P F V + +V + NLS+  +   W   F+  
Sbjct  62   RRVIAILVASTIITGTILFVIWIVILPRIPEFQVDSLNVSNLNLSNSLITANWDLRFTAR  121

Query  449  NPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREP  270
            NPN  L + ++ + + ++Y+   +A+  V PF + R  +      +S  A+  G    + 
Sbjct  122  NPNKKLTLYYDEIAAAIFYDSLSIADTTVPPFFMDRVNETT--QEVSFVAS--GAYVEKW  177

Query  269  PWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLT  129
             ++ M  E  +   + F V +    +FK+G+  +RR    V C  L+
Sbjct  178  AFEGMAKERAEKASVRFNVRMVARVSFKAGAWRARRRYLRVYCGDLS  224



>ref|XP_009349009.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=236

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 59/105 (56%), Gaps = 4/105 (4%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD--KSLAGTWQANFSVENPN  441
            + +F+I+G +   L+ ++V    +P F V + S+ +FN+S   +SL GTW   FSV NPN
Sbjct  57   VALFVIVGCIM--LVIWLVIRPKLPDFRVDSLSLTNFNVSSSSQSLTGTWSVGFSVYNPN  114

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
              L + +E VES ++Y   L+++   +PF      +  + A  S+
Sbjct  115  KKLSIRYEEVESSIFYGRGLISDTRSQPFAQGTKDRNFINATFSA  159



>ref|XP_009369914.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=236

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 59/105 (56%), Gaps = 4/105 (4%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD--KSLAGTWQANFSVENPN  441
            + +F+I+G +   L+ ++V    +P F V + S+ +FN+S   +SL GTW   FSV NPN
Sbjct  57   VALFVIVGCIM--LVIWLVIRPKLPDFRVDSLSLTNFNVSSSSQSLTGTWSVGFSVYNPN  114

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
              L + +E VES ++Y   L+++   +PF      +  + A  S+
Sbjct  115  KKLSIRYEEVESSIFYGRGLISDTRSQPFAQGTKDRNFINATFSA  159



>gb|KEH38989.1| late embryogenesis abundant protein [Medicago truncatula]
Length=232

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 60/107 (56%), Gaps = 4/107 (4%)
 Frame = -2

Query  626  VILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVEN  447
             ++CL V  I G +   ++T++V   ++P F +   S+ SFN S +SL GTW+  F+V N
Sbjct  53   TMICLAV--IFGVIL--VITWLVLRPSLPTFTLTTLSLSSFNTSSQSLTGTWRLTFNVRN  108

Query  446  PNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
             N+ L V +  + S ++Y+   +A   + PF++   ++  L A  S+
Sbjct  109  GNNKLSVNYNALRSSIFYHSNYIAESNLAPFKMDTKSEANLNATFSA  155



>ref|XP_006403802.1| hypothetical protein EUTSA_v10010982mg [Eutrema salsugineum]
 gb|ESQ45255.1| hypothetical protein EUTSA_v10010982mg [Eutrema salsugineum]
Length=294

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 83/178 (47%), Gaps = 11/178 (6%)
 Frame = -2

Query  629  RVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVE  450
            R IL  LV L++     + +T++V    +P F V  FSV +FN++    +  W AN +VE
Sbjct  101  RGILAGLVVLVVLLCISTTITWLVLRPQIPVFSVTNFSVSNFNVTGPVFSAQWTANLTVE  160

Query  449  NPNHGLDVMFERVESMVYYNEFL-----LANKMVEPFELKRNAKMVLPARISSPATRDGG  285
            NPN  L   F+R++  +Y    +     LA    +P  ++    + +   +++    +  
Sbjct  161  NPNSKLKGYFDRIQGFIYNQNAIGEDDFLAKAFFQPVYVETKKSVSIGETLTA---GEKE  217

Query  284  NEREPPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
              + P W  +EMK E  ++  + F + + V  TFK+    +R     V C  L   F+
Sbjct  218  QPKVPSWVGEEMKKE-RETGTVSFDLRMAVWVTFKTEGWSARESGLKVFCGKLKVAFE  274



>ref|XP_008243645.1| PREDICTED: uncharacterized protein LOC103341867 [Prunus mume]
Length=459

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 86/188 (46%), Gaps = 13/188 (7%)
 Frame = -2

Query  626  VILCLLVFLILGTVA-----MSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQAN  462
            +IL     LI GT+A     MSLL+ +      P   + +  +  FN+S+ +L   W   
Sbjct  42   IILLSPTLLIFGTLALLCIFMSLLSQV--HPKAPNVQLNSLFMSKFNISNTTLGANWDMT  99

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGN  282
             +++NPN    V F  ++  + Y + +LA   VEPF L    +  +  +IS+    + G 
Sbjct  100  LTIDNPNLVTWVRFNHIKGSISYKDNILAISSVEPFMLGLKERRTVRVKISTMGLGEEGR  159

Query  281  EREPPWK-----EMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-  120
            + +   K     EM S   ++  + F + + V AT+++G   ++ +  +  C  L   F 
Sbjct  160  DHQLVVKNRVLDEMMSRRRENGAVHFSMQMFVWATYRTGWWGTQDVVISPQCMDLKVGFS  219

Query  119  KDPGVGVW  96
            +  G G W
Sbjct  220  RGIGFGSW  227



>ref|XP_004172133.1| PREDICTED: uncharacterized protein At1g08160-like [Cucumis sativus]
 gb|KGN48048.1| hypothetical protein Csa_6G425850 [Cucumis sativus]
Length=248

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 79/166 (48%), Gaps = 9/166 (5%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD  492
            P+       ++   R ++  ++ + + T  +  + ++V    +P F V +F V +F+ + 
Sbjct  48   PYDSTHHNARLSFLRALIAGIIVVFIITAVILFIIWLVLRPQLPEFRVDSFQVTNFSTAA  107

Query  491  KSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
            K+L+ +W   FSV NPN  + V ++ ++S ++YN   L +  V PF  ++  + V+ A  
Sbjct  108  KTLSASWFIGFSVFNPNKKMTVSYDFIDSTLFYNNEFLTDTRVPPFAQEKKTQSVVNASF  167

Query  311  SSPATRDGGNEREPPWKEMKSELDDSR--DLEFQVALEVLATFKSG  180
            S+ +     +        +    DD R   ++F V +     F++G
Sbjct  168  SALSAYVEAS-------SLNKINDDRRRGTIKFNVGISARVGFRAG  206



>ref|XP_007205847.1| hypothetical protein PRUPE_ppa011071mg [Prunus persica]
 gb|EMJ07046.1| hypothetical protein PRUPE_ppa011071mg [Prunus persica]
Length=225

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 56/104 (54%), Gaps = 4/104 (4%)
 Frame = -2

Query  659  FEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD--KS  486
            + PR   +   V   + +F+I+G +   L+ +++    VP F V + S+ +FN+S   +S
Sbjct  42   YNPRAAFIRRFVGAMIALFVIVGCIL--LVVWLILRPKVPDFRVDSLSLSNFNVSSASQS  99

Query  485  LAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF  354
            + GTW   F V NPN  L + ++ VES +YY    ++   V PF
Sbjct  100  VTGTWSVGFMVYNPNKKLSIRYDDVESSIYYGPGFISGTRVPPF  143



>ref|XP_006408687.1| hypothetical protein EUTSA_v10002076mg [Eutrema salsugineum]
 gb|ESQ50140.1| hypothetical protein EUTSA_v10002076mg [Eutrema salsugineum]
Length=265

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 80/165 (48%), Gaps = 10/165 (6%)
 Frame = -2

Query  671  PHVEFEPRPK-ILLARVILCLLVFL-ILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNL  498
            P+   EP P+ ILL R+ + +LVFL ILG +  S +  +V    +P   + + SV +FN+
Sbjct  68   PYFATEPNPRAILLRRLFIAILVFLLILGLI--SFIFILVVRPQLPVVFINSLSVSNFNV  125

Query  497  SDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPA  318
            S+  + G W       NPN  + + ++ V   +YY    L++  ++PF+     +  + A
Sbjct  126  SNNQVTGNWDLQLQFRNPNSKMALHYDSVFCTLYYGRESLSDTRLQPFDQGTEDQTPINA  185

Query  317  RISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKS  183
             ++   T   G   +   KE  S+     ++EF   L V +T  S
Sbjct  186  TLAVSGTYVDGKLADSIGKERASK----GNVEFN--LRVFSTVTS  224



>ref|XP_003543419.1| PREDICTED: uncharacterized protein LOC100780672 [Glycine max]
Length=271

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 87/187 (47%), Gaps = 13/187 (7%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRP--KILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            YYN+   PP   +  R   +   A +I CL V  + G V   ++T++V   ++P F + +
Sbjct  69   YYNTT-YPPPRSYASRSFFRAFFATMI-CLAV--VFGVVL--IITWLVLRPSLPHFTLHS  122

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
             SV + + + +SL+ TW  +F V N N  + V +  + S ++Y +  ++   + PF    
Sbjct  123  LSVSNLSSTSQSLSATWHLSFLVRNGNKKMTVSYNALRSSIFYRQNYISESQLAPFRQDT  182

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRR  162
             ++  L A +++      G   EP   +  +   ++  + F V +    +F+SGS   R 
Sbjct  183  RSQTTLNATLTA-----AGTYLEPKLIDNLNAERNASSVLFDVQVVAATSFRSGSWRFRT  237

Query  161  MTFTVSC  141
                V C
Sbjct  238  RVLKVLC  244



>ref|XP_004140265.1| PREDICTED: uncharacterized protein At1g08160-like [Cucumis sativus]
Length=243

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 78/159 (49%), Gaps = 11/159 (7%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTW  471
            R   L A +   ++VF+I  T  +  + ++V    +P F V +F V +F+ + K+L+ +W
Sbjct  57   RLSFLRALIAGIIVVFII--TAVILFIIWLVLRPQLPEFRVDSFQVTNFSTAAKTLSASW  114

Query  470  QANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRD  291
               FSV NPN  + V ++ ++S ++YN   L +  V PF  ++  + V+ A  S+ +   
Sbjct  115  FIGFSVFNPNKKMTVSYDFIDSTLFYNNEFLTDTRVPPFAQEKKTQSVVNASFSALSAYV  174

Query  290  GGNEREPPWKEMKSELDDSR--DLEFQVALEVLATFKSG  180
              +        +    DD R   ++F V +     F++G
Sbjct  175  EAS-------SLNKINDDRRRGTIKFNVGISARVGFRAG  206



>ref|XP_002322792.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEF04553.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=273

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 62/117 (53%), Gaps = 1/117 (1%)
 Frame = -2

Query  623  ILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENP  444
            IL  ++FL++    + L+  +     +P F V  FSV +FN +  +    W+A  SV+NP
Sbjct  86   ILSTIIFLVMFIFTLQLIMLLALRPELPVFHVEDFSVLNFNATMPTFTAIWEAYVSVKNP  145

Query  443  NHGLDVMFERVESMVYYN-EFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNER  276
            N  L + F  + S +YY+ +++LA+     F ++   + V+ AR+S+  T +    R
Sbjct  146  NTRLKIDFGPIHSHMYYDKDYILASANSPKFSMETKTRNVIHARLSANNTDNSVESR  202



>gb|KFK32407.1| hypothetical protein AALP_AA6G237800 [Arabis alpina]
Length=242

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 82/172 (48%), Gaps = 6/172 (3%)
 Frame = -2

Query  653  PR-PKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
            PR P+ +L R +  +L   +L    + ++  IV    +P   + + SV +FN+S+  ++G
Sbjct  50   PRNPRAVLLRRLFIVLTAFLLVLGLILIVFLIVVRPQLPNVYINSLSVSNFNVSNSQVSG  109

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPAT  297
             W  N    NPN  + + ++ V   VYY    L++  ++PF+  +  +  L A +S   T
Sbjct  110  KWDLNLLFRNPNSKMSLHYDTVLCSVYYGRASLSDTRLQPFDQGKRDETPLNATLSVSGT  169

Query  296  RDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
               G   +   KE  S+     ++EF + +    TF+ G+   RR   T+ C
Sbjct  170  YVDGRLADSIAKERASK----GNVEFNLRMLSWVTFRYGA-FRRRRWLTIYC  216



>ref|XP_010487808.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=245

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 85/178 (48%), Gaps = 5/178 (3%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS  495
            P +   +P P+ +L R +  + +  +L    +  + ++V    +P   + + SV +FN+S
Sbjct  47   PYYAPQQPNPRAVLIRRLFIVFMAFLLILGLILFIFFLVVRPQLPDVYLNSLSVSNFNVS  106

Query  494  DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPAR  315
            +  ++G W     + NPN  + + ++ + + +YY+   L+   ++PFE  +  + V+ A 
Sbjct  107  NNQVSGKWDVQVQIRNPNSKMSLYYDSILAALYYHRASLSETRLQPFEQGKKDQTVVNAT  166

Query  314  ISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
            +S   T   G   +   KE  ++      +EF + +    TF+ G+   RR   TV C
Sbjct  167  LSVSGTYVEGRLADDIGKERGAK----GSVEFDLRMISSVTFRYGA-FRRRRFVTVYC  219



>ref|XP_010557439.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=238

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/186 (24%), Positives = 84/186 (45%), Gaps = 9/186 (5%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS  495
            PP     PR  +     I+ + V L+LG      + ++V    +P  ++ + SV  F +S
Sbjct  44   PPQTN--PRAALYRRLFIIFMAVLLVLGFAL--FIFFLVARPRLPDVNINSVSVSRFIVS  99

Query  494  DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPAR  315
            + +++G W   F   NPN  + + ++ V+S V+Y   LL+   + PF+     +  + A 
Sbjct  100  NSTISGEWDVQFQFRNPNSRMSLYYDDVDSGVFYRRSLLSESHLPPFDQGTKDQTAINAT  159

Query  314  ISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYG  135
            +S+ +    G   +     M  E      + F + L  +  F+ G+ + RR   TV C G
Sbjct  160  LSTVSNYLEGRLLD----SMGRERAAHGVVAFDLQLTSIVGFRYGA-IRRRRFVTVVCIG  214

Query  134  LTAHFK  117
            +  + +
Sbjct  215  VAVNLR  220



>ref|XP_009349088.1| PREDICTED: protein YLS9-like [Pyrus x bretschneideri]
Length=258

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/202 (23%), Positives = 82/202 (41%), Gaps = 15/202 (7%)
 Frame = -2

Query  659  FEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA  480
            F  +P +L   +I  + +F ++  +  S ++++V    +P F V + SV   N +   L 
Sbjct  65   FRRKPTVLCRIIIAAVALFAVMSII--SFISWLVLRPQLPEFRVESASVSPLNATSSELT  122

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPA  300
             TW       NPNH L + ++R+ +   Y    L    + PF   +  +  +  ++++  
Sbjct  123  ATWDFTLLAANPNHKLTIFYDRLTASPVYGRVPLTTAALPPFVSAKRNQTRVNFKLATVG  182

Query  299  TRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSRRMTFTVSCYGL-  132
               G N        +   + D +D   + F V +     FKSG   SR     V C  + 
Sbjct  183  EYVGDN--------VARGIADGKDRGSVRFGVWVAAWVRFKSGVFQSRSRLLQVYCNRVE  234

Query  131  -TAHFKDPGVGVWDGVKPSCTV  69
             T   ++ G G   G    C V
Sbjct  235  FTGFARNNGTGTLTGQSSPCEV  256



>ref|XP_008449592.1| PREDICTED: uncharacterized protein At1g08160 [Cucumis melo]
Length=248

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -2

Query  644  KILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQA  465
            ++   R ++  ++ + + T  +  + ++V    +P F V +F V +F+ + +SL+ +W  
Sbjct  57   RLSFLRALIAGIIVVFIITAVILFIIWLVLRPQLPEFRVDSFQVTNFSTAAQSLSASWFI  116

Query  464  NFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
             FSV NPN  + V ++ V+S ++YN   L    V PF   +  +  + A +SS
Sbjct  117  GFSVFNPNKKMTVSYDFVDSTLFYNNEFLTETRVPPFTQDKRTQSFVNASLSS  169



>ref|NP_565642.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 gb|AAK17140.1|AF325072_1 unknown protein [Arabidopsis thaliana]
 gb|AAD42003.1| expressed protein [Arabidopsis thaliana]
 gb|AAK83643.1| At2g27260/F12K2.16 [Arabidopsis thaliana]
 gb|AAM10380.1| At2g27260/F12K2.16 [Arabidopsis thaliana]
 gb|AEC07965.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=243

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/177 (23%), Positives = 82/177 (46%), Gaps = 5/177 (3%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD  492
            P+   +P P+ ++ R +  +    +L    +  + +++    +P  ++ + SV +FN+S+
Sbjct  46   PYYAPQPNPRAVIIRRLFIVFTTFLLLLGLILFIFFLIVRPQLPDVNLNSLSVSNFNVSN  105

Query  491  KSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
              ++G W       NPN  + + +E     +YYN   L+   ++PF+  +  + V+ A +
Sbjct  106  NQVSGKWDLQLQFRNPNSKMSLHYETALCAMYYNRVSLSETRLQPFDQGKKDQTVVNATL  165

Query  311  SSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
            S   T   G   +   KE   +     ++EF + +    TF+ G+   RR   TV C
Sbjct  166  SVSGTYVDGRLVDSIGKERSVK----GNVEFDLRMISYVTFRYGA-FRRRRYVTVYC  217



>ref|XP_009605492.1| PREDICTED: protein YLS9-like [Nicotiana tomentosiformis]
Length=251

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 79/166 (48%), Gaps = 5/166 (3%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANF  459
            LL R I  ++   I+ T  +  + +++    +P F + + ++ + NLS+  +   W  +F
Sbjct  64   LLRRAIAIIVASTII-TGTILFILWLLISPRIPEFQIDSLTMSNLNLSNSLITANWDLHF  122

Query  458  SVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            + +NPN  + + ++ + + ++Y+   +A+  V PF + +  +     +IS  A+  G   
Sbjct  123  TAKNPNKKMTLYYDEIAAAIFYDSLSIADTTVPPFFMDKGNETA--QKISFVAS--GAYV  178

Query  278  REPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
             +  +  M  E   S  + F V +     FK+G+  +RR    V C
Sbjct  179  EKWAFDGMNKEKAQSGSIGFNVRMVARVGFKAGAWRARRRYLRVYC  224



>ref|XP_008391967.1| PREDICTED: uncharacterized protein At1g08160-like [Malus domestica]
Length=258

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 82/203 (40%), Gaps = 17/203 (8%)
 Frame = -2

Query  659  FEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA  480
            F  +P +L   +I  + VF ++  +    ++++V    +P F V + SV   N +   L 
Sbjct  65   FRRKPTVLCRIIIAAVAVFAVMSIIF--FISWLVLRPQLPXFRVESASVSPLNATSSELT  122

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-ELKRNAKMVLPARISSP  303
             TW       NPNH L + ++R+ +   Y    L    V PF   KRN       R++  
Sbjct  123  ATWDFTLLATNPNHKLTIFYDRLTASPVYGGVPLTTAAVPPFVSAKRNQ-----TRVNFK  177

Query  302  ATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSRRMTFTVSCYGL  132
                G   R+    ++   + D +D   + F V +     FKSG   SR     V C  +
Sbjct  178  LAMVGEYVRD----DVARGIADGKDRGSVRFGVWVAAWVRFKSGVFQSRSRLLRVYCNRV  233

Query  131  --TAHFKDPGVGVWDGVKPSCTV  69
              T   ++ G G   G    C V
Sbjct  234  EFTGFARNNGTGTLTGQSSPCEV  256



>ref|XP_007016047.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
 gb|EOY33666.1| Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
Length=202

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 84/181 (46%), Gaps = 9/181 (5%)
 Frame = -2

Query  656  EPRPKILLARVI-LCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA  480
            +P   I L R +  CLL  ++L  +A+ L+T+++       + +   S+ +FNL++  L 
Sbjct  14   QPPKHINLVRFLATCLLALIVLVGLAV-LITWLIIRPKRFVYTMENGSIQNFNLTNNHLN  72

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEP-FELKRNAKMVLPARISSP  303
             T+       NPN  + + ++ +ES V Y +  LA   VEP F+  RNA      R+ S 
Sbjct  73   ATFDFVLKAYNPNSRISLYYDYMESAVTYEDQTLAFNTVEPFFQPHRNA-----TRVESK  127

Query  302  ATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAH  123
             T          +K++K E   S +++  V  +    FK G   SR     + C  +T H
Sbjct  128  LTAQNLALSPSIFKDIKVE-KASGEIQVDVHFKSKIRFKVGVWKSRHRILRIVCSSVTVH  186

Query  122  F  120
            F
Sbjct  187  F  187



>gb|KDP36126.1| hypothetical protein JCGZ_08770 [Jatropha curcas]
Length=262

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 75/161 (47%), Gaps = 9/161 (6%)
 Frame = -2

Query  656  EPRPKILLARVIL-CLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA  480
             P  + LL R    C+  FL++  V   L +YI     +P F V + ++   NL+   L 
Sbjct  69   HPIRRTLLHRAFFFCMTAFLVM--VLFVLTSYIALKPHLPEFRVDSAAISQLNLTQSELT  126

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYY-NEFLLANKMVEPFELKRNAKMVLPARISSP  303
             TW     V+NPN  L + ++R+++ V+Y +E  LA   + PF   RN +  +  ++ + 
Sbjct  127  ATWLFTLLVKNPNDKLRIQYDRLKASVFYGDELELATNNLPPFFQDRNNESTVKFQLDAI  186

Query  302  ATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSG  180
                G +  E   KE      DS  ++F V +     +++G
Sbjct  187  TKYVGEDAVEEISKER-----DSGSIDFGVRVFAWVRYRTG  222



>ref|XP_010503988.1| PREDICTED: uncharacterized protein LOC104781090 [Camelina sativa]
Length=304

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 76/161 (47%), Gaps = 11/161 (7%)
 Frame = -2

Query  578  SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMV  399
            + +T+++    +P F +  FSV +FN++    +  W AN ++EN N  L   F+R++ +V
Sbjct  127  TTITWLILRPQIPVFSLNNFSVSNFNVTGPVFSPQWTANLTIENQNTKLKGYFDRIQGLV  186

Query  398  YYNEFL-----LANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPW--KEMKSELD  240
            Y+   +     LA    +P  ++    + +   +++    +    + P W   EMK E  
Sbjct  187  YHQNAIGEDDFLATAFFQPVFVETKKSVAIGETLTA---GEKEQPKIPSWVVDEMKKE-R  242

Query  239  DSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
            ++  + F + + V  TFK+   ++R     V C  L   F+
Sbjct  243  ETGTVTFNLRMAVWVTFKTDGWVARERGLKVFCGKLKVGFE  283



>ref|XP_009776258.1| PREDICTED: protein YLS9-like [Nicotiana sylvestris]
Length=248

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/187 (21%), Positives = 87/187 (47%), Gaps = 8/187 (4%)
 Frame = -2

Query  695  YYNSAPLP--PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            Y+N+ P    P+     R  +L   + + +   +I GT+   L  +++    +P F + +
Sbjct  41   YFNNNPYHHYPNPYASQRNTLLRRAIAIIVASTIITGTILFIL--WLLISPRIPEFQIDS  98

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
             ++ + NLS+  +   W  +F+ +NPN  + + ++ + + ++++   +A+  V PF + +
Sbjct  99   LTISNLNLSNSLITANWDLHFTAKNPNKKMTLYYDEIAAAIFFDSLSVADTTVPPFFMDK  158

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRR  162
              +     ++S  A+  G    +  +  M  E   S  + F V +     FK+G+  +RR
Sbjct  159  GNETA--QKVSFVAS--GAYVEKWAFDGMNKEKAQSGSIGFNVRMVARVGFKAGAWRARR  214

Query  161  MTFTVSC  141
                V C
Sbjct  215  RYLRVYC  221



>ref|XP_002874099.1| hypothetical protein ARALYDRAFT_910289 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50358.1| hypothetical protein ARALYDRAFT_910289 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 82/183 (45%), Gaps = 10/183 (5%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS-DKSLAGT  474
            RP  L+  V L +L  + +  V   L+T++V       + V + SV +FNL+ D  ++ T
Sbjct  23   RPS-LVCYVFLVILTLIFIAAVGF-LITWLVTKPKKLHYTVESASVRNFNLTNDNHMSAT  80

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR-NAKMVLPARISSPAT  297
            ++      NPNH + V +  VE  V + +  LA   +EPF   R N K +    ++    
Sbjct  81   FKFTIQSHNPNHRISVYYSSVEIFVKFKDQTLAFDTMEPFHQPRMNVKQIDETLVAQNVA  140

Query  296  RDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
                N      K+++S+    + +EF+V ++    FK G   S   T  + C  +T    
Sbjct  141  FSKSNG-----KDLRSQTSLGK-IEFEVFVKARVRFKVGIWKSSHRTAKIECSHVTVSLS  194

Query  116  DPG  108
             P 
Sbjct  195  QPN  197



>ref|XP_010426861.1| PREDICTED: uncharacterized protein LOC104711796 [Camelina sativa]
Length=306

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 77/166 (46%), Gaps = 21/166 (13%)
 Frame = -2

Query  578  SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMV  399
            + +T+++    +P F +  FSV +FN++    +  W AN ++EN N  L   F+R++ +V
Sbjct  129  TTITWLILRPQIPVFSLNNFSVSNFNVTGPVFSPQWTANLTIENQNTKLKGYFDRIQGLV  188

Query  398  YYNEFL-----LANKMVEP--FELKRNAKMVLPARISSPATRDGGNEREPP---W--KEM  255
            Y+   +     LA    +P   E K++A +          T   G + +P    W   EM
Sbjct  189  YHQNAIGEDDFLATAFFQPVFVETKKSAAI--------GETLTAGEKEQPKIPSWVVDEM  240

Query  254  KSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
            K E  ++  + F + + V  TFK+   ++R     V C  L   F+
Sbjct  241  KKE-RETGTVTFNLRMAVWVTFKTDGWVARERGLKVFCGKLKVGFE  285



>ref|XP_008392042.1| PREDICTED: uncharacterized protein LOC103454227 [Malus domestica]
Length=229

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 85/197 (43%), Gaps = 6/197 (3%)
 Frame = -2

Query  680  PLPPHVEFEPRPKILLARVILCLLVFLILGTVAM-SLLTYIVFGSAVPFFDVAAFSVPSF  504
            P  P +      + +   V++   + L LGT  +  +  Y    S  P   + +  V   
Sbjct  22   PSNPIISDSXTSRCVAKLVLVHRALLLALGTFTLLCVFMYTSIISESPKIRIDSLFVSKL  81

Query  503  NLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVL  324
            ++S+ SL   W   F++ENPN    V F+ +E  + Y +  L+   V PFEL       L
Sbjct  82   DVSNTSLGVNWDVAFTIENPNLVSWVQFKSIEGSISYEDNPLSKFHVGPFELGLKEHKRL  141

Query  323  PARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVS  144
              + S+  + +G   R   ++E+K + +D   + F + L   AT+ +G   ++ +T    
Sbjct  142  RVKFSTTVSHEG---RPVLFEEIKRQQEDGA-MNFNMHLFAWATYGNGWWGTQNVTMEXQ  197

Query  143  CYGLTAHF-KDPGVGVW  96
            C  L   F    G G W
Sbjct  198  CLNLRVSFLPKVGFGSW  214



>ref|XP_010248449.1| PREDICTED: protein YLS9-like [Nelumbo nucifera]
Length=242

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 72/154 (47%), Gaps = 19/154 (12%)
 Frame = -2

Query  581  MSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESM  402
            +S+  + +    VP   V +FSV +FNLS   L   W    +V NP+  + ++++RV ++
Sbjct  73   ISIAAWFILPPQVPEIRVESFSVSNFNLSSSILTAKWDVAMNVNNPSEKVGMVYDRVHTL  132

Query  401  VYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELD-----D  237
            V + E +L  K + PF L++  +  L  + ++ +            + M+  LD     D
Sbjct  133  VLFGERILTAKFLPPFYLEKRDQTTLNVKFTADS------------EYMEGVLDEIMQVD  180

Query  236  SRDLE--FQVALEVLATFKSGSDLSRRMTFTVSC  141
             R+ E  F + +    TFK+G     + +  V C
Sbjct  181  RRNGEMLFNLRMTAFITFKNGIWTLSKQSVRVYC  214



>ref|XP_010480378.1| PREDICTED: protein YLS9-like, partial [Camelina sativa]
Length=194

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/172 (23%), Positives = 82/172 (48%), Gaps = 5/172 (3%)
 Frame = -2

Query  656  EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
            +P P+ +L R +  + +  +L    +  + ++V    +P   + + SV +FN+S+  ++G
Sbjct  2    QPNPRAVLIRRLFIVFMAFLLILGLILFIFFLVVRPQLPDVYLNSLSVSNFNVSNNQVSG  61

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPAT  297
             W     + NPN  + + ++ +   + Y+   L++  ++PFE  +  + V+ A +S   T
Sbjct  62   KWDLQVQIRNPNSKMSLYYDSILCALSYHRASLSDTRLQPFEQGKKDQTVVNATLSVSGT  121

Query  296  RDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
               G   +   KE  ++      +EF + +    TF+ G+   RR   TV C
Sbjct  122  YVEGRLADDIGKERGAK----GSVEFDLRIISYVTFRYGA-FRRRRYVTVYC  168



>ref|XP_002879078.1| hypothetical protein ARALYDRAFT_481623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55337.1| hypothetical protein ARALYDRAFT_481623 [Arabidopsis lyrata subsp. 
lyrata]
Length=243

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/187 (24%), Positives = 84/187 (45%), Gaps = 11/187 (6%)
 Frame = -2

Query  695  YYNSAPL--PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            Y N  P   PP    +P P+ ++ R +  + +  +L    +  + ++V    +P   + +
Sbjct  40   YQNHNPYYAPP----QPNPRAVIIRRLFIVFMTFLLILGLILFIFFLVVRPQLPDVYLNS  95

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
             SV +FN+S+  ++G W       NPN  + + ++     +YYN   L+   ++PF+  +
Sbjct  96   LSVSNFNVSNNQVSGKWDLQVQFRNPNSKMSLHYDAALCAMYYNRVSLSETRLQPFDQGK  155

Query  341  NAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRR  162
              + V+ A +S   T   G   +   KE       +  +EF + +    TF+ G+   RR
Sbjct  156  KDQTVVNATLSVSGTYVDGRLADSIGKERSV----TGSVEFDLRMISYVTFRYGA-FRRR  210

Query  161  MTFTVSC  141
               TV C
Sbjct  211  RYVTVYC  217



>ref|XP_006304143.1| hypothetical protein CARUB_v10010132mg [Capsella rubella]
 gb|EOA37041.1| hypothetical protein CARUB_v10010132mg [Capsella rubella]
Length=244

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 84/177 (47%), Gaps = 5/177 (3%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD  492
            P+   +P P+ +L R +  + +  +L    +  + ++V    +P   + + SV +FN+S+
Sbjct  47   PYYAPQPNPRAVLFRRLFIVFMAFLLILGLILFIFFLVVRPQLPDVYLNSLSVSNFNVSN  106

Query  491  KSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
              ++G W     + NPN  + + ++ +  ++YY+   L++  + PF   +  + V+ A +
Sbjct  107  NQVSGKWDLQAQIRNPNSKMSLYYDSLGCLLYYHRAPLSDTRLPPFSQGKKDQTVVNATL  166

Query  311  SSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
            S   T   G   +   KE  ++      +EF + +    TF+ G+   RR   +V C
Sbjct  167  SVSGTYVEGRLADAIAKERGAK----GSVEFDLRMGSFVTFRYGA-FRRRRYVSVYC  218



>ref|XP_010685426.1| PREDICTED: protein YLS9-like [Beta vulgaris subsp. vulgaris]
Length=245

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 79/171 (46%), Gaps = 17/171 (10%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFF--DVAAFSVPSFNLSDKSLAGTWQANFSVENPN  441
            + VF+I G +   L+ ++V    +P F  D  + S  + + S   ++G+W   FSV NPN
Sbjct  66   IAVFIIFGVIL--LIVWLVLRPRIPSFTVDSLSLSSLNVSNSPSQISGSWSLQFSVSNPN  123

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPFEL-KRNAKMVLPARISSPATRDGGNEREPPW  264
            H L V ++ +++ ++Y   L+    + PF+   +N   +    ++S A  D         
Sbjct  124  HKLHVYYDEIDARLFYRNSLITQNQLPPFDQGTKNITSMDAHLVASSAYID---------  174

Query  263  KEMKSELDDSR---DLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF  120
              + S ++  R    + F V +  L  FK+G   +RR    V C  L+  F
Sbjct  175  SNLGSRINGDRSRGSVNFDVQVIALVRFKAGGWRARRRFLRVFCDDLSVGF  225



>ref|XP_008351503.1| PREDICTED: uncharacterized protein At1g08160-like [Malus domestica]
Length=258

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 81/203 (40%), Gaps = 17/203 (8%)
 Frame = -2

Query  659  FEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA  480
            F  +P +L   +I  + VF ++  +    ++++V    +P F V + SV   N +   L 
Sbjct  65   FRRKPTVLCRIIIAAVAVFAVMSIIF--FISWLVLRPQLPXFRVESASVSPLNATSSELT  122

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-ELKRNAKMVLPARISSP  303
             TW       NPNH L + ++R+ +   Y    L    V PF   KRN       R++  
Sbjct  123  ATWDFTLLATNPNHKLTIFYDRLTASPVYGGVPLTTAAVPPFVSAKRNQ-----TRVNFK  177

Query  302  ATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSRRMTFTVSCYGL  132
                G    E    ++   + D +D   + F V +     FKSG   SR     V C  +
Sbjct  178  LAMVG----EYVXDDVARGIADGKDRGSVXFGVWVAAWVRFKSGVFQSRSRLLRVYCNRV  233

Query  131  --TAHFKDPGVGVWDGVKPSCTV  69
              T   ++ G G   G    C V
Sbjct  234  EFTGFARNNGTGTLTGQSSPCEV  256



>ref|XP_008245745.1| PREDICTED: uncharacterized protein At1g08160-like [Prunus mume]
Length=183

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD--KSLAGTWQANFSVENPN  441
            + +F+I+G +   L+ +++    VP F V + S+ +FN+S   +S+ GTW   F V NPN
Sbjct  4    IALFVIVGCIL--LVVWLILRPKVPDFRVDSLSLSNFNVSSSSQSVTGTWSVGFMVYNPN  61

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPF  354
              L + ++ VES +YY    ++   + PF
Sbjct  62   KKLSIRYDDVESSIYYGPGFISGTRIPPF  90



>ref|XP_010912375.1| PREDICTED: protein YLS9-like [Elaeis guineensis]
Length=284

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 96/209 (46%), Gaps = 23/209 (11%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS-  495
            PH  F  R   LLA   + +  FL++G    +L+ ++V    +P F V++ SV +FN S 
Sbjct  89   PHTRFLRR---LLA---IAVAFFLLMGLA--TLIIWLVLRPRLPAFAVSSASVSAFNFSA  140

Query  494  -DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-ELKRNAKMVLP  321
              + L+  +  + SV+NPNH + + ++ VE+ V Y    +A+  + PF + K NA  V  
Sbjct  141  PQQLLSSDFDISLSVQNPNHKMGIYYDSVEAAVLYGSDNIADTSLPPFYQAKGNATTVRA  200

Query  320  ARISSPATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSRRMTFT  150
              +++    +    +           D  R+   + F V++     F +G+  +RR    
Sbjct  201  HLVAAAEYVEDDVAK-------GIAADRGRNDGVVNFHVSVWAWVRFNAGAWRTRRHLMR  253

Query  149  VSCYGLTAHFKD--PGVGVWDGVKPSCTV  69
            V C  ++  FK+    VG   G    C V
Sbjct  254  VYCEDVSIGFKNGTATVGSLVGSPKRCEV  282



>ref|XP_008385491.1| PREDICTED: uncharacterized protein At1g08160-like [Malus domestica]
Length=198

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 80/173 (46%), Gaps = 9/173 (5%)
 Frame = -2

Query  653  PRPKILLARVILCLLV--FLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA  480
            P+ K  L R I  +L+   +ILG V   L+T+++       + +   S+ +FNL++  L+
Sbjct  12   PKAKSNLIRTIAIVLLASIVILGLVV--LITWLIVRPKRLVYTIEDGSIQNFNLTNNHLS  69

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPA  300
              +       NPN  + + ++ + + V YN+  LA   +EPF  +R        + ++P+
Sbjct  70   ADFDFVIRSYNPNKRVSIYYDSIGATVNYNDQTLAFSGIEPFYQRRRNVTRFDVKFTAPS  129

Query  299  TRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
            T    +  +    E +S       ++F V L+    FK G+  S   T  VSC
Sbjct  130  TALSSSVSKDLMLEKRSG-----KIQFDVWLKARIRFKVGALKSHHRTLRVSC  177



>emb|CDX77105.1| BnaC04g39000D [Brassica napus]
Length=238

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (45%), Gaps = 4/161 (2%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD  492
            PH   +P P+ +L R +       +L    +  + +IV    +P   + + SV +F +SD
Sbjct  42   PHYAPQPSPRAVLLRRLFTAFTVFLLILGLILFIFFIVVRPQLPTVYLNSLSVSNFTVSD  101

Query  491  KSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
              LAG W      +NPN  + + ++ V   +YY+   L+   ++PF+L    +  + A +
Sbjct  102  NRLAGNWDLRLQFQNPNSKMSLHYDGVSCALYYDRASLSETRLQPFDLGTKDQTPVNATL  161

Query  311  SSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATF  189
            S   T   G   +     +  E  +   +EF + +  L TF
Sbjct  162  SVSGTYVDGRLVD----SIGKERGEKGSVEFDLRVVSLVTF  198



>ref|XP_009350003.1| PREDICTED: uncharacterized protein LOC103941519 [Pyrus x bretschneideri]
Length=403

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 75/169 (44%), Gaps = 11/169 (7%)
 Frame = -2

Query  542  PFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMV  363
            P   + +  +  FN S+ +L   W+ + +VENPN    V F  V   + Y ++ +A   V
Sbjct  10   PNVQLNSLFMSKFNTSNTTLGANWEMSLTVENPNLVTWVRFNHVRGSISYKDYFVAISSV  69

Query  362  EPFELKRNAKMVLPARISSPAT--RDGGNEREPPWKEMKSELDD--SRDLE-----FQVA  210
            EPFEL      ++  +ISS  T   +  +    P   MK  LD+  SR  E     F + 
Sbjct  70   EPFELGLKESKMIRLKISSKMTWSEEDYHRLGLPVVIMKWGLDEMLSRQREDGAVHFNLQ  129

Query  209  LEVLATFKSGSDLSRRMTFTVSCYGLTAHFK-DPGVGVWDGVKP-SCTV  69
            + V AT+K+G    + +  +  C  +        G G W    P SC+V
Sbjct  130  MFVWATYKTGWWGEQHVVMSPQCLDMKVELSPRIGFGSWISGGPMSCSV  178



>ref|XP_006481532.1| PREDICTED: protein YLS9-like isoform X1 [Citrus sinensis]
Length=253

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 72/174 (41%), Gaps = 11/174 (6%)
 Frame = -2

Query  575  LLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVY  396
            L+ ++V    +P F + + SV +F+ +   + G W A     NPN  + V +  V S +Y
Sbjct  72   LIFWLVVRPRIPEFHLTSLSVSNFSTNQSQVTGNWDAAIEAYNPNKKMRVSYYDVVSGIY  131

Query  395  YNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSR---DL  225
            Y+   L    + PF      +  L A+ S     D   ER     ++   ++  R    +
Sbjct  132  YDGNYLTRTPLPPFSQDTRERTPLSAKFS---VIDSYVER-----KVLDSINAERARGAV  183

Query  224  EFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVGVWDGVKPSCTVLF  63
            +F   LE +A FK G   +RR    V C  +  +    G G   G    C VL 
Sbjct  184  KFDFRLEAIAGFKYGGWRTRRRLVRVWCPDVPVNVSSKGSGSLVGGARKCRVLL  237



>ref|XP_009349979.1| PREDICTED: uncharacterized protein LOC103941503 [Pyrus x bretschneideri]
Length=229

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 84/196 (43%), Gaps = 11/196 (6%)
 Frame = -2

Query  647  PKILLARVILCLLVFLILGTVAM-SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTW  471
            PK++L    L     L LGT  +  +  Y    S  P   + +  V   N+S+ S    W
Sbjct  37   PKLVLVHRSL----LLALGTFTLLCVFMYTSIISESPKIRIDSLFVSKLNVSNTSFGVNW  92

Query  470  QANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRD  291
               F++ENPN    V F+ +E  + Y +  L+   V  FEL       L  + S+  + +
Sbjct  93   DVAFTIENPNLVSWVQFKSIEGSISYEDNPLSKFPVGQFELGLQEHKRLRVKFSTTVSHE  152

Query  290  GGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-KD  114
            G   R   ++E+K + +D   + F + L   AT+ +G   ++ +T    C  L   F   
Sbjct  153  G---RSGLFEEIKRQQEDGA-MNFNMHLFAWATYSNGWWGTQDVTMEAQCLNLRVGFLPK  208

Query  113  PGVGVWDGVKP-SCTV  69
             G G W    P +C+ 
Sbjct  209  VGFGSWISGGPMTCST  224



>ref|XP_008243646.1| PREDICTED: uncharacterized protein LOC103341868 [Prunus mume]
Length=291

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 78/152 (51%), Gaps = 9/152 (6%)
 Frame = -2

Query  623  ILCLLVFL-ILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNL--SDKSLAGTWQANFSV  453
              C+++FL ++ T+  S++ ++V     P F V +FSV +FNL    K L+G W+A+  V
Sbjct  96   CFCIIMFLLVIFTLLASIVMFVVVRPETPAFKVESFSVSNFNLVPGSKVLSGKWEASIYV  155

Query  452  ENPNHGLDVMFERVESMVYYNE-FLLANKMVEPFELKRNAKMVLPARISSPATRDGGNER  276
            +NP++ + +  +R E+ +Y+ + +L    ++    L   AK  +  ++ +  T       
Sbjct  156  DNPSYRMKLDIDRWETSLYHKDNYLAMGSVMHSMNLDSRAKGTMHMKMETYNTTASS---  212

Query  275  EPPWKEMKSELDDSRDLEFQVALEVLATFKSG  180
                ++M+ E  +  ++ F + L +    K+G
Sbjct  213  --AVEDMEKEQKEGGNVSFNLRLTLSYDMKAG  242



>ref|XP_009140785.1| PREDICTED: uncharacterized protein LOC103864770 [Brassica rapa]
Length=238

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 72/161 (45%), Gaps = 4/161 (2%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD  492
            PH   +P P+ +L R +       +L    +  + +IV    +P   + + SV +F +SD
Sbjct  42   PHYAPQPSPRAVLLRRLFTAFTVFLLILGLILFIFFIVVRPQLPTVYLNSLSVSNFTVSD  101

Query  491  KSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
              LAG W      +NPN  + + ++ V   +YY+   L+   ++PF+L    +  + A +
Sbjct  102  NRLAGNWDLRLQFQNPNSKMSLHYDGVLCTLYYDRASLSETRLQPFDLGTKDQTPINATL  161

Query  311  SSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATF  189
            S   T   G   +     +  E  +   +EF + +  L TF
Sbjct  162  SVSGTYVDGRLVD----SIGKERGEKGSVEFDLRVVSLVTF  198



>emb|CDX71465.1| BnaC04g17000D [Brassica napus]
Length=235

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 63/133 (47%), Gaps = 4/133 (3%)
 Frame = -2

Query  689  NSAPLPPHVEFEPRPK-ILLARVILCLLV-FLILGTVAMSLLTYIVFGSAVPFFDVAAFS  516
            N  P   +    P P+ +L+ R+ + L+V  LI G +    L  IV    +P   + + S
Sbjct  32   NGYPYQNYHAPHPDPRALLIRRLFIALMVSILIFGLILFIFL--IVVRPQLPTVYINSLS  89

Query  515  VPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNA  336
            V +FN+S+  L G W      ENPN  + + ++ V   VYY +  L+   ++PF+     
Sbjct  90   VSNFNVSNNQLTGNWDLRLRFENPNSKMSLYYDTVLCAVYYGDDSLSETRLQPFDQGTKD  149

Query  335  KMVLPARISSPAT  297
            +  + A +S   T
Sbjct  150  QTPINATLSVSGT  162



>ref|XP_010457962.1| PREDICTED: protein YLS9-like [Camelina sativa]
Length=241

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 82/178 (46%), Gaps = 5/178 (3%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS  495
            P +   +P P+ +L R +  + +  +L    +  + + V    +P   + + SV +FN+ 
Sbjct  43   PYYAPQQPNPRAVLIRRLFIVFMAFLLILGLILFIFFFVVRPQLPDVYLNSLSVSNFNVL  102

Query  494  DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPAR  315
            +  ++G W     + NPN  + + ++ +   +YY+   L+   ++PFE  +  + V+ A 
Sbjct  103  NNQVSGKWDLQVQIRNPNSKMSLYYDTILCALYYHRASLSETRLQPFEQGKKDQTVVNAT  162

Query  314  ISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
            +S   T   G   +   KE  ++      +EF + +    TF+ G+   RR   TV C
Sbjct  163  LSVSGTYVEGRLADDIGKERGAK----GSVEFDLRMISSVTFRYGA-FRRRRFVTVYC  215



>ref|XP_010932709.1| PREDICTED: uncharacterized protein LOC105053306 [Elaeis guineensis]
Length=322

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  617  CLLVF--LILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG---TWQANFSV  453
            C L++  +ILG V + L+ Y+VF    P  D+ + ++ +  L   +L     T  ANFS 
Sbjct  146  CALMWTIVILGGVVV-LIVYLVFRPKSPLLDIQSATLNAAYLDTGTLLNADITILANFS-  203

Query  452  ENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS---PATRDGGN  282
             NPN  + V F  V+  +Y+ + ++A + VEPF  +     +    + +   P  R    
Sbjct  204  -NPNRKVHVAFSYVQVDLYFMDTMIATQAVEPFAERPGESALKSLHVIASEVPLPRKAAE  262

Query  281  EREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYG  135
            E    W+   SE          VALEV   F++ SDL + + FT   YG
Sbjct  263  E----WQRGTSEEG--------VALEVTGRFRTRSDLGKWLHFTYWLYG  299



>ref|XP_010942912.1| PREDICTED: uncharacterized protein LOC105060767 [Elaeis guineensis]
Length=207

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  689  NSAPLPPHVEFEPR----PKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAA  522
            + AP   H    PR    P I  A V+  +   L++    ++L+ ++V     P FD  +
Sbjct  5    SEAPPRKHGLLPPRHRTNPMIWCAAVLCVIFSLLLIFAGIVTLIVFLVIKPKNPLFDTTS  64

Query  521  FSVPSFNLSDKSLAG---TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFE  351
             ++ S  L  ++      T+ ANFS  NPNH +DVMFE +   +Y+ + LL+ + ++PF 
Sbjct  65   ATINSVYLDSQAYLNSDLTFLANFS--NPNHKMDVMFEYLSIELYFYDRLLSAQALQPFA  122

Query  350  LKR  342
             +R
Sbjct  123  QRR  125



>gb|KEH24231.1| transmembrane protein, putative [Medicago truncatula]
Length=289

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 87/190 (46%), Gaps = 8/190 (4%)
 Frame = -2

Query  623  ILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENP  444
            I+C   F+  G   ++L+  +      P F V + SV +FN S   L G W  + + ENP
Sbjct  104  IMCS-CFIFTGFFVLTLIAALSLHPQFPVFKVVSLSVSNFNTSSI-LTGDWNISVTAENP  161

Query  443  NHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPW  264
            N  L   F   +  V ++   LA  +V  FEL+++ +  +  + SS    +  + ++   
Sbjct  162  NTRLKGYFLDFKVDVVHDNNELAMSLVPDFELEKHEQKQMDVKASS---NNVVSFQKWDL  218

Query  263  KEMKSELDDSRD-LEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK-DPGVGVWD-  93
             +M +E   S + + F V +  LA FKS S  +R       C GL   F+ + G G  D 
Sbjct  219  DKMSNERQSSSNSIMFGVRVSSLAEFKSTSFATRSTRMLAICEGLKVVFQNNTGTGSLDN  278

Query  92   GVKPSCTVLF  63
            G  P+   L+
Sbjct  279  GGNPATCQLY  288



>ref|XP_006430078.1| hypothetical protein CICLE_v10013405mg [Citrus clementina]
 gb|ESR43318.1| hypothetical protein CICLE_v10013405mg [Citrus clementina]
Length=288

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/180 (24%), Positives = 81/180 (45%), Gaps = 14/180 (8%)
 Frame = -2

Query  575  LLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVY  396
            +L +++     P F V   +V +F++++      W  N  VEN N G +V F+R++S +Y
Sbjct  110  VLMFLIARPKFPIFHVETLAVTNFSVANDDFTSAWDINLVVENRNFGANVHFDRIQSFIY  169

Query  395  YN--EFLLANKMVEP---FELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSR  231
            +N  + L ++    P     +K N K  +  ++S   T D       P K +  E+ + R
Sbjct  170  FNTDDLLASSHFDHPTTYVTVKANEKGTIDIKLS---TADYKQSVPAPGKRVMEEMRNIR  226

Query  230  D---LEFQVALEVLATFKSG--SDLSRRMTFTVSCYGLTAHFK-DPGVGVWDGVKPSCTV  69
            +   + F +     +  ++G     ++ +   + C  L  HF+ D G G  +G    C V
Sbjct  227  ETGVVPFSLRAFAWSQIETGLFYTETKHIQSRIICEDLKVHFEGDTGNGKLNGKSKDCVV  286



>ref|XP_007162964.1| hypothetical protein PHAVU_001G195100g [Phaseolus vulgaris]
 gb|ESW34958.1| hypothetical protein PHAVU_001G195100g [Phaseolus vulgaris]
Length=293

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 94/209 (45%), Gaps = 15/209 (7%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS  495
            PP      R K  +   +LC  V +  G  A +L+  ++    +P + V + SV +FN+S
Sbjct  94   PPTYHNVDRTKAFVRGFVLCSCV-IFAGLFAATLIMALMLHPQLPVYTVNSLSVANFNIS  152

Query  494  DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPAR  315
               L   W   FS+ N N  L+ +F   +  + Y +  LA   V  FEL++     +  R
Sbjct  153  -TPLTADWNTTFSILNDNDKLNGVFTDFKVDLLYRDDALAMSFVPDFELEKKEIRRIDER  211

Query  314  ISSPATRDGGNEREPPWK--EMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVS-  144
            +SS           P W+  EM  E   S  + F + +  +  FKS S +S +M+  ++ 
Sbjct  212  MSS------NGFLLPRWELDEMAKE-QASGSVTFILRIASMVEFKS-STISTKMSLILAL  263

Query  143  CYGLTAHFK-DPGVGVWD-GVKPSCTVLF  63
            C GL   F+ + G G  D G +P    L+
Sbjct  264  CDGLKVVFQNNTGNGALDNGGRPIICQLY  292



>ref|XP_008243455.1| PREDICTED: uncharacterized protein At1g08160-like [Prunus mume]
Length=261

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/214 (23%), Positives = 87/214 (41%), Gaps = 22/214 (10%)
 Frame = -2

Query  674  PPHVEFEP-------RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFS  516
            PPH   +P       RP +L   +I  + VF I+  V    + ++     +P F V + S
Sbjct  56   PPHYAPQPTGPIAPNRPTLLCRLLIAAVAVFAIMSLVF--FIAWLALRPRLPEFRVESAS  113

Query  515  VPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYY-NEFLLANKMVEPFELKRN  339
            V   N +   L  TW       NPNH L + ++ +++ ++Y ++  +A   + PF L + 
Sbjct  114  VFPLNATGSELTATWNLTLLANNPNHKLRIYYDSIQASLFYGDDDRIATTSLPPFVLTKR  173

Query  338  AKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLS  168
             +  +  ++++     G          +   + D RD   + F + +     F+SG   S
Sbjct  174  NQTRVGFKLATVGEYVG--------NYVAKRISDERDRGSVRFGLGVFASVRFRSGVFQS  225

Query  167  RRMTFTVSCYGLTAHF-KDPGVGVWDGVKPSCTV  69
            R     V C  +   F +  G G   G    C V
Sbjct  226  RPRVLRVFCERVDFGFAQKNGTGTLTGQSSPCVV  259



>ref|NP_197678.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
 dbj|BAB10608.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED93090.1| late embryogenesis abundant hydroxyproline-rich glycoprotein 
[Arabidopsis thaliana]
Length=207

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 10/183 (5%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS-DKSLAGT  474
            RP  L+  + L +L  + +  V   L+T++        + V   SV +FNL+ D  ++ T
Sbjct  22   RPS-LICYIFLVILTLIFMAAVGF-LITWLETKPKKLRYTVENASVQNFNLTNDNHMSAT  79

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR-NAKMVLPARISSPAT  297
            +Q      NPNH + V +  VE  V + +  LA   VEPF   R N K +    I+    
Sbjct  80   FQFTIQSHNPNHRISVYYSSVEIFVKFKDQTLAFDTVEPFHQPRMNVKQIDETLIAENVA  139

Query  296  RDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFK  117
                N      K+++S+ +    + F+V ++    FK G   S   T  + C  +T    
Sbjct  140  VSKSNG-----KDLRSQ-NSLGKIGFEVFVKARVRFKVGIWKSSHRTAKIKCSHVTVSLS  193

Query  116  DPG  108
             P 
Sbjct  194  QPN  196



>ref|XP_006430077.1| hypothetical protein CICLE_v10013330mg, partial [Citrus clementina]
 gb|ESR43317.1| hypothetical protein CICLE_v10013330mg, partial [Citrus clementina]
Length=209

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 65/142 (46%), Gaps = 5/142 (4%)
 Frame = -2

Query  542  PFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMV-YYNEFLLANKM  366
            P F + + SV +F +S   LAG W A+F++ NPN   ++ FE +ES V Y     LA   
Sbjct  40   PSFYLNSLSVANFTVSKTKLAGIWAADFTISNPNSAAEISFESIESTVSYKGNDALAITS  99

Query  365  VEPFELK-RNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATF  189
             E F++  R  K V     +S    D      P  +E+  E   +  + F + L + AT+
Sbjct  100  SENFDVGFRGEKNVEMKFETSGYEGDQPIVEYPVLREIDEERKSTGTVRFGIRLNMWATY  159

Query  188  KSG---SDLSRRMTFTVSCYGL  132
            K+        RR+    SC  L
Sbjct  160  KTSYYWGTWRRRVLTHSSCLNL  181



>ref|XP_007015707.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
 gb|EOY33326.1| Late embryogenesis abundant hydroxyproline-rich glycoprotein 
family, putative [Theobroma cacao]
Length=235

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = -2

Query  611  LVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGL  432
            ++ +I GT+   L+ ++V    +P F + + S+ +FN S++ +  TW A F V NPN  L
Sbjct  64   ILVIIFGTIL--LIFWLVLRPHLPDFSLESLSLSNFNASNQRVTATWNAQFQVFNPNKKL  121

Query  431  DVMFERVESMVYYNEFLLANKMVEPF-ELKRNAKMV  327
             + +  + S V++ ++LL    + PF +  RN   V
Sbjct  122  SISYGDIVSSVFHKDYLLTETRIGPFVQGTRNVSTV  157



>ref|XP_008243644.1| PREDICTED: protein YLS9-like [Prunus mume]
Length=237

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/218 (24%), Positives = 97/218 (44%), Gaps = 16/218 (7%)
 Frame = -2

Query  692  YNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPF---FDVAA  522
            YN +   PH+      +  +  V+L  ++  +LG V  +LL   +  S VP      + +
Sbjct  20   YNPSISNPHMSMSITSRFTVKLVLLHRILLFVLGIV--TLLCVAMATSLVPQPLKIKLNS  77

Query  521  FSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
              +   N+S+  L   +   F++ENPN    + F+R++  + Y +  LA   ++PF L  
Sbjct  78   LFMSKINVSNTKLVANFDVAFTIENPNLVSWIWFDRIDGSISYKDNALATYSLDPFILGL  137

Query  341  NAKMVLPARISSPATRDGGNEREPPWKE-MKSELDDSRD---LEFQVALEVLATFKSGSD  174
                ++  +IS     +G  E +P  KE +  E+   R+   + F + +   AT+++G  
Sbjct  138  KEHRMMRVKISV----NGLQEDQPVVKERVLEEIHRQREDGAVNFSLEMFARATYRTGWW  193

Query  173  LSRRMTFTVSCYGLTAHF-KDPGVGVWD--GVKPSCTV  69
             ++ +     C  L   F    G G W+  G   +C V
Sbjct  194  GTKSVLMNPQCLDLRVGFLPKVGFGSWNNSGGPMTCAV  231



>emb|CDY30561.1| BnaA04g15720D [Brassica napus]
Length=238

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = -2

Query  671  PHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSD  492
            PH   +P P+ +L R +       +L    +  + +IV    +P   + + SV +F +SD
Sbjct  42   PHYAPQPSPRAVLLRRLFTAFTVFLLILGLILFIFFIVVRPQLPTVYLNSLSVSNFTVSD  101

Query  491  KSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
              LAG W      +NPN  + + ++ V   +YY+   L+   ++PF+L    +  + A +
Sbjct  102  NRLAGNWDLGLQFQNPNSKMSLHYDGVLCTLYYDRASLSETRLQPFDLGTKDQTPINATL  161

Query  311  SSPAT  297
            S   T
Sbjct  162  SVSGT  166



>gb|KEH24229.1| late embryogenesis abundant protein [Medicago truncatula]
Length=255

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 55/111 (50%), Gaps = 7/111 (6%)
 Frame = -2

Query  635  LARVILCLLVFLILGTVAM----SLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQ  468
            + R  LC  + ++   VA+    SL+ Y V    +P F V + S+ SFNL+   L   W 
Sbjct  65   VVRSFLCGFISVMTAIVALFGLISLIGYFVLKPRIPEFSVNSASLTSFNLTGSGLNAKWD  124

Query  467  ANFSVENPNHGLDVMFERVESMVYYNE---FLLANKMVEPFELKRNAKMVL  324
                V NPN  LD+ ++ V + V+Y +    +LA   + PF    ++K +L
Sbjct  125  ITLIVSNPNKKLDITYDAVAASVFYGDDEYGVLAYTRLAPFHQPTHSKTML  175



>gb|KDO58253.1| hypothetical protein CISIN_1g043833mg [Citrus sinensis]
Length=237

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 71/172 (41%), Gaps = 11/172 (6%)
 Frame = -2

Query  575  LLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVY  396
            L+ ++V    +P F + + SV +F+ +   + G W A     NPN  + V +  V S +Y
Sbjct  72   LIFWLVVRPRIPEFHLTSLSVSNFSTNQSQVTGNWDAAIEAYNPNKKMRVSYYDVVSGIY  131

Query  395  YNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSR---DL  225
            Y+   L    + PF      +  L A+ S     D   ER     ++   ++  R    +
Sbjct  132  YDGNYLTRTPLPPFSQDTRERTPLSAKFS---VIDSYVER-----KVLDSINAERARGAV  183

Query  224  EFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVGVWDGVKPSCTV  69
            +F   LE +A FK G   +RR    V C  +  +    G G   G    C V
Sbjct  184  KFDFRLEAIAGFKYGGWRTRRRLVRVWCPDVPVNVSSKGSGSLVGGARKCRV  235



>ref|XP_006424127.1| hypothetical protein CICLE_v10029176mg [Citrus clementina]
 gb|ESR37367.1| hypothetical protein CICLE_v10029176mg [Citrus clementina]
Length=243

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 71/172 (41%), Gaps = 11/172 (6%)
 Frame = -2

Query  575  LLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVY  396
            L+ ++V    +P F + + SV +F+ +   + G W A     NPN  + V +  V S +Y
Sbjct  72   LIFWLVVRPRIPEFHLTSLSVSNFSTNQSQVTGNWDAAIEAYNPNKKMRVSYYDVVSGIY  131

Query  395  YNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSR---DL  225
            Y+   L    + PF      +  L A+ S     D   ER     ++   ++  R    +
Sbjct  132  YDGNYLTRTPLPPFSQDTRERTPLSAKFS---VIDSYVER-----KVLDSINAERARGAV  183

Query  224  EFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVGVWDGVKPSCTV  69
            +F   LE +A FK G   +RR    V C  +  +    G G   G    C V
Sbjct  184  KFDFRLEAIAGFKYGGWRTRRRLVRVWCPDVPVNVSSKGSGSLVGGARKCRV  235



>ref|XP_006481533.1| PREDICTED: protein YLS9-like isoform X2 [Citrus sinensis]
Length=243

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 71/172 (41%), Gaps = 11/172 (6%)
 Frame = -2

Query  575  LLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVY  396
            L+ ++V    +P F + + SV +F+ +   + G W A     NPN  + V +  V S +Y
Sbjct  72   LIFWLVVRPRIPEFHLTSLSVSNFSTNQSQVTGNWDAAIEAYNPNKKMRVSYYDVVSGIY  131

Query  395  YNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSR---DL  225
            Y+   L    + PF      +  L A+ S     D   ER     ++   ++  R    +
Sbjct  132  YDGNYLTRTPLPPFSQDTRERTPLSAKFS---VIDSYVER-----KVLDSINAERARGAV  183

Query  224  EFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVGVWDGVKPSCTV  69
            +F   LE +A FK G   +RR    V C  +  +    G G   G    C V
Sbjct  184  KFDFRLEAIAGFKYGGWRTRRRLVRVWCPDVPVNVSSKGSGSLVGGARKCRV  235



>gb|KDP29882.1| hypothetical protein JCGZ_19149 [Jatropha curcas]
Length=260

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 83/200 (42%), Gaps = 10/200 (5%)
 Frame = -2

Query  653  PRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS--LA  480
            P P+  L R I+  ++ + +    +  + ++V     P F V +FSV + N+S  S  L+
Sbjct  49   PNPRATLLRRIVAAVIVVTVIFFTILFICWLVIRPHRPEFHVTSFSVTNLNVSTSSQRLS  108

Query  479  GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPA  300
              W A F V NPN  + + ++ + S V Y   +LA   + PF+     +  + A  ++  
Sbjct  109  ANWNARFQVYNPNKKMKISYDAIMSSVLYKTEILAQTRIPPFKQDTKNQTTIDAAFAAVE  168

Query  299  TRDGGNEREPPWKEMKSELDDSRD-LEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAH  123
            +   G      W       + S   +EF + L     FK G   +RR    V C  +   
Sbjct  169  SYVDG------WVVNDINGEKSHGAVEFNLRLVADVGFKVGGFRARRRLLRVWCDNVPIG  222

Query  122  FK-DPGVGVWDGVKPSCTVL  66
            F  + G G   G    C V 
Sbjct  223  FSVNGGSGNLTGGARECKVF  242



>ref|XP_007204469.1| hypothetical protein PRUPE_ppa022527mg [Prunus persica]
 gb|EMJ05668.1| hypothetical protein PRUPE_ppa022527mg [Prunus persica]
Length=291

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -2

Query  623  ILCLLVFL-ILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNL--SDKSLAGTWQANFSV  453
              C+++FL ++ T+  S++ ++V     P F V +FSV +FNL    K L+G W+A+  V
Sbjct  96   CFCIIMFLLVIFTLLASIVMFVVVRPETPAFKVESFSVSNFNLVPGSKVLSGKWEASIYV  155

Query  452  ENPNHGLDVMFERVESMVYYNEFLLA  375
            +NP++ + +  +R E+ +Y+ +  LA
Sbjct  156  DNPSYRMKLEIDRWETSLYHKDNYLA  181



>ref|XP_007150037.1| hypothetical protein PHAVU_005G120800g [Phaseolus vulgaris]
 gb|ESW22031.1| hypothetical protein PHAVU_005G120800g [Phaseolus vulgaris]
Length=292

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/165 (24%), Positives = 78/165 (47%), Gaps = 15/165 (9%)
 Frame = -2

Query  626  VILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVEN  447
             ++CL V  I G +   ++T++V   ++P F + + S+ + + + +SL+ TW   F V N
Sbjct  113  TMICLAV--IFGVIL--IVTWLVLRPSLPHFTLHSLSLTNLSTTSQSLSATWHVAFIVRN  168

Query  446  PNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPP  267
             N  + V +  + S ++Y    +A+  + PF+    ++  L A + +      G   +P 
Sbjct  169  GNKKMSVTYNDLRSFIFYRTIDVADSQLAPFKQDTESETTLNATLVA-----AGTYLQP-  222

Query  266  WKEMKSELDDSR---DLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
               + ++L+  R    + F V +    +F+SGS   R     V C
Sbjct  223  --SLINDLNAERTANSVLFDVQVVASTSFRSGSWRFRTRILKVLC  265



>ref|XP_006400795.1| hypothetical protein EUTSA_v10015654mg, partial [Eutrema salsugineum]
 gb|ESQ42248.1| hypothetical protein EUTSA_v10015654mg, partial [Eutrema salsugineum]
Length=204

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/192 (24%), Positives = 86/192 (45%), Gaps = 16/192 (8%)
 Frame = -2

Query  680  PLPPHVEFEP---RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVP  510
            P+PP     P   R + L+  V L +L  + +      L+T+IV       + +   SV 
Sbjct  5    PMPPITYHAPALHRRRSLVCYVFLVILTLIFIVATGF-LITWIVTKPKKLHYTLENASVE  63

Query  509  SFNLSDKS-LAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR-NA  336
             FNL+D + ++GT++     +NPNH + V +  VE  V + +  LA   +EPF   R N 
Sbjct  64   KFNLTDDNHVSGTFKFTIRSQNPNHRISVYYNSVEIFVKFKDQTLAFDTIEPFHQPRMNI  123

Query  335  KMVLPARISS--PATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRR  162
              +    ++   P ++  G       K ++++    + ++ +V ++    F+ G   S  
Sbjct  124  TQIDDTLVAQNVPVSKSNG-------KNLRAQTSLGK-IDLEVYVKARVRFQVGIWKSSH  175

Query  161  MTFTVSCYGLTA  126
             T  + C  +T 
Sbjct  176  RTVKIECSHVTV  187



>ref|XP_008777695.1| PREDICTED: uncharacterized protein LOC103697582 [Phoenix dactylifera]
Length=207

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -2

Query  647  PKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS-LAG--  477
            P I  A V+  +   L++    ++L+ ++V     P FD  + S+ S  L   S L G  
Sbjct  23   PMIWCAAVLCVIFSLLLIFAGIVTLIVFLVIKPRNPLFDTTSASLNSIYLDSPSYLNGDL  82

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
            T+ ANFS  NPNH +DVMFE     +Y+ + LL+ + ++PF  +R
Sbjct  83   TFLANFS--NPNHKIDVMFEYSSIELYFYDRLLSAQALQPFAQRR  125



>ref|XP_010521631.1| PREDICTED: protein YLS9-like [Tarenaya hassleriana]
Length=242

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 75/173 (43%), Gaps = 8/173 (5%)
 Frame = -2

Query  674  PPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS  495
            PP     PR  +L  R+ +  + FL++  +A+ +L ++V    +P   + + SV  FN+S
Sbjct  48   PPQTN--PR-AVLYRRLFIIFMAFLLIIGLALFIL-FLVVRPHLPDVSLNSLSVSDFNVS  103

Query  494  DKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPAR  315
            +  ++G W   F V NPN  + + +  V+  VYY    L+   + PF      +  + A 
Sbjct  104  NSMISGRWDLQFQVRNPNSKMSLYYYEVDCFVYYRGESLSRSRLPPFNQGTKDQTPINAT  163

Query  314  ISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMT  156
            +    +   G   +   KE  +       +EF V L     FK G    RR  
Sbjct  164  VLVALSYLEGRLVDSIGKERAAR----GRVEFDVKLFSYVGFKYGVIRRRRFV  212



>ref|XP_009103588.1| PREDICTED: protein YLS9-like [Brassica rapa]
Length=237

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 71/167 (43%), Gaps = 4/167 (2%)
 Frame = -2

Query  689  NSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVP  510
            N+ P   +    P P+ LL R +   L+  IL    +  +  +V    +P   + + SV 
Sbjct  34   NAYPYQNYHAPHPDPRALLIRRLFIALMVSILFFGLILFIFLLVVRPQLPTVYITSLSVS  93

Query  509  SFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKM  330
             FN+S+  L G W       NPN  + + ++ V   VYY +  L+   ++PF+     + 
Sbjct  94   DFNVSNNQLTGNWDLRLQFLNPNSKMSLYYDTVLCAVYYGDDSLSKTRLQPFDQGTKDQT  153

Query  329  VLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATF  189
             + A +S   T   G   +   KE      +   +EF + +  + TF
Sbjct  154  PINATLSVSGTYVEGKLADSIGKERA----EKGSVEFDLRMVSVVTF  196



>gb|KFK44298.1| hypothetical protein AALP_AA1G239800 [Arabis alpina]
Length=240

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 86/191 (45%), Gaps = 19/191 (10%)
 Frame = -2

Query  695  YYNSAP-LPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVP----FFD  531
            Y N  P  PP    +  P ++LAR I C +   +L T+A   L +I+F   VP    +  
Sbjct  38   YQNHNPDYPP----QDHPCVVLARRI-CFVFMALLITLA---LIFIIFSLVVPPQSPYVY  89

Query  530  VAAFSVPSFNLSDKSLAGTWQANFSVENPNHG-LDVMFERVESMVYYNEFLLANKMVEPF  354
            + + S+ +FN+S+  L+G W  N    NPN     + ++     VYY+   L++  + PF
Sbjct  90   INSLSLSNFNVSNNQLSGKWDLNLLFHNPNSKWTSLHYDTSLCSVYYDRVSLSDTRLPPF  149

Query  353  ELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSD  174
            + ++  +      +S   T   G   +   KE  S+     +++F + +    TF+ G+ 
Sbjct  150  DQRKRDETRFNVTLSVSGTYLEGELADSIAKERASK----GNVDFNLTMVSRITFRYGA-  204

Query  173  LSRRMTFTVSC  141
              R     V C
Sbjct  205  FHRSRYLRVYC  215



>ref|XP_004301661.1| PREDICTED: uncharacterized protein LOC101294768 [Fragaria vesca 
subsp. vesca]
Length=229

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 81/189 (43%), Gaps = 13/189 (7%)
 Frame = -2

Query  632  ARVILCLLVFLILGTV--AMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANF  459
             R++  +++ +  GT+  + S+ T++      P F + +  + +FN+S+ +    W    
Sbjct  41   VRIVDIIVLMVTFGTILSSPSVFTFMSLPPQTPSFQLDSLFLSNFNISNTTFRTDWDTTL  100

Query  458  SVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNE  279
            ++ENPN    V    ++ ++ Y +  LA   ++P EL      ++  +IS+  T      
Sbjct  101  TIENPNMISTVNINSIKGLISYKDNSLAMYSIKPLELGCMEHRLVHVKISTMTTNR----  156

Query  278  REPPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-KDPG  108
                W  +E+  + D++  + F + + V  T+ SG      +     C  L   F    G
Sbjct  157  ----WIFEEINRQRDENEAVRFNMTMFVSPTYTSGWWGIENVVLNPRCMDLKVAFLPRAG  212

Query  107  VGVWDGVKP  81
             G W    P
Sbjct  213  FGSWVNRGP  221



>gb|KHG10449.1| hypothetical protein F383_15951 [Gossypium arboreum]
Length=288

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = -2

Query  629  RVILCLLVFLIL-GTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSV  453
            R+ +   V LI+ GT+   L+ ++V    +P F + + S+ +FN S++ + GTW A F V
Sbjct  57   RLFVAFAVLLIIFGTIL--LIFWLVLRPHLPDFSIQSISLSNFNASNQRVNGTWNAQFQV  114

Query  452  ENPNHGLDVMFERVESMVYYNEFLLANKMVEPF  354
             NPN  L + +  + S V++ +  L    + PF
Sbjct  115  SNPNKKLSIYYGDIVSSVFHKDDFLTETRIGPF  147



>ref|XP_009371484.1| PREDICTED: uncharacterized protein At1g08160-like [Pyrus x bretschneideri]
Length=236

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA--GTWQANFSVENPN  441
            + +F+I+G +   L+ ++V    VP F V + S+ +FN+S  S +  GTW   FSV NPN
Sbjct  57   IALFVIVGCIM--LVIWLVLRPKVPDFRVDSLSLTNFNVSSSSQSLSGTWSVGFSVYNPN  114

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPF  354
              L + +E V S ++Y    ++   V+PF
Sbjct  115  KKLSIRYEEVVSSIFYRNGFISETRVQPF  143



>emb|CDP06857.1| unnamed protein product [Coffea canephora]
Length=251

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 87/207 (42%), Gaps = 20/207 (10%)
 Frame = -2

Query  656  EPRPK-ILLARVILCLLVFLILGTVAMSLLTYI---VFGSAVPFFDVAAFSVPSFNLSDK  489
            +P P  I  A  +  L  F+I G + +  + +I   V    +P F V + SV +FNLS  
Sbjct  52   QPDPDAIRRATFLRRLFAFIIAGVIILGTILFIIWLVLRPRLPEFRVDSLSVSNFNLSSS  111

Query  488  SL-AGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARI  312
            +L +  +    +  NPN  + + ++ VE+ VY+  F L+   + PF   +  +    A +
Sbjct  112  TLVSADFDVKITARNPNGKITLFYDNVEAAVYFKNFQLSQTTLPPFSQGKKNETSFTAEL  171

Query  311  SS-PATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVL----ATFKSGSDLSRRMTFTV  147
            ++  A  DG         ++ + ++  R     V L V       FK+G+  +RR     
Sbjct  172  AAVKAYLDG---------DIANGINGERGKNGNVVLNVRMLMEVRFKAGAWKARRRYLKA  222

Query  146  SCYGLTAHFK-DPGVGVWDGVKPSCTV  69
             C  L+     +   G   G    C V
Sbjct  223  FCGDLSVGISANASNGTLTGGPRQCRV  249



>gb|EPS67655.1| hypothetical protein M569_07117 [Genlisea aurea]
Length=256

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/191 (23%), Positives = 82/191 (43%), Gaps = 11/191 (6%)
 Frame = -2

Query  698  GYYNSAPLPPHVEFEP----RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFD  531
            GYY     P   +++P    R   L   V L + V ++ GT+  + + ++V    +P F 
Sbjct  44   GYYGYQSYPQSYQYDPNYAQRLTFLRRIVGLGIAVLIVFGTI--TFIVWLVLRPQMPQFQ  101

Query  530  VAAFSVPSFNLSDKSLAG-TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF  354
            V + S+ +F+L   SL   T     +  NPN  + + ++ +++ +YY    L+   V PF
Sbjct  102  VDSLSISNFSLGSSSLISFTSAVRLTATNPNKKMKLEYDDIQAYIYYKTESLSQTSVPPF  161

Query  353  ELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSD  174
            + +      L A  ++  +   G         +  E  +S D+ F   +     F++ + 
Sbjct  162  QQETRNITSLTANFAAAGSFVDGFVVN----GINGERANSGDVNFNFRMITRVAFEAKAW  217

Query  173  LSRRMTFTVSC  141
             +RR    V C
Sbjct  218  RARRRYLKVIC  228



>ref|XP_009374790.1| PREDICTED: uncharacterized protein At1g08160-like [Pyrus x bretschneideri]
Length=236

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLA--GTWQANFSVENPN  441
            + +F+I+G +   L+ ++V    VP F V + S+ +FN+S  S +  GTW   FSV NPN
Sbjct  57   IALFVIVGCIM--LVIWLVLRPKVPDFRVDSLSLTNFNVSSSSQSLSGTWSVGFSVYNPN  114

Query  440  HGLDVMFERVESMVYYNEFLLANKMVEPF  354
              L + +E V S ++Y    ++   V+PF
Sbjct  115  KKLSIRYEEVVSSIFYRNGFISETRVQPF  143



>emb|CDY04485.1| BnaA07g13110D [Brassica napus]
Length=237

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 59/133 (44%), Gaps = 0/133 (0%)
 Frame = -2

Query  656  EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG  477
             P P+ LL R +   L+  IL    +  +  +V    +P   + + SV  FN+S+  L G
Sbjct  45   HPDPRALLIRRLFIALMVSILFFGLILFIFLLVVRPQLPTVYITSLSVSDFNVSNNQLTG  104

Query  476  TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPAT  297
            +W       NPN  + + ++ V   VYY +  L+   ++PF+     +  + A +S   T
Sbjct  105  SWDLRLQFLNPNSKMSLYYDTVLCAVYYGDDSLSETRLQPFDQGTKDQTPINATLSVSGT  164

Query  296  RDGGNEREPPWKE  258
               G   +   KE
Sbjct  165  YVEGKLADSIGKE  177



>ref|XP_009419494.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=254

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 90/205 (44%), Gaps = 21/205 (10%)
 Frame = -2

Query  698  GYYNSAPLPPHVEF-EPRP--------KILLARVILCLLV-FLILGTVAMSLLTYIVFGS  549
             Y  + P P H  + +PR          +LL R+++   V FL++G +  S   ++    
Sbjct  30   AYTYATPRPDHYYYADPRTGAAFSANHNLLLYRILIAAAVAFLLVGFI--SFFLWLFLRP  87

Query  548  AVPFFDVAAFSVPSFNLSDK-----SLAGTWQANFSVENPNHGLDVMFERVESMVYYNEF  384
            + P F V++ +V +FNLS        L+ ++    +V NPN  + V +  V + V Y+  
Sbjct  88   SAPVFIVSSATVSAFNLSSPYGPSPQLSSSFNLALNVSNPNKKMGVNYFHVAAAVAYDGV  147

Query  383  LLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALE  204
            +LA   + PF+ +      L A +++     G +      + M  +   S  + F V +E
Sbjct  148  ILAETALSPFDQEGRTSTTLQATLATRQESVGLDVA----RGMSRDRATSGAVRFDVMVE  203

Query  203  VLATFKSGSDLSRRMTFTVSCYGLT  129
                FK+ +  +      V C G++
Sbjct  204  AWVWFKTSAWSTSSSVMKVYCEGIS  228



>emb|CDX96759.1| BnaA08g23020D [Brassica napus]
Length=261

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 76/169 (45%), Gaps = 10/169 (6%)
 Frame = -2

Query  614  LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS-LAGTWQANFSVENPNH  438
            +++FLIL   A S + Y+++    P F V++  V S NL+  + LA     +   +NPN 
Sbjct  66   VIIFLILLVAAASAVVYLIYRPQRPSFTVSSLKVSSLNLTSATRLATAISLSVVAKNPNK  125

Query  437  GLDVMFERVESMVYY-----NEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNERE  273
             +   ++  +  VY      ++ ++    +  F   +    +L + + SP     G+  E
Sbjct  126  NVGFSYDVADVTVYRVSPGDDDVVIGKGSIASFVHGKKNTTLLKSTVGSPP----GDLDE  181

Query  272  PPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTA  126
                ++K +L   R +  ++ L    T K G+  + +    V+C G+ A
Sbjct  182  LSAGKLKGDLKAKRGVAVKIVLNTKVTVKMGAVKTPKSGIRVTCEGIRA  230



>gb|KFK32426.1| hypothetical protein AALP_AA6G240400 [Arabis alpina]
Length=257

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 79/172 (46%), Gaps = 11/172 (6%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS-LAGT  474
            R +  +  V+  L + L+L  +++++L Y+VF    P + V  FSV   NL+  S ++  
Sbjct  70   RCRCCICSVLATLFIVLVLAGISLAVL-YLVFHPEAPRYSVEGFSVSGINLTSSSPISPK  128

Query  473  WQANFSVENPNHGLDVMFERVESM-VYYNEFLLANKMVEPFELKRNAKMVLPARISSPAT  297
            +       N N  + + +E+  S+ V+YN+  L N  +  F    N   V+   ++    
Sbjct  129  FNVTVRSRNGNGKIGIYYEKGSSVDVFYNDVDLCNGALPAFYQPPNNVTVVKTALTGSTI  188

Query  296  RDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
            +     R    KEM++E    + L F++ +      K GS  +  +T  V+C
Sbjct  189  QLTTATR----KEMRNE----KTLPFKLKIRAPVKIKLGSVKTWTLTVKVNC  232



>ref|XP_008387108.1| PREDICTED: uncharacterized protein LOC103449562 [Malus domestica]
Length=236

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 70/162 (43%), Gaps = 5/162 (3%)
 Frame = -2

Query  542  PFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMV  363
            P   + +  V   N+S   L   +   F++ENPN    V F R++  + Y +  +    +
Sbjct  71   PKIRLNSLFVSKLNVSRGMLGANFDVTFTIENPNPVSWVHFNRLDGSILYKDNAILTYSL  130

Query  362  EPFELKRNAKMVLPARISSPATRDGGNE--REPPWKEMKSELDDSRDLEFQVALEVLATF  189
            EPF L    +  +  +I +   +D G    +E    EMK + +D   ++  + +   AT+
Sbjct  131  EPFVLGLKQQRTMRVKIXTTGLQDVGQPIVKEGVLDEMKRQGEDGA-VDLSMEMFAWATY  189

Query  188  KSGSDLSRRMTFTVSCYGLTAHF-KDPGVGVWDGVKP-SCTV  69
            K+G   +R +     C  L   F    G G W    P +C+V
Sbjct  190  KTGWSGTRSVIMKPQCLDLRVGFLPKVGFGSWISGGPMTCSV  231



>ref|XP_008340121.1| PREDICTED: uncharacterized protein LOC103403078 [Malus domestica]
Length=400

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 81/167 (49%), Gaps = 16/167 (10%)
 Frame = -2

Query  620  LCLLVF--LILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG---TWQANFS  456
            +C  +F  LI+ T  + L+ Y+VF    P FDV++ ++ +  L    L     T  ANF+
Sbjct  222  ICCAIFWVLIIITGLVVLIIYLVFRPRTPKFDVSSATLNAAYLDMGYLLNADVTVLANFT  281

Query  455  VENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNER  276
              NPN  + V F  +   +YY   L+A + VEPF  +R+  M     + +   R G  ER
Sbjct  282  --NPNKKVSVDFSYLIIDLYYGNTLIATQYVEPFSAERSRSMFANVHMVASQVRLGVLER  339

Query  275  EPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYG  135
            +     +K +++++R        EV   F++ ++  + + ++   +G
Sbjct  340  Q----RLKKQMENNR-----AEFEVKGYFRARANFGKILRYSYWLHG  377



>ref|XP_010520485.1| PREDICTED: protein YLS9 [Tarenaya hassleriana]
Length=267

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 11/171 (6%)
 Frame = -2

Query  635  LARVILC-----LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAG-T  474
            L R  +C     +L+F +L T+A ++L Y+V+    P F VA  S+  FNL+  SL    
Sbjct  77   LCRRCVCSFLAAVLIFAVLATIAAAVL-YLVYRPEKPRFSVARVSITGFNLTSPSLTSPE  135

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATR  294
             +  F +ENPN  L   +E+  +   Y++ +     V P   K+ AK +        A +
Sbjct  136  IEVTFRLENPNGKLGFFYEKGSTAKIYHDGVNFGNGVTP-SFKQPAKNITTLMT---ALK  191

Query  293  DGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
              G +     ++  +E      L F + ++       GS  +  M+ TV C
Sbjct  192  GSGIQLTASMRKELTEAQKKGTLPFSLKIDAPVKVNVGSVTTWTMSVTVDC  242



>ref|XP_008799741.1| PREDICTED: protein YLS9-like [Phoenix dactylifera]
Length=253

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 87/191 (46%), Gaps = 13/191 (7%)
 Frame = -2

Query  692  YNSAPLPPHVEFEPRPK----ILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVA  525
            Y  AP+PP   +E R +     LL+ +I  ++ F +   + + L+ ++VF  +     V 
Sbjct  5    YYGAPIPPEQHYEQRHRSCYCCLLSTLIKTIIAFCLALGITL-LVLWLVFRPSKVEVSVE  63

Query  524  AFSVPSFNL--SDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-  354
              S+ SFNL  S  +L     A+ S+ NPN  + + ++ +E+  YY       + +  F 
Sbjct  64   KASLTSFNLTTSPTNLYYNLSADISIRNPNKRIGICYDWLEADPYYQGHRFDWEALPSFY  123

Query  353  ELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSD  174
            +  +N  M+ P    + A   G ++ E    E K E +++      + L     +K GS 
Sbjct  124  QGHKNTTMLYPVLKGNSAIGLGDSDIE----EFKKE-NETSFFNVDIWLIGQVRYKFGSV  178

Query  173  LSRRMTFTVSC  141
             +RR T  V C
Sbjct  179  TTRRYTMRVKC  189



>ref|XP_010031558.1| PREDICTED: protein YLS9-like [Eucalyptus grandis]
 gb|KCW50900.1| hypothetical protein EUGRSUZ_J00544 [Eucalyptus grandis]
Length=246

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 72/169 (43%), Gaps = 8/169 (5%)
 Frame = -2

Query  566  YIVFGSAVPFFDVAAFSVPSFNLSDKS--LAGTWQANFSVENPNHGLDVMFERVESMVYY  393
            ++V    +P F V + ++ +F++S  S  ++G W   F V NPN  + + +  +ES +Y 
Sbjct  81   WLVLRPRLPVFVVESVTLNNFSISTSSQQVSGHWLVRFQVRNPNQNMKLSYADIESYIYC  140

Query  392  NEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQV  213
            N   L+   + PF     ++ V+ A   +  +   G        E  S +     + FQV
Sbjct  141  NSEPLSRTRLPPFNQGARSQTVVQASFVAMDSFVDGWAVSGIIAERASGV-----VRFQV  195

Query  212  ALEVLATFKSGSDLSRRMTFTVSCYGLTAHFKDPG-VGVWDGVKPSCTV  69
             L  LA FK+G    RR +  V C  L       G  G   G    C V
Sbjct  196  RLIALAQFKAGWWPERRASIQVLCGDLAVGLPSNGEAGKLTGGARECRV  244



>ref|XP_010454565.1| PREDICTED: uncharacterized protein At1g08160-like [Camelina sativa]
Length=208

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 81/179 (45%), Gaps = 14/179 (8%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS-DKSLAGT  474
            RP  L+  V L +L  + +  V   L+T+ V       + +   SV +FNL+ D  ++ T
Sbjct  23   RPS-LVCYVFLVILTLIFIAAVGF-LITWFVTKPKKLHYTLENASVQNFNLTNDNHMSAT  80

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR-NAKMVLPARISS--P  303
            +       NPNH + V +  VE  V + +  LA   +EPF   R N K +    ++    
Sbjct  81   FIFTIQSHNPNHRISVYYSSVEIFVKFKDQTLAFDTMEPFHQPRMNVKQIDDTLVAQNVA  140

Query  302  ATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTA  126
             T+  G       K++++++   + ++F+V ++    FK G   +   T  V C  +T 
Sbjct  141  VTKSNG-------KDLRAQMSSGK-IDFEVFVKARVRFKVGVWKTAHHTAKVKCSHITV  191



>gb|ABK23490.1| unknown [Picea sitchensis]
Length=217

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 95/229 (41%), Gaps = 36/229 (16%)
 Frame = -2

Query  689  NSAPLPPHVEFE-----------PRPK--ILLARVILCLLVFLILGTVAMSL-LTYIVFG  552
            NS P    + FE           PRPK  + L R   C + F IL  +A+++ +T++   
Sbjct  5    NSKPFSGPLRFELSDTSGQISSPPRPKCSVRLLRC-FCAISFAILSVIAVAIFVTWLAIR  63

Query  551  SAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLAN  372
               P + + + +V    +S+ ++  T   N S  NPN  + + ++ +E++V Y+   +AN
Sbjct  64   PHKPKYHLDSGAVSRLAISNGTITTTMNFNISSRNPNERVGIFYDSMEALVLYDTVKIAN  123

Query  371  KMVEP-FELKRNAKMVLPARISSPATRDGGNEREP-PWKEMKSELDDSRDLEFQVALEVL  198
              V   F+ ++N  ++      SP  R       P  +  +K+E   +  L  +V L   
Sbjct  124  ASVPKFFQSQKNTTVI------SPVVRGQSVHVVPGTFTGLKAE-SLTGQLVVEVKLIAR  176

Query  197  ATFKSGSDLSRRMTFTVSCYGLTAHFKDPGVGVWDGVKP----SCTVLF  63
              F+     SR     VSC G              GVKP     C V F
Sbjct  177  IRFQVARWTSRHYKMRVSCAGAVLDL--------SGVKPLKPQKCMVYF  217



>ref|XP_011010004.1| PREDICTED: protein YLS9-like [Populus euphratica]
Length=248

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 94/224 (42%), Gaps = 24/224 (11%)
 Frame = -2

Query  692  YNSAPLPPHVEFEP-----------RPKILLARVILCLLVFL-ILGTVAMSLLTYIVFGS  549
            Y S   PPH    P           +  I L RVI+ L++F  I  T+    + ++V   
Sbjct  31   YASQAPPPHQPTYPYTYNTNETYPNQRAIFLRRVIIALIIFTGIFFTIL--FICWLVIRP  88

Query  548  AVPFFDVAAFSVPSFNLSDKSLA--GTWQANFSVENPNHGLDVMFERVESMVYYNEFLLA  375
              P F V + S+ +FN+S  S +  GTW A F V NPN  + + +  +++ ++Y    L+
Sbjct  89   HFPEFRVTSLSISNFNVSTSSSSVTGTWNARFQVSNPNKKMKISYNEIQTSIFYKSEFLS  148

Query  374  NKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDL-EFQVALEVL  198
               V PF  ++  K V    +   AT     ER     ++ S  D+ R L  F + +   
Sbjct  149  RTRVPPF--RQGKKNVTNIDVEYGATSSYIGERSV--SQINS--DEGRGLVSFNLRIVAD  202

Query  197  ATFKSGSDLSRRMTFTVSCYGLTAHFKDPG-VGVWDGVKPSCTV  69
            A FK     +RR    V C  +       G  G   G    C+V
Sbjct  203  AGFKVEGFWARRRLLRVYCNDVAVGISRNGRSGNLTGGATRCSV  246



>ref|XP_006408666.1| hypothetical protein EUTSA_v10002079mg [Eutrema salsugineum]
 gb|ESQ50119.1| hypothetical protein EUTSA_v10002079mg [Eutrema salsugineum]
Length=260

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/173 (24%), Positives = 80/173 (46%), Gaps = 10/173 (6%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS-LAGT  474
            R +  +  ++  + + ++L  +++++L Y+VF    P + V  FSV   NL+  S ++  
Sbjct  70   RCRCCICSILAAIFILIVLAGISLTVL-YLVFRPEAPKYSVEGFSVSGINLTSPSPISPK  128

Query  473  WQANFSVENPNHGLDVMFERVESM-VYYNEFLLANKMVEPF-ELKRNAKMVLPARISSPA  300
            +       N N  + + +E+  ++ +YYN+  L N  +  F +   N  MV  A   S  
Sbjct  129  FNVTVRSRNGNGKIGIYYEKGSTVDIYYNDVDLCNGALPVFYQPANNVTMVKTALTGSRI  188

Query  299  TRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
                        KEM++EL   + + F+V ++     K GS  +  +T  V+C
Sbjct  189  QLTSAMR-----KEMRNELSK-KTMPFKVKIKAPVKIKVGSVKTWTITVKVNC  235



>gb|KDO70597.1| hypothetical protein CISIN_1g026507mg [Citrus sinensis]
Length=237

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS--DKSLAGTWQA  465
            LL R+ L ++V + +  VA S  T+++     P F V + S+   N +  + ++  TWQ 
Sbjct  48   LLCRLFLVVIVIISIMAVA-SFATWLILKPEFPEFRVDSASIAQLNTTSANSTMTATWQL  106

Query  464  NFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRN  339
            +  V NPN  L +++  +E+ V Y E+ L + ++ PF  ++ 
Sbjct  107  SLRVRNPNRKLALVYNTLEAAVLYGEWELDSTLLPPFSQEKG  148



>ref|XP_010908042.1| PREDICTED: uncharacterized protein At1g08160-like [Elaeis guineensis]
Length=202

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/195 (25%), Positives = 80/195 (41%), Gaps = 22/195 (11%)
 Frame = -2

Query  671  PHVEFEPRPKI------LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPF-FDVAAFSV  513
            P     P+P +      LL  + +  LV +IL  V +++L + +     P  F V   S 
Sbjct  4    PGTSHNPQPPLGRRGSGLLPCIAISTLVLIIL--VGLAILIFWLTVRPAPLEFSVDDAST  61

Query  512  PSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-ELKRNA  336
              FNL+ K L  T+      +NPNH + V ++ V   V+Y++ ++A   V PF +  RN 
Sbjct  62   HGFNLTAKELNATFNLTLRADNPNHRIRVYYDSVNITVWYSDQMVAFSEVAPFHQSHRNV  121

Query  335  KMVLPARISSPATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSR  165
            + +           D   +  P    +   L   R    +E +V +     FK G   ++
Sbjct  122  RTI---------DVDPVAKSVPLVASVVDNLKHDRSAGAVELEVRVRARIRFKVGLAKTK  172

Query  164  RMTFTVSCYGLTAHF  120
              T    C  +  HF
Sbjct  173  HYTLRAYCSPVVVHF  187



>gb|EYU36037.1| hypothetical protein MIMGU_mgv1a017876mg [Erythranthe guttata]
Length=259

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 89/214 (42%), Gaps = 8/214 (4%)
 Frame = -2

Query  698  GYYNSAPLPPHVEF--EPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVA  525
            GY N+A  P + +   E   +    R I   ++ L++    ++ + ++V    +P F V 
Sbjct  48   GYQNNAYYPNNYQSDQESVRRATCLRRIFAFVIGLVVIFGTITFIVWLVLRPQLPEFRVD  107

Query  524  AFSVPSFNLSDKSLAG-TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFEL  348
            +FS+ +F L + SL   T +   +  NPN  + + ++ +E++++Y    ++   V PF  
Sbjct  108  SFSISNFTLGNNSLVSFTSEVRLTARNPNKKMTLTYDHIEAVIFYKSSSISETTVPPFYQ  167

Query  347  KRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLS  168
                +  L A  ++     G    +     +  E   + ++ F   +     F++ +  +
Sbjct  168  PTKNETSLAANFAAA----GSFVEKSVLDGINGERGKNGNVNFNFRMLSRVRFEAKAWTT  223

Query  167  RRMTFTVSCYGLTAHFKDPG-VGVWDGVKPSCTV  69
            RR    V C  L       G VG   G    C V
Sbjct  224  RRRYLKVFCGDLIVGIPTNGSVGALTGGPRQCRV  257



>ref|XP_007202522.1| hypothetical protein PRUPE_ppa010944mg [Prunus persica]
 gb|EMJ03721.1| hypothetical protein PRUPE_ppa010944mg [Prunus persica]
Length=229

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 59/125 (47%), Gaps = 6/125 (5%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFS  516
            YY  AP P       RP +L   +I  + VF I+  V    + ++     +P F V + S
Sbjct  58   YY--APRPTGPITPNRPTLLCRLLIAAIAVFAIMSLVF--FIAWLALRPRLPEFRVESAS  113

Query  515  VPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYY-NEFLLANKMVEPFEL-KR  342
            V   N +   L  TW       NPNH L + ++ +++ ++Y +++ LA   + PF L KR
Sbjct  114  VFPLNATGSELTATWDLTLLANNPNHKLRIYYDSIQASLFYGDDYRLATTSLPPFVLTKR  173

Query  341  NAKMV  327
            N   V
Sbjct  174  NQTRV  178



>ref|XP_006342981.1| PREDICTED: uncharacterized protein LOC102587456 [Solanum tuberosum]
Length=267

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 77/194 (40%), Gaps = 12/194 (6%)
 Frame = -2

Query  692  YNSA-----PLPPHVEFEPRPKILLARVILCLLVFLI--LGTVAMSLLTYIVFGSAVPFF  534
            YN+A     P+PP      R       + +   +  I  L  +A ++  ++++    P F
Sbjct  46   YNAARPTYRPMPPPRRKHRRSCCCCCCLFITFFIITIVLLAAIAGAIF-WVLYRPQRPSF  104

Query  533  DVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF  354
             V+   V  FNL+   LA  +       NPN  +   ++ +      N+  + +  +  F
Sbjct  105  SVSTLQVSQFNLTSTKLASKFNLTVVARNPNKKISFFYDPINISFNSNDVDIGDGSLPAF  164

Query  353  ELKRNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSD  174
               R     L   +SS     G N  +     +KS+L +   L  ++ L+     K GS 
Sbjct  165  MHDRKNTTTLKTVVSS----SGKNLDDSAISNLKSKLKNKNTLPLEIKLDTKVKVKVGSL  220

Query  173  LSRRMTFTVSCYGL  132
             ++++   V C G+
Sbjct  221  KTKKVGIRVKCSGI  234



>ref|XP_009798502.1| PREDICTED: uncharacterized protein LOC104244724 [Nicotiana sylvestris]
Length=270

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 65/112 (58%), Gaps = 10/112 (9%)
 Frame = -2

Query  623  ILCLLVFLILGTVAMSLLTYIVFGSAVP---FFDVAAFSVPSFNL-SDKSLAG--TWQAN  462
            ILC++  L+L  +   ++T ++F S  P    FD +  S+    L S + + G  T+ AN
Sbjct  93   ILCMIFCLLL--ICFGIVTLVIFLSIKPRNPLFDTSNASLSLIYLDSPQYMNGDFTFIAN  150

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
            F+  NPN  LDV FE ++  +Y+++ L+A ++++PF  +R+   ++P  + S
Sbjct  151  FT--NPNRKLDVRFEHLDIELYFSDSLIATQVLQPFTQRRHETRLIPVHMIS  200



>gb|KHN42909.1| hypothetical protein glysoja_046984 [Glycine soja]
Length=239

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 87/203 (43%), Gaps = 25/203 (12%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILC---LLVFLILGTVAMSLLTYIVFGSAVPFFDVA  525
            YY   P P +    P  + + +  ILC   +L F  L ++ ++L+        +P + V 
Sbjct  32   YY--GPPPTYQTSSPGTRFIRS-FILCFMMILTFFFLSSLVLALM----LRPELPVYKVV  84

Query  524  AFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELK  345
            +F+V +F  +  +LAG W    S++NPN  L   F   +  V Y + ++A      F L 
Sbjct  85   SFNVNNFT-TTPTLAGQWDTKISIDNPNDKLVAYFSNFKVDVAYKDGVMAINHAPGFVLN  143

Query  344  RNAKMVLPARISSPATRDGGNEREPPWKEMKSELDD------SRDLEFQVALEVLATFKS  183
             N  M     ++  + +   N  E      K+ +DD      +  + F + +  +  FKS
Sbjct  144  TNDHM--DVNVAGLSNQGNVNLLE------KTTMDDLVKERSTGSVTFTLRVSSVNMFKS  195

Query  182  GSDLSRRMTFTVSCYGLTAHFKD  114
            GS  +R       C GL   F++
Sbjct  196  GSISTRTEEIVAICEGLKVVFQN  218



>ref|XP_006481586.1| PREDICTED: protein YLS9-like [Citrus sinensis]
Length=237

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (53%), Gaps = 3/102 (3%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS--DKSLAGTWQA  465
            LL R+ L ++V   +  VA S  T+++     P F V + S+   N +  + ++  TWQ 
Sbjct  48   LLCRLFLVVIVIFSIMAVA-SFATWLILKPEFPEFRVDSASIAQLNTTSANSTMTATWQL  106

Query  464  NFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRN  339
            +  V NPN  L +++  +E+ V Y E+ L + ++ PF  ++ 
Sbjct  107  SLRVRNPNRKLALVYNTLEAAVLYGEWELDSTLLPPFSQEKG  148



>ref|XP_009359238.1| PREDICTED: uncharacterized protein LOC103949837 [Pyrus x bretschneideri]
Length=400

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (47%), Gaps = 19/181 (10%)
 Frame = -2

Query  653  PRPK---ILLARVILCLLVF--LILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDK  489
            PRP+   +      +C  +F  LI+ T  + L+ Y+VF    P FDV++ ++ +  L   
Sbjct  208  PRPQQTNVFTWSGAICCAIFWVLIIITGLVVLIIYLVFRPRTPKFDVSSATLNAAYLDMG  267

Query  488  SLAG---TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPA  318
             L     T  ANF+  NPN  + V F  +   +YY   L+A + VEPF  +R+  M    
Sbjct  268  YLLNADVTVLANFT--NPNKKVSVDFSYLSIDLYYGNTLIATQYVEPFSAERSQSMFANV  325

Query  317  RISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCY  138
             + +   R G  E +     +K +++++R        EV   F++ ++  + + ++   +
Sbjct  326  HMVASQVRLGVLESQ----RLKKQMENNR-----AEFEVKGYFRARANFGKILRYSYWLH  376

Query  137  G  135
            G
Sbjct  377  G  377



>ref|XP_009416878.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416879.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=261

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 74/163 (45%), Gaps = 9/163 (6%)
 Frame = -2

Query  620  LCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS--LAGTWQANFSVEN  447
            + + +FL+ G V  +L+ ++V    +P F V++ +V  FNLS     L+  +  + +V N
Sbjct  74   IAVALFLLFGLV--TLIVWLVLRPRLPEFTVSSATVSGFNLSTSQQLLSADFDLDLTVHN  131

Query  446  PNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPP  267
            PN  + + ++ V + V Y    L+   + PF   + A   L AR+ + A     N     
Sbjct  132  PNSKMGIYYDHVAAAVLYGSDPLSETSLAPFYQAKGATTALRARLVAVAMYVDSNVV---  188

Query  266  WKEMKSELDDSRD-LEFQVALEVLATFKSGSDLSRRMTFTVSC  141
             K + S+       + FQ  +     FK G+  +R  T  V C
Sbjct  189  -KGINSDRGRGDGAVRFQARVSAWVRFKPGAWKTRWHTMRVYC  230



>ref|XP_008807076.1| PREDICTED: uncharacterized protein At1g08160-like [Phoenix dactylifera]
Length=204

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 77/190 (41%), Gaps = 14/190 (7%)
 Frame = -2

Query  665  VEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKS  486
            +    R   L+  + +  L  +IL  +A+ L+ +++   A   + V   S+  FNL+   
Sbjct  14   LHMRRRRSNLMPCIAISALALIILACLAI-LIFWLIVRPAQLEYSVDDASIHGFNLTANE  72

Query  485  LAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-ELKRNAKMVLPARIS  309
            L  T+      ENPNH + V ++ V+ +V+Y+  ++A   V PF +  RN   +      
Sbjct  73   LNATFNLTLRAENPNHRVGVYYDSVDIVVWYSNQMVAFSDVAPFYQGHRNVTTI------  126

Query  308  SPATRDGGNEREPPWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSRRMTFTVSCY  138
                 D   +  P    +   L   R    +E +V +     FK G   ++    T  C 
Sbjct  127  ---EVDPVAKSVPLLAPVVDNLQHDRSAGAVELEVKVRARIRFKVGLAKTKHYKLTAYCS  183

Query  137  GLTAHFKDPG  108
                HF  P 
Sbjct  184  PAVVHFSSPA  193



>ref|XP_007205939.1| hypothetical protein PRUPE_ppa011745mg [Prunus persica]
 gb|EMJ07138.1| hypothetical protein PRUPE_ppa011745mg [Prunus persica]
Length=198

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 79/170 (46%), Gaps = 11/170 (6%)
 Frame = -2

Query  647  PKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQ  468
            P  L+A V+L  +V  +LG V   L+T+++       + +   S+ +FNL++  L+  + 
Sbjct  18   PIRLIAIVLLACIV--LLGIVV--LITWLILKPKRLVYTIEDGSIQNFNLTNDHLSADFD  73

Query  467  ANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPF-ELKRNAKMVLPARISSPATRD  291
                  NPN  + + ++ +++ V YN+  LA   V+PF +  RN       R +   T  
Sbjct  74   FVLRAYNPNKRVSLYYDSIQATVNYNDQTLAFSGVDPFYQRHRNV-----TRFNIKFTAH  128

Query  290  GGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
                      +++ E    R ++F V L+    FK G+  SR  T  VSC
Sbjct  129  STALPSSVSNDLQLEKRSGR-IQFDVWLKARIRFKVGAWKSRHRTLRVSC  177



>ref|XP_008226754.1| PREDICTED: uncharacterized protein At1g08160-like [Prunus mume]
Length=198

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 78/169 (46%), Gaps = 9/169 (5%)
 Frame = -2

Query  647  PKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQ  468
            P  L+A V+L  +V  +LG V   L+T+++       + +   S+ +FNL++  L+  + 
Sbjct  18   PIRLIAIVLLACIV--LLGLVV--LITWLILKPKRLVYTIEDGSIQNFNLTNDHLSADFD  73

Query  467  ANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDG  288
                  NPN  + + ++ +++ V YN+  LA   V+PF  +         + ++ +T   
Sbjct  74   FVLRAYNPNKRVSIYYDSIQATVNYNDQTLAFSGVDPFYQRHRNVTRFNVKFTAHSTALP  133

Query  287  GNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
             +       E ++       ++F V L+    FK G+  SR  T  VSC
Sbjct  134  SSVSNDLQLEKRTG-----KIQFDVWLKARIRFKVGAWKSRHRTLRVSC  177



>ref|XP_008387109.1| PREDICTED: uncharacterized protein LOC103449563 [Malus domestica]
Length=168

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (49%), Gaps = 0/84 (0%)
 Frame = -2

Query  542  PFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMV  363
            P   +A+  V    +S+ S    W   F++ENPN    V F+R+E  + Y +  L+   V
Sbjct  69   PKIQIASLFVSKLKVSNTSFGANWDVAFTIENPNVVSWVRFKRIEGSISYEDNSLSKFPV  128

Query  362  EPFELKRNAKMVLPARISSPATRD  291
            EPFEL       L  +IS+  + D
Sbjct  129  EPFELGLTEHKRLRVKISTTVSHD  152



>ref|XP_003537109.1| PREDICTED: uncharacterized protein LOC100780240 [Glycine max]
Length=283

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 87/203 (43%), Gaps = 25/203 (12%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILC---LLVFLILGTVAMSLLTYIVFGSAVPFFDVA  525
            YY   P P +    P  + + +  ILC   +L F  L ++ ++L+        +P + V 
Sbjct  76   YY--GPPPTYQTSSPGTRFIRS-FILCFMMILTFFFLSSLVLALM----LRPELPVYKVV  128

Query  524  AFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELK  345
            +F+V +F  +  +LAG W    S++NPN  L   F   +  V Y + ++A      F L 
Sbjct  129  SFNVNNFTTT-PTLAGQWDTKISIDNPNDKLVAYFSNFKVDVAYKDGVMAINHAPGFVLN  187

Query  344  RNAKMVLPARISSPATRDGGNEREPPWKEMKSELDD------SRDLEFQVALEVLATFKS  183
             N  M     ++  + +   N  E      K+ +DD      +  + F + +  +  FKS
Sbjct  188  TNDHM--DVNVAGLSNQGNVNLLE------KTTMDDLVKERSTGSVTFTLRVSSVNMFKS  239

Query  182  GSDLSRRMTFTVSCYGLTAHFKD  114
            GS  +R       C GL   F++
Sbjct  240  GSISTRTEEIVAICEGLKVVFQN  262



>ref|XP_009620973.1| PREDICTED: uncharacterized protein LOC104112683 [Nicotiana tomentosiformis]
Length=268

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 65/112 (58%), Gaps = 10/112 (9%)
 Frame = -2

Query  623  ILCLLVFLILGTVAMSLLTYIVFGSAVP---FFDVAAFSVPSFNL-SDKSLAG--TWQAN  462
            ILC++  L+L  +   ++T ++F S  P    FD +  S+    L S + + G  T+ AN
Sbjct  91   ILCMVFCLLL--ICFGIVTLVIFLSIKPRNPLFDTSNASLSLIYLDSPQYMNGDFTFIAN  148

Query  461  FSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
            F+  NPN  LDV FE ++  +Y+++ L+A ++++PF  +R+   ++P  + S
Sbjct  149  FT--NPNRKLDVRFEHLDIELYFSDSLIATQVLQPFTQRRHETRLVPVHMIS  198



>ref|XP_006385614.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP63411.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=249

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 8/87 (9%)
 Frame = -2

Query  542  PFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMV-------YYNEF  384
            P F + +FS+P FN S    +  W+AN +V N    L + F ++ + V       YY+ F
Sbjct  81   PDFHIDSFSIPDFNPSYPGFSANWEANITVRNSEEKLKIHFHQIHAFVQKYANVDYYDPF  140

Query  383  -LLANKMVEPFELKRNAKMVLPARISS  306
              LA+   +PF ++ N+  V+ A++S+
Sbjct  141  STLASGFSQPFSMEPNSSNVIHAKLST  167



>ref|XP_009414842.1| PREDICTED: protein YLS9-like [Musa acuminata subsp. malaccensis]
Length=261

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 77/172 (45%), Gaps = 13/172 (8%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS--DKSLAGTWQA  465
            L  R +L   V L L       + ++V    +P   V + +V  FNLS  ++ L+  +  
Sbjct  66   LFLRRLLSFFVALFLLVGLAVFIVWLVLRPRLPEIGVTSVAVSGFNLSASEQQLSADFDL  125

Query  464  NFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGG  285
            N +V NPN  + + ++ V + V Y    ++   + PF  ++   + + AR  +      G
Sbjct  126  NLAVHNPNRKMGIYYDHVTAAVLYGTETISEASLAPFYQEKGNTIAVRARFVAV-----G  180

Query  284  NEREP-PWKEMKSELDDSRD---LEFQVALEVLATFKSGSDLSRRMTFTVSC  141
               +P   K ++S  D SR    + FQV +     F+SG+  +R  T  V C
Sbjct  181  EYVDPDAVKGIRS--DQSRGDGAVGFQVTVLAWVRFRSGAWRTRWHTMRVYC  230



>gb|KDO40068.1| hypothetical protein CISIN_1g036189mg [Citrus sinensis]
Length=241

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/204 (22%), Positives = 93/204 (46%), Gaps = 12/204 (6%)
 Frame = -2

Query  668  HVEFEPRPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDK  489
            H + +  PK+++  + L ++   I  T  + +L Y   G  +P   +  FSV +F +   
Sbjct  39   HFQIKKLPKLII--ITLLVVAASISLTALICILMYFTLGPKLPSLHLDTFSVSNFTIGST  96

Query  488  SLAGTWQANFSVENPNHGLDVMFERVESM-VYYNEFLLA--NKMVEPFELKRNAKMVLPA  318
            +L   W  N + +NP+H   +  + +E + + ++ F +A  + +  PF++K   K  +  
Sbjct  97   NLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHFPIAINHSVSPPFKVKPMKKSTIHV  156

Query  317  RISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDL--SRRMTFTVS  144
            ++++  +    N +    +++ S+  + R + F +A+     F   S L  +       +
Sbjct  157  QLATGDSLIFLNHQL--LQKINSQRRNGRMVVFGLAVRAKTRFTGVSWLWWTEFANLMYT  214

Query  143  CYGLTAHFK---DPGVGVWDGVKP  81
            C  L   FK   D  VG++ G  P
Sbjct  215  CLDLKVGFKGLSDSDVGMFIGRLP  238



>ref|XP_004301934.1| PREDICTED: uncharacterized protein At1g08160-like [Fragaria vesca 
subsp. vesca]
Length=243

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = -2

Query  587  VAMSLLTYIVFGSA-----------VPFFDVAAFSVPSFNLSD--KSLAGTWQANFSVEN  447
            +AM  L +++FGS            +P F V +F+V + N+S   ++L GTW   F V N
Sbjct  61   IAMVFL-FVIFGSLLLIIWLILRPKIPDFRVDSFTVTNLNVSSSRQALTGTWSVGFDVFN  119

Query  446  PNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISS  306
            PN  + + ++ + + V+Y    ++   V PF+  +  +  + A +S+
Sbjct  120  PNKKMTIEYDGIGASVFYRSGFISETRVPPFQQGKRVRSAVNATLSA  166



>ref|XP_006430079.1| hypothetical protein CICLE_v10012623mg [Citrus clementina]
 gb|ESR43319.1| hypothetical protein CICLE_v10012623mg [Citrus clementina]
Length=237

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -2

Query  638  LLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS--DKSLAGTWQA  465
            LL R+ L ++V + +  VA S  T+++     P F V + S+   N +  + ++  TW+ 
Sbjct  48   LLCRLFLVVIVIISIMAVA-SFATWLILKPEFPEFRVDSASIAQLNTTSANSTMTATWKL  106

Query  464  NFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRN  339
            +  V NPN  L +++  +E+ V Y E+ L + ++ PF  ++ 
Sbjct  107  SLRVRNPNRKLALVYNTLEAAVLYGEWELDSTLLPPFSQEKG  148



>ref|XP_007203710.1| hypothetical protein PRUPE_ppa019255mg [Prunus persica]
 gb|EMJ04909.1| hypothetical protein PRUPE_ppa019255mg [Prunus persica]
Length=182

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/139 (24%), Positives = 65/139 (47%), Gaps = 7/139 (5%)
 Frame = -2

Query  581  MSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESM  402
            MSLL+ +      P   + +  +  FN+S+ +L   W    +++NPN    V F  ++  
Sbjct  1    MSLLSQV--HPQAPNVQLNSLFMSKFNISNTTLGANWDMTLTIDNPNLLTWVRFNHIKGS  58

Query  401  VYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRDGGNEREPPWK-----EMKSELDD  237
            + Y + +LA   +EPF L    +  +  +IS+    +   + +   K     EM S+  +
Sbjct  59   MSYKDNILAISSIEPFMLGLKERRTVRVKISTMGLGEEDRDHQLVVKKRVLDEMMSKRRE  118

Query  236  SRDLEFQVALEVLATFKSG  180
               + F + + V AT+++G
Sbjct  119  DGAVHFSMQMFVWATYRTG  137



>ref|XP_004494246.1| PREDICTED: uncharacterized protein LOC101501676 [Cicer arietinum]
Length=294

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 87/196 (44%), Gaps = 12/196 (6%)
 Frame = -2

Query  695  YYNSAPLPPHVEFEPRPKILLARVILC-LLVF--LILGTVAMSLLTYIVFGSAVPFFDVA  525
            YYN   +PP+       +      I+C  L+F    L ++ M+L+ +      +P + V 
Sbjct  87   YYN---VPPNYNAANGGRGFFRGFIMCSCLIFTCFFLSSIIMALILH----PQLPVYKVT  139

Query  524  AFSVPSFNLSDKSLAGTWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELK  345
            + SV +FN +   L G W  + +V+NPN  L   F   +  V +    LA   V  FEL+
Sbjct  140  SLSVTNFNTT-PILTGDWNISITVQNPNDRLRGYFSDFKVDVVHENDELALSYVPDFELE  198

Query  344  RNAKMVLPARISSPATRDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSR  165
            ++ +  +  + SS     G + ++    ++ +E   +  + F V +  +  FKS S  +R
Sbjct  199  KHEQKQMDVKTSSSNGAYGVSFQKWDLDKIANE-RQTGSVMFGVRVSSMTAFKSTSLSTR  257

Query  164  RMTFTVSCYGLTAHFK  117
                   C GL   F+
Sbjct  258  NAVILAVCEGLKVVFQ  273



>ref|XP_010421086.1| PREDICTED: uncharacterized protein At1g08160-like [Camelina sativa]
Length=208

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 10/176 (6%)
 Frame = -2

Query  650  RPKILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLS-DKSLAGT  474
            RP  L+  V L +L  + +  V   L+T+ V       + +   SV +FNL+ D  ++ T
Sbjct  23   RPS-LVCYVFLVILTLIFIAAVGF-LITWFVTKPKKLHYTLENASVQNFNLTNDNHMSAT  80

Query  473  WQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR-NAKMVLPARISSPAT  297
            +       NPNH + V +  VE  V + +  LA   +EPF   R N K +    ++    
Sbjct  81   FIFTIQSHNPNHRISVYYSSVEIFVKFKDQTLAFDTMEPFHQPRMNVKQIDDMLVAQNVA  140

Query  296  RDGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLT  129
                N      K +++++   + ++F+V ++    FK G   +   T  V C  +T
Sbjct  141  VSKSNG-----KNLRAQISSGK-IDFEVFVKARVRFKIGVWKTAHHTAKVKCPHVT  190



>ref|XP_010248691.1| PREDICTED: uncharacterized protein LOC104591528 [Nelumbo nucifera]
Length=229

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 91/206 (44%), Gaps = 30/206 (15%)
 Frame = -2

Query  674  PPHVEFEPRPK----ILLARVILC--LLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSV  513
            P H    P+P+    I     I C  L + +ILG + M L+ Y+V+    P FD+++ ++
Sbjct  30   PMHGLKVPQPRRTKPITWFTAIFCAILWMIIILGGL-MVLIVYLVYRPRSPRFDISSATL  88

Query  512  PSFNLSDKSLAG---TWQANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKR  342
             +  +    L     T  ANF+  NPN  +DV F  +   +YY E  +A + ++PF   R
Sbjct  89   NAAYIDMGYLLNADLTILANFT--NPNRKIDVDFHYMVIDLYYGETQIATQAIDPFSATR  146

Query  341  NAKMVLPARISSPATR----DGGNEREPPWKEMKSELDDSRDLEFQVALEVLATFKSGSD  174
                +L   + S   R    D G        ++K +++++R     V L+V   F++ S+
Sbjct  147  AESKLLDVHMVSSQVRLPSGDSG--------QLKQQMEENR-----VVLDVRGLFRTRSN  193

Query  173  LSRRMTFTVSCYG-LTAHFKDPGVGV  99
                  ++   Y   T     P  G+
Sbjct  194  FGTIFHYSYWLYSRCTIVLNGPPTGI  219



>ref|XP_011011008.1| PREDICTED: uncharacterized protein At1g08160 [Populus euphratica]
Length=199

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/163 (23%), Positives = 74/163 (45%), Gaps = 8/163 (5%)
 Frame = -2

Query  626  VILCLLVFLILGTVAMSLLTYIVFGSAVPFFDVAAFSVPSFNLSDKSLAGTWQANFSVEN  447
            +++ +L  ++L  +A+ L+T+++       + + + SV +FNL +  L  T+       N
Sbjct  22   IVVVILALIVLFGIAV-LITWLIIKPKQLVYRIDSASVHNFNLKNNHLNATFDLLIKAHN  80

Query  446  PNHGLDVMFERVESMVYYNEFLLANKMVEPFEL-KRNAKMVLPARISSPATRDGGNEREP  270
            PN  + V ++ +E  V Y+   +A   +EPF   +RN   +    ++  A   G   R+ 
Sbjct  81   PNARISVYYDPIEVSVAYDGQTIAFNTLEPFHQPRRNVTRLDATLVARDAALSGALSRDL  140

Query  269  PWKEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSC  141
              ++       S D+   V ++    FK G    +  T  +SC
Sbjct  141  MVQK------KSGDIGLDVRIKARIRFKVGIFKLKHHTLRISC  177



>ref|XP_009349991.1| PREDICTED: uncharacterized protein LOC103941512 [Pyrus x bretschneideri]
Length=236

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 86/198 (43%), Gaps = 15/198 (8%)
 Frame = -2

Query  641  ILLARVILCLLVFLILGTVAMSLLTYIVFGSAVPF---FDVAAFSVPSFNLSDKSLAGTW  471
            +L+ RV+L       LG V  +L+  I+  S VP      + +  V   N+S   L   +
Sbjct  42   VLVHRVLL-----FALGIV--TLICVIMATSLVPQPPKIRLNSLFVSKLNISRGMLGANF  94

Query  470  QANFSVENPNHGLDVMFERVESMVYYNEFLLANKMVEPFELKRNAKMVLPARISSPATRD  291
               F++ENPN    V F R++  + Y + ++    +EPF L    +  +  +IS+ A  D
Sbjct  95   DVTFTIENPNLVSWVRFNRLDGSISYKDNVVLTYSLEPFVLGLKQQRTMRVKISTMALED  154

Query  290  GGNEREPPW--KEMKSELDDSRDLEFQVALEVLATFKSGSDLSRRMTFTVSCYGLTAHF-  120
                    W   E+K + +D   +E  + +   AT+K+G   ++ +     C  L   F 
Sbjct  155  DDQPVVEEWVLDEVKRQREDG-AVELSMEMFAWATYKTGWWGTQFVIMNPQCLDLRVGFL  213

Query  119  KDPGVGVWDGVKP-SCTV  69
               G G W    P  C+V
Sbjct  214  PKVGFGSWISGGPMMCSV  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2569280546592