BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23059_g1_i2 len=1554 path=[306:0-110 3912:111-113 3915:114-125
432:126-419 1954:420-473 2008:474-588 2123:589-630 2165:631-731
2266:732-1180 2715:1181-1217 2752:1218-1239 2774:1240-1263
2798:1264-1553]

Length=1554
                                                                      Score     E

ref|XP_004238625.1|  PREDICTED: UPF0496 protein At1g20180-like          253   2e-75   
ref|XP_009796590.1|  PREDICTED: UPF0496 protein At1g20180-like          248   6e-73   
ref|XP_009605221.1|  PREDICTED: UPF0496 protein At1g20180-like          246   2e-72   
ref|XP_006342242.1|  PREDICTED: UPF0496 protein At1g20180-like          246   2e-72   
ref|XP_004292933.1|  PREDICTED: UPF0496 protein At1g20180-like          219   4e-62   
ref|XP_011083446.1|  PREDICTED: UPF0496 protein At1g20180-like          213   9e-60   
ref|XP_008359758.1|  PREDICTED: UPF0496 protein At1g20180-like          204   3e-56   
ref|XP_010100136.1|  hypothetical protein L484_014327                   201   4e-55   
ref|XP_011015237.1|  PREDICTED: UPF0496 protein At1g20180-like          200   9e-55   
ref|XP_002510585.1|  conserved hypothetical protein                     197   9e-54   Ricinus communis
ref|XP_002301952.1|  hypothetical protein POPTR_0002s01980g             197   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011075001.1|  PREDICTED: UPF0496 protein At1g20180-like          196   2e-53   
ref|XP_010266030.1|  PREDICTED: UPF0496 protein At1g20180-like is...    194   4e-53   
ref|XP_010266029.1|  PREDICTED: UPF0496 protein At1g20180-like is...    194   8e-53   
ref|XP_007017877.1|  Uncharacterized protein TCM_034276                 194   1e-52   
ref|XP_002306952.2|  hypothetical protein POPTR_0005s26520g             194   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002279229.1|  PREDICTED: UPF0496 protein At1g20180               192   3e-52   Vitis vinifera
ref|XP_008221219.1|  PREDICTED: UPF0496 protein At1g20180               192   1e-51   
ref|XP_006473909.1|  PREDICTED: UPF0496 protein At1g20180-like          190   3e-51   
ref|XP_010266985.1|  PREDICTED: UPF0496 protein At1g20180-like          190   4e-51   
ref|XP_009334684.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...    190   5e-51   
ref|XP_011034981.1|  PREDICTED: UPF0496 protein At1g20180-like          189   7e-51   
ref|XP_006435237.1|  hypothetical protein CICLE_v10003990mg             188   1e-50   
gb|KDP36884.1|  hypothetical protein JCGZ_08175                         189   1e-50   
gb|KDO84940.1|  hypothetical protein CISIN_1g038436mg                   183   9e-49   
ref|XP_003544385.2|  PREDICTED: UPF0496 protein At1g20180-like          182   2e-48   
ref|XP_006579026.1|  PREDICTED: UPF0496 protein At1g20180-like          181   4e-48   
ref|XP_003549471.2|  PREDICTED: UPF0496 protein At1g20180-like          181   1e-47   
ref|XP_007224037.1|  hypothetical protein PRUPE_ppa015186mg             181   1e-47   
gb|KHN12622.1|  UPF0496 protein                                         180   2e-47   
emb|CDP07360.1|  unnamed protein product                                178   4e-47   
gb|KHN39407.1|  UPF0496 protein                                         178   9e-47   
ref|XP_004499302.1|  PREDICTED: UPF0496 protein At1g20180-like          177   2e-46   
gb|KEH20116.1|  transmembrane protein                                   177   3e-46   
ref|XP_006416424.1|  hypothetical protein EUTSA_v10007842mg             176   7e-46   
ref|XP_008357119.1|  PREDICTED: UPF0496 protein At1g20180-like          170   8e-44   
gb|KHN45948.1|  UPF0496 protein                                         166   3e-43   
emb|CDY71153.1|  BnaAnng36320D                                          167   1e-42   
ref|XP_010257866.1|  PREDICTED: UPF0496 protein At1g20180-like          165   2e-42   
ref|XP_009110237.1|  PREDICTED: UPF0496 protein At1g20180-like          166   3e-42   
ref|XP_003589549.1|  hypothetical protein MTR_1g025960                  163   2e-41   
ref|XP_003603811.1|  hypothetical protein MTR_3g114460                  162   4e-41   
gb|AES74062.2|  transmembrane protein                                   162   5e-41   
emb|CDY54335.1|  BnaCnng26810D                                          161   2e-40   
ref|XP_004500922.1|  PREDICTED: UPF0496 protein At1g20180-like          160   3e-40   
ref|XP_010498452.1|  PREDICTED: UPF0496 protein At1g20180-like          159   7e-40   
ref|XP_010459700.1|  PREDICTED: UPF0496 protein At1g20180-like is...    158   1e-39   
ref|XP_010459701.1|  PREDICTED: UPF0496 protein At1g20180-like is...    158   2e-39   
ref|XP_010477250.1|  PREDICTED: UPF0496 protein At1g20180               157   5e-39   
ref|XP_007160635.1|  hypothetical protein PHAVU_001G003900g             155   9e-39   
gb|AAT67559.1|  hypothetical protein At1G20180                          155   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173445.2|  uncharacterized protein                               155   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498454.1|  PREDICTED: UPF0496 protein At1g20180-like          155   2e-38   
ref|XP_010265539.1|  PREDICTED: UPF0496 protein At1g20180-like          155   3e-38   
ref|XP_010064565.1|  PREDICTED: UPF0496 protein At1g20180-like          153   1e-37   
gb|KCW67992.1|  hypothetical protein EUGRSUZ_F01683                     152   1e-37   
ref|XP_010061096.1|  PREDICTED: UPF0496 protein At1g20180               152   2e-37   
ref|XP_010539833.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...    152   2e-37   
ref|XP_010064566.1|  PREDICTED: UPF0496 protein At1g20180-like          150   6e-37   
gb|KCW67991.1|  hypothetical protein EUGRSUZ_F01681                     149   9e-37   
gb|KCW67993.1|  hypothetical protein EUGRSUZ_F01684                     149   1e-36   
ref|XP_002890374.1|  hypothetical protein ARALYDRAFT_472247             148   4e-36   
ref|XP_006305029.1|  hypothetical protein CARUB_v10009395mg             146   2e-35   
ref|NP_001077567.1|  uncharacterized protein                            143   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAX23752.1|  hypothetical protein At1g20180                          143   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008381824.1|  PREDICTED: UPF0496 protein At1g20180-like          142   5e-34   
ref|XP_006353951.1|  PREDICTED: UPF0496 protein At3g49070-like          140   1e-33   
ref|XP_009758515.1|  PREDICTED: UPF0496 protein At1g20180-like is...    140   2e-33   
ref|XP_009612127.1|  PREDICTED: UPF0496 protein At3g49070-like          140   3e-33   
ref|XP_009758514.1|  PREDICTED: UPF0496 protein At1g20180-like is...    140   3e-33   
ref|XP_010668392.1|  PREDICTED: UPF0496 protein At1g20180               140   3e-33   
ref|XP_004234461.2|  PREDICTED: UPF0496 protein At3g49070-like          137   2e-32   
ref|XP_002302174.2|  hypothetical protein POPTR_0002s06790g             137   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010536427.1|  PREDICTED: UPF0496 protein At1g20180-like          136   2e-32   
ref|XP_010935393.1|  PREDICTED: putative UPF0496 protein 2              136   7e-32   
ref|XP_009587167.1|  PREDICTED: UPF0496 protein At1g20180-like          135   8e-32   
ref|XP_011042862.1|  PREDICTED: UPF0496 protein At1g20180-like          133   4e-31   
ref|XP_007019520.1|  Uncharacterized protein TCM_035624                 131   3e-30   
ref|XP_010064985.1|  PREDICTED: UPF0496 protein At1g20180-like          130   3e-30   
ref|XP_008445326.1|  PREDICTED: UPF0496 protein At1g20180-like          130   7e-30   
ref|XP_002524292.1|  conserved hypothetical protein                     129   1e-29   Ricinus communis
ref|XP_007199021.1|  hypothetical protein PRUPE_ppa017714mg             129   1e-29   
ref|XP_008347375.1|  PREDICTED: UPF0496 protein At1g20180-like          125   4e-29   
ref|XP_009800794.1|  PREDICTED: UPF0496 protein At3g49070-like is...    127   5e-29   
ref|XP_009800793.1|  PREDICTED: UPF0496 protein At3g49070-like is...    127   6e-29   
ref|XP_008237859.1|  PREDICTED: UPF0496 protein At1g20180-like          126   9e-29   
ref|XP_010665136.1|  PREDICTED: UPF0496 protein At1g20180-like          126   9e-29   
ref|XP_011044296.1|  PREDICTED: UPF0496 protein At1g20180-like          126   1e-28   
ref|XP_009376530.1|  PREDICTED: UPF0496 protein At1g20180-like          125   1e-28   
gb|KGN62262.1|  hypothetical protein Csa_2G346030                       126   1e-28   
ref|XP_004143078.1|  PREDICTED: UPF0496 protein At1g20180-like          126   2e-28   
ref|XP_008806163.1|  PREDICTED: putative UPF0496 protein 2              125   2e-28   
ref|XP_010102653.1|  hypothetical protein L484_004321                   126   3e-28   
ref|XP_007218328.1|  hypothetical protein PRUPE_ppa008472mg             124   4e-28   
ref|XP_002513670.1|  conserved hypothetical protein                     122   2e-27   Ricinus communis
ref|XP_004309191.1|  PREDICTED: UPF0496 protein At3g49070-like          121   6e-27   
ref|XP_009595974.1|  PREDICTED: UPF0496 protein At1g20180-like          120   1e-26   
ref|XP_008234194.1|  PREDICTED: UPF0496 protein At3g49070               119   2e-26   
ref|XP_009777697.1|  PREDICTED: UPF0496 protein At1g20180-like          118   3e-26   
emb|CDY66065.1|  BnaCnng49510D                                          117   1e-25   
ref|XP_010275646.1|  PREDICTED: UPF0496 protein At3g49070               117   1e-25   
ref|XP_011076482.1|  PREDICTED: UPF0496 protein At3g49070               117   2e-25   
ref|XP_010662696.1|  PREDICTED: UPF0496 protein At3g49070               116   2e-25   
ref|XP_010550544.1|  PREDICTED: UPF0496 protein At3g49070               115   7e-25   
gb|EYU25118.1|  hypothetical protein MIMGU_mgv1a009025mg                114   1e-24   
ref|XP_009149505.1|  PREDICTED: UPF0496 protein At1g20180 isoform X1    115   1e-24   
ref|XP_010671658.1|  PREDICTED: UPF0496 protein At3g49070               114   2e-24   
ref|XP_009368752.1|  PREDICTED: UPF0496 protein At3g49070               112   3e-24   
ref|XP_007143548.1|  hypothetical protein PHAVU_007G080900g             113   4e-24   
ref|XP_007143549.1|  hypothetical protein PHAVU_007G080900g             112   4e-24   
ref|XP_008806164.1|  PREDICTED: putative UPF0496 protein 2              112   5e-24   
gb|KCW70525.1|  hypothetical protein EUGRSUZ_F03728                     112   7e-24   
ref|XP_007038771.1|  Uncharacterized protein TCM_015222                 114   1e-23   
ref|XP_010930967.1|  PREDICTED: UPF0496 protein At1g20180-like          111   1e-23   
ref|XP_002306700.2|  hypothetical protein POPTR_0005s21510g             108   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008781640.1|  PREDICTED: UPF0496 protein At1g20180-like          110   5e-23   
gb|KDP30764.1|  hypothetical protein JCGZ_15193                         109   7e-23   
ref|XP_004496535.1|  PREDICTED: UPF0496 protein At3g49070-like is...    109   8e-23   
emb|CDP05163.1|  unnamed protein product                                109   8e-23   
gb|KGN50304.1|  hypothetical protein Csa_5G166480                       107   2e-22   
emb|CAN76069.1|  hypothetical protein VITISV_028178                     109   2e-22   Vitis vinifera
ref|XP_006434470.1|  hypothetical protein CICLE_v10003841mg             107   3e-22   
ref|XP_004143745.1|  PREDICTED: UPF0496 protein At3g49070-like          107   3e-22   
ref|XP_002322490.1|  hypothetical protein POPTR_0015s12800g             107   3e-22   Populus trichocarpa [western balsam poplar]
gb|KFK34197.1|  hypothetical protein AALP_AA5G114000                    107   5e-22   
ref|XP_004158156.1|  PREDICTED: UPF0496 protein At3g49070-like          107   5e-22   
gb|KFK34198.1|  hypothetical protein AALP_AA5G114000                    107   6e-22   
ref|XP_009149769.1|  PREDICTED: UPF0496 protein At3g49070               107   6e-22   
ref|XP_008436996.1|  PREDICTED: UPF0496 protein At3g49070 isoform X1    106   8e-22   
ref|XP_006404181.1|  hypothetical protein EUTSA_v10010462mg             106   1e-21   
gb|KEH43679.1|  UPF0496 plant-like protein                              106   1e-21   
ref|XP_009382157.1|  PREDICTED: UPF0496 protein 3-like                  106   1e-21   
ref|XP_003592217.1|  hypothetical protein MTR_1g100200                  105   1e-21   
gb|AES62468.2|  UPF0496 plant-like protein                              105   1e-21   
gb|KEH43678.1|  UPF0496 plant-like protein                              105   1e-21   
gb|EYU41111.1|  hypothetical protein MIMGU_mgv1a008146mg                105   2e-21   
gb|KDO83745.1|  hypothetical protein CISIN_1g045225mg                   105   2e-21   
emb|CDY08106.1|  BnaA06g16200D                                          105   2e-21   
ref|NP_190476.1|  uncharacterized protein                               105   3e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05899.1|  BnaC08g20760D                                          104   4e-21   
gb|KDP42179.1|  hypothetical protein JCGZ_02909                         103   5e-21   
ref|XP_011048768.1|  PREDICTED: UPF0496 protein At3g49070               104   6e-21   
ref|XP_010935394.1|  PREDICTED: putative UPF0496 protein 2              103   7e-21   
ref|XP_007152005.1|  hypothetical protein PHAVU_004G093700g             103   1e-20   
ref|XP_010060591.1|  PREDICTED: UPF0496 protein At3g49070               103   1e-20   
ref|XP_002877644.1|  hypothetical protein ARALYDRAFT_906162             102   3e-20   
ref|XP_006421982.1|  hypothetical protein CICLE_v10006929mg             101   5e-20   
ref|XP_010933135.1|  PREDICTED: UPF0496 protein 3                       101   6e-20   
gb|KDO51964.1|  hypothetical protein CISIN_1g046315mg                   100   6e-20   
ref|XP_010314477.1|  PREDICTED: UPF0496 protein At1g20180-like is...    100   9e-20   
ref|XP_004237798.1|  PREDICTED: UPF0496 protein At1g20180-like          100   1e-19   
ref|XP_007161536.1|  hypothetical protein PHAVU_001G077600g             100   1e-19   
ref|XP_010515252.1|  PREDICTED: UPF0496 protein At3g49070               100   2e-19   
gb|KCW70523.1|  hypothetical protein EUGRSUZ_F03726                   97.8    3e-19   
ref|XP_006291302.1|  hypothetical protein CARUB_v10017437mg           97.8    1e-18   
ref|XP_006589491.1|  PREDICTED: UPF0496 protein At1g20180-like        96.3    1e-18   
ref|XP_010108625.1|  hypothetical protein L484_017858                 98.6    1e-18   
ref|XP_004985705.1|  PREDICTED: UPF0496 protein 3-like isoform X3     96.7    2e-18   
ref|XP_004985704.1|  PREDICTED: UPF0496 protein 3-like isoform X2     95.9    4e-18   
ref|XP_004985703.1|  PREDICTED: UPF0496 protein 3-like isoform X1     95.9    5e-18   
ref|XP_006600008.1|  PREDICTED: UPF0496 protein At1g20180-like        95.5    7e-18   
ref|XP_002465856.1|  hypothetical protein SORBIDRAFT_01g047060        94.7    1e-17   Sorghum bicolor [broomcorn]
ref|XP_008794309.1|  PREDICTED: UPF0496 protein 3                     94.0    2e-17   
ref|XP_009387360.1|  PREDICTED: UPF0496 protein 3-like                93.2    4e-17   
ref|XP_006601074.1|  PREDICTED: UPF0496 protein At3g49070-like        92.0    5e-17   
ref|XP_010941446.1|  PREDICTED: putative UPF0496 protein 2            92.0    9e-17   
ref|XP_009149506.1|  PREDICTED: UPF0496 protein At1g20180 isoform X2  91.3    1e-16   
tpg|DAA43374.1|  TPA: hypothetical protein ZEAMMB73_365203            87.0    3e-15   
ref|NP_001136798.1|  hypothetical protein                             86.7    6e-15   Zea mays [maize]
ref|XP_009388342.1|  PREDICTED: putative UPF0496 protein 2            85.5    9e-15   
ref|XP_009383392.1|  PREDICTED: putative UPF0496 protein 2            85.9    1e-14   
ref|XP_003563532.2|  PREDICTED: UPF0496 protein At1g20180-like        84.7    2e-14   
ref|XP_008436997.1|  PREDICTED: UPF0496 protein At3g49070 isoform X2  79.7    8e-14   
gb|EAY88551.1|  hypothetical protein OsI_10026                        79.0    1e-12   Oryza sativa Indica Group [Indian rice]
sp|A2XCJ1.2|U496C_ORYSI  RecName: Full=UPF0496 protein 3              79.0    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_011069602.1|  PREDICTED: UPF0496 protein At3g49070-like        75.1    2e-12   
gb|KHN41282.1|  UPF0496 protein                                       76.6    3e-12   
ref|XP_010314478.1|  PREDICTED: UPF0496 protein At3g49070-like is...  74.7    5e-12   
ref|XP_009395566.1|  PREDICTED: putative UPF0496 protein 2            77.8    5e-12   
gb|AAN87731.1|  Unknown protein                                       77.4    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAK98722.1|AC090485_1  Hypothetical protein                        77.0    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048965.1|  Os03g0148000                                     77.0    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KHN33256.1|  UPF0496 protein                                       73.6    2e-11   
ref|XP_011075012.1|  PREDICTED: UPF0496 protein At3g49070-like        70.1    1e-10   
gb|EMT22072.1|  hypothetical protein F775_11781                       72.0    2e-10   
tpg|DAA37854.1|  TPA: hypothetical protein ZEAMMB73_661500            70.9    7e-10   
ref|XP_011069603.1|  PREDICTED: UPF0496 protein At3g49070-like        68.6    1e-09   
ref|XP_011075011.1|  PREDICTED: uncharacterized protein LOC105159596  68.6    1e-09   
gb|EMS66051.1|  hypothetical protein TRIUR3_17406                     69.3    1e-09   
ref|XP_002983928.1|  hypothetical protein SELMODRAFT_423232           70.1    2e-09   
emb|CDY28664.1|  BnaCnng05500D                                        69.3    2e-09   
ref|XP_004173545.1|  PREDICTED: UPF0496 protein 3-like                68.9    2e-09   
ref|XP_004141011.1|  PREDICTED: UPF0496 protein 3-like                68.9    3e-09   
ref|XP_009408431.1|  PREDICTED: UPF0496 protein At3g19330             68.9    3e-09   
ref|XP_002512821.1|  conserved hypothetical protein                   68.9    4e-09   Ricinus communis
ref|XP_003561583.1|  PREDICTED: putative UPF0496 protein 2            68.9    4e-09   
ref|XP_010064984.1|  PREDICTED: UPF0496 protein At1g20180-like        65.9    4e-09   
ref|XP_004975612.1|  PREDICTED: putative UPF0496 protein 2-like       67.8    6e-09   
ref|XP_002960743.1|  hypothetical protein SELMODRAFT_402070           67.4    1e-08   
emb|CDY29368.1|  BnaA06g14280D                                        66.6    1e-08   
ref|XP_004493091.1|  PREDICTED: UPF0496 protein At3g19330-like        66.6    2e-08   
sp|A2YH25.2|U496B_ORYSI  RecName: Full=Putative UPF0496 protein 2     66.6    2e-08   Oryza sativa Indica Group [Indian rice]
dbj|BAK04981.1|  predicted protein                                    66.2    2e-08   
ref|XP_008441510.1|  PREDICTED: UPF0496 protein At3g49070-like        65.9    3e-08   
sp|Q5Z8N6.1|U496B_ORYSJ  RecName: Full=Putative UPF0496 protein 2     66.2    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003624518.1|  hypothetical protein MTR_7g084240                65.9    3e-08   
ref|XP_004510071.1|  PREDICTED: UPF0496 protein 3-like                63.5    1e-07   
ref|XP_003562085.1|  PREDICTED: UPF0496 protein 3                     64.3    1e-07   
ref|XP_006468920.1|  PREDICTED: UPF0496 protein At3g19330-like        63.9    1e-07   
ref|XP_006446909.1|  hypothetical protein CICLE_v10015537mg           63.2    2e-07   
ref|XP_006851409.1|  hypothetical protein AMTR_s00040p00067520        62.0    3e-07   
ref|XP_002274305.1|  PREDICTED: UPF0496 protein At3g19330 isoform X2  62.4    4e-07   Vitis vinifera
ref|XP_006651040.1|  PREDICTED: UPF0496 protein 3-like                60.1    5e-07   
gb|KDO45973.1|  hypothetical protein CISIN_1g0163131mg                61.6    6e-07   
ref|XP_004966478.1|  PREDICTED: putative UPF0496 protein 2-like       61.6    8e-07   
gb|KFK37660.1|  hypothetical protein AALP_AA3G011900                  61.2    8e-07   
ref|XP_009603388.1|  PREDICTED: UPF0496 protein At3g19330-like        60.8    1e-06   
ref|XP_010664051.1|  PREDICTED: UPF0496 protein At3g19330 isoform X1  60.8    1e-06   
gb|EAY94126.1|  hypothetical protein OsI_15899                        60.5    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006599418.1|  PREDICTED: UPF0496 protein At3g19330-like        60.1    2e-06   
gb|EAY94125.1|  hypothetical protein OsI_15898                        60.5    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008671312.1|  PREDICTED: putative UPF0496 protein 2            59.7    2e-06   
gb|KDP41869.1|  hypothetical protein JCGZ_26887                       60.1    3e-06   
gb|EPS58966.1|  hypothetical protein M569_15847                       58.5    3e-06   
dbj|BAJ96873.1|  predicted protein                                    60.1    3e-06   
ref|XP_006827565.1|  hypothetical protein AMTR_s00009p00223100        59.3    3e-06   
gb|EAZ25586.1|  hypothetical protein OsJ_09413                        60.1    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010316380.1|  PREDICTED: UPF0496 protein At3g19330-like is...  59.3    3e-06   
gb|KCW55750.1|  hypothetical protein EUGRSUZ_I01580                   57.4    6e-06   
ref|XP_008646698.1|  PREDICTED: putative UPF0496 protein 2            58.5    7e-06   
ref|XP_011077825.1|  PREDICTED: UPF0496 protein At3g19330-like        58.2    8e-06   
gb|AFW69532.1|  hypothetical protein ZEAMMB73_472244                  58.2    8e-06   
ref|XP_010550240.1|  PREDICTED: UPF0496 protein At3g19330-like is...  57.8    1e-05   
ref|XP_011094271.1|  PREDICTED: UPF0496 protein At3g19330-like        57.8    1e-05   
gb|EYU18084.1|  hypothetical protein MIMGU_mgv1a025599mg              57.0    1e-05   
ref|XP_010270665.1|  PREDICTED: UPF0496 protein At3g19330-like is...  57.4    2e-05   
gb|EMS63340.1|  hypothetical protein TRIUR3_00514                     56.2    2e-05   
ref|XP_008231230.1|  PREDICTED: UPF0496 protein At3g19330             57.4    2e-05   
gb|EPS74092.1|  hypothetical protein M569_00664                       55.8    3e-05   
ref|XP_007215603.1|  hypothetical protein PRUPE_ppa007763mg           56.2    4e-05   
emb|CAN67266.1|  hypothetical protein VITISV_028729                   57.0    4e-05   Vitis vinifera
ref|XP_010927490.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0496 prot...  56.2    4e-05   
ref|XP_007151712.1|  hypothetical protein PHAVU_004G069400g           55.5    5e-05   
ref|XP_010670227.1|  PREDICTED: UPF0496 protein At3g19330 isoform X2  55.5    7e-05   
ref|XP_010932700.1|  PREDICTED: UPF0496 protein At3g19330-like        55.1    7e-05   
ref|XP_004228688.1|  PREDICTED: UPF0496 protein At3g19330-like is...  55.1    8e-05   
ref|XP_010670226.1|  PREDICTED: UPF0496 protein At3g19330 isoform X1  55.1    8e-05   
ref|XP_009798011.1|  PREDICTED: UPF0496 protein At3g19330-like        55.1    9e-05   
ref|XP_003548490.2|  PREDICTED: UPF0496 protein At3g19330-like        55.1    9e-05   
gb|EAZ30748.1|  hypothetical protein OsJ_14812                        53.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009345183.1|  PREDICTED: UPF0496 protein At3g19330 isoform X2  55.1    1e-04   
ref|NP_001173935.1|  Os04g0423200                                     55.1    1e-04   
ref|XP_006408570.1|  hypothetical protein EUTSA_v10021033mg           54.7    1e-04   
ref|XP_009124821.1|  PREDICTED: UPF0496 protein At3g19330             53.9    1e-04   
ref|XP_008365350.1|  PREDICTED: UPF0496 protein At3g19330-like        54.3    2e-04   
ref|XP_009603415.1|  PREDICTED: UPF0496 protein At3g19330-like        53.9    2e-04   
ref|XP_006378820.1|  hypothetical protein POPTR_0010s24650g           53.9    2e-04   
ref|XP_009345181.1|  PREDICTED: UPF0496 protein At3g19330 isoform X1  53.9    2e-04   
ref|XP_003581178.1|  PREDICTED: UPF0496 protein At3g19330-like is...  53.9    2e-04   
ref|XP_011024180.1|  PREDICTED: UPF0496 protein At3g19330-like        53.5    2e-04   
ref|XP_007161601.1|  hypothetical protein PHAVU_001G083200g           53.5    3e-04   
gb|EYU38667.1|  hypothetical protein MIMGU_mgv1a017681mg              53.1    3e-04   
ref|NP_188564.2|  uncharacterized protein                             53.5    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512820.1|  conserved hypothetical protein                   53.5    3e-04   Ricinus communis
dbj|BAB02457.1|  unnamed protein product                              53.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960745.1|  hypothetical protein SELMODRAFT_74185            53.1    4e-04   
ref|XP_006653394.1|  PREDICTED: uncharacterized protein LOC102715476  53.1    4e-04   
gb|AGT16016.1|  hypothetical protein SHCRBa_144_K17_R_270             53.1    4e-04   
ref|XP_006378819.1|  hypothetical protein POPTR_0010s24650g           52.8    4e-04   
ref|XP_002446395.1|  hypothetical protein SORBIDRAFT_06g015270        52.8    4e-04   Sorghum bicolor [broomcorn]
ref|XP_006468917.1|  PREDICTED: UPF0496 protein At3g19330-like is...  52.8    5e-04   
ref|XP_006604203.1|  PREDICTED: UPF0496 protein At3g19330-like        52.4    5e-04   
ref|XP_010550241.1|  PREDICTED: UPF0496 protein At3g19330-like is...  52.4    6e-04   
ref|XP_006468919.1|  PREDICTED: UPF0496 protein At3g19330-like is...  52.4    6e-04   
ref|XP_009765445.1|  PREDICTED: UPF0496 protein At3g19330-like        52.4    6e-04   
ref|XP_008379042.1|  PREDICTED: UPF0496 protein At3g19330             52.4    6e-04   
ref|XP_002983926.1|  hypothetical protein SELMODRAFT_119515           52.4    7e-04   
ref|XP_010090929.1|  hypothetical protein L484_007564                 52.0    7e-04   
ref|XP_006354112.1|  PREDICTED: UPF0496 protein At3g19330-like is...  52.0    7e-04   
ref|XP_010270664.1|  PREDICTED: UPF0496 protein At3g19330-like is...  52.0    7e-04   
ref|XP_010270666.1|  PREDICTED: UPF0496 protein At3g19330-like is...  52.0    8e-04   
gb|KHG13867.1|  hypothetical protein F383_20153                       52.0    8e-04   



>ref|XP_004238625.1| PREDICTED: UPF0496 protein At1g20180-like [Solanum lycopersicum]
Length=359

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 233/396 (59%), Gaps = 46/396 (12%)
 Frame = +2

Query  62    MHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQ  241
             MHL   KK + +K     +S RR  N++ GSL  KS+ V+ EY+ A RT SYVE+Y+KVQ
Sbjct  1     MHL--MKKLAWLKLKSTLQSQRRTENDDSGSLVNKSN-VNEEYVQALRTKSYVELYNKVQ  57

Query  242   GQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQAS  421
              QL   +  E     ++  L ++                       LCQE + +LP+ + 
Sbjct  58    EQLEDGKLNE--SSSSSLQLDTN-----------------------LCQEALLKLPE-SC  91

Query  422   NAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNR---  592
               HPL+  YF +TLEAC ICE LL+ V QTRA+Y+ +++A+       L + EQ +R   
Sbjct  92    QLHPLIVNYFDITLEACRICELLLQNVQQTRANYRKIRRAIR------LMTIEQESRHCY  145

Query  593   -AYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALG  760
               Y E+AS +   N+ SAV   +  D R+ H  LL +L+ +  R+ +R K L+  K   G
Sbjct  146   NVYRELASFASLNNSFSAVNQVQILDTREGHDLLLQKLSLQFRRVNKRMKILKSCKRVFG  205

Query  761   STLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKR--GIPSRKGLYMP  934
              ++ IG T  MI   +L +H +V  +AVPGLIA S  + KK  +  R     S + L   
Sbjct  206   ISIAIGYTGIMIALLVLVLHSMVGIVAVPGLIACSYKLFKKRSKVDREKSSSSLEILIAQ  265

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             LDVAAKG+++LIND  T+SRLV RL DE+EHN+++AD+ A K   D+LKE +  +N++I 
Sbjct  266   LDVAAKGVYILINDFDTMSRLVRRLYDEIEHNRSVADMCARKKNADMLKEAI--RNYSIN  323

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
             ++  +E LKELE+H++LCFL I RSRRM++QE+V R
Sbjct  324   KDCFMEKLKELEEHVFLCFLTINRSRRMVLQEMVSR  359



>ref|XP_009796590.1| PREDICTED: UPF0496 protein At1g20180-like [Nicotiana sylvestris]
Length=373

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 167/393 (42%), Positives = 237/393 (60%), Gaps = 26/393 (7%)
 Frame = +2

Query  62    MHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQ  241
             MHL     +SK+KS    +  RRN     GSL  KS+ V+ EY+ A RT SYVE+Y+KVQ
Sbjct  1     MHLMRKLVWSKLKSTL--RKQRRNGKNGSGSLVNKSN-VNEEYVEALRTKSYVEMYNKVQ  57

Query  242   GQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQAS  421
             GQL      EI+G D+    +SSSSS      +  +SL  P      CQE + E+P+ + 
Sbjct  58    GQL------EILGDDHKLSSSSSSSSVQLN-TNLSKSLLEP------CQEVLAEMPK-SC  103

Query  422   NAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYG  601
               +PL+  YF +T EAC ICE LL+ V +TR +Y+ ++K +  ++ +   S       Y 
Sbjct  104   QLNPLIVNYFDITSEACRICELLLQSVRKTRVNYRKIRKVIRLMKNMEPDSSHCYG-VYT  162

Query  602   EIASLSLFGNTLSAVR---FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
             E+AS + + N  S V    F D R+ H GLL +LTS+  +++RR K LR  K   G ++ 
Sbjct  163   ELASFASYKNPFSVVNREEFLDTREGHDGLLQKLTSQFRKVKRRMKFLRSCKKVFGISIA  222

Query  773   IGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK-LKEAKRGIPSR--KGLYMPLDV  943
             IG T  +I   +L +H +VC +A PGL+  S  + KK  K  K+ I S   + L   LDV
Sbjct  223   IGYTGILIALLVLVLHSMVCIVAAPGLVFCSFKLFKKRYKVDKKAISSSSLEILIAQLDV  282

Query  944   AAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEW  1123
             AAKG+++LIND  T+SRLV RL DE EHN+++AD+ A K   D+LKEV+  ++F+I +  
Sbjct  283   AAKGVYILINDFDTMSRLVRRLYDETEHNRSVADMCARKKNADMLKEVI--RDFSINKHC  340

Query  1124  ALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
              +E LKELE+H+ LCFL I RSRRM++QE+V R
Sbjct  341   FMEQLKELEEHVCLCFLTINRSRRMVLQEMVSR  373



>ref|XP_009605221.1| PREDICTED: UPF0496 protein At1g20180-like [Nicotiana tomentosiformis]
Length=373

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 164/393 (42%), Positives = 239/393 (61%), Gaps = 26/393 (7%)
 Frame = +2

Query  62    MHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQ  241
             MHL     +SK+KS    +  RRN  +  GSL  KS+ V+ EY+ A RTNSYVE+Y+KVQ
Sbjct  1     MHLMRKLFWSKLKSTL--RKQRRNGKDGSGSLVNKSN-VNEEYVEALRTNSYVEMYNKVQ  57

Query  242   GQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQAS  421
              QL + +    +G ++    +SSS       I+  +SL  P      CQE + E+P+ + 
Sbjct  58    EQLESGK----LGHNHKLFSSSSSLQLD---INLSKSLLEP------CQEVLVEIPE-SC  103

Query  422   NAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYG  601
               HPL+  YF +T EAC ICE LL+ V +TRA+Y+ ++K +  ++ +   S    +  Y 
Sbjct  104   QLHPLIVNYFDITSEACRICELLLQSVQKTRANYRKIRKVIRLMKNMEPDSSYCYD-VYR  162

Query  602   EIASLSLFGNTLSA---VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
             E+AS + + N  S    V+F D R+ H  LL +LTS+  R++RR K LR  K   G ++ 
Sbjct  163   ELASFASYKNPFSVFNRVQFLDTREGHDVLLKKLTSQFRRVKRRMKFLRSCKKVFGISIA  222

Query  773   IGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK-LKEAKRGIPSR--KGLYMPLDV  943
             IG T  +I   +L +H +VC +A PGL+  S  + KK  K  K+ I S   + L   LDV
Sbjct  223   IGYTGILIALLVLVLHSMVCIVAAPGLVFCSFKLFKKRFKVDKKAISSSSLEMLIAQLDV  282

Query  944   AAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEW  1123
             AAKG+++LIND  T+SRLV RL DE EH++++AD+ A K   D+LKEV+  ++F+I +  
Sbjct  283   AAKGVYILINDFDTMSRLVRRLYDETEHDRSVADMCAKKKNADMLKEVI--RDFSINKHC  340

Query  1124  ALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
              +E LKELE+H+ LCFL I RSRRM++QE+V R
Sbjct  341   FMEQLKELEEHVCLCFLTINRSRRMVLQEMVSR  373



>ref|XP_006342242.1| PREDICTED: UPF0496 protein At1g20180-like [Solanum tuberosum]
Length=360

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 157/393 (40%), Positives = 226/393 (58%), Gaps = 39/393 (10%)
 Frame = +2

Query  62    MHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQ  241
             MHL   KK    KS    ++ RR  N+  GSL  K + V+ EY+ A RT SYVE+Y+KVQ
Sbjct  1     MHLT--KKLVWFKSKSTLRNQRRIENDGSGSLVNKLN-VNEEYVQALRTKSYVELYNKVQ  57

Query  242   GQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQAS  421
              QL   +  E                          S  S      LCQE + +LP+ + 
Sbjct  58    EQLEDGKLNE-------------------------SSSSSLQLDTNLCQEALLKLPE-SC  91

Query  422   NAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYG  601
               HPL+  YF +TLEAC ICE LL+ V QTRA+Y+ +++A+ ++  +   S    N  Y 
Sbjct  92    QLHPLIVNYFDITLEACRICELLLQNVQQTRANYRKIRRAI-RLMTIEQESGHCYN-VYR  149

Query  602   EIASLSLFGNTLSA---VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
             E+AS +   N+ S    V+  D R+ H  LL +L+ +  R+ +R K L+  K   G ++ 
Sbjct  150   ELASFASLNNSFSVGNQVQILDTREGHDLLLQKLSLQFRRVNKRMKILKTCKRVFGISIA  209

Query  773   IGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK---LKEAKRGIPSRKGLYMPLDV  943
             IG T  MI   +L +H +V  MA PGLIA S  + KK   + +  +G  S + L   LDV
Sbjct  210   IGYTGIMIALLVLVLHSMVGLMAAPGLIACSYKLFKKRSKVDKGGKGSSSLEILIAQLDV  269

Query  944   AAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEW  1123
             AAKG+++LIND  T+SRLV RL DE+EHN+++AD+ A K   D+LKE +  +N++I ++ 
Sbjct  270   AAKGVYILINDFDTMSRLVRRLYDEIEHNRSVADMCARKKNADMLKEAI--RNYSINKDC  327

Query  1124  ALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
              +E LKELE+H++LCFL I RSRRM++QE+V R
Sbjct  328   FMEKLKELEEHVFLCFLTINRSRRMVLQEMVSR  360



>ref|XP_004292933.1| PREDICTED: UPF0496 protein At1g20180-like [Fragaria vesca subsp. 
vesca]
Length=380

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 140/393 (36%), Positives = 223/393 (57%), Gaps = 37/393 (9%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSS--SVSHEYMAAFRTNSYVEIYDKVQGQLAAAR  262
             S ++S F     R    ++ G  G  SS  SV+ EY+  FRT SY+E++D+V G +    
Sbjct  7     SGLRSMFSKPGSRSRKIDHRGGGGSFSSKLSVNDEYLEVFRTKSYLEMWDRVHGSV----  62

Query  263   SKEIVGGDNTFPLTssssssssPLISGH----ESLPSPGCKLLLCQENMEEL-PQQASNA  427
                       +P T+ +  SSSP +  +    E+L  P       QE + E+  +   N 
Sbjct  63    ---------QYPTTNPNLLSSSPSVPFYVNLSENLLDPR------QETLNEMISEDGINV  107

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEI  607
             H LL +YF  +LEAC ICE LL+ + QT A+Y ++KK ++K+ +  + ++EQ    + E+
Sbjct  108   HHLLTDYFEASLEACHICELLLRSIHQTHAEYGNIKKVMKKLSQRSIYTDEQCRAIFREL  167

Query  608   ASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIG  778
              + +   N LS +   +F D+ D +  LLS LTS++ +I RR KR R+ K   G  L++ 
Sbjct  168   TTFARLKNPLSIISPLQFRDIHDSYSALLSSLTSRQQKIRRRAKRNRILKKVGGVGLVVS  227

Query  779   CTAFMITFTILAVHFVVCTMAVPGLIALSLGMV-KKLKEAKRGIPSRKGLY----MPLDV  943
              +A +I   + A H ++  +A P ++A S G+  KK++  ++   SR  ++      LDV
Sbjct  228   HSALLIGLLVFAFHSMIGIVAAPAIMACSAGLCKKKMESGEQWFKSRFDVHEIHGEQLDV  287

Query  944   AAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD-DVLKEVVSSKNFAIQEE  1120
             AAKG+++LIND  T+SRLV RL DE+EH K +ADL      + +V K VV  + F + + 
Sbjct  288   AAKGIYILINDFDTMSRLVMRLQDEVEHRKAVADLCVRNGINCEVFKGVV--REFHVHDS  345

Query  1121  WALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
               +E L+ELE+H+YLC L I +SRR+++QEI+ 
Sbjct  346   NFMEQLEELEEHVYLCMLTINKSRRLVLQEILA  378



>ref|XP_011083446.1| PREDICTED: UPF0496 protein At1g20180-like [Sesamum indicum]
Length=389

 Score =   213 bits (543),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 143/377 (38%), Positives = 220/377 (58%), Gaps = 29/377 (8%)
 Frame = +2

Query  143   NEGSLG--------RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFP  298
             NEG  G        R   +V+ EY  AFRT SY++I +KVQGQL    S ++  G ++  
Sbjct  21    NEGGHGKEEIVDSSRGKPNVNDEYREAFRTKSYIDICNKVQGQLETRTSLDVQLGQSSSS  80

Query  299   LTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHP-LLNEYFLLTLEACA  475
              +SSSS    P +   ++L  P       QE +  + +     H   L  YF ++LEA  
Sbjct  81    SSSSSSPLVHP-VRLSDNLLEPR------QETLTAIFETTKTLHDHFLENYFEISLEAGR  133

Query  476   ICESLLKIVLQTRADYKSVK---KAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV  646
             ICE LL+ V Q R +++++K   K ++++ +    +  Q +  Y  +AS +   N  S++
Sbjct  134   ICEFLLQNVHQVRTNHRAIKYLLKLIKRVPDCENWTNNQHHTVYRNLASFASSRNPFSSM  193

Query  647   ---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV  817
                +F ++ D H+ LL +LTSK  + +RRTK +R  K AL + + +GC    I   +LA+
Sbjct  194   TPEKFHELHDCHVDLLHQLTSKCRKTKRRTKFIRYMKRALATFVFLGCGGLAIAVLVLAI  253

Query  818   HFVVCTMAVPGLIALSLGMVKKL-KEAKRGIPSR---KGLYMPLDVAAKGLFVLINDLST  985
             H +V  +A P LI L + ++KKL K+A     SR    G+   LD+AA+G+++L+ND  T
Sbjct  254   HSIVGLLAAPCLI-LGMFVIKKLRKQADHDQSSRTWLDGVGAQLDLAARGVYILVNDFDT  312

Query  986   VSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYL  1165
             +SRLV RL DEMEH K +AD+   K  +++LKEVV  K F + E W +E L+ELE+ IYL
Sbjct  313   ISRLVQRLHDEMEHRKFVADICVRKGKNEMLKEVV--KEFEMHEGWFMEQLEELEKQIYL  370

Query  1166  CFLNIVRSRRMIVQEIV  1216
             CFL+I RSRR++V+++V
Sbjct  371   CFLDINRSRRLVVEQMV  387



>ref|XP_008359758.1| PREDICTED: UPF0496 protein At1g20180-like [Malus domestica]
Length=398

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 138/409 (34%), Positives = 219/409 (54%), Gaps = 47/409 (11%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             +K++SAF    PRR  +   G+     SSV+ EYM  FRT SYVE++D+V  QL +  + 
Sbjct  7     TKLRSAF--SKPRREKDNVGGNGFSSKSSVNEEYMEVFRTKSYVEMWDRVHEQLPSTSTS  64

Query  269   EIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEEL-PQQASNAHPLLNE  445
                   +   L S+       ++   E L  P       QE ++ +  ++  N H LL +
Sbjct  65    TSRLPSSRSSLLSNM------VLDRSEYLLEPR------QETLKNIIDEEGLNLHHLLTD  112

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKI---------EELGLSSEEQVNRAY  598
             YF  +L+AC IC+ LL  + QTRA+ +  KK V K+         + + ++ +EQ    +
Sbjct  113   YFEASLDACHICDVLLHSIHQTRAENRHTKKLVLKLSQRVHLLYNDNIDITDDEQCLEIF  172

Query  599   GEIASLSLFGNTLSAVR---FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
             GE+ + +   N LS +    F  + D ++ L  RL  K  ++ R +KR R+ K   G  L
Sbjct  173   GELGTFARAKNPLSIISPGPFRHIHDSYVALFDRLILKHKKVRRASKRNRICKKVGGVGL  232

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRGIPSR--KGLYMPLD  940
             ++  TA +IT  + A+H ++  +  P LIA SLG+  +K+  A   + +R  +     LD
Sbjct  233   VVSHTALLITLLVFAIHSMIGIVVAPALIACSLGLCARKMDSAAEWLKTRFPESHGQQLD  292

Query  941   VAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW--------------AMKHCDDVL  1078
             VAAKG+++LIND  T+SR+V RL DE+EH K +A +               +  +C D+ 
Sbjct  293   VAAKGVYILINDFDTMSRMVRRLYDEVEHRKAVARMCVSSVRNIISTNNGGSSSNC-DIF  351

Query  1079  KEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV  1225
             K+VV  + F   E+  +E L+ELE+HIYLC L I RSRR+++QEI+ + 
Sbjct  352   KKVV--REFHASEDSFVEQLEELEEHIYLCLLTINRSRRLVIQEILAKT  398



>ref|XP_010100136.1| hypothetical protein L484_014327 [Morus notabilis]
 gb|EXB81519.1| hypothetical protein L484_014327 [Morus notabilis]
Length=394

 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 150/403 (37%), Positives = 220/403 (55%), Gaps = 39/403 (10%)
 Frame = +2

Query  77    FKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAA  256
             F  +SK+KS        R    N  SL  KSS V  EY+ AFR+NSY E++DKVQGQL  
Sbjct  6     FPMWSKLKSLDTETGKSRKDRGN--SLSTKSS-VDEEYLKAFRSNSYEEMWDKVQGQLGI  62

Query  257   ARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPL  436
               +    G        S SS SS   +   E L  P       QE ++ + + + N H L
Sbjct  63    TSATTSTG-----AAFSPSSLSSPFYLDLSEYLLEPR------QETLKSMIE-SLNFHLL  110

Query  437   LNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEEL------------GLSSEE  580
             L EYF  +L AC ICE LL+ + Q R+DY+ +K+ ++  + +             L   +
Sbjct  111   LVEYFEASLRACNICELLLRSIKQARSDYRKIKRVIKMSKRVLVLDHDQYDDHSQLLHND  170

Query  581   QVNRA-YGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFK  748
             Q +RA + E+ +++L  N LS +   ++ D+RD ++ LL +LTSK  +I+RR K  R+ K
Sbjct  171   QCSRAVFRELGAIALLKNPLSIISPAQYHDIRDGYMVLLHKLTSKGKKIKRREKLKRLCK  230

Query  749   VALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALS---LGMVKKLKEAKRGIPSR-  916
                G+ L++  +A +I   + A H V   +A P L+  S   L   KK K A    P R 
Sbjct  231   KVGGAGLVVTHSALLIALLVFAFHGVFGIVAAPALVGCSSVYLAKKKKKKRAMDSQPPRL  290

Query  917   --KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVV  1090
                GL   LD+A KG+F+LIND  T+ ++V RL DE+EH K++AD+       ++L+EVV
Sbjct  291   PGGGLGKQLDMATKGVFILINDFDTMCQMVRRLHDEVEHRKSVADICVRNRKFELLREVV  350

Query  1091  SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
               + F  +E   +E L+ELE HIYLC L I RSRR+++QEI+ 
Sbjct  351   --REFRDEEPSFMEQLEELEGHIYLCLLTINRSRRLVIQEIIA  391



>ref|XP_011015237.1| PREDICTED: UPF0496 protein At1g20180-like, partial [Populus euphratica]
Length=388

 Score =   200 bits (508),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 143/383 (37%), Positives = 206/383 (54%), Gaps = 43/383 (11%)
 Frame = +2

Query  125   RRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLT  304
             RR+  E   SL  K + V  EY  AFRT SYVE+  KVQ QL   R      GD    +T
Sbjct  29    RRSPKERASSLSNKLN-VDEEYKEAFRTKSYVEMRSKVQDQLRKTR------GDGVDKVT  81

Query  305   ssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA--------HPLLNEYFLLT  460
                        S   SLP      L   + M E  QQA+          H  L +YF   
Sbjct  82    -----------SPSSSLPF----YLHLSDYMFEPQQQATRKEMIESLRFHHFLIDYFEAR  126

Query  461   LEACAICESLLKIVLQTRADYKSVKKAVE---KIEELGLSSEEQVNRAYGEIASLSLFGN  631
              EAC IC+ LL+ + Q RA+YK + + ++   ++++    S++     + E+A+ +L  N
Sbjct  127   SEACHICDLLLQCIQQKRANYKKITRVIKLSKRVQDSADYSDKICIAMFRELAAYALLEN  186

Query  632   TLS----AVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMIT  799
              LS     V+F+D  D++L LL  L S++ +I R+ K  RV     G  L I  TA +I 
Sbjct  187   PLSMFLTTVKFNDFHDNNLVLLHGLNSEQRKITRKAKFKRVCMKVGGGCLFISHTALLIA  246

Query  800   FTILAVHFVVCTMAVPGLIALSLGMVKK-LKEAKRGIPS---RKGLYMPLDVAAKGLFVL  967
               ++A+H +V  +A PG++  SL + +K +K   RG+ +   +K L   LD+AAKG ++L
Sbjct  247   LLVIAIHGIVGIVAAPGIMGCSLYVFRKQIKLVYRGLETSLLQKKLGAQLDLAAKGTYIL  306

Query  968   INDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKEL  1147
             I D  T+SRLV RL DE+EH K +AD+       ++LKEVV  K F   +   LE L+EL
Sbjct  307   IKDFDTMSRLVRRLFDEVEHRKALADMCVRNKKPELLKEVV--KEFHTHDLCYLEQLEEL  364

Query  1148  EQHIYLCFLNIVRSRRMIVQEIV  1216
             EQHIYLCF  I RSRR++++EI+
Sbjct  365   EQHIYLCFHTINRSRRLVMEEIM  387



>ref|XP_002510585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52772.1| conserved hypothetical protein [Ricinus communis]
Length=383

 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 144/394 (37%), Positives = 218/394 (55%), Gaps = 31/394 (8%)
 Frame = +2

Query  68    LPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQ  247
             +P  +K +  KS F    P ++ NE   S   K + V+ EY  AFRT SY E++ K+QGQ
Sbjct  1     MPHMRKLAWAKSPF--SKPEKSRNERGDSFSNKLN-VNEEYKEAFRTKSYEEMWSKIQGQ  57

Query  248   LAAARSKEIVGGDNTFPLTssssssssPL-ISGHESLPSPGCKLLLCQENMEELPQQASN  424
             L      EI            SSSSS P  I   + L  P       Q++  +   +   
Sbjct  58    LKRKSVDEIE--------RLRSSSSSLPFCIHLSDYLFEPE------QQDSSKEMLETMK  103

Query  425   AHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYG-  601
              H LL ++F  +LEAC +C+ LL  + QTR +Y+ +++ + K+ +    S++  ++A G 
Sbjct  104   FHCLLIDFFKASLEACNLCDLLLHSIQQTRVNYRRIERVI-KLSKKVQDSQDYTDKACGA  162

Query  602   ---EIASLSLFGNTLS---AVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGS  763
                E+ + +L  N LS    + F DV D++L LL RL S++ +I ++ K  R+ K   G 
Sbjct  163   MFRELTAFALLRNPLSFASPLNFGDVHDNNLMLLHRLNSEQRKIRKKVKFNRICKKLGGY  222

Query  764   TLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMV-KKLKEAKRGIPSR--KGLYMP  934
              L+I  TA +    ++A+H ++  +A PGLI  SL    KK+K    G+ +R  + L   
Sbjct  223   CLVITHTAILAAMLVMALHGIIGIVAAPGLIGCSLYFSRKKIKFFSGGVKTRLLEKLCAQ  282

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             LD+AAKG ++L NDL T+SRLV  L +E+EH K +ADL       ++LKEVV  K F + 
Sbjct  283   LDLAAKGTYILFNDLDTISRLVRSLYNEIEHKKALADLCVRSKNAELLKEVV--KEFYMH  340

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             + +  E L ELE+HIYLCF  I RSRR+++QEI+
Sbjct  341   DSFYEEQLDELEEHIYLCFHTINRSRRLVIQEIM  374



>ref|XP_002301952.1| hypothetical protein POPTR_0002s01980g [Populus trichocarpa]
 gb|EEE81225.1| hypothetical protein POPTR_0002s01980g [Populus trichocarpa]
Length=392

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 145/393 (37%), Positives = 217/393 (55%), Gaps = 38/393 (10%)
 Frame = +2

Query  86    FSKMKSAF--ITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAA  259
             ++K++S F    +SP+   N     L     +V+ EY  AFRT SYVE++ KVQ QL   
Sbjct  6     WAKIRSIFSRAGRSPKERGNSLSNKL-----NVNEEYKEAFRTKSYVEMWSKVQDQL---  57

Query  260   RSKEIVGGDNTFPLTssssssssPL---ISGHESLPSPGCKLLLCQENMEELPQQASNAH  430
             R   I G D      +S S  S PL   +S +   P         QE + E+   +   H
Sbjct  58    RKTSIDGVDKV----ASPSDPSLPLYHHLSDYLFEPQQ-------QETLREM-MGSLKFH  105

Query  431   PLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE---KIEELGLSSEEQVNRAYG  601
              LL +YF  + +AC ICE  L+ + QTR +YK +++ ++   ++ +    S++     + 
Sbjct  106   HLLVDYFEASSKACHICELHLQCIQQTRGNYKKIRRVIKLSKRVHDSADCSDKIQGAMFR  165

Query  602   EIASLSLFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
             E+A+ +L  N LS      +F D  DD++ LL  LTS++ RI R+TK  R+     G  L
Sbjct  166   ELAAYALLENPLSMFFSTEKFLDFHDDNVVLLHGLTSQKKRIMRKTKFRRICIRVGGGCL  225

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSL-GMVKKLKEAKRGIPS---RKGLYMPL  937
             +I  TA +I   ++A+H +   +A PGL+  SL    K++K   RG+      K L   L
Sbjct  226   VISHTALLIALLVIAIHSMAGIVAAPGLMGCSLYAFRKQIKLVHRGLEKSRFEKRLGAQL  285

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQE  1117
             D+AAKG+++LIND +TVSRL   L DE+EH K +AD+    +  ++LKEVV  K F I +
Sbjct  286   DLAAKGIYILINDFNTVSRLTRSLFDEVEHQKALADMCVRNNKPELLKEVV--KEFHIHD  343

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                LE L+ELE+HIYLCF  I RSRR+++ EI+
Sbjct  344   SSYLEQLEELERHIYLCFHTINRSRRIVMDEIM  376



>ref|XP_011075001.1| PREDICTED: UPF0496 protein At1g20180-like [Sesamum indicum]
Length=388

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/389 (36%), Positives = 212/389 (54%), Gaps = 31/389 (8%)
 Frame = +2

Query  101   SAFITKSP-----RRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARS  265
             S  + KSP     R    +   SL RK + V+ EY  AFRT SY+EI +KVQ QL     
Sbjct  11    SKLMIKSPLPKQGRHGKEDAVNSLMRKPN-VNEEYKEAFRTKSYIEICNKVQDQLELR--  67

Query  266   KEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNE  445
                        LTS           G + L      L   QE +  +    SN H  L  
Sbjct  68    ----------SLTSGDLDLDHDDEEGRQYLHLSEYLLQPHQETLTSMFDHTSNHHQFLLN  117

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVK---KAVEKIEELGLSSEEQVNRAYGEIASL  616
             YF ++LEA  ICESLL  V Q R  Y+++K   K ++++ + G  +    +R Y  +AS 
Sbjct  118   YFKISLEATKICESLLTNVHQARNGYRAIKTVTKLIKRVPDCGNRTHNHYHRVYKTLASF  177

Query  617   SLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
             +  GN  S +   +F ++ D H+ LL  LTS+  + +RRTK +R+ K  + S +++ C A
Sbjct  178   ARRGNPFSTMALEKFLELHDKHVNLLQELTSQHRKTKRRTKFIRLIKRGMTSFIVMACGA  237

Query  788   FMITFTILAVHF-VVCTMAVPGL---IALSLGMVKKLKEAKR--GIPSRKGLYMPLDVAA  949
              ++   +LA+H   V  +A PGL    AL L M+KK +  +R   +     +   LD+AA
Sbjct  238   LVVALLVLAMHIATVGLVAAPGLAIICALGLFMMKKTRRDEREWSVARLDEVVEQLDMAA  297

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWAL  1129
             +G+++++ND +T+SRLV RL DEMEH K +A++   K  + +LKEV+  + F + E   L
Sbjct  298   RGVYIMMNDFNTMSRLVRRLHDEMEHRKFVAEICVRKGKNKMLKEVI-EREFQMHECCFL  356

Query  1130  EVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             E L+ELE+ IYLCFL+I RS R++V+++V
Sbjct  357   EQLEELEKQIYLCFLDINRSTRLLVRKMV  385



>ref|XP_010266030.1| PREDICTED: UPF0496 protein At1g20180-like isoform X2 [Nelumbo 
nucifera]
Length=356

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 199/362 (55%), Gaps = 31/362 (9%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             R   +V+ EYM AFRT SY+EI+ K Q QL     +E V   +  P              
Sbjct  9     RGKLNVNEEYMKAFRTQSYMEIWSKAQVQLRKKDDEERVSSLSPVP--------------  54

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
                S P     LL  Q+++     + SN H LL +YF  ++EA  ICE LLK + QTR +
Sbjct  55    ---STPHLSDFLLEPQQDILTDMIKNSNLHHLLIDYFQGSIEASKICEFLLKSIDQTRVN  111

Query  521   YKSVKKAVEKIEELGLSS----EEQVNRAYGEIASLSLFGNTLS---AVRFDDVRDDHLG  679
             Y  +++ + + + L   S    E++    + ++ S +   N LS   +++F  + D +  
Sbjct  112   YCIIRRILNETKRLPAGSCDYSEDECKTIFRDLDSFAKLNNPLSGFTSMQFRLIHDRYGL  171

Query  680   LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIA  859
             +L +L + R R+ RR K + V K A+G +L+IGC+A  +    LAVH +V  +A PGLI+
Sbjct  172   MLKQLRTARKRVTRRKKLIGVSKKAVGLSLVIGCSALSVVTLALAVHALVGLIAAPGLIS  231

Query  860   LSLGMVKK-LKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
              SLG++KK ++ A+ G+ +     L   LD AAKG+++L  D  T+SRLV RL DE+EH 
Sbjct  232   FSLGVMKKQIRSARVGLKTNMLARLSAQLDAAAKGVYILDRDFDTISRLVERLQDEIEHG  291

Query  1031  KTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
             + IA +        +LKEVV  + F   E   L+ L ELE H+YLCFL I  +RR++V E
Sbjct  292   RVIARMGVRNR--KILKEVV--REFQTHESCFLDQLGELEDHVYLCFLTINAARRLVVHE  347

Query  1211  IV  1216
             I+
Sbjct  348   IM  349



>ref|XP_010266029.1| PREDICTED: UPF0496 protein At1g20180-like isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 199/362 (55%), Gaps = 31/362 (9%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             R   +V+ EYM AFRT SY+EI+ K Q QL     +E V   +  P              
Sbjct  35    RGKLNVNEEYMKAFRTQSYMEIWSKAQVQLRKKDDEERVSSLSPVP--------------  80

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
                S P     LL  Q+++     + SN H LL +YF  ++EA  ICE LLK + QTR +
Sbjct  81    ---STPHLSDFLLEPQQDILTDMIKNSNLHHLLIDYFQGSIEASKICEFLLKSIDQTRVN  137

Query  521   YKSVKKAVEKIEELGLSS----EEQVNRAYGEIASLSLFGNTLS---AVRFDDVRDDHLG  679
             Y  +++ + + + L   S    E++    + ++ S +   N LS   +++F  + D +  
Sbjct  138   YCIIRRILNETKRLPAGSCDYSEDECKTIFRDLDSFAKLNNPLSGFTSMQFRLIHDRYGL  197

Query  680   LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIA  859
             +L +L + R R+ RR K + V K A+G +L+IGC+A  +    LAVH +V  +A PGLI+
Sbjct  198   MLKQLRTARKRVTRRKKLIGVSKKAVGLSLVIGCSALSVVTLALAVHALVGLIAAPGLIS  257

Query  860   LSLGMVKK-LKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
              SLG++KK ++ A+ G+ +     L   LD AAKG+++L  D  T+SRLV RL DE+EH 
Sbjct  258   FSLGVMKKQIRSARVGLKTNMLARLSAQLDAAAKGVYILDRDFDTISRLVERLQDEIEHG  317

Query  1031  KTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
             + IA +        +LKEVV  + F   E   L+ L ELE H+YLCFL I  +RR++V E
Sbjct  318   RVIARMGVRNR--KILKEVV--REFQTHESCFLDQLGELEDHVYLCFLTINAARRLVVHE  373

Query  1211  IV  1216
             I+
Sbjct  374   IM  375



>ref|XP_007017877.1| Uncharacterized protein TCM_034276 [Theobroma cacao]
 gb|EOY15102.1| Uncharacterized protein TCM_034276 [Theobroma cacao]
Length=390

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/367 (35%), Positives = 208/367 (57%), Gaps = 30/367 (8%)
 Frame = +2

Query  140   ENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTsssss  319
             E  G+L  K++ V+ EY  AFRT SYVE++ +V GQL    S + +   ++ P       
Sbjct  42    EGGGNLSGKTN-VNEEYEEAFRTKSYVEMWSQVHGQLEKP-SFDKLPSSSSIPYQ-----  94

Query  320   sssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKI  499
                  I+  E L  P       +E ++++  ++ N H LL +YF   LEAC +CE LL+ 
Sbjct  95    -----INLSEYLLKPR------EETLDKI--ESLNCHHLLLDYFGAGLEACNLCELLLRS  141

Query  500   VLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV---RFDDVRDD  670
             + QTR  Y+ +++ ++    +   S+EQ +    E+A  +   N LS +   +F ++ + 
Sbjct  142   IQQTRVYYRKIRRVIKISGGMQGFSDEQCSVILKELAGFASLKNPLSIISTAQFREIHET  201

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
             ++ L  +LTSKR +I+R+ K  R+ K   G  L+I  T+ +    +LA H +V  +A PG
Sbjct  202   NVDLFHKLTSKREKIKRQVKSRRISKQIEGLCLVISQTSLVTALLVLAFHSMVGIIAAPG  261

Query  851   LIALSLGMVKKLKEA---KRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             L A   G+ KK +     ++G+ +   + L   LD++AKG+++LIND  T+SRLV RL D
Sbjct  262   LAACLFGIKKKRRSKSSDQQGLKTSLLESLGAQLDISAKGIYILINDFDTMSRLVWRLHD  321

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+EH K IA +       +VLKEV+  + F++ +   LE L+ELEQH  LCF  I RSRR
Sbjct  322   EIEHRKAIASMCIRNGKVEVLKEVI--REFSMHDSSFLEQLQELEQHTKLCFHTINRSRR  379

Query  1196  MIVQEIV  1216
             +++QEI+
Sbjct  380   LVIQEII  386



>ref|XP_002306952.2| hypothetical protein POPTR_0005s26520g [Populus trichocarpa]
 gb|EEE93948.2| hypothetical protein POPTR_0005s26520g [Populus trichocarpa]
Length=393

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 141/394 (36%), Positives = 213/394 (54%), Gaps = 39/394 (10%)
 Frame = +2

Query  86    FSKMKSAF--ITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAA  259
             ++K+KS F     SP+    E   SL  K + V+ EY  AFRT SYVE++ KVQ QL   
Sbjct  6     WAKLKSTFSRAGGSPK----ERASSLSNKLN-VNEEYKEAFRTKSYVEMWSKVQDQLRKT  60

Query  260   RSK---EIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAH  430
             R     ++    ++ P          P +S +   P     L    E +E L       H
Sbjct  61    RVDGVDKVTSPSSSLPF--------YPHLSDYLFEPQQQATL---GEMIESL-----RFH  104

Query  431   PLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE---KIEELGLSSEEQVNRAYG  601
               L +YF    EAC IC  LL+ + QTRA+YK +++ ++   ++++    S++     + 
Sbjct  105   HFLIDYFEARSEACHICGLLLQCIQQTRANYKKIRRVIKLSKRVQDSADYSDKICIAMFR  164

Query  602   EIASLSLFGNTLS----AVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
             E+A+ +L  N LS     V+F+D  D++L LL  L S++ +I R+ K  R+     G  L
Sbjct  165   ELAAYALLENPLSMFSTTVKFNDFHDNNLVLLHGLNSEQRKIMRKAKFRRICMKVAGGCL  224

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK-LKEAKRGIPS---RKGLYMPL  937
             +I  TA +I   ++A+H +V  +A PG++  SL + +K +K   RG+ +    K L   L
Sbjct  225   VISHTALLIALLVIAIHGIVGIVAAPGIMGCSLYVFRKQIKLVHRGLETSLLEKRLGAQL  284

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQE  1117
             D+AAKG ++LI D  T+SRLV RL DE+E  K +AD+       ++LKEVV  K F   +
Sbjct  285   DLAAKGTYILIKDFDTMSRLVRRLFDEVERRKALADMCVRNKKPELLKEVV--KEFHTHD  342

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
                LE L+ELEQHIYLCF  I RSRR+++ EI+ 
Sbjct  343   LCYLEQLEELEQHIYLCFHTINRSRRLVMDEIMA  376



>ref|XP_002279229.1| PREDICTED: UPF0496 protein At1g20180 [Vitis vinifera]
 emb|CBI19923.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 140/385 (36%), Positives = 206/385 (54%), Gaps = 35/385 (9%)
 Frame = +2

Query  86    FSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARS  265
             + K KS F      R S  +  SL  KS+ V+ EYM AFRT SY+EI+ KVQGQL     
Sbjct  6     WRKFKSHFTRAGGSRKSGVD--SLCTKSN-VNEEYMEAFRTKSYIEIHSKVQGQLMNELP  62

Query  266   KEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNE  445
                        L+              + L  P      CQE +  + Q   N H LL +
Sbjct  63    SSSSSFPFYIHLS--------------DYLLEP------CQETLANMIQTL-NLHHLLID  101

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVE---KIEELGLSSEEQVNRAYGEIASL  616
             YF  +LEAC ICE LL  + QTRA+Y+ +K+ ++   ++++    + EQ    + E+   
Sbjct  102   YFQASLEACKICEILLLRIHQTRANYQIIKRVIKLTKRLDDGEYYTTEQYGTIFRELTKF  161

Query  617   SLFGNTLSA---VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
             S   N L A   V+F D+ +    LL +L SK  +  RR K  R+ K   G +L+I  +A
Sbjct  162   SKLTNPLMAAGPVQFHDIHESCKTLLPKLVSKSKKTRRRAKFNRLCKRVAGFSLIISYSA  221

Query  788   FMITFTILAVHFVVCTMAVPGLIALSLGMVK-KLKEAKRGIPS--RKGLYMPLDVAAKGL  958
               +   +LA+H +V  +  PGL+   +G V+ +   A+RG+ +   + L   LD AAKG+
Sbjct  222   VAVALVVLAIHSIVGIVIAPGLMGCFVGAVRNRYVFARRGLGTCFLERLGEQLDAAAKGI  281

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             ++L+ND  T+SRLV RL DE+EH+K I D+       ++L EVV  K F + + + LE L
Sbjct  282   YILVNDFDTMSRLVSRLYDEVEHSKAIVDMCVRNGKSEMLMEVV--KEFHVHDSFFLEQL  339

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEI  1213
             +ELE HIYLC L I +SR +++QEI
Sbjct  340   EELEDHIYLCLLTINKSRMLVIQEI  364



>ref|XP_008221219.1| PREDICTED: UPF0496 protein At1g20180 [Prunus mume]
Length=406

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 142/420 (34%), Positives = 220/420 (52%), Gaps = 65/420 (15%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSS---SVSHEYMAAFRTNSYVEIYDKVQGQLAAA  259
             +K++SAF     R    + +   G   S   SV+ EY+  FRT SYVE++DKV GQL + 
Sbjct  7     TKLRSAFSKAGCRSYGGKGDRVGGNSFSDKLSVNEEYLQVFRTKSYVEMWDKVHGQLPST  66

Query  260   RSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLL  439
              +            TSSSS S +  +   E L  P   +L      + + ++  N H LL
Sbjct  67    AT------------TSSSSLSPNSYMDRSEYLLEPRQDIL-----KDIISEEGLNLHHLL  109

Query  440   NEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEE-------------  580
               YF  +L+AC IC+ LL+ + QTR++ + +KK + K+ +  L  E+             
Sbjct  110   THYFEASLDACRICDLLLRTLHQTRSECRKIKKLILKLSQRVLLLEQAQTHNHGNDNNNN  169

Query  581   ------QVNRAYGEIASLSLFGNT----LSAVRFDDVRDDHLGLLSRLTSKRGRIERRTK  730
                   Q    +G++ + +L        ++ V+F D+ D HL L +RLT K  R++R  K
Sbjct  170   NEDDDEQREAIFGDLTTFALVKKNPLSIINPVQFRDIHDSHLALFNRLTLKHKRVQRTAK  229

Query  731   RLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRGI  907
             R R+ K   G  L++  +A +I   + A+H ++  +  P L+A SLGM  KK++ A+  +
Sbjct  230   RNRICKKVGGVGLVVSHSALLIALLVFAIHSMIGIVVAPALMACSLGMCAKKMESAQDWL  289

Query  908   PSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL-----------  1048
              +R        LDVAAKG+++LIND  T+SR+V RL DE+EH K IA +           
Sbjct  290   EARFPDSHSEQLDVAAKGIYILINDFDTMSRMVRRLHDEVEHRKAIAGMCVTAARNVKNV  349

Query  1049  ---WAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
                W   +C ++ KEVV  + F   E   ++ L+ELE+HIYLC L I RSRR++++EIV 
Sbjct  350   NGSWG--NC-EIFKEVV--REFHAAESGYVDQLEELEEHIYLCLLTINRSRRLVLEEIVA  404



>ref|XP_006473909.1| PREDICTED: UPF0496 protein At1g20180-like [Citrus sinensis]
Length=366

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 134/377 (36%), Positives = 201/377 (53%), Gaps = 34/377 (9%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSS---VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD  286
             KSP   S E++   G   SS   ++ EY  AFRT SYVE++ K Q QLAA  S   +   
Sbjct  6     KSPFTRSGESQKQCGDSLSSRSNINEEYTEAFRTKSYVEMWSKAQSQLAARTSFNGLSST  65

Query  287   NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLE  466
             ++    +  S          E L  P       QE + ++ ++  + H LL +YF  ++E
Sbjct  66    SSVSFYAHLS----------EYLLEPQ------QETLMKMIERL-HFHHLLMDYFEASVE  108

Query  467   ACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV  646
             A  +C+ LL+ V QTRA+Y+ +++ ++  E +           +  +A+ +   N LS +
Sbjct  109   AYNVCQLLLRSVHQTRANYRRIQRVIKISENM-----HDCRATFKHLAAFASSKNPLSII  163

Query  647   RFDDVRDDHLG---LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV  817
                  RD H G   L S LTSK  +I RR K  ++ K     +L+I  TA +I   +  +
Sbjct  164   SMVQFRDYHHGKMLLFSSLTSKGKKIRRRAKFNKLLKKVGAYSLVISQTALLIALLVFVL  223

Query  818   HFVVCTMAVPGLIALSLGMVKK--LKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLST  985
             H +V  +A PGL+   L + K+   K  +RG  +   +     LDVAAKG+++L+ND  T
Sbjct  224   HSMVGIVAAPGLMVPCLALFKRKLTKLVRRGPKTSLLQKFAAQLDVAAKGVYILVNDFDT  283

Query  986   VSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYL  1165
             +SR+V RL DE+EH K IA +       ++LKEV+  K F + E   LE LKELE HI L
Sbjct  284   ISRMVRRLYDEVEHRKDIARMCFRSGNSEILKEVM--KEFHMHESSFLEQLKELEDHICL  341

Query  1166  CFLNIVRSRRMIVQEIV  1216
             CFL I RSRR+++QEI+
Sbjct  342   CFLTINRSRRLVLQEIM  358



>ref|XP_010266985.1| PREDICTED: UPF0496 protein At1g20180-like [Nelumbo nucifera]
Length=397

 Score =   190 bits (483),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 140/390 (36%), Positives = 210/390 (54%), Gaps = 36/390 (9%)
 Frame = +2

Query  89    SKMKSAFITK----SPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAA  256
             SK++S+  T     SP++    N GS      +V+ EYM AFRT SYVEI+ K QGQ+  
Sbjct  10    SKLRSSLTTAVGGGSPKQQEMSNVGS----KLNVNEEYMEAFRTKSYVEIWSKAQGQMR-  64

Query  257   ARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPL  436
              R  E     ++ P   SS   S  L+                Q+ + E+ +  S+ H L
Sbjct  65    -RKDEDRSSSSSLPSLPSSPRLSDFLLEPR-------------QDILVEMIKN-SDQHRL  109

Query  437   LNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLS---SEEQVNRAYGEI  607
             L +YF  +LEAC IC+ LLK + QTRA+Y+ +++ +   + L  S   +++Q    + ++
Sbjct  110   LTDYFDGSLEACRICDFLLKSIDQTRANYRIIRRIISLTKRLPDSCDYTDDQCRLIFRDL  169

Query  608   ASLSLFGNTLSA----VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLI  775
              S +   N LSA    V F  V D +  +L++L   R RI +R K + + K A G  L++
Sbjct  170   DSFAKLNNPLSAGSSPVEFRLVHDRYGSMLNQLRKTRKRINKREKLIGLSKKAAGLGLIV  229

Query  776   GCTAFMITFTILAVHFVVCTMAVPGLIALSLGMV-KKLKEAKRGIPSR--KGLYMPLDVA  946
              C A  +   +L VH +V  +A P L+A S+    KK+K A+ G+ +     L   LD A
Sbjct  230   ACGAVSVITLVLVVHTLVGIIATPALLAFSVNATKKKIKSARVGLKTSMLARLGAQLDAA  289

Query  947   AKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWA  1126
             AKG+++L  D  T+S L+ RL DE+EH + IA +        +LKEVV  + F   E   
Sbjct  290   AKGVYILNRDFDTISGLMVRLQDEIEHGRVIAGMVVKNQTRRILKEVV--REFQTHESCF  347

Query  1127  LEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             LE L ELE+H+YLCFL I R+R ++VQEI+
Sbjct  348   LEQLGELEEHVYLCFLTINRARSLVVQEII  377



>ref|XP_009334684.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At1g20180 [Pyrus 
x bretschneideri]
Length=404

 Score =   190 bits (483),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 135/410 (33%), Positives = 216/410 (53%), Gaps = 51/410 (12%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             +K++SAF    PRR  +   G+     SSV+ EYM  FRT SYVE++D+V  QL +  + 
Sbjct  15    TKLRSAF--SKPRREKDNVGGNGFSSKSSVNEEYMEVFRTKSYVEMWDRVHEQLPSTSTS  72

Query  269   EIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEY  448
                   ++  L S+       L+   E L  P       QE ++ +  +    +P   + 
Sbjct  73    TSRLPSSSSSLPSNM------LLDRTEYLLEPR------QETLKNIIDE-EGLNPHHTDX  119

Query  449   FLLTLEACAICESLLKIVLQTRADYKSVKKAVEKI---------EELGLSSEEQVNRAYG  601
             F  +L+AC IC+ LL+ + QTRA+ + +KK V K+         + + ++ +EQ    +G
Sbjct  120   FEASLDACHICDVLLRSIYQTRAENRHMKKLVLKLSQRVHLLYNDNIDITDDEQCLEIFG  179

Query  602   EIASLSLFGNTLSAVR---FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
             E+ + +L    LS +    F  + D ++ L  RL  K  ++ R +KR R+ K   G  L+
Sbjct  180   ELGTFALAKTPLSIISPGPFRHIHDSYVALFFRLILKHKKVRRASKRDRICKKVGGVGLV  239

Query  773   IGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEA----KRGIPSRKGLYMPL  937
             +  TA +I   + A+H ++  +  P L+  SLG+ V+K+  A    K   P   G    L
Sbjct  240   VSHTALLIALLVFAIHSMIGIVVAPALMVCSLGLCVRKMDSAAEWLKTRFPESDG--QQL  297

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW--------------AMKHCDDV  1075
             DVAAKG+++LIND  T+SR+V RL DE+EH K +A +               +  +C D+
Sbjct  298   DVAAKGVYILINDFETISRMVKRLHDEVEHRKAVAGMCVSSVRNIISTNNGGSSSNC-DI  356

Query  1076  LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV  1225
              K+VV  + F   E+  +E L ELE+HIYLC L I RSRR+++QEI+ ++
Sbjct  357   FKKVV--REFHASEDSFVEQLXELEEHIYLCLLTINRSRRLVIQEILAKI  404



>ref|XP_011034981.1| PREDICTED: UPF0496 protein At1g20180-like [Populus euphratica]
Length=391

 Score =   189 bits (481),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 139/388 (36%), Positives = 209/388 (54%), Gaps = 32/388 (8%)
 Frame = +2

Query  92    KMKSAF--ITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARS  265
             K++S F    +SP+  SN     L     +V+ EY  AFRT SYVE++ KVQ QL   R 
Sbjct  8     KIRSIFSRAGRSPKERSNSLSNKL-----NVNEEYNEAFRTKSYVEMWSKVQDQL---RK  59

Query  266   KEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNE  445
               I G D     ++ S      L S + S P         QE + E+   +   H LL +
Sbjct  60    TSIDGVDKVVSPSNPSLPLYLHL-SDYLSEPQQ-------QETLREM-MGSLKFHHLLVD  110

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVE---KIEELGLSSEEQVNRAYGEIASL  616
             YF    +AC ICE  L+ + Q+R +YK +++ ++   ++ +    S++ +   + E+A+ 
Sbjct  111   YFEAISKACHICELHLQCIQQSRGNYKKIRRVIKLSKRVHDSADCSDKILGAMFRELAAY  170

Query  617   SLFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCT  784
             +L  N LS      +F D  DD++ LL  LTS++ RI R+ K  R+     G  L+I  T
Sbjct  171   ALLENPLSMFFSTEKFLDFHDDNVVLLHGLTSQKKRIMRKEKFRRICIRVGGGCLVISHT  230

Query  785   AFMITFTILAVHFVVCTMAVPGLIALSL-GMVKKLKEAKRGIPS---RKGLYMPLDVAAK  952
             A +I   ++A+H +   +A PGL+  SL    K++K   RG+      K L   LD+AAK
Sbjct  231   ALLIALLVIAIHSMAGIVAAPGLMGCSLYAFRKQIKLVHRGLEKSRLEKRLSAQLDLAAK  290

Query  953   GLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALE  1132
             G+++LIND +TVSRL   L DE+EH K +AD+    +  ++LKEVV  K   I +   LE
Sbjct  291   GIYILINDFNTVSRLTRSLFDEVEHQKALADMCVRNNKPELLKEVV--KEIHIHDSSYLE  348

Query  1133  VLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              L ELE+HIYLCF  I R RR+++  I+
Sbjct  349   QLDELERHIYLCFHTINRFRRLVMDGIM  376



>ref|XP_006435237.1| hypothetical protein CICLE_v10003990mg [Citrus clementina]
 gb|ESR48477.1| hypothetical protein CICLE_v10003990mg [Citrus clementina]
Length=366

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 132/377 (35%), Positives = 199/377 (53%), Gaps = 34/377 (9%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSS---VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD  286
             KSP   S E++   G   SS   ++ EY  AFRT SYVE++ K Q QLAA  S   +   
Sbjct  6     KSPFTRSGESQKQCGDSLSSRSNINEEYTEAFRTKSYVEMWSKAQSQLAARTSFNGLSST  65

Query  287   NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLE  466
             ++              +   + L  P       QE + ++ ++    H LL +YF  ++E
Sbjct  66    SSVSF----------YVHLSDYLLEPQ------QETLMKMIERL-RFHHLLMDYFEASVE  108

Query  467   ACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV  646
             A  +C+ LL+ V QTRA+Y+ +++ ++  E +           +  +A+ +   N LS +
Sbjct  109   AYNVCQLLLRSVHQTRANYRRIQRVIKISENM-----HDCRATFKHLAAFASSKNPLSII  163

Query  647   RFDDVRDDHLG---LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV  817
                  RD H G   L S LTSK  +I RR K  ++ K     +L+I  TA +I   +  +
Sbjct  164   SMVQFRDYHHGKMLLFSSLTSKGKKIRRRAKFNKLLKKVGAYSLVISQTALLIALLVFVL  223

Query  818   HFVVCTMAVPGLIALSLGMVKK--LKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLST  985
             H +V  +A PGL+   L + K+   K  +RG  +   +     LDVAAKG+++L+ND  T
Sbjct  224   HSMVGIVAAPGLMVPCLALFKRKLTKLVRRGPKTSLLQKFAAQLDVAAKGVYILVNDFGT  283

Query  986   VSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYL  1165
             +SR+V RL DE+EH K IA +       ++LKEV+  K F + E   LE LKELE HI L
Sbjct  284   ISRMVRRLYDEVEHRKDIARMCFRSGNSEILKEVM--KEFHMHESSFLEQLKELEDHICL  341

Query  1166  CFLNIVRSRRMIVQEIV  1216
             CFL I RSRR+++QEI+
Sbjct  342   CFLTINRSRRLVLQEIM  358



>gb|KDP36884.1| hypothetical protein JCGZ_08175 [Jatropha curcas]
Length=382

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 134/356 (38%), Positives = 207/356 (58%), Gaps = 25/356 (7%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             +V+ EY  AFRT SYVE++ K+QGQL       I G      L+ SSS      +S + S
Sbjct  35    NVNEEYREAFRTKSYVEMWSKIQGQLKRINVDGIDG------LSPSSSLPFYVHLSEYLS  88

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
              P         Q+ + +L Q+    H L+ +YF  +LEAC +C+ LL+ + QTR +Y+ +
Sbjct  89    EPEK-------QQTLADLIQRFKFHHSLI-DYFEASLEACNLCDLLLRSIHQTRVNYRRI  140

Query  533   KKAVEKIEELGLSSE--EQVNRA-YGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRL  694
             ++ ++    +  S++  ++VN   + E+ + +L  N LS V    F DV D+++GLL +L
Sbjct  141   ERVIKLSNRMQDSADYTDKVNGVIFRELTAYTLLRNPLSFVSQLEFQDVHDNNMGLLHKL  200

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM  874
             TS++ +I R+ K  R+ K   G  LLI  TA +I   ++A+H +V  +A PGL+  SL  
Sbjct  201   TSEQRKITRKVKVKRICKKVGGYCLLISHTALLIALLVIALHGIVGIVAAPGLMGCSLYF  260

Query  875   V-KKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIAD  1045
               KK+K    G+ +   + L   LD+AAKG ++L+ND  T+SRLV  L DE+EH K +AD
Sbjct  261   FRKKIKFINGGLKTGLLEKLSAQLDLAAKGTYILVNDFDTMSRLVMSLHDELEHKKALAD  320

Query  1046  LWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             +       ++LK+VV  K F + +    E L ELE+H+YLCF  I RSRR+++QEI
Sbjct  321   MCVRSKNTELLKKVV--KEFYMHDSCYQEQLDELEEHVYLCFHTINRSRRLVLQEI  374



>gb|KDO84940.1| hypothetical protein CISIN_1g038436mg, partial [Citrus sinensis]
Length=353

 Score =   183 bits (464),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 127/356 (36%), Positives = 193/356 (54%), Gaps = 31/356 (9%)
 Frame = +2

Query  170   SSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHE  349
             S+++ EY  AFRT SYVE++ K Q QLAA  S   +   ++              +   +
Sbjct  14    SNINEEYTEAFRTKSYVEMWSKAQSQLAARTSFNGLSSTSSVSF----------YVHLSD  63

Query  350   SLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKS  529
              L  P       QE + ++ ++  + H LL +YF  ++EA  +C+ LL+ V QTRA+Y+ 
Sbjct  64    YLLEPQ------QETLMKMIERL-HFHHLLMDYFEASVEAYNVCQLLLRSVHQTRANYRR  116

Query  530   VKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLG---LLSRLTS  700
             +++ V KI E    +       +  +A+ +   N LS +     RD H G   L S LTS
Sbjct  117   IQR-VMKISE----NMHDCRATFKHLAAFASSKNPLSIISMVQFRDYHHGKMLLFSSLTS  171

Query  701   KRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVK  880
             K  +I RR K  ++ K     +L+I  TA +I   +  +H +V  +A PGL+   L + +
Sbjct  172   KGKKIRRRAKFNKLLKKVGAYSLVISQTALLIALLVFVLHSMVGIVAAPGLMVPCLALFQ  231

Query  881   K--LKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
             +   K  +RG  +   +     LDVAAKG+++L+ND  T+SR+V RL DE+EH K IA +
Sbjct  232   RKLTKLVRRGPKTSLLQKFAAQLDVAAKGVYILVNDFDTISRMVRRLYDEVEHRKDIARM  291

Query  1049  WAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                    ++LKEV+  K F + E   LE LKELE HI LCFL I RSRR+++QEI+
Sbjct  292   CFRSGNSEILKEVM--KEFHMHESSFLEQLKELEDHICLCFLTINRSRRLVLQEIM  345



>ref|XP_003544385.2| PREDICTED: UPF0496 protein At1g20180-like [Glycine max]
Length=381

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 134/385 (35%), Positives = 200/385 (52%), Gaps = 38/385 (10%)
 Frame = +2

Query  113   TKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNT  292
             T   R+  NE+      K  SV+ EY+ AFRT SY+EI +K Q  +    +K +    ++
Sbjct  16    TGRSRKECNEDRWY---KKQSVNEEYLEAFRTKSYIEICNKAQEGIEKTSTKMLTSSSSS  72

Query  293   FPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEAC  472
              PL    +          E L  P       QE +  + Q+    H LL +YF  +LEAC
Sbjct  73    IPLCMQLT----------EYLLEPR------QEMIANIAQRL-KLHHLLVDYFEASLEAC  115

Query  473   AICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRA--------YGEIASLSLFG  628
               C+++L+ +   R  Y+ + + V K+ +  L  E+  N          Y E+AS ++  
Sbjct  116   RCCDTILEAIHSMRLAYRRITRVV-KLSKTVLDDEDDDNDDKIHNKYVIYRELASFAMQK  174

Query  629   NTLS----AVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMI  796
             N LS     V+F D+ D H+ LL RL S R  I RR    RV K  LG  L+   +  ++
Sbjct  175   NPLSVVISTVKFRDIHDRHVELLQRLKSTRREIRRRLTLKRVCKKVLGIALITAHSVVLV  234

Query  797   TFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRG-IPSRKGLYMPLDVAAKGLFVLI  970
                + A H +V  +A P ++   +G+ VK+ +E  R      + L   LDVAAKG++VL 
Sbjct  235   ALLVFAFHSIVGLVAAPSIVCGLVGLFVKRGRERFRSSYCDDEKLCEQLDVAAKGVYVLS  294

Query  971   NDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKEL  1147
             NDL T+SR+V RL DE+EH K +A++       ++ LK+V+  ++F   E   LE L+EL
Sbjct  295   NDLDTMSRMVKRLHDEVEHRKVVAEVCVRNEKSEILLKQVM--RDFHEHESSFLEQLEEL  352

Query  1148  EQHIYLCFLNIVRSRRMIVQEIVGR  1222
             E HIYLCFL   RSRR++VQEI  +
Sbjct  353   EGHIYLCFLTTNRSRRLVVQEITDK  377



>ref|XP_006579026.1| PREDICTED: UPF0496 protein At1g20180-like [Glycine max]
Length=358

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 195/374 (52%), Gaps = 44/374 (12%)
 Frame = +2

Query  128   RNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTs  307
             R     EGS    + +V+ EY+ AFRT SYVEI +    +L  A +       N+F +  
Sbjct  18    RKKEHEEGSFC-GTPNVNGEYLEAFRTKSYVEICNIAHRELGNAST-----NTNSFKMHL  71

Query  308   sssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA----HPLLNEYFLLTLEACA  475
             +                          E + E PQQ   A    H LL +YF  +LEAC 
Sbjct  72    T--------------------------EYLLEPPQQEIVANMKVHRLLVDYFEASLEACR  105

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF-GNTLSAVRF  652
              CE++++ + QTR  Y  V   V K+ +     ++  N  + +++S  L   N LS V+F
Sbjct  106   CCETIVQAIHQTRLAYARVTNVVVKLSQTAPYYDQSQNPIHTQLSSFVLLQNNPLSIVQF  165

Query  653   DDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVC  832
              D+ D ++ LLSRL SK+ +I+R      V K   G  L++     M+   + A H V+ 
Sbjct  166   HDIHDRYMTLLSRLLSKKRKIQRILTIKSVCKKVGGIGLIVSQGVLMVALLVFAFHSVIG  225

Query  833   TMAVPGLIALSLGMVKKLKEAKRGIPSRKG---LYMPLDVAAKGLFVLINDLSTVSRLVG  1003
              +A    I + L M K+ K +     +R     L   LDVAAKG++V+IN+L T+SR+V 
Sbjct  226   FVAAAPCI-VGLVMKKRFKRSCERFNTRNSCMKLCEQLDVAAKGVYVVINELDTMSRMVK  284

Query  1004  RLSDEMEHNKTIADLWAMKHCD-DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNI  1180
             RL DE+EH + +AD+    +C  ++LK VV  K F   E   L++L+ELE+HIYLCFL +
Sbjct  285   RLDDEVEHWRQVADICVKNYCKCEILKRVV--KEFQDNESNFLDMLEELEEHIYLCFLTV  342

Query  1181  VRSRRMIVQEIVGR  1222
              R RR++++EI+G+
Sbjct  343   NRFRRLVMEEIMGK  356



>ref|XP_003549471.2| PREDICTED: UPF0496 protein At1g20180-like [Glycine max]
Length=381

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 137/382 (36%), Positives = 206/382 (54%), Gaps = 32/382 (8%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             ++  R+  E E     K  SV+ EY+ AFRT SY+EI +K QG          +G  +T 
Sbjct  15    RTTGRSRKECEEDRLCKKQSVNEEYLEAFRTKSYIEICNKAQGG---------IGKTSTK  65

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
              LTSSSSSS    +   E L  P       QE +  + Q+    H LL +YF  +LEAC 
Sbjct  66    MLTSSSSSSIPLCMQLTEYLLEPR------QEMIANITQRL-KLHHLLVDYFEASLEACR  118

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLS----A  643
              C+++L+ +   R  Y+ + + V K+ +  L  ++     Y E+AS +L  N LS    +
Sbjct  119   CCDTILEAIHSMRLSYRRITRIV-KLSKTVLDDDDTKGVIYRELASFALQNNPLSVAISS  177

Query  644   VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHF  823
             V+F D+ D ++ LL RL S    I RR    RV K   G  L+   +  ++   + A H 
Sbjct  178   VKFRDIHDRYVELLKRLKSTSKEIRRRLTLKRVCKKVAGIALITSHSVVLVALLVFAFHS  237

Query  824   VVCTMAVPGLIALSLGM-VKKLKEAKRGIPS-------RKGLYMPLDVAAKGLFVLINDL  979
             +V  +A P ++   +G+ VKK ++    I S        + L   LD+AAKG++VLINDL
Sbjct  238   IVGLVAAPSIVGGLVGLFVKKGRQRFMSISSNNNNNNCEERLCEQLDLAAKGVYVLINDL  297

Query  980   STVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQH  1156
              T+SR+V RL+DE+EH K +A++       ++ LK+V+  ++F   E   LE L+ELE H
Sbjct  298   DTMSRMVKRLNDEVEHRKVVAEVCVRNGKSEILLKQVM--RDFHEHESSFLEQLEELEGH  355

Query  1157  IYLCFLNIVRSRRMIVQEIVGR  1222
             IYLCFL   RSRR++VQ+I  +
Sbjct  356   IYLCFLTTNRSRRLVVQQITDK  377



>ref|XP_007224037.1| hypothetical protein PRUPE_ppa015186mg, partial [Prunus persica]
 gb|EMJ25236.1| hypothetical protein PRUPE_ppa015186mg, partial [Prunus persica]
Length=389

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 210/387 (54%), Gaps = 58/387 (15%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             SV+ EY+ AFRT SYVE++D+V GQL +  +            +SSSS   +  +   E 
Sbjct  21    SVNEEYLQAFRTKSYVEMWDRVHGQLPSTAT------------SSSSSLPPNSYMDRSEY  68

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             L  P   +L      + + ++  N H  L +YF  +L+AC IC+ LL+ + QTR++Y+ +
Sbjct  69    LLEPRQDIL-----KDIISEEGLNLHHFLADYFEASLDACHICDLLLRSLHQTRSEYRKI  123

Query  533   KKAVEKIEELGLSSEE-------------------QVNRAYGEIASLSLFGNT----LSA  643
             KK + K+ + GL  E+                   Q    +G++ + ++        +S 
Sbjct  124   KKLILKLSQRGLLLEQAQTHNHANDTNNNNEDDDEQREAIFGDLTTFAVVKKNPLSIISP  183

Query  644   VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHF  823
             V+F D+ D HL L +RLT K  +++R  KR R+ K   G  L++  +A +I   +LA+H 
Sbjct  184   VQFRDIHDSHLALFNRLTLKHKKVQRTAKRNRICKKVGGVGLVVSHSALLIALLVLAIHS  243

Query  824   VVCTMAVPGLIALSLGM-VKKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSR  994
             ++  +  P L+A SLGM  KK++ A+  + +R        LDVAAKG+++LIND  T+SR
Sbjct  244   MIGIVVAPALMACSLGMCAKKMESAQDWLEARFPDSHSEQLDVAAKGIYILINDFDTMSR  303

Query  995   LVGRLSDEMEHNKTIADLWAMK------------HCDDVLKEVVSSKNFAIQEEWALEVL  1138
             +V RL DE+EH K IA +                +C ++ KEVV  + F   E   ++ L
Sbjct  304   MVRRLHDEVEHRKAIAVMCVTAARNVKNVNGSSGNC-EIFKEVV--REFHATESGFVDQL  360

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +ELE+HIYLC L I RSRR++++EIV 
Sbjct  361   EELEEHIYLCLLTINRSRRLVLEEIVA  387



>gb|KHN12622.1| UPF0496 protein [Glycine soja]
Length=381

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 134/366 (37%), Positives = 200/366 (55%), Gaps = 32/366 (9%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             K  SV+ EY+ AFRT SY+EI +K QG          +G  +T  LTSSSSSS    +  
Sbjct  31    KKQSVNEEYLEAFRTKSYIEICNKAQGG---------IGKTSTKMLTSSSSSSIPLCMQL  81

Query  344   HESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
              E L  P       QE +  + Q+    H LL +YF  +LEAC  C+++L+ +   R  Y
Sbjct  82    TEYLLEPR------QEMIANITQRL-KLHHLLVDYFEASLEACRCCDTILEAIHSMRLSY  134

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLS----AVRFDDVRDDHLGLLSR  691
             + + + V K+ +  L  ++     Y E+AS +L  N LS    +V+F D+ D ++ LL R
Sbjct  135   RRITRIV-KLSKTVLDDDDTKGVIYRELASFALQNNPLSVAISSVKFRDIHDRYVELLKR  193

Query  692   LTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLG  871
             L S    I RR    RV K   G  L+   +  ++   + A H +V  +A P ++   +G
Sbjct  194   LKSTSKEIRRRLTLKRVCKKVAGIALITSHSVVLVALLVFAFHSIVGLVAAPSIVGGLVG  253

Query  872   M-VKKLKEAKRGIPS-------RKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEH  1027
             + VKK ++    I S        + L   LD+AAKG++VLINDL T+SR+V RL+DE+EH
Sbjct  254   LFVKKGRQRFMSISSNNNNNNCEERLCEQLDLAAKGVYVLINDLDTMSRMVKRLNDEVEH  313

Query  1028  NKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
              K +A++       ++ LK+V+  ++F   E   LE L+ELE HIYLCFL   RSRR++V
Sbjct  314   RKVVAEVCVRNGKSEILLKQVM--RDFHEHESSFLEQLEELEGHIYLCFLTTNRSRRLVV  371

Query  1205  QEIVGR  1222
             Q+I  +
Sbjct  372   QQITDK  377



>emb|CDP07360.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 134/365 (37%), Positives = 200/365 (55%), Gaps = 45/365 (12%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             KS+ V  EYM AFRTNSY+EI  +VQ QLA    K I                    +S 
Sbjct  3     KSNIVDEEYMEAFRTNSYIEICSEVQSQLA---RKSI------------------DRLSS  41

Query  344   HESLPSPGCKLLLCQENMEELPQQASNA--------HPLLNEYFLLTLEACAICESLLKI  499
               SLP       L Q  +E  PQ  +N         H +L+ +F ++ EAC  CE +L+ 
Sbjct  42    SPSLPQH-----LSQGVLEPCPQTPTNVNKGSANDLHQILSGFFKISSEACKTCELILRS  96

Query  500   VLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGN---TLSAVRFDDVRDD  670
             + +TRA Y ++K+ + ++E+  +S E+Q N  Y  +AS +L  N   T++  +F  + DD
Sbjct  97    IHETRAKYGTMKRVLNQLEQ--ISDEDQQNELYRNLASFALLRNPLATITQAQFQHIHDD  154

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                 L R TSK  RI RR K +R  K     TL+    A  I   IL +H  V  +A P 
Sbjct  155   LHSALQRFTSKIKRIRRRRKFIRCSKRFARGTLIAASCALTIALPILVLHSAVGIVAAPA  214

Query  851   LIALSLGM-VKKLKEAKRGIPSRKGL---YMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             L+A SLG  +K++K+ K  +     L      LD AAKG++++IND  T+SRL+  L DE
Sbjct  215   LVACSLGACMKRIKQTKEWLVPETSLERFEAQLDTAAKGIYLIINDFDTMSRLMTLLHDE  274

Query  1019  MEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
             +EH+K +A+L   +  +++L EV+  + F I E   L+ L+ELE+++YLC LNI RSRR+
Sbjct  275   VEHSKFLANLCLRRRSNELLNEVI--REFQINETGVLDELEELEENVYLCILNINRSRRL  332

Query  1199  IVQEI  1213
             +V+++
Sbjct  333   LVEQM  337



>gb|KHN39407.1| UPF0496 protein [Glycine soja]
Length=381

 Score =   178 bits (451),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 201/386 (52%), Gaps = 36/386 (9%)
 Frame = +2

Query  110   ITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDN  289
             + ++ R     NE  L +K S V+ EY+ AFRT SY+EI +K Q  +    +K +    +
Sbjct  13    LRRTGRSRKECNEDRLYKKQS-VNEEYLEAFRTKSYIEICNKAQEGIEKTSTKMLTSSSS  71

Query  290   TFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEA  469
             + PL    +          E L  P       QE +  + Q+    H L+N YF  +LEA
Sbjct  72    SIPLCMQLT----------EYLLEPH------QEMIANITQRLKLHHLLVN-YFEASLEA  114

Query  470   CAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRA--------YGEIASLSLF  625
             C  C+++L+ +   R  Y+ + + V K+ +  L  E+  N          Y E+AS ++ 
Sbjct  115   CRCCDTILEAIHSMRLAYRRITRVV-KLSKTVLDDEDDDNDDKIHNKYVIYRELASFAMQ  173

Query  626   GNTLS----AVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFM  793
              N LS     V+F D+ D ++ LL RL S R  I RR    RV K  LG  L+   +  +
Sbjct  174   KNPLSVVISTVKFRDIHDRYVELLQRLKSTRREIRRRLTLKRVCKKVLGIALITAHSVVL  233

Query  794   ITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRG-IPSRKGLYMPLDVAAKGLFVL  967
             +   + A H +V  +A P ++   +G+ VK+ +E  R      + L   LDVAAKG++VL
Sbjct  234   VALLVFAFHSIVGLVAAPSIVCGLVGLFVKRGRERFRSSYCDDEKLCEQLDVAAKGVYVL  293

Query  968   INDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKE  1144
              NDL T+ R+V RL DE+EH K +A++       ++ LK+V+  ++F   E   LE L+E
Sbjct  294   SNDLDTMGRMVKRLHDEVEHRKVVAEVCVRNEKSEILLKQVM--RDFHEHESSFLEQLEE  351

Query  1145  LEQHIYLCFLNIVRSRRMIVQEIVGR  1222
             LE HIYLCFL   RSRR++VQEI  +
Sbjct  352   LEGHIYLCFLTTNRSRRLVVQEITDK  377



>ref|XP_004499302.1| PREDICTED: UPF0496 protein At1g20180-like [Cicer arietinum]
Length=363

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 130/376 (35%), Positives = 208/376 (55%), Gaps = 42/376 (11%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             + P ++ N+NE SL RK++ V+ EY+  FRT SY+EI +K QGQ              T 
Sbjct  11    RRPGKSRNKNEDSLYRKAN-VNEEYLETFRTKSYMEICNKAQGQFG-----------KTI  58

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
                  SSSS    ++  E L  P       +E +     Q    H L+ +YF  +LEAC 
Sbjct  59    STRRLSSSSLPIYMNLTECLLEP-------REEIIRNMTQNLKVHHLVVDYFEASLEACR  111

Query  476   ICESLLKIVLQTRADYKSVKKAVE--KIEELGLSSEEQVNRAYGEIASLSLFG-----NT  634
              C+++L+ +   R  YK + + V+  KI+++           Y E+ S S        + 
Sbjct  112   CCDTILEGIHSLRLCYKRITRVVKLTKIKDI-----------YRELVSFSSLQQKNPLSI  160

Query  635   LSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILA  814
             +S ++F D+ D ++ LL RLTSKRG+I+RR   + V K   G  L+    A +I   +++
Sbjct  161   ISTMQFRDIHDRYMELLQRLTSKRGKIKRRLTLISVCKKVGGIALVTSHAAILIALLVIS  220

Query  815   VHFVVCTMAVPGLIALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVS  991
             +H VV  +A P ++   +G+ +K++K  +      + L+  LD AAKG+F+LINDL T+S
Sbjct  221   IHSVVGLVAAPSIVGGLVGLFIKRIKRIRVRKSYSERLWGQLDAAAKGVFILINDLDTMS  280

Query  992   RLVGRLSDEMEHNKTIADLWAMKHCD-DVLKEVVSSKNFAIQEEWAL-EVLKELEQHIYL  1165
             R+V RL+DE+EH KT+ D +       ++LK V+S   F   +E +  E L+ELE+H+YL
Sbjct  281   RMVKRLNDEVEHRKTVIDFFVKNDSKCEILKRVISE--FGDDDECSFLEQLEELEEHVYL  338

Query  1166  CFLNIVRSRRMIVQEI  1213
             CFL + +SRR+++Q+I
Sbjct  339   CFLTVNKSRRLVMQQI  354



>gb|KEH20116.1| transmembrane protein [Medicago truncatula]
Length=379

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 141/375 (38%), Positives = 215/375 (57%), Gaps = 34/375 (9%)
 Frame = +2

Query  128   RNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTs  307
             R   + E SL +K + V+ EY+  FRT SY+EI +K QGQ      K I    NT  L+S
Sbjct  21    RKQLDKEESLCKKPN-VNEEYLETFRTKSYIEICNKAQGQFG----KTI----NTKRLSS  71

Query  308   sssssssPL----ISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
             S S+SS PL    ++  ESL  P  +++    NM    ++    H LL  YF  +LEA  
Sbjct  72    SCSTSS-PLPPICLNLTESLLEPRHEIIT---NM----RRNFKVHDLLVNYFDASLEASR  123

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLS--LFGNTLSAV-  646
              C+++L+ +  TR  Y  + + V K+ +  L+ E+     Y E+AS S  +  N LS + 
Sbjct  124   CCDTILEGIHSTRISYTRITRVV-KLSKRVLN-EQTKKDIYRELASFSSKVQNNPLSVIS  181

Query  647   --RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVH  820
               +FD++ + ++ LL RLTSKR +I+RR   +RV K   G  L+    A +I   +++ H
Sbjct  182   TMQFDNIHNRYIELLHRLTSKRKKIQRRLALIRVCKKVGGIALVTSHGAILIALLVVSFH  241

Query  821   FVVCTMAVPGLIALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRL  997
              VV  +A P ++   +G+ +KK+K   R     + L   LD AAKG+F+LINDL T+SR+
Sbjct  242   SVVGLVAAPSIVGSLVGLFIKKIKIRLRRSSYCERLCEQLDAAAKGVFILINDLDTMSRM  301

Query  998   VGRLSDEMEHNKTIADLWAMKHCD---DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLC  1168
             V RL+DE+EH K  AD+    +     ++LK V+S   +  QE   L+ L+ELE+H+YLC
Sbjct  302   VKRLNDEVEHRKIFADVCVKNNVGSKCEILKRVMSE--YRDQESSFLDQLEELEEHVYLC  359

Query  1169  FLNIVRSRRMIVQEI  1213
             FL I +SRR+++Q+I
Sbjct  360   FLTINKSRRLVMQQI  374



>ref|XP_006416424.1| hypothetical protein EUTSA_v10007842mg [Eutrema salsugineum]
 gb|ESQ34777.1| hypothetical protein EUTSA_v10007842mg [Eutrema salsugineum]
Length=393

 Score =   176 bits (446),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 142/390 (36%), Positives = 214/390 (55%), Gaps = 37/390 (9%)
 Frame = +2

Query  119   SPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFP  298
             S  R  N  + SL  K S V+ EY  AFRTNSY+EI  K + QL      ++    ++  
Sbjct  15    SSARQGNSEKDSLTSKLS-VNEEYKEAFRTNSYLEIRTKAEDQLGITFCSKLSSPSSSSS  73

Query  299   LTssssssssPLISGHES--LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEAC  472
              T+S SSS     S      L  P       QE ++ L Q +S  H LL ++F  + EAC
Sbjct  74    STTSPSSSDLSFHSHFTDYLLDPP-------QETLDALMQDSS-FHNLLVKFFDFSSEAC  125

Query  473   AICESLLKIVLQTRADYKSVKKAVE---------KIEELGLSSEEQVNRAYGEIASLSLF  625
              +CESLL+ + Q + ++  +K+ ++         K  E   S E+     + E++  +L 
Sbjct  126   DVCESLLQCIQQIKINHNKIKRVIKIGKRVCNGAKTAEC--SPEKLCALIFQELSRFALL  183

Query  626   GNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFM  793
              N L  +    +F  V D +  LL+RLTSK+ +I R+ + +R  K   G +L+I  +A +
Sbjct  184   KNPLCCIINESQFRKVHDANSELLARLTSKKRKIRRKVRFIRCCKKLGGYSLVISHSAIV  243

Query  794   ITFTILAVHFVVCTMAVPGLIAL-SLGMVKKLKEAKRGIPSRKGLYMPL-------DVAA  949
             IT  I+A+H ++  +A P L+ L SLG+ +K K+ KR + +R   +  L       D+AA
Sbjct  244   ITLLIIALHSILGVLAAPALLGLCSLGLWRK-KKVKRNMKNRSKTHTTLEKLGTQMDIAA  302

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWAL  1129
             KG+F+LINDL T+SRL GRL DE+EH KT+A + A     +VLKE +   N    EE   
Sbjct  303   KGMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSGKLEVLKEGLRELNG--HEERFS  360

Query  1130  EVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             + L+ELE+H++LCF  I RSRR++V +I G
Sbjct  361   QQLQELEEHLFLCFHTINRSRRLVVAQITG  390



>ref|XP_008357119.1| PREDICTED: UPF0496 protein At1g20180-like [Malus domestica]
Length=398

 Score =   170 bits (431),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 127/409 (31%), Positives = 213/409 (52%), Gaps = 56/409 (14%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             +K++SAF    PR   +   G+      +V  EY+  FRT SYVE++D+  GQL +AR  
Sbjct  12    TKLRSAF--SKPRSKKDNVGGNSFSSKLNVKEEYLEVFRTKSYVEMWDRXHGQLPSARLS  69

Query  269   EIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEEL-PQQASNAHPLLNE  445
                        +SSSS   +      E L  P       QE ++ +  ++  N H LL +
Sbjct  70    -----------SSSSSLPPNLFXDRSEYLLEPR------QETLKNIVDKEGINLHHLLTD  112

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKI---------EELGLSSEEQVNRAY  598
             YF  +L+AC IC+ LL+ + QTRA+ +  KK   K+         + + ++ ++Q    +
Sbjct  113   YFEASLDACHICDVLLRSMHQTRAENRHTKKLXLKLSXRVRILNNDNIDITDDKQCLAIF  172

Query  599   GEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
             GE+ + +   N LS V   +F D+ D +  L +RLT K  ++ R  KR R+ K      L
Sbjct  173   GELGTFARAKNPLSIVSPGQFRDIHDSYAALFNRLTLKHKKVRRAAKRNRICKKVGEVGL  232

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRGIPSR--KGLYMPLD  940
             ++  TA +I + + A+H ++  +  P L+A SLG+ V+K+  A   + +R  +     LD
Sbjct  233   VLSHTALLIAWLVFAIHSMIGIVVAPALMACSLGLCVRKMDSAAEWLNARFPESHGKQLD  292

Query  941   VAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEE  1120
             VAA+G+++LIND  T+SR+V RL +E+EH K +A +     C   ++ ++++ N      
Sbjct  293   VAAQGVYILINDFDTMSRMVRRLHNEVEHRKVVAGI-----CVRSVRSIITTSNGGSASN  347

Query  1121  WAL--EVLKELE--------------QHIYLCFLNIVRSRRMIVQEIVG  1219
             + +  +V++E                +HIYLC L I RSRR+++QEI+ 
Sbjct  348   FDIFKKVVREFHASEASFLEQLEELEEHIYLCLLTINRSRRLVIQEILA  396



>gb|KHN45948.1| UPF0496 protein [Glycine soja]
Length=272

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 158/271 (58%), Gaps = 8/271 (3%)
 Frame = +2

Query  425   AHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGE  604
              H LL +YF  +LEAC  CE++++ + QTR  Y  V   V K+ +     ++  N  + +
Sbjct  3     VHRLLVDYFEASLEACRCCETIVQAIHQTRLAYARVTNVVVKLSQTAPYYDQSQNPIHTQ  62

Query  605   IASLSLF-GNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGC  781
             ++S  L   N LS V+F D+ D ++ LLSRL SK+ +I+R      V K   G  L++  
Sbjct  63    LSSFVLLQNNPLSIVQFHDIHDRYMTLLSRLLSKKRKIQRILTIKSVCKKVGGIGLIVSQ  122

Query  782   TAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG---LYMPLDVAAK  952
                M+   + A H V+  +A    I + L M K+ K +     +R     L   LDVAAK
Sbjct  123   GVLMVALLVFAFHSVIGFVAAAPCI-VGLVMKKRFKRSCERFNTRNSCMKLCEQLDVAAK  181

Query  953   GLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD-DVLKEVVSSKNFAIQEEWAL  1129
             G++V+IN+L T+SR+V RL DE+EH + +AD+    +C  ++LK VV  K F   E   L
Sbjct  182   GVYVVINELDTMSRMVKRLDDEVEHWRQVADICVKNYCKCEILKRVV--KEFQDNESNFL  239

Query  1130  EVLKELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
             ++L+ELE+HIYLCFL + R RR++++EI+G+
Sbjct  240   DMLEELEEHIYLCFLTVNRFRRLVMEEIMGK  270



>emb|CDY71153.1| BnaAnng36320D [Brassica napus]
Length=392

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 126/364 (35%), Positives = 203/364 (56%), Gaps = 25/364 (7%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             SV+ EY  AFRT SY++I  K + QL    S ++     +   +  SS  S         
Sbjct  36    SVNEEYKEAFRTKSYLDIRTKAEDQLGITLSSKLSSSPPSSSHSPPSSDLSFHSHFTDYL  95

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             L  P       QE ++ L Q +S  H LL  +F  + +AC +CESLL+ + Q + ++  +
Sbjct  96    LDPP-------QETLDALMQDSS-FHNLLANFFDFSSDACDVCESLLQCIQQIKINHVKI  147

Query  533   KKAVEKIEELGLSSEEQVNRA--YGEIASLSLFGNTLSAV----RFDDVRDDHLGLLSRL  694
             K+ ++  + +  +  +   RA  + E++  +L  N L ++    +F  V D +  LL+RL
Sbjct  148   KRVIKIGKRVCNNGAKTPERALVFQELSRYALLKNPLYSIINQAQFRRVHDANSELLARL  207

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIAL-SLG  871
             TSKR RI R+ +  +  K   G +L+I  +A +IT  I+A+H ++  +  P ++ L SLG
Sbjct  208   TSKRRRIRRKDRFFKFCKKLGGCSLVISHSAIVITLLIVALHSILGVLVAPAVLGLCSLG  267

Query  872   MV--------KKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEH  1027
             ++        + ++   +  PS + L   +D+AAKG+F++INDL T+SRL GRL DE+EH
Sbjct  268   LLRKKKKKAKRNVENKSKTDPSLEKLGTQMDIAAKGMFIMINDLDTLSRLAGRLCDEIEH  327

Query  1028  NKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
              KT+A + A     +VLKE +  + F+  EE  LE L+ELE+H+YLCF  I RSRR++  
Sbjct  328   RKTVAAMCAKSGKIEVLKEAL--REFSGHEERFLEQLQELEEHLYLCFHTINRSRRLVFA  385

Query  1208  EIVG  1219
             +I G
Sbjct  386   QITG  389



>ref|XP_010257866.1| PREDICTED: UPF0496 protein At1g20180-like [Nelumbo nucifera]
Length=339

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 196/352 (56%), Gaps = 27/352 (8%)
 Frame = +2

Query  191   MAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGC  370
             M AFRT SY++I+ KVQ QL    + E+   + + PL+   S +        + L  P  
Sbjct  1     MEAFRTKSYIDIWSKVQDQLRTCTTSEV---EKSSPLSPFQSYARLS-----DFLLEPR-  51

Query  371   KLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEK  550
                  QE + EL +  S+ H LL +YF  +LEAC ICE LL  + QTR +Y  +++ +  
Sbjct  52    -----QEILIELIEN-SHLHHLLIDYFDGSLEACRICELLLHRINQTRNNYCIIQRIMNL  105

Query  551   IEELGLS----SEEQVNRAYGEIASLSLFGNTLS---AVRFDDVRDDHLGLLSRLTSKRG  709
              + L       +++Q    + E+ S +   N LS    V+F  + + +  +L +LT KR 
Sbjct  106   TKTLPAEYCDYTDDQCRIIFRELDSFATLDNPLSDTSPVQFRLLHERYGLMLKQLTLKRR  165

Query  710   RIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLG-MVKKL  886
             RI RR + +R+ K   G +L+I C A  +   +LAVH ++  +A PG++  S+  M KKL
Sbjct  166   RIIRRGRLIRLSKNGAGLSLVIACGALAVATLVLAVHTLIGIVAAPGILTFSVAFMKKKL  225

Query  887   KEAKRGIPSRK--GLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK  1060
             K A+ G+ + K   L   LD AAKG+F+L  D  T+SRLV RL DE+EH K IA +    
Sbjct  226   KSARIGLKTSKLARLEAQLDAAAKGVFILNRDFDTISRLVVRLHDEIEHGKAIARMCLRS  285

Query  1061  HCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                 +L+ VV  K+F   E   LE L ELE+H+YL FL I R+RR+++QEI+
Sbjct  286   QKRQILEVVV--KDFETHESCFLEQLGELEEHVYLSFLTINRARRLVIQEIM  335



>ref|XP_009110237.1| PREDICTED: UPF0496 protein At1g20180-like [Brassica rapa]
Length=391

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 127/364 (35%), Positives = 204/364 (56%), Gaps = 25/364 (7%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             SV+ EY  AFRT SY++I  K + QL    S ++     +   + SSS  S         
Sbjct  35    SVNEEYKEAFRTKSYLDIRTKAEDQLGITFSSKLSSSPPSASHSPSSSDLSFHSHFTDYL  94

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             L  P       QE ++ L Q +S  H LL  +F  + +AC +CESLL+ + Q + ++  +
Sbjct  95    LDPP-------QETLDALMQDSS-FHNLLANFFDFSSDACDVCESLLQCIQQIKINHIKI  146

Query  533   KKAVEKIEELGLSSEEQVNRA--YGEIASLSLFGNTLSAV----RFDDVRDDHLGLLSRL  694
             K+ ++  + +  +  +   RA  + E++  +L  N L ++    +F  V D +  LL+RL
Sbjct  147   KRVIKIGKRVCNNGAKTPERALVFQELSRYALLKNPLYSIINQAQFRRVHDANSELLARL  206

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIAL-SLG  871
             TSKR RI R+ +  +  K   G +L+I  +A +IT  I+A+H ++  +  P ++ L SLG
Sbjct  207   TSKRRRIRRKDRFFKFCKKLGGCSLVISHSAIVITLLIVALHSILGVLVAPAVLGLCSLG  266

Query  872   MVK--------KLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEH  1027
             +++         ++   +  PS + L   +D+AAKG+F++INDL T+SRL GRL DE+EH
Sbjct  267   LLRKKKKKAKRNVENKSKTDPSLEKLGTQMDIAAKGMFIMINDLDTLSRLAGRLCDEIEH  326

Query  1028  NKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
              KT+A + A     +VLKE +  + F+  EE  LE L+ELE+H+YLCF  I RSRR++  
Sbjct  327   RKTVAAMCAKSGKIEVLKEAL--REFSGHEERFLEQLQELEEHLYLCFHTINRSRRLVFA  384

Query  1208  EIVG  1219
             +I G
Sbjct  385   QITG  388



>ref|XP_003589549.1| hypothetical protein MTR_1g025960 [Medicago truncatula]
 gb|AES59800.1| transmembrane protein [Medicago truncatula]
Length=369

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 137/387 (35%), Positives = 208/387 (54%), Gaps = 42/387 (11%)
 Frame = +2

Query  104   AFITKSPR-RNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVG  280
              ++ +S R R     + SL RKS+ V+ EY  AFRT SY+EI +K + Q     S     
Sbjct  8     CYLRRSGRSRKQCHKDDSLCRKSN-VNEEYFEAFRTKSYIEICNKAKVQFEKTIS-----  61

Query  281   GDNTFPLTssssssssPL-ISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLL  457
                T  L++S S+S  P+ I+  E L  P       QE +  + Q     H LL +YF  
Sbjct  62    ---TKRLSTSCSTSLPPICINLTEYLLEPR------QEIITNMTQNF-KVHHLLVDYFEA  111

Query  458   TLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASL--SLFGN  631
             +LEAC  C+++L+ +  TR  Y   K+ V+  + +   +E      Y E+A     L  N
Sbjct  112   SLEACRCCDTILEGIHATRLSYTRTKRFVKLSKRV--INEPTKKDIYRELALFPSKLQNN  169

Query  632   TLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITF  802
              LS +   +F D+R+ ++ LL +LTSKR +I+RR   + V K   G  L+    A +I  
Sbjct  170   PLSVISTMQFHDIRNRYMELLQKLTSKRRKIQRRLTLISVCKKVGGIALVTSHAAILIAL  229

Query  803   TILAVHFVVCTMAVP----GLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLI  970
              +++ H VV  +A P    GL+ L +  +K     +R       L   LD AAKG+F+LI
Sbjct  230   LVVSFHSVVGLVAAPSIVGGLVGLFIKRIKNRTNCER-------LCEQLDAAAKGVFILI  282

Query  971   NDLSTVSRLVGRLSDEMEHNKTIADLWAMK---HCDDVLKEVVSSKNFAIQEEWALEVLK  1141
             NDL T+SR+V RL+DE+EH K +A +        C ++LK  +S   F+ QE   L+ L+
Sbjct  283   NDLDTMSRMVKRLNDEVEHRKMVAQVCVKNVGSKC-EILKRFMSE--FSDQESRFLDELE  339

Query  1142  ELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
             ELE+H+YLCFL + +SRR+++Q+I  R
Sbjct  340   ELEEHVYLCFLTVNKSRRLVLQQITER  366



>ref|XP_003603811.1| hypothetical protein MTR_3g114460 [Medicago truncatula]
Length=367

 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 130/377 (34%), Positives = 203/377 (54%), Gaps = 43/377 (11%)
 Frame = +2

Query  146   EGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTsssssss  325
             E SL  KS+ V+ EY  AFRT SYV+I +K QG           G +NT    S  SS S
Sbjct  14    EDSLSSKSN-VNSEYRNAFRTKSYVDICNKAQG----------YGIENT----SMRSSHS  58

Query  326   sPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVL  505
             +   +   SL  P       QE +  + + +   H LL +YF  +LEA   C+ +L+ V 
Sbjct  59    NSCSTSSSSLLEPR------QEIVTNMIK-SFKVHHLLVDYFEASLEAYLCCDKILQGVR  111

Query  506   QTRADYKSV--------KKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL----SAVR  649
             QTR  Y  V        ++ VE   +  + +    N  Y E+ S S+  N+L    + + 
Sbjct  112   QTRFGYGKVINVVNKLSQRVVEYDTDTDVDTNVNDNIIYEELVS-SVINNSLCLSNNIIN  170

Query  650   FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV  829
             F D+++ H+ LL+RL SKR +++RR    R+ K   G  L++  TA ++   + A H ++
Sbjct  171   FCDIQEKHIALLNRLNSKRLKLKRRITIKRLCKKVGGIGLVVSETALLVALLVFAFHSII  230

Query  830   CTMAVPGLIALSLGMVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGR  1006
                A P ++  S G++KK  K   +   S + LY  +DVAAKG++++INDL T+SR+V R
Sbjct  231   GLAAAPYVVGGSFGLMKKRSKWENKKYNSCEKLYEQIDVAAKGVYIVINDLDTMSRMVKR  290

Query  1007  LSDEMEHNKTIADLWAMKHCDD-----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCF  1171
             L+DE+EH + +AD+    +        +LK V+  + F   +   ++ L+ELE+HIYLCF
Sbjct  291   LADEVEHCREVADICVKNYGHGNGRCVILKMVL--REFRDCQTNFMDQLEELEEHIYLCF  348

Query  1172  LNIVRSRRMIVQEIVGR  1222
             L I RSRR ++Q+I  +
Sbjct  349   LAINRSRRQLMQKITDK  365



>gb|AES74062.2| transmembrane protein [Medicago truncatula]
Length=378

 Score =   162 bits (410),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 130/377 (34%), Positives = 204/377 (54%), Gaps = 43/377 (11%)
 Frame = +2

Query  146   EGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTsssssss  325
             E SL  KS+ V+ EY  AFRT SYV+I +K QG           G +NT    S  SS S
Sbjct  25    EDSLSSKSN-VNSEYRNAFRTKSYVDICNKAQG----------YGIENT----SMRSSHS  69

Query  326   sPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVL  505
             +   +   SL  P  +++    NM     ++   H LL +YF  +LEA   C+ +L+ V 
Sbjct  70    NSCSTSSSSLLEPRQEIVT---NM----IKSFKVHHLLVDYFEASLEAYLCCDKILQGVR  122

Query  506   QTRADYKSV--------KKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL----SAVR  649
             QTR  Y  V        ++ VE   +  + +    N  Y E+ S S+  N+L    + + 
Sbjct  123   QTRFGYGKVINVVNKLSQRVVEYDTDTDVDTNVNDNIIYEELVS-SVINNSLCLSNNIIN  181

Query  650   FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV  829
             F D+++ H+ LL+RL SKR +++RR    R+ K   G  L++  TA ++   + A H ++
Sbjct  182   FCDIQEKHIALLNRLNSKRLKLKRRITIKRLCKKVGGIGLVVSETALLVALLVFAFHSII  241

Query  830   CTMAVPGLIALSLGMVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGR  1006
                A P ++  S G++KK  K   +   S + LY  +DVAAKG++++INDL T+SR+V R
Sbjct  242   GLAAAPYVVGGSFGLMKKRSKWENKKYNSCEKLYEQIDVAAKGVYIVINDLDTMSRMVKR  301

Query  1007  LSDEMEHNKTIADLWAMKHCDD-----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCF  1171
             L+DE+EH + +AD+    +        +LK V+  + F   +   ++ L+ELE+HIYLCF
Sbjct  302   LADEVEHCREVADICVKNYGHGNGRCVILKMVL--REFRDCQTNFMDQLEELEEHIYLCF  359

Query  1172  LNIVRSRRMIVQEIVGR  1222
             L I RSRR ++Q+I  +
Sbjct  360   LAINRSRRQLMQKITDK  376



>emb|CDY54335.1| BnaCnng26810D [Brassica napus]
Length=392

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 205/366 (56%), Gaps = 29/366 (8%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH--  346
             SV+ EY  AFRT SY++I  K + QL    S ++     +   +  SS     +   H  
Sbjct  36    SVNEEYKEAFRTKSYLDIRTKAEDQLGITLSSKLSSSPPSSSHSPPSSDL---IFHSHFT  92

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             + L  P       QE ++ L Q +S  H LL  +F  + +AC +CESLL+ + Q + ++ 
Sbjct  93    DYLLDPP------QETLDALMQDSS-FHNLLANFFDFSSDACDVCESLLQSIQQIKINHV  145

Query  527   SVKKAVEKIEELGLSSEEQVNRA--YGEIASLSLFGNTLSAV----RFDDVRDDHLGLLS  688
              +K+ ++  + +  +  +   RA  + E++  +L  N L ++    +F  V D +  LL+
Sbjct  146   KIKRVIKIGKRVCNNGAKTPERALIFQELSRYALLKNPLYSIINQAQFRRVHDANSELLA  205

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIAL-S  865
             RLTSKR RI R+ +  +  K   G +L+I  +A +IT  I+A+H ++  +  P ++   S
Sbjct  206   RLTSKRRRIRRKDRFFKFCKKLGGCSLVISHSAIVITLLIVALHSILGVLVAPAMLGFCS  265

Query  866   LGMVKKLKEA--------KRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEM  1021
             LG+++K K+          +  P+ + L   +D+AAKG+F++INDL T+SRL GRL DE+
Sbjct  266   LGLLRKKKKKAKRNMKNKSKTDPTLEKLGTQMDIAAKGMFIMINDLDTLSRLAGRLCDEI  325

Query  1022  EHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
             EH KT+A + A     +VLKE +  + F+  EE  LE L+ELE+H+YLCF  I RSRR++
Sbjct  326   EHRKTVAAMCAKSGKIEVLKEAL--REFSGHEERFLEQLQELEEHLYLCFHTINRSRRLV  383

Query  1202  VQEIVG  1219
               +I G
Sbjct  384   FAQITG  389



>ref|XP_004500922.1| PREDICTED: UPF0496 protein At1g20180-like [Cicer arietinum]
Length=389

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 127/402 (32%), Positives = 208/402 (52%), Gaps = 38/402 (9%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             +K  S F  K+   +   NE SL  K + V+ EY  AFRT SY++I +KV        S 
Sbjct  2     TKCLSLFRRKTGGGSEERNEDSLSDKPN-VNGEYFKAFRTKSYIDICNKVHKHEIDNTSS  60

Query  269   EIVGGDNTFPLTssssssssPLISGH--ESLPSPGCKLLLCQENMEELPQQASNAHPLLN  442
                   +    +S+S  +    ++ H  E       K++ C +            H LL 
Sbjct  61    ISSISSSCSTSSSTSLPNYFLNLTEHLLEPRKEIVTKIIKCLK-----------VHRLLV  109

Query  443   EYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEE---------LGLSSEEQVNRA  595
             +YF  +LEAC  C+++L+ + QTR  Y  V  AV K+ E           + +   +N  
Sbjct  110   DYFESSLEACLCCDTILQSIRQTRFVYGRVTNAVNKLSERVVLEYDTDTNMDTNNNINAI  169

Query  596   YGEIASLSLFGN------TLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVAL  757
             Y E+AS  L  N      + + ++F ++++ H+ LL+RL SKR ++ RR +  R+ K   
Sbjct  170   YKELASFVLQNNNNPFCLSNNVIKFHNIQEKHMVLLNRLNSKRLKLRRRIRIKRLCKKVG  229

Query  758   GSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPL  937
             G  L++  T  ++     A H ++   A P ++   LG++KK K   +     + LY  +
Sbjct  230   GIGLIVSQTTLLVALLFFAFHSIIGLAAAPYVVGGFLGLMKKKKRFVKYSTCSEKLYEQI  289

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD-------DVLKEVVSS  1096
             DVAAKG++++IND+ T+SR+V RL DE+EH + +AD+    + +       ++L+ VV  
Sbjct  290   DVAAKGVYIVINDMDTMSRMVKRLEDEVEHWREVADICVKNYGNGNGKGRCEILRMVV--  347

Query  1097  KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGR  1222
             + F   +   L+ L+ELE+HIYLCFL I RSRR+++QEI  +
Sbjct  348   REFHDCQTQFLDQLEELEEHIYLCFLTINRSRRLLMQEITHK  389



>ref|XP_010498452.1| PREDICTED: UPF0496 protein At1g20180-like [Camelina sativa]
Length=393

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 138/401 (34%), Positives = 213/401 (53%), Gaps = 28/401 (7%)
 Frame = +2

Query  74    LFKKFSKMKSAFITKSPRRNSNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQL  250
             + K  S + S   + S R+  +E E      S  SV+ EY  AFRTNSY+EI  K + QL
Sbjct  1     MMKMKSFLGSRLYSSSTRKGKSEKECCRSLTSKLSVNEEYKEAFRTNSYLEIRTKAEDQL  60

Query  251   AAARSKEIVGGDNTFPLTssssssssPLISGH-ESLPSPGCKLLLCQENMEELPQQASNA  427
                   ++    +    +SS SSS     S   + L  P       Q+ ++ L Q +S  
Sbjct  61    GVTSCSKLSSSSSPSSSSSSPSSSDLSFHSHFTDYLLDPP------QDTLDALMQDSS-F  113

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV-------EKIEELGLSSEEQV  586
             + LL ++F  + EAC +CESLL  + Q + ++  +K+ +          +    S E+  
Sbjct  114   NDLLVKFFAFSSEACDVCESLLHSIQQIKINHNKIKRIITIGKRVCNGAKTTEFSHEQLC  173

Query  587   NRAYGEIASLSLFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
                + E++  +   N L  +    RF  V D +  LL +LT+KR RI R+ + L   K  
Sbjct  174   ALIFQELSRFAALKNPLCCIINEARFGIVHDANSDLLEKLTTKRRRIRRKVRFLSFCKKL  233

Query  755   LGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG----  922
              G +L+I  +A +IT  I+A+H ++  +A P L+ L   ++ + KEAKR +   K     
Sbjct  234   GGYSLVISHSAIVITLVIIALHSILGALAAPALLGLCSLVLLRKKEAKRSMHKSKRHTTL  293

Query  923   --LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSS  1096
               L   +D+AAKG+F+LINDL T+SRL GRL DE+EH KT+A + A     +VLKE +  
Sbjct  294   ERLGTQIDIAAKGMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEAL--  351

Query  1097  KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             + F   EE   + L+ELE+H+YLCF+ I RSRR+++ +I G
Sbjct  352   REFNAHEERFSDQLQELEEHLYLCFITINRSRRLVLAQITG  392



>ref|XP_010459700.1| PREDICTED: UPF0496 protein At1g20180-like isoform X1 [Camelina 
sativa]
 ref|XP_010459702.1| PREDICTED: UPF0496 protein At1g20180-like isoform X3 [Camelina 
sativa]
Length=393

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 138/401 (34%), Positives = 213/401 (53%), Gaps = 28/401 (7%)
 Frame = +2

Query  74    LFKKFSKMKSAFITKSPRRNSNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQL  250
             + K  S + S   + S R+  +E E      S  SV+ EY  AFRTNSY+EI  K + QL
Sbjct  1     MMKMKSFLGSRLYSSSTRKGKSEKECCRSLTSKLSVNEEYKEAFRTNSYLEIRTKAEDQL  60

Query  251   AAARSKEIVGGDNTFPLTssssssssPLISGH-ESLPSPGCKLLLCQENMEELPQQASNA  427
                   ++    +    +SS SSS     S   + L  P       Q+ ++ L Q +S  
Sbjct  61    GVTSCSKLSSSSSPSSSSSSPSSSDLSFHSHFTDYLLDPP------QDTLDALMQDSS-F  113

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV-------EKIEELGLSSEEQV  586
             + LL ++F  + EAC +CESLL  + Q + ++  +K+ +          +    S E+  
Sbjct  114   NDLLVKFFDFSSEACDVCESLLHSIQQIKINHNKIKRIITIGKRVCNGAKTTEFSHEQLC  173

Query  587   NRAYGEIASLSLFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
                + E++  +   N L  +    RF  V D +  LL +LT+KR RI R+ + L   K  
Sbjct  174   ALIFQELSRFAALKNPLCCIINEARFGIVHDANSDLLEKLTTKRRRIRRKVRFLSFCKKL  233

Query  755   LGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG----  922
              G +L+I  +A +IT  I+A+H ++  +A P L+ L   ++ + KEAKR +   K     
Sbjct  234   GGYSLVISHSAIVITLVIIALHSILGALAAPALLGLCSLVLLRKKEAKRSMHKSKRHTTL  293

Query  923   --LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSS  1096
               L   +D+AAKG+F+LINDL T+SRL GRL DE+EH KT+A + A     +VLKE +  
Sbjct  294   ERLGTQIDIAAKGMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEAL--  351

Query  1097  KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             + F   EE   + L+ELE+H+YLCF+ I RSRR+++ +I G
Sbjct  352   REFNAHEERFSDQLQELEEHLYLCFITINRSRRLVLAQITG  392



>ref|XP_010459701.1| PREDICTED: UPF0496 protein At1g20180-like isoform X2 [Camelina 
sativa]
Length=390

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 136/394 (35%), Positives = 210/394 (53%), Gaps = 28/394 (7%)
 Frame = +2

Query  95    MKSAFITKSPRRNSNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKE  271
             + S   + S R+  +E E      S  SV+ EY  AFRTNSY+EI  K + QL      +
Sbjct  5     LGSRLYSSSTRKGKSEKECCRSLTSKLSVNEEYKEAFRTNSYLEIRTKAEDQLGVTSCSK  64

Query  272   IVGGDNTFPLTssssssssPLISGH-ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEY  448
             +    +    +SS SSS     S   + L  P       Q+ ++ L Q +S  + LL ++
Sbjct  65    LSSSSSPSSSSSSPSSSDLSFHSHFTDYLLDPP------QDTLDALMQDSS-FNDLLVKF  117

Query  449   FLLTLEACAICESLLKIVLQTRADYKSVKKAV-------EKIEELGLSSEEQVNRAYGEI  607
             F  + EAC +CESLL  + Q + ++  +K+ +          +    S E+     + E+
Sbjct  118   FDFSSEACDVCESLLHSIQQIKINHNKIKRIITIGKRVCNGAKTTEFSHEQLCALIFQEL  177

Query  608   ASLSLFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLI  775
             +  +   N L  +    RF  V D +  LL +LT+KR RI R+ + L   K   G +L+I
Sbjct  178   SRFAALKNPLCCIINEARFGIVHDANSDLLEKLTTKRRRIRRKVRFLSFCKKLGGYSLVI  237

Query  776   GCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG------LYMPL  937
               +A +IT  I+A+H ++  +A P L+ L   ++ + KEAKR +   K       L   +
Sbjct  238   SHSAIVITLVIIALHSILGALAAPALLGLCSLVLLRKKEAKRSMHKSKRHTTLERLGTQI  297

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQE  1117
             D+AAKG+F+LINDL T+SRL GRL DE+EH KT+A + A     +VLKE +  + F   E
Sbjct  298   DIAAKGMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEAL--REFNAHE  355

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             E   + L+ELE+H+YLCF+ I RSRR+++ +I G
Sbjct  356   ERFSDQLQELEEHLYLCFITINRSRRLVLAQITG  389



>ref|XP_010477250.1| PREDICTED: UPF0496 protein At1g20180 [Camelina sativa]
Length=393

 Score =   157 bits (396),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 137/401 (34%), Positives = 215/401 (54%), Gaps = 28/401 (7%)
 Frame = +2

Query  74    LFKKFSKMKSAFITKSPRRNSNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQL  250
             + K  S + S   + S R+  +E E      S  SV+ EY  AFRTNSY+EI  K + QL
Sbjct  1     MMKMKSFLGSRLYSSSTRKGKSEKECCRSLTSKLSVNEEYKEAFRTNSYLEIRTKAEDQL  60

Query  251   AAARSKEIVGGDNTFPLTssssssssPLISGH-ESLPSPGCKLLLCQENMEELPQQASNA  427
                   ++    +    +SS SSS     S   + L  P       Q+ ++ L Q +S  
Sbjct  61    GVTSCSKLSSSSSPSSSSSSPSSSDLSFHSHFTDYLLDPP------QDTLDALMQDSS-F  113

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV-------EKIEELGLSSEEQV  586
             + LL ++F  + EAC +CESLL+ + Q + ++  +K+ +          +    S E+  
Sbjct  114   NDLLVKFFDFSSEACDVCESLLQSIQQIKVNHNKIKRIITIGKRVCNGAKTTEYSHEQLC  173

Query  587   NRAYGEIASLSLFGNTL----SAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
                + E++  +   N L    +  RF  V D +  LL +LT+KR RI R+ + L   K  
Sbjct  174   ALIFQELSRFAALKNPLCCNINEARFGIVHDANSDLLDKLTTKRKRIRRKVRFLSFCKKL  233

Query  755   LGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG----  922
              G +L+I  +A +IT  I+A+H ++  +A P L+ L   ++ + K+AKR +   K     
Sbjct  234   GGYSLVISHSAIVITLLIIALHSILGALAAPALLGLCSLVLLRKKKAKRNMHKSKRDTTL  293

Query  923   --LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSS  1096
               L   +D+AAKG+F+LINDL T+SRL GRL DE+EH KT+A + A     +VLKE +  
Sbjct  294   ERLGTQIDIAAKGMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEAL--  351

Query  1097  KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             + F+  EE   + L+ELE+H+YLCF+ I RSRR+++ +I G
Sbjct  352   REFSAHEERFSDQLQELEEHLYLCFITINRSRRLVLAQITG  392



>ref|XP_007160635.1| hypothetical protein PHAVU_001G003900g [Phaseolus vulgaris]
 gb|ESW32629.1| hypothetical protein PHAVU_001G003900g [Phaseolus vulgaris]
Length=371

 Score =   155 bits (393),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 132/372 (35%), Positives = 204/372 (55%), Gaps = 22/372 (6%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             K+  R   E E     K  SV+ EY+ AFRT SY+EI +K Q  L    +K +     T 
Sbjct  12    KTTGRARKECEEDRLCKKRSVNEEYLEAFRTKSYMEICNKAQVGLGKTTTKML-----TS  66

Query  296   PLTssssssssPL-ISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEAC  472
               +SSSSSS+ PL +   E L  P       QE +  + Q+    H LL EYF  TLEAC
Sbjct  67    SSSSSSSSSAVPLCMQLTEYLLDPR------QETIANISQRL-KLHRLLVEYFEATLEAC  119

Query  473   AICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNR--AYGEIASLSLFGNTLSAV  646
               C+++L+ +   R  Y+ + + + K+ ++  ++ +Q +R   Y E++S +   N  SAV
Sbjct  120   RFCDTILEAIHSVRLAYRRIAR-IAKLSKIA-NNHDQTHRDTIYRELSSFASQTNPFSAV  177

Query  647   ---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV  817
                +F D+ D  + LL+RL   R +I RR K  RV K   G  L+      +    ++A 
Sbjct  178   STLQFRDIHDKCVELLNRLKQTRRKIRRRLKLKRVCKKVGGIALVASHCVVLAGLLVIAF  237

Query  818   HFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRL  997
             H VV  +  P ++   +G++ K    + G    + +   LDVAAKG++++INDL T+SR+
Sbjct  238   HSVVGVVVAPSILGGLVGLLAKRGGGRVGCRGSERVCEQLDVAAKGIYIVINDLDTMSRM  297

Query  998   VGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLN  1177
             V RL DE+EH K +A++ A     +++K+V+  + F  ++   +E L+ELE HIYLCFL 
Sbjct  298   VKRLEDEVEHRKMVAEVGARNGKWEIVKQVM--REFHERDSSFVEQLEELEGHIYLCFLT  355

Query  1178  IVRSRRMIVQEI  1213
               RSRR++VQ I
Sbjct  356   TNRSRRLLVQTI  367



>gb|AAT67559.1| hypothetical protein At1G20180 [Arabidopsis thaliana]
Length=390

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 129/369 (35%), Positives = 197/369 (53%), Gaps = 34/369 (9%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH--  346
             SV+ EY  AFRTNSY+E   K + QL       I         + S SSSS      H  
Sbjct  35    SVNEEYKEAFRTNSYLETRTKAEDQLG------ITSCSKLSSSSPSPSSSSDLSFHSHFT  88

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             + L  P       QE ++ L Q +S    L+  +F L+ EAC +CE+LL+ + Q + ++ 
Sbjct  89    DYLLDPP------QETLDALMQDSS-LDNLIVTFFDLSSEACDVCETLLQCLQQIKINHN  141

Query  527   SVKKAVE-------KIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV----RFDDVRDDH  673
              +K+ ++         + L  S E      + E++  +   N L  +    +F  V D +
Sbjct  142   KIKRVMKIGKRVCNGAKTLECSPETLCALIFQELSRFAALKNPLCRIVNEAQFRIVHDAN  201

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               LL++LTSK+ RI R+ +  +  K   G +L+I  +A +IT  I+A+H ++   A P L
Sbjct  202   SDLLTKLTSKKRRIRRKIRFFKFCKKLGGYSLVITHSAIVITLLIIALHSILGVFAAPAL  261

Query  854   IAL-SLGMVKKLKEAKRGIPSRKG-----LYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             + L S  +++K K   R   S K      L   +D+AAKG+F+LINDL T+SRL GRL D
Sbjct  262   LGLCSFCLLRKKKAKGRMHKSNKDTTLEKLGTQIDIAAKGMFILINDLDTLSRLAGRLCD  321

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+EH KT+A + A     +VLKE +  + F   EE   + L+ELE+H+YLCF  I RSRR
Sbjct  322   EIEHRKTVAAMCAKSRKIEVLKEAL--REFNGHEEKFSDQLQELEEHLYLCFHTINRSRR  379

Query  1196  MIVQEIVGR  1222
             +++ +I G+
Sbjct  380   LVLAQITGQ  388



>ref|NP_173445.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q6DYE5.2|U496K_ARATH RecName: Full=UPF0496 protein At1g20180 [Arabidopsis thaliana]
 gb|AAF79896.1|AC022472_5 Contains similarity to At14a protein from Arabidopsis thaliana 
gi|4589123 [Arabidopsis thaliana]
 gb|ABE65635.1| hypothetical protein At1g20180 [Arabidopsis thaliana]
 gb|AEE29947.1| uncharacterized protein AT1G20180 [Arabidopsis thaliana]
Length=390

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 129/369 (35%), Positives = 197/369 (53%), Gaps = 34/369 (9%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH--  346
             SV+ EY  AFRTNSY+E   K + QL       I         + S SSSS      H  
Sbjct  35    SVNEEYKEAFRTNSYLETRTKAEDQLG------ITSCSKLSSSSPSPSSSSDLSFHSHFT  88

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             + L  P       QE ++ L Q +S    L+  +F L+ EAC +CE+LL+ + Q + ++ 
Sbjct  89    DYLLDPP------QETLDALMQDSS-LDNLIVTFFDLSSEACDVCETLLQCLQQIKINHN  141

Query  527   SVKKAVE-------KIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV----RFDDVRDDH  673
              +K+ ++         + L  S E      + E++  +   N L  +    +F  V D +
Sbjct  142   KIKRVMKIGKRVCNGAKTLECSPEMLCALIFQELSRFAALKNPLCRIVNEAQFRIVHDAN  201

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               LL++LTSK+ RI R+ +  +  K   G +L+I  +A +IT  I+A+H ++   A P L
Sbjct  202   SDLLTKLTSKKRRIRRKIRFFKFCKKLGGYSLVITHSAIVITLLIIALHSILGVFAAPAL  261

Query  854   IAL-SLGMVKKLKEAKRGIPSRKG-----LYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             + L S  +++K K   R   S K      L   +D+AAKG+F+LINDL T+SRL GRL D
Sbjct  262   LGLCSFCLLRKKKAKGRMHKSNKDTTLEKLGTQIDIAAKGMFILINDLDTLSRLAGRLCD  321

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+EH KT+A + A     +VLKE +  + F   EE   + L+ELE+H+YLCF  I RSRR
Sbjct  322   EIEHRKTVAAMCAKSRKIEVLKEAL--REFNGHEEKFSDQLQELEEHLYLCFHTINRSRR  379

Query  1196  MIVQEIVGR  1222
             +++ +I G+
Sbjct  380   LVLAQITGQ  388



>ref|XP_010498454.1| PREDICTED: UPF0496 protein At1g20180-like [Camelina sativa]
Length=393

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 136/401 (34%), Positives = 216/401 (54%), Gaps = 28/401 (7%)
 Frame = +2

Query  74    LFKKFSKMKSAFITKSPRRNSNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQL  250
             + K  S + S   + S R+  +E E      S  SV+ EY  AFRTNSY+EI  K + QL
Sbjct  1     MMKMKSFLGSRLYSSSTRKGKSEKECCRSLTSKLSVNEEYKEAFRTNSYLEIRTKAEDQL  60

Query  251   AAARSKEIVGGDNTFPLTssssssssPLISGH-ESLPSPGCKLLLCQENMEELPQQASNA  427
                   ++    +    +SS SSS     S   + L  P       Q+ ++ L Q +S  
Sbjct  61    GVTSCSKLSSSSSPSSSSSSPSSSDLSFHSHFTDYLLDPP------QDTLDALMQDSS-F  113

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV-------EKIEELGLSSEEQV  586
             + LL ++F  + EAC +CESLL+ + + + ++  +K+ +          +    S E+  
Sbjct  114   NDLLVKFFAFSSEACDVCESLLQSIQRIKINHNKIKRIITIGKRVCNGAKTTEYSHEQLC  173

Query  587   NRAYGEIASLSLFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
                + E++  +   N L  +    RF  V D +  LL +LT+KR RI+R+ + L   K  
Sbjct  174   ALIFQELSRFAALKNPLCCMINEARFGIVHDANSDLLEKLTTKRRRIKRKVRFLSFCKKL  233

Query  755   LGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG----  922
              G +L+I  +A +IT  I+A+H ++  +A P L+ L   ++ + K+AKR +   K     
Sbjct  234   GGYSLVISHSAIVITLLIIALHSILGALAAPALLGLCSLVLLRKKKAKRSMHKSKRDTTL  293

Query  923   --LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSS  1096
               L   +D+AAKG+F+LINDL T+SRL GRL DE+EH KT+A + A     +VLKE +  
Sbjct  294   ERLGTQIDIAAKGMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEAL--  351

Query  1097  KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             + F+  EE   + L+ELE+H+YLCF+ I RSRR+++ +I G
Sbjct  352   REFSAHEERFSDQLQELEEHLYLCFITINRSRRLVLAQITG  392



>ref|XP_010265539.1| PREDICTED: UPF0496 protein At1g20180-like [Nelumbo nucifera]
Length=426

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 128/367 (35%), Positives = 187/367 (51%), Gaps = 45/367 (12%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             R   SV+ EYM AFRT S+++I  KV+ QL +         D   PL             
Sbjct  83    RNKLSVNEEYMEAFRTKSFIDICSKVKDQLQS------TNQDRASPL-------------  123

Query  341   GHESLPSPGCKLLLCQENMEELPQQ-------ASNAHPLLNEYFLLTLEACAICESLLKI  499
                   SP        + + E PQ+        S  H LL +YF  + EAC ICE LL+ 
Sbjct  124   ------SPSRSYSRLSDFLLEPPQELVAEMIDNSELHFLLIDYFDGSFEACKICEFLLQR  177

Query  500   VLQTRADYKSVKKAVEKIEELGLS----SEEQVNRAYGEIASLSLFGNTLS---AVRFDD  658
             + QTR +Y  +++ +   E L       +++Q    + E+ S +   N LS    V+F  
Sbjct  178   INQTRINYCIIQRIISLTETLPADYSSYTDDQCRIKFRELDSFAKLDNPLSRSSPVQFRL  237

Query  659   VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTM  838
             + D +  LL RL SKR +I RR K + + + A   +L+I C A      +LAVH ++   
Sbjct  238   IHDRYRLLLKRLRSKRRKIVRREKLMGLSEKAARLSLVIACAALGFGAIVLAVHTLIGIA  297

Query  839   AVPGLIALSLGMVKKLKEAKRGIPSRK--GLYMPLDVAAKGLFVLINDLSTVSRLVGRLS  1012
             A+P   A  L  +KKLK    G+   K   L   LD AA+G+F+L  D+ T+SRLV RL+
Sbjct  298   AIPA--AGMLAFMKKLKCDWLGLKRSKLARLDAQLDAAARGIFILNGDMDTISRLVKRLN  355

Query  1013  DEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSR  1192
             DE+EH K IA + A      +L+ VV+  +F   E    E L+ELE+H+YL FL I R+R
Sbjct  356   DEIEHGKAIAKMCAQSRNRQILEVVVN--DFETHESCFREQLEELEEHVYLSFLTINRAR  413

Query  1193  RMIVQEI  1213
             R++++EI
Sbjct  414   RLVIEEI  420



>ref|XP_010064565.1| PREDICTED: UPF0496 protein At1g20180-like [Eucalyptus grandis]
Length=424

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 196/397 (49%), Gaps = 58/397 (15%)
 Frame = +2

Query  86    FSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARS  265
             +  +KSA +    +R   E    +  K SSV+ EY  AFRT SYVE+Y KVQ  +     
Sbjct  60    YGVVKSACVVGESQR---ERLNGMSSKPSSVNGEYTQAFRTKSYVEMYAKVQSHIG----  112

Query  266   KEIVGGDNTFPLTssssssssPLISGH------ESLPSPGCKLLLCQENMEELPQQASNA  427
             +  +G   + PL         P    H      E L  PG      QE +  + +   N 
Sbjct  113   RTSIG--RSLPL-------LPPSADAHSMAHLSEWLLEPG------QETLTNMIKTL-NF  156

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIE---ELGLSSEEQVNRAY  598
             H LL +YF ++  AC +CE LL+ + Q R +Y+ +++A +  +   E    ++EQ +   
Sbjct  157   HGLLVDYFQMSSYACDVCELLLRGIYQIRTNYQRIRRATKLAKLVFEDASHADEQSHLIC  216

Query  599   GEIASLSLFGNTLSA---VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
              E+++ +   N L A   V+F  + D+H+ L   LTSKR ++ RR K  R  K   G  L
Sbjct  217   RELSAFASLTNPLFAIAVVQFPGMHDNHMALFHELTSKRKQMRRRMKLARACKRVGGLGL  276

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRG------IPSRKGLYM  931
             ++       T  +LA              + S GM  +  ++ R         S + +  
Sbjct  277   VVSSAVISATALVLA--------------SCSTGMCNRKGKSIRSPSYPEKSSSTQAVCA  322

Query  932   PLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD--DVLKEVVSSKNF  1105
              LDV AKG+++L ND+ TVS   GRL D++EH ++ + +    +    ++++EVV ++ F
Sbjct  323   QLDVTAKGVYILANDMDTVSTFAGRLHDDVEHGRSRSRMVVRNYAKTGNMVREVV-NEFF  381

Query  1106  AIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                    L+ ++ELE+HIYLC L + RSRR++V+EI+
Sbjct  382   DAHNARFLQQVEELEKHIYLCLLTMNRSRRLVVEEIL  418



>gb|KCW67992.1| hypothetical protein EUGRSUZ_F01683 [Eucalyptus grandis]
Length=375

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/379 (31%), Positives = 188/379 (50%), Gaps = 55/379 (15%)
 Frame = +2

Query  140   ENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTsssss  319
             E    +  K SSV+ EY  AFRT SYVE+Y KVQ  +     +  +G   + PL      
Sbjct  26    ERLNGMSSKPSSVNGEYTQAFRTKSYVEMYAKVQSHIG----RTSIG--RSLPL------  73

Query  320   sssPLISGH------ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAIC  481
                P    H      E L  PG      QE +  + +   N H LL +YF ++  AC +C
Sbjct  74    -LPPSADAHSMAHLSEWLLEPG------QETLTNMIKTL-NFHGLLVDYFQMSSYACDVC  125

Query  482   ESLLKIVLQTRADYKSVKKAVEKIE---ELGLSSEEQVNRAYGEIASLSLFGNTLSA---  643
             E LL+ + Q R +Y+ +++A +  +   E    ++EQ +    E+++ +   N L A   
Sbjct  126   ELLLRGIYQIRTNYQRIRRATKLAKLVFEDASHADEQSHLICRELSAFASLTNPLFAIAV  185

Query  644   VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHF  823
             V+F  + D+H+ L   LTSKR ++ RR K  R  K   G  L++       T  +LA   
Sbjct  186   VQFPGMHDNHMALFHELTSKRKQMRRRMKLARACKRVGGLGLVVSSAVISATALVLA---  242

Query  824   VVCTMAVPGLIALSLGMVKKLKEAKRG------IPSRKGLYMPLDVAAKGLFVLINDLST  985
                        + S GM  +  ++ R         S + +   LDV AKG+++L ND+ T
Sbjct  243   -----------SCSTGMCNRKGKSIRSPSYPEKSSSTQAVCAQLDVTAKGVYILANDMDT  291

Query  986   VSRLVGRLSDEMEHNKTIADLWAMKHCD--DVLKEVVSSKNFAIQEEWALEVLKELEQHI  1159
             VS   GRL D++EH ++ + +    +    ++++EVV ++ F       L+ ++ELE+HI
Sbjct  292   VSTFAGRLHDDVEHGRSRSRMVVRNYAKTGNMVREVV-NEFFDAHNARFLQQVEELEKHI  350

Query  1160  YLCFLNIVRSRRMIVQEIV  1216
             YLC L + RSRR++V+EI+
Sbjct  351   YLCLLTMNRSRRLVVEEIL  369



>ref|XP_010061096.1| PREDICTED: UPF0496 protein At1g20180 [Eucalyptus grandis]
Length=373

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/362 (33%), Positives = 189/362 (52%), Gaps = 46/362 (13%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V+ EY  A RT SY ++  KVQ Q+     +  +   +  P T++       ++   ESL
Sbjct  37    VNQEYTQALRTKSYEDMCTKVQSQIRRTSIRRTLSSPS--PSTNAHY-----MVHLSESL  89

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               PG      QE + ++ + A N H LL  YF  + EAC +CE LL+ + QTR +Y+ ++
Sbjct  90    LEPG------QETLTKMIK-ALNFHRLLVGYFEASSEACDMCELLLRGIYQTRTNYQRIR  142

Query  536   KAVEKIEELGLS----SEEQVNRAYGEIASLSLFGNTLSA---VRFDDVRDDHLGLLSRL  694
             +A+ K+  L       +EEQ      E+++ +   N LSA   V+   + D+H+ L  +L
Sbjct  143   RAI-KLSRLVFEDPSHAEEQSRLICQELSAFASLTNPLSAIAQVQLPRMHDNHVALFRQL  201

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM  874
              SK  ++ RR K  R  K   G  L++  +    T  +L               +  +GM
Sbjct  202   MSKCRQMRRRMKLARACKGVRGLGLIVSSSLISTTSLVLT--------------SFRIGM  247

Query  875   VKKLKEAKRG--IP----SRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
               +  ++ R    P    S +G+   LDVAAKG+F+LIND+ T+SR VGRL DE+EH ++
Sbjct  248   CNRKVKSIRSSSCPEKSLSTEGVSAQLDVAAKGVFILINDMDTISRWVGRLYDEVEHGRS  307

Query  1037  IADLWAMKHCD--DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
              A +    +    ++++EV  +K F +     L  L+ELE+HIYLC L + RSRR++V+E
Sbjct  308   RAGMAVRNYMKKGEIVREV--AKEFDVHNACFLGQLEELEEHIYLCLLTMNRSRRLVVEE  365

Query  1211  IV  1216
             I+
Sbjct  366   IL  367



>ref|XP_010539833.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At1g20180-like 
[Tarenaya hassleriana]
Length=394

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 127/368 (35%), Positives = 190/368 (52%), Gaps = 34/368 (9%)
 Frame = +2

Query  170   SSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHE  349
             +S++ EY  AFRTNSY+EI  K +GQL       +    ++          +  L+    
Sbjct  34    ASLNEEYKEAFRTNSYLEIKTKAEGQLGRTLCDRLSSSPSSSSSLGFQVHFTDYLLEPR-  92

Query  350   SLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKS  529
                         QE +  L Q+    H L+ ++F  + EAC ICES+LK V QTRA+++ 
Sbjct  93    ------------QETVHALMQEL-RFHRLVVKFFDSSSEACYICESILKCVHQTRANHRK  139

Query  530   VKKAVE---KIEELGLSSEEQVNRAYG----EIASLSLFGNTLSAVRFDDVR---DDHLG  679
             +K+ ++   K+   G SS+    R +     E++  +   N L  V   + R   D +  
Sbjct  140   IKRVIKISKKVCGDGKSSDLSPERVFSLVLEELSRFTSLENPLCNVNEAEFRCFHDSNAE  199

Query  680   LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVH----FVVCTMAVP  847
             LL+RL SKR RI R+ K  R FK A G  L+I  +  ++   + A H      +  +   
Sbjct  200   LLARLMSKRRRIIRKVKFFRFFKKAGGYGLVISHSVTVVALLVFARHSXAAPALLALCSS  259

Query  848   GLIALSLGMVKKLKEAKRGIP----SRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             GL+       KK K   + +     S + L   LD+AAKG+F+L+ND  T+SRL GRLSD
Sbjct  260   GLLKNKNKKKKKKKMETKMMNKTDVSEEKLVTQLDIAAKGMFILMNDFDTLSRLAGRLSD  319

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E++H KT+A +       +VLKE V+   F   EE   E L+ELE+H+YLCF  I RSRR
Sbjct  320   EIDHRKTVAAMCVKSLKTEVLKEAVN--EFDAHEERFSEQLQELEEHVYLCFHTINRSRR  377

Query  1196  MIVQEIVG  1219
             M++++I G
Sbjct  378   MVLEQITG  385



>ref|XP_010064566.1| PREDICTED: UPF0496 protein At1g20180-like [Eucalyptus grandis]
Length=371

 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 117/367 (32%), Positives = 191/367 (52%), Gaps = 31/367 (8%)
 Frame = +2

Query  140   ENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTsssss  319
             E   S+  K SSV+ EY  AFRT SY E+Y KVQ  +    +     G +   L  S+ +
Sbjct  26    ERLNSMSSKPSSVNGEYTQAFRTKSYAEMYAKVQSHIGRTST-----GRSLSSLPPSTDA  80

Query  320   sssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKI  499
              S   +S  +SL  PG      QE +  + +   N H LL +YF ++ +AC +CE LL+ 
Sbjct  81    QSMGYLS--DSLLEPG------QETLANMIKTL-NFHGLLVDYFQVSSDACDVCELLLRG  131

Query  500   VLQTRADYKSVKKAVEKIE---ELGLSSEEQVNRAYGEIASLSLFGNTLSA---VRFDDV  661
             + Q R +Y+ +++A E  +   E    ++EQ      E+++ +   N L A   V+F  +
Sbjct  132   IYQIRTNYQRIRRATELAKLVFEDASHADEQSRLICQELSAFASLTNPLFAIAVVQFPGM  191

Query  662   RDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMA  841
              D+H+ L   LTSK  ++ RR K  R  K   G  L++       T  +LA     C+  
Sbjct  192   HDNHMVLFHELTSKCKQMRRRMKLARACKRVGGIGLMVSSAVISATALVLAS----CSAG  247

Query  842   VPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEM  1021
             +      S+G     +++     S + +   LDV AKG+++L ND+ +VS L GRL +E+
Sbjct  248   MCIGKGKSIGSTSYPEKSS----STQAVCAQLDVTAKGVYILTNDMDSVSTLAGRLHNEV  303

Query  1022  EHNKTIADLWAMKHC--DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             EH ++ A +    +    ++++EVV ++ F       LE ++ELE+HIYLC L + RSR 
Sbjct  304   EHGRSRARMVVRNYAKTGNMVREVV-NEFFDAHNARFLERVEELEKHIYLCLLTVNRSRG  362

Query  1196  MIVQEIV  1216
             ++V+EI+
Sbjct  363   LVVEEIL  369



>gb|KCW67991.1| hypothetical protein EUGRSUZ_F01681, partial [Eucalyptus grandis]
Length=330

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 118/361 (33%), Positives = 186/361 (52%), Gaps = 46/361 (13%)
 Frame = +2

Query  155   LGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPL  334
             +  KSSSV+ EY  A RT SY ++  KVQ Q+     +  +   +  P T++       +
Sbjct  1     MSSKSSSVNQEYTQALRTKSYEDMCTKVQSQIRRTSIRRTLSSPS--PSTNAHY-----M  53

Query  335   ISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTR  514
             +   ESL  PG      QE + ++ + A N H LL  YF  + EAC +CE LL+ + QTR
Sbjct  54    VHLSESLLEPG------QETLTKMIK-ALNFHRLLVGYFEASSEACDMCELLLRGIYQTR  106

Query  515   ADYKSVKKAVEKIEELGLS----SEEQVNRAYGEIASLSLFGNTLSA---VRFDDVRDDH  673
              +Y+ +++A+ K+  L       +EEQ      E+++ +   N LSA   V+   + D+H
Sbjct  107   TNYQRIRRAI-KLSRLVFEDPSHAEEQSRLICQELSAFASLTNPLSAIAQVQLPRMHDNH  165

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
             + L  +L SK  ++ RR K  R  K   G  L++  +    T  +L              
Sbjct  166   VALFRQLMSKCRQMRRRMKLARACKGVRGLGLIVSSSLISTTSLVLT-------------  212

Query  854   IALSLGMVKKLKEAKRG--IP----SRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
              +  +GM  +  ++ R    P    S +G+   LDVAAKG+F+LIND+ T+SR VGRL D
Sbjct  213   -SFRIGMCNRKVKSIRSSSCPEKSLSTEGVSAQLDVAAKGVFILINDMDTISRWVGRLYD  271

Query  1016  EMEHNKTIADLWAMKHCD--DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRS  1189
             E+EH ++ A +    +    ++++EV  +K F +     L  L+ELE+HIYLC L + RS
Sbjct  272   EVEHGRSRAGMAVRNYMKKGEIVREV--AKEFDVHNACFLGQLEELEEHIYLCLLTMNRS  329

Query  1190  R  1192
             R
Sbjct  330   R  330



>gb|KCW67993.1| hypothetical protein EUGRSUZ_F01684 [Eucalyptus grandis]
Length=341

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 115/362 (32%), Positives = 189/362 (52%), Gaps = 31/362 (9%)
 Frame = +2

Query  155   LGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPL  334
             +  K SSV+ EY  AFRT SY E+Y KVQ  +    +     G +   L  S+ + S   
Sbjct  1     MSSKPSSVNGEYTQAFRTKSYAEMYAKVQSHIGRTST-----GRSLSSLPPSTDAQSMGY  55

Query  335   ISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTR  514
             +S  +SL  PG      QE +  + +   N H LL +YF ++ +AC +CE LL+ + Q R
Sbjct  56    LS--DSLLEPG------QETLANMIKTL-NFHGLLVDYFQVSSDACDVCELLLRGIYQIR  106

Query  515   ADYKSVKKAVEKIE---ELGLSSEEQVNRAYGEIASLSLFGNTLSA---VRFDDVRDDHL  676
              +Y+ +++A E  +   E    ++EQ      E+++ +   N L A   V+F  + D+H+
Sbjct  107   TNYQRIRRATELAKLVFEDASHADEQSRLICQELSAFASLTNPLFAIAVVQFPGMHDNHM  166

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              L   LTSK  ++ RR K  R  K   G  L++       T  +LA     C+  +    
Sbjct  167   VLFHELTSKCKQMRRRMKLARACKRVGGIGLMVSSAVISATALVLAS----CSAGMCIGK  222

Query  857   ALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
               S+G     +++     S + +   LDV AKG+++L ND+ +VS L GRL +E+EH ++
Sbjct  223   GKSIGSTSYPEKSS----STQAVCAQLDVTAKGVYILTNDMDSVSTLAGRLHNEVEHGRS  278

Query  1037  IADLWAMKHC--DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
              A +    +    ++++EVV ++ F       LE ++ELE+HIYLC L + RSR ++V+E
Sbjct  279   RARMVVRNYAKTGNMVREVV-NEFFDAHNARFLERVEELEKHIYLCLLTVNRSRGLVVEE  337

Query  1211  IV  1216
             I+
Sbjct  338   IL  339



>ref|XP_002890374.1| hypothetical protein ARALYDRAFT_472247 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66633.1| hypothetical protein ARALYDRAFT_472247 [Arabidopsis lyrata subsp. 
lyrata]
Length=389

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 130/386 (34%), Positives = 204/386 (53%), Gaps = 36/386 (9%)
 Frame = +2

Query  125   RRNSNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPL  301
             R+  +E E      S  SV+ EY  AFRTNSY+EI  K + QL        +    +   
Sbjct  18    RKGKSEKECCRSLTSKLSVNEEYKEAFRTNSYLEIRTKAEDQLG-------ITTSCSKLS  70

Query  302   TssssssssPLISGH--ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
             +SS SSSS      H  + L  P       QE ++ L Q +   + L+N +F  + EAC 
Sbjct  71    SSSPSSSSDLSFHSHFTDYLLDPP------QETLDALMQDSIIDNLLVN-FFDFSSEACD  123

Query  476   ICESLLKIVLQTRADYKSVKKAV-------EKIEELGLSSEEQVNRAYGEIASLSLFGNT  634
             +CE+LL+ + Q + ++  +K+ +          + L    E+     + E++  +   N 
Sbjct  124   VCETLLQCIQQIKINHNKIKRVITIGKRVCNGAKTLECGPEKLCALIFQELSRFAALKNP  183

Query  635   LSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITF  802
             L  +    +F  V D +  LL++LTSKR RI R+ +  R  K   G +L+I  +A +IT 
Sbjct  184   LCCIINEAQFRVVHDANSDLLTKLTSKRRRIRRKIRFFRFCKKLGGYSLVITHSAIVITL  243

Query  803   TILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG------LYMPLDVAAKGLFV  964
              I+A+H ++  +A P L+ L    + + K+AK  +   K       L   +D+AAKG+F+
Sbjct  244   LIIALHSIIGVLAAPALLGLCSLGLLRKKKAKGRMHKSKTDTTLEKLGTQIDIAAKGMFI  303

Query  965   LINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKE  1144
             L+ DL T+SRL GRL DE+EH KT+A + A     +VLKE +  + F   EE   + L+E
Sbjct  304   LMKDLDTLSRLSGRLCDEIEHRKTVAAMCAKSRKIEVLKEAL--REFNGHEEKFSDQLQE  361

Query  1145  LEQHIYLCFLNIVRSRRMIVQEIVGR  1222
             LE+H+YLCF  I RSRR+++ +I G+
Sbjct  362   LEEHLYLCFHTINRSRRLVLAQITGQ  387



>ref|XP_006305029.1| hypothetical protein CARUB_v10009395mg [Capsella rubella]
 gb|EOA37927.1| hypothetical protein CARUB_v10009395mg [Capsella rubella]
Length=390

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 130/368 (35%), Positives = 202/368 (55%), Gaps = 35/368 (10%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH--  346
             SV+ EY  AFRTNSY+EI  K + QL        +    +   +SSS SSS      H  
Sbjct  36    SVNEEYKEAFRTNSYLEIRTKAEDQLG-------ITSSCSKLSSSSSPSSSDLSFHSHFT  88

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             + L  P       Q+ ++ L Q  S  H LL ++F  + EAC +CESLL+ + Q + ++ 
Sbjct  89    DYLLDPP------QDTLDALMQD-STLHNLLVKFFDFSSEACDVCESLLQSIQQIKINHN  141

Query  527   SVKKAV-------EKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV----RFDDVRDDH  673
              +K+ +          +    S E+     + E++  +L  N L  +    RF  V D +
Sbjct  142   KIKRVITIGKRVCNGAKTTEYSHEKLCALIFQELSRFALLKNPLCCIINEARFGIVHDAN  201

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               LL++LTSKR +I R+ + L   K   G +L+I  +A +IT  I+A+H ++  +A P L
Sbjct  202   SDLLAKLTSKRRKIRRKVRFLSFCKKLGGYSLVISHSAIVITLLIIALHSILGALAAPAL  261

Query  854   IALSLGMVKKLKEAKRGI------PSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             + L    + + K+AK+ +       + + L   +D+AAKG+F+LINDL T+SRL GRL D
Sbjct  262   LGLCSLGLLRKKKAKKSMHKSKRDTTLEKLGTQIDIAAKGMFILINDLDTLSRLAGRLCD  321

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+EH KT+A + A     +VLKE +  + F   EE   + L+ELE+H+YLCF  I RSRR
Sbjct  322   EIEHRKTVASMCAKSGKIEVLKEAL--REFNAHEERFSDQLQELEEHLYLCFHTINRSRR  379

Query  1196  MIVQEIVG  1219
             +++ +I+G
Sbjct  380   LVLAQIMG  387



>ref|NP_001077567.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE29948.1| uncharacterized protein AT1G20180 [Arabidopsis thaliana]
Length=359

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 180/369 (49%), Gaps = 65/369 (18%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH--  346
             SV+ EY  AFRTNSY+E   K + QL       I         + S SSSS      H  
Sbjct  35    SVNEEYKEAFRTNSYLETRTKAEDQLG------ITSCSKLSSSSPSPSSSSDLSFHSHFT  88

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             + L  P       QE ++ L Q +S    L+  +F L+ EAC +CE+LL+ + Q + ++ 
Sbjct  89    DYLLDPP------QETLDALMQDSS-LDNLIVTFFDLSSEACDVCETLLQCLQQIKINHN  141

Query  527   SVKKAVE-------KIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV----RFDDVRDDH  673
              +K+ ++         + L  S E      + E++  +   N L  +    +F  V D +
Sbjct  142   KIKRVMKIGKRVCNGAKTLECSPEMLCALIFQELSRFAALKNPLCRIVNEAQFRIVHDAN  201

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               LL++LTSK+ RI R+   L VF                               A P L
Sbjct  202   SDLLTKLTSKKRRIRRKISILGVF-------------------------------AAPAL  230

Query  854   IAL-SLGMVKKLKEAKRGIPSRKG-----LYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             + L S  +++K K   R   S K      L   +D+AAKG+F+LINDL T+SRL GRL D
Sbjct  231   LGLCSFCLLRKKKAKGRMHKSNKDTTLEKLGTQIDIAAKGMFILINDLDTLSRLAGRLCD  290

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+EH KT+A + A     +VLKE +  + F   EE   + L+ELE+H+YLCF  I RSRR
Sbjct  291   EIEHRKTVAAMCAKSRKIEVLKEAL--REFNGHEEKFSDQLQELEEHLYLCFHTINRSRR  348

Query  1196  MIVQEIVGR  1222
             +++ +I G+
Sbjct  349   LVLAQITGQ  357



>gb|AAX23752.1| hypothetical protein At1g20180 [Arabidopsis thaliana]
Length=359

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 180/369 (49%), Gaps = 65/369 (18%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH--  346
             SV+ EY  AFRTNSY+E   K + QL       I         + S SSSS      H  
Sbjct  35    SVNEEYKEAFRTNSYLETRTKAEDQLG------ITSCSKLSSSSPSPSSSSDLSFHSHFT  88

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             + L  P       QE ++ L Q +S    L+  +F L+ EAC +CE+LL+ + Q + ++ 
Sbjct  89    DYLLDPP------QETLDALMQDSS-LDNLIVTFFDLSSEACDVCETLLQCLQQIKINHN  141

Query  527   SVKKAVE-------KIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV----RFDDVRDDH  673
              +K+ ++         + L  S E      + E++  +   N L  +    +F  V D +
Sbjct  142   KIKRVMKIGKRVCNGAKTLECSPEMLCALIFQELSRFAALKNPLCRIVNEAQFRIVHDAN  201

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               LL++LTSK+ RI R+   L VF                               A P L
Sbjct  202   SDLLTKLTSKKRRIRRKISILGVF-------------------------------AAPAL  230

Query  854   IAL-SLGMVKKLKEAKRGIPSRKG-----LYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             + L S  +++K K   R   S K      L   +D+AAKG+F+LINDL T+SRL GRL D
Sbjct  231   LGLCSFCLLRKKKAKGRMHKSNKDTTLEKLGTQIDIAAKGMFILINDLDTLSRLAGRLCD  290

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+EH KT+A + A     +VLKE +  + F   EE   + L+ELE+H+YLCF  I RSRR
Sbjct  291   EIEHRKTVAAMCAKSRKIEVLKEAL--REFNGHEEKFSDQLQELEEHLYLCFHTINRSRR  348

Query  1196  MIVQEIVGR  1222
             +++ +I G+
Sbjct  349   LVLAQITGQ  357



>ref|XP_008381824.1| PREDICTED: UPF0496 protein At1g20180-like [Malus domestica]
Length=365

 Score =   142 bits (357),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 107/362 (30%), Positives = 178/362 (49%), Gaps = 34/362 (9%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             RKS +++ EY++AFRT SY + ++K Q  L    S   +  ++   LT         L  
Sbjct  22    RKSFNLNEEYLSAFRTKSYADFFNKAQ-LLVNEXSSSPLNYNHDHKLTEVL------LEP  74

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
             G E++P      +L +E     P+       L+  YF ++ EA  IC  LLK +   ++ 
Sbjct  75    GQEAIPDILDSAILSKE-----PKLKG----LMLNYFDISAEASKICSHLLKSINHVQSS  125

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGN-----TLSAVRFDDVRDDHLGLL  685
             Y  V++ ++K EE    S +++     E+  L L  N       +   F+ + + +  +L
Sbjct  126   YHFVQQELDKFEEY---SPDKIKSIISELNLLILQNNINPFSNPNNHDFELIHEKYSSVL  182

Query  686   SRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALS  865
               L S R ++ R+ KR++ FK A G  +   C+   IT  +LA H +   +  P LI+  
Sbjct  183   HHLKSMRKKVSRKIKRIKCFKKATGICITAACSLIAITAIVLAAHTLTALLMGPALISFP  242

Query  866   LGMVKKLKEAKRGIPSRKGLYMP-----LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
                 K  K+  R IP  +   +      LDVAAKG+++L  D  T+SRLV RL DE+EHN
Sbjct  243   F---KSFKKKPRSIPFLRSRILTKVGEQLDVAAKGIYILNRDFDTMSRLVARLHDEVEHN  299

Query  1031  KTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
             K +      +  D    +VV  K     +    + ++EL++H+YLC + I R+R ++V+E
Sbjct  300   KAMIRFCLERREDKFSLQVV--KELKKTDVGFRKQVEELQEHVYLCLVTINRARALVVKE  357

Query  1211  IV  1216
             + 
Sbjct  358   MT  359



>ref|XP_006353951.1| PREDICTED: UPF0496 protein At3g49070-like [Solanum tuberosum]
Length=349

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 180/356 (51%), Gaps = 34/356 (10%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPS-  361
             EY  AFRT SY + + +V      A S++I         TS++   S  L   H   P  
Sbjct  6     EYAHAFRTESYADFWTRV-----LALSEKISSPTKIVGSTSAARLPSYRLFVEHLLDPDQ  60

Query  362   PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKA  541
             P    +L       L Q   + H LL+EYF  T E   +C  LLK V +TR+ YKS+K A
Sbjct  61    PTVTRILG------LIQTHQDTHSLLSEYFSQTAETSLLCSLLLKDVQRTRSRYKSLKSA  114

Query  542   VEKIEELGLSSEEQVNRAYGEIASL-----SLFGNTLSAVRFDDVRDDHLGLLSRLTSKR  706
             ++ +++   S ++ + +    +         L  +T S +RF  V+ +   LL R+  KR
Sbjct  115   LDSLQKTPYSPKKHMPKILTRLTKFCNSLNPLVSSTSSPLRFKTVQANCSQLLKRIELKR  174

Query  707   GRIERRTKRLRVFKVALGSTLLIGCTAFMITFT-ILAVHFVVCTMAVPGLIALSLGMVKK  883
              + + + + +  FK   GS + +   A  I+ T I+A H +   +A P ++  S  ++  
Sbjct  175   DKTKAKLRLINKFKR--GSAIFV--MALTISLTVIVATHALALLVAAPTVMMASFQLMST  230

Query  884   LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKH  1063
              K A             LDVAAKG ++LI DL T+SRLVGRL+DE+E  + I   W  + 
Sbjct  231   KKLASWS--------AQLDVAAKGTYILIRDLDTISRLVGRLNDELEDLQAIVRFWLERG  282

Query  1064  CDDVLKEVVSSKNFA--IQEEWA--LEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
              D +  EV +S   A  +++ +A  +E L ELE+H+YLCF+ I R+R +++ EI+ 
Sbjct  283   GDPLQLEVQASGEVARQLKKNYANFVEQLDELEEHLYLCFMTINRARNLVITEIMN  338



>ref|XP_009758515.1| PREDICTED: UPF0496 protein At1g20180-like isoform X2 [Nicotiana 
sylvestris]
Length=374

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/369 (30%), Positives = 180/369 (49%), Gaps = 49/369 (13%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
              R+S +V+ EY+ A RT SYV+ +  ++ QL    ++       TF              
Sbjct  19    ARRSLNVNEEYLGALRTKSYVDFF--LKAQLLVNNNQPSSPSQYTFS-------------  63

Query  338   SGHESLPSPGCKLLLCQENMEELPQQAS------NAHPLLNEYFLLTLEACAICESLLKI  499
                E L  PG      QE +  + +  +      N   LL+ YF ++ +A   C  LLK 
Sbjct  64    ---EILLEPG------QETITSILESTNIFPGKYNLKSLLSNYFNISAQASKFCSHLLKS  114

Query  500   VLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR---FDDVRDD  670
             + Q ++DY  V++  E I++   S+++       E+ S  +  N  S ++   F  + D+
Sbjct  115   INQVQSDYTFVEQVFESIDDCSSSTDQHFGYLVLELRSFIIHNNPFSDLKKQDFTRINDE  174

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
             +  +L  L SKR ++ R+ K ++    A G  +   C    +   +LA H V   +  P 
Sbjct  175   YSSILQHLKSKRKKVARKIKLIKGVNKASGVCVTAACGLVAVAAMVLAAHTVAAIIMGPA  234

Query  851   LIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             +++L L  +KK    L+  K G   + G    LDVAAKG ++L  D  T+SRLV RL DE
Sbjct  235   ILSLPLNPIKKKITNLRFLKCGFLRKIG--AQLDVAAKGTYILNRDFDTMSRLVDRLHDE  292

Query  1019  MEHNKTIADLWAMKHCD----DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVR  1186
             +EHNK +  L   +  D     VLKE+  S N   +++     ++ELE+H+YLC L I R
Sbjct  293   IEHNKAMIQLCLDRREDSISLQVLKELKKS-NVGFRKQ-----VEELEEHVYLCLLTINR  346

Query  1187  SRRMIVQEI  1213
             +R ++++EI
Sbjct  347   ARALVIKEI  355



>ref|XP_009612127.1| PREDICTED: UPF0496 protein At3g49070-like [Nicotiana tomentosiformis]
Length=379

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 119/361 (33%), Positives = 188/361 (52%), Gaps = 44/361 (12%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQ--GQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLP  358
             EY  AFRT SY + + +V   G+  ++ +K IVG       TS++   S  L   H   P
Sbjct  33    EYAHAFRTESYADFWTRVLALGEKISSPTK-IVGS------TSAARLLSYRLFVEHLLDP  85

Query  359   S-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P    +L      +L Q     H LL+EYF  T EA  +C  LLK V  TR+ YKS+K
Sbjct  86    DQPTVTRIL------DLIQTHPQTHSLLSEYFSQTAEASLLCSVLLKNVEITRSKYKSLK  139

Query  536   KAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL--------SAVRFDDVRDDHLGLLSR  691
               ++ +++   S+   V+R    ++ L+ F N+L        S +RF  V+ D   LL R
Sbjct  140   FTLDALQKTPYSN---VDRMPKIVSRLTKFCNSLNPFVSSASSPLRFQVVQTDCSHLLKR  196

Query  692   LTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTIL-AVHFVVCTMAVPGLIALSL  868
             L  +R + + R + +   K+  GS + +   A  ++ TI+ A H +   +A P ++A S 
Sbjct  197   LELRRDKTKVRLRLMN--KLKHGSAVFL--VALTVSLTIIVATHALALLVATPIVMAASF  252

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
              +    K A+            LD+AAKG ++LI DL T+SRLVGRL+DE+E  + I   
Sbjct  253   QLASTKKLARWS--------AQLDIAAKGTYILIRDLDTISRLVGRLTDELEDLQAIVRF  304

Query  1049  WAMKHCDDVLKEVVSSKNFA--IQEEWA--LEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             W  +  D V  ++ +S   A  +++ +A  +E L ELE+H+YLCF+ I R+R +++ EI+
Sbjct  305   WLERGGDPVQLQLQASGEVARQLKKNYASFVEQLDELEEHLYLCFMTINRARNLVITEIM  364

Query  1217  G  1219
              
Sbjct  365   N  365



>ref|XP_009758514.1| PREDICTED: UPF0496 protein At1g20180-like isoform X1 [Nicotiana 
sylvestris]
Length=376

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/363 (30%), Positives = 177/363 (49%), Gaps = 37/363 (10%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
              R+S +V+ EY+ A RT SYV+ +  ++ QL    ++       TF              
Sbjct  21    ARRSLNVNEEYLGALRTKSYVDFF--LKAQLLVNNNQPSSPSQYTFS-------------  65

Query  338   SGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
                E L  PG + +        +     N   LL+ YF ++ +A   C  LLK + Q ++
Sbjct  66    ---EILLEPGQETITSILESTNIFPGKYNLKSLLSNYFNISAQASKFCSHLLKSINQVQS  122

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR---FDDVRDDHLGLLS  688
             DY  V++  E I++   S+++       E+ S  +  N  S ++   F  + D++  +L 
Sbjct  123   DYTFVEQVFESIDDCSSSTDQHFGYLVLELRSFIIHNNPFSDLKKQDFTRINDEYSSILQ  182

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L SKR ++ R+ K ++    A G  +   C    +   +LA H V   +  P +++L L
Sbjct  183   HLKSKRKKVARKIKLIKGVNKASGVCVTAACGLVAVAAMVLAAHTVAAIIMGPAILSLPL  242

Query  869   GMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
               +KK    L+  K G   + G    LDVAAKG ++L  D  T+SRLV RL DE+EHNK 
Sbjct  243   NPIKKKITNLRFLKCGFLRKIG--AQLDVAAKGTYILNRDFDTMSRLVDRLHDEIEHNKA  300

Query  1037  IADLWAMKHCD----DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
             +  L   +  D     VLKE+  S N   +++     ++ELE+H+YLC L I R+R +++
Sbjct  301   MIQLCLDRREDSISLQVLKELKKS-NVGFRKQ-----VEELEEHVYLCLLTINRARALVI  354

Query  1205  QEI  1213
             +EI
Sbjct  355   KEI  357



>ref|XP_010668392.1| PREDICTED: UPF0496 protein At1g20180 [Beta vulgaris subsp. vulgaris]
Length=416

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 139/396 (35%), Positives = 206/396 (52%), Gaps = 42/396 (11%)
 Frame = +2

Query  128   RNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTs  307
             R   E EGSL RK + V+ EY   FRT SY+EI+ KVQ  L     +      ++   +S
Sbjct  27    RKDTEKEGSLCRKLN-VNEEYKEVFRTKSYMEIWSKVQA-LDDNNQQCFSRSSSSSSSSS  84

Query  308   sssssssPLISGHESLPSPGCKLLLCQENMEELPQQ--------ASNAHPLLNEYFLLTL  463
               S SSS     + S P P     L    +E  P+Q        +SN   LLN+YF  +L
Sbjct  85    YVSYSSSSSYKYNSSSPVPFYMHHLSDFLLE--PRQEAVIDIIKSSNLQTLLNDYFDASL  142

Query  464   EACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAY------------GEI  607
             EAC ICE LL+ + +TR++++ ++K +   E      E +    Y             E+
Sbjct  143   EACNICELLLRGIHKTRSNHRLLEKVINLSEGGMEDGEGEGEGDYFSRFTCHKIILLQEL  202

Query  608   ASLSLFGNTLS-----AVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
             AS +   N LS      V F  + D +  LL +LT+++ RI+R+ K  R +K A G   +
Sbjct  203   ASFASLNNPLSNIINGTVDFRKIHDKYSHLLRKLTNRKRRIKRKEKFTRFYKKAAGYGFV  262

Query  773   IGCTAFMITFTILAVHFVV-CTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMP-----  934
             I  +   I    LA+H +V    A   L+ LS+G++KK+K    G  S K  ++      
Sbjct  263   ITYSVLAIALLALAMHSMVGILGAPGLLLPLSMGVMKKVK----GGGSLKANFLKHLGSQ  318

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK-HCDDVLKEVVSSKNFAI  1111
             LDVAAKG+++ IND  TV RLV RL DE+EH + IA +         V++E +  ++  +
Sbjct  319   LDVAAKGMYIFINDFDTVGRLVTRLHDEVEHKREIAAMCVRNGKSHQVIREAL--RDIQM  376

Query  1112  QEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
              ++  +E L+ELEQHIYLCFL I RSRR++ +EI+ 
Sbjct  377   HQQGFVEQLEELEQHIYLCFLTINRSRRLVTEEILA  412



>ref|XP_004234461.2| PREDICTED: UPF0496 protein At3g49070-like [Solanum lycopersicum]
Length=376

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 110/355 (31%), Positives = 179/355 (50%), Gaps = 32/355 (9%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPS-  361
             EY  AFRT SY + + +V      A S++I         TS++   S  L   H   P  
Sbjct  33    EYAHAFRTESYTDFWTRV-----LALSEKISSPTKIVGSTSAARLPSYRLFVEHLLDPDQ  87

Query  362   PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKA  541
             P    +L       L +   + H LL++YF  T EA  +C  LLK V +TR+ YKS+K A
Sbjct  88    PTVTRIL------NLIRTHQDNHSLLSQYFTQTAEASLLCSLLLKDVQRTRSRYKSLKSA  141

Query  542   VEKIEELGLSSEEQVNRAYGEIASL-----SLFGNTLSAVRFDDVRDDHLGLLSRLTSKR  706
             ++ +++   S ++ + +    +         L  +T S +RF  V+ +   LL R+  KR
Sbjct  142   LDSLQKTPYSPKKHMPKILTRLTKFCNSLNPLVSSTSSPLRFKTVQANCSQLLKRIELKR  201

Query  707   GRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKL  886
              + + + + +  FK   GS + +      +T  I+A H +   +A P ++  S  ++   
Sbjct  202   DKTKAKLRIINKFKR--GSAVFVMALTVSLT-VIVATHALALLVAAPTVMMASFQLMSTK  258

Query  887   KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHC  1066
             K A             LDVAAKG ++LI DL T+SRLVGRL+DE+E  + I   W  +  
Sbjct  259   KLA--------SWSAQLDVAAKGTYILIRDLDTISRLVGRLNDELEDLQAIVRFWLERGG  310

Query  1067  DDVLKEVVSSKNFA--IQEEWA--LEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             D +  E+ +S   A  +++ +A  +E L ELE+H+YLCF+ I R+R +++ EI+ 
Sbjct  311   DPLQLELQASGEVARQLKKNYANFVEQLDELEEHLYLCFMTINRARNLVIAEIMN  365



>ref|XP_002302174.2| hypothetical protein POPTR_0002s06790g [Populus trichocarpa]
 gb|EEE81447.2| hypothetical protein POPTR_0002s06790g [Populus trichocarpa]
Length=362

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 184/381 (48%), Gaps = 48/381 (13%)
 Frame = +2

Query  125   RRNSNENEG---SLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             R + N  +G   S   KS +V+ EY++A RT S+ + + K Q          +V G  +F
Sbjct  7     RASKNRKDGKEFSDACKSLNVNEEYLSALRTQSFADFFTKAQS---------LVNGP-SF  56

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
             P       S   L  G ES+P     ++L    + ++P+       L+  YF ++ EA  
Sbjct  57    PTHCHRKFSEILLEPGQESIP-----VILESALLSKVPELKG----LMLNYFDVSAEASN  107

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFD  655
             IC  LLK + Q ++ Y  +++ +  I++    S E+V     E+ S  +  N  S     
Sbjct  108   ICSHLLKNINQIQSSYVFIQRVLNSIDD---CSPEKVKLIVSELNSFIIQSNPFSTPNKH  164

Query  656   D---VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFV  826
             D   + D +L +L+RL SKR ++ R+ K +     A G  +   C+   IT  +LA H +
Sbjct  165   DFKLINDRYLLVLNRLKSKRNKVARKMKLIACIHKATGICIAAACSLIAITTIVLAAHTL  224

Query  827   VCTMAVPGLIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSR  994
                +  P + +L +   KK     K  + G   + G    LDVAAKG ++L  D  T+S 
Sbjct  225   TALVMGPAIFSLPIKHFKKQLTSFKFLRSGFLRKVG--QQLDVAAKGTYILNRDFDTISS  282

Query  995   LVGRLSDEMEHNKTIADLWAMKHCDD-----VLKEVVSSK-NFAIQEEWALEVLKELEQH  1156
             LV RL DE+EH+K +   + ++  +D     V+KE+  S   F  Q E       ELE+H
Sbjct  283   LVSRLHDEVEHDKAMIQ-FCLERIEDKFSLQVIKELKKSDIGFRKQVE-------ELEEH  334

Query  1157  IYLCFLNIVRSRRMIVQEIVG  1219
             +YLC L I R+R ++++EI  
Sbjct  335   LYLCLLTINRARALVIEEITA  355



>ref|XP_010536427.1| PREDICTED: UPF0496 protein At1g20180-like [Tarenaya hassleriana]
Length=326

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 104/292 (36%), Positives = 156/292 (53%), Gaps = 33/292 (11%)
 Frame = +2

Query  386   QENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKI----  553
             QE +  L Q+ S  H +L ++F  + EA  IC+S+LK + Q R +++ +++ ++      
Sbjct  45    QETIHSLMQE-SCFHSMLVKFFDSSSEASCICQSILKWLHQIRVNHRKIERVIKICRKAC  103

Query  554   --EELGLSSEEQVNRAYGEIASLSLFGNTLSAVR----FDDVRDDHLGLLSRLTSKRGRI  715
               E      E+     + E++ ++   N L  +     F  +RD ++   SRL SKR RI
Sbjct  104   HGESTDRFPEKICTVVFRELSRIASLENPLCVINSEAGFRCLRDSNVDFFSRLMSKRRRI  163

Query  716   ERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIAL-SLGMVKKLKE  892
              R  K  R  K   G  L+I  +                 +AVP L+ L SLGM++K K+
Sbjct  164   RRNVKFFRFCKKYGGYGLVISNS----------------ILAVPPLLGLCSLGMLRKKKK  207

Query  893   AKRGIPSR---KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKH  1063
              KR +      + L   LD+AAKG+F+LIND  T+SRLVGRL DE+EH KT+A +     
Sbjct  208   IKRKMNKTDVLEKLGTQLDIAAKGMFILINDFDTLSRLVGRLYDEIEHRKTVAAMCVKSQ  267

Query  1064  CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
               +VL E V  K F   E+   E LKELE+H+YLC   I RSRR+++++I G
Sbjct  268   KPEVLMEAV--KEFDSHEQRFSEQLKELEEHVYLCSHTINRSRRLVLEQITG  317



>ref|XP_010935393.1| PREDICTED: putative UPF0496 protein 2 [Elaeis guineensis]
Length=386

 Score =   136 bits (342),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 144/269 (54%), Gaps = 12/269 (4%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIAS  613
             LL +YF  T +ACA C +LL  + + R+ ++S+++ + K+    L +       + E+ S
Sbjct  111   LLLDYFDTTSDACAACTTLLASIDRARSHHRSIRRLLLKLARARLDTNCTT---FAELKS  167

Query  614   LSLFGNTLSA---VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCT  784
                  N LS+     F DV   +  L+ RLT    RI RR K +RV K A G  L+  C 
Sbjct  168   HIELDNPLSSETLAHFHDVHAGYGPLVDRLTKANRRIARRAKLIRVAKKASGVILIGACV  227

Query  785   AFMITFTILAVHFVVCT----MAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAK  952
             A M+   ++AVH VV T    +A P ++A      ++++    G    K +   +D AAK
Sbjct  228   AAMVAALVIAVHTVVGTGLAAVAAPTMVAGPGAAARRIRGRMGGESYLKRVGAQVDAAAK  287

Query  953   GLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALE  1132
             G +++  DL TVSR+V R  DE+EH + +A L        +++E  +++     EE   E
Sbjct  288   GAYIVGRDLDTVSRMVRRAHDEVEHGRDVARLVLRNRERQLVRE--AAREVEGGEEELAE  345

Query  1133  VLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
              L ELE+H+YLC + I RSRRM+ QE++G
Sbjct  346   QLDELEEHVYLCLITINRSRRMVAQEMMG  374



>ref|XP_009587167.1| PREDICTED: UPF0496 protein At1g20180-like [Nicotiana tomentosiformis]
Length=377

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 183/363 (50%), Gaps = 37/363 (10%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
              R+S +V+ EY+ A RT SY + + K Q          ++  +N     S  + S   L 
Sbjct  22    ARRSLNVNEEYLGALRTKSYGDFFLKAQ----------LLVNNNLLSSPSQYTFSEILLD  71

Query  338   SGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
              G E++ S     +L   N+   P +  N   LL+ YF ++ +A   C  LLK + Q ++
Sbjct  72    PGQETITS-----ILESTNI--FPGKY-NLKSLLSNYFNISAQASKFCSHLLKSINQVQS  123

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR---FDDVRDDHLGLLS  688
             DY  V++ +E I++   S+++       E+ S  +  N  S ++   F  + D++  +L 
Sbjct  124   DYTFVEQVLESIDDCSNSTDQHFGYLVLELRSFVIHSNPFSDLKKQDFTRINDEYSSILQ  183

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L SKR ++ R+ K ++    A G  +   C    +   +LA H +   +  P +++L +
Sbjct  184   HLKSKRKKVARKIKLIKGVNKASGVCVTAACGLVAVAAMVLAAHTLAAIIMGPAILSLPI  243

Query  869   GMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
               +KK    L+  K G   + G    LDVAAKG ++L  D  T+SRLV RL DE+EHNK 
Sbjct  244   SPIKKKLTNLRFLKCGFLRKIG--AQLDVAAKGTYILNRDFDTMSRLVDRLHDEIEHNKA  301

Query  1037  IADLWAMKHCD----DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
             +  L   +  D     VLKE+  S N   +++     ++ELE+H+YLC L I R+R +++
Sbjct  302   MIQLCLDRREDSISLQVLKELKKS-NVGFRKQ-----VEELEEHVYLCLLTINRARALVI  355

Query  1205  QEI  1213
             +EI
Sbjct  356   KEI  358



>ref|XP_011042862.1| PREDICTED: UPF0496 protein At1g20180-like [Populus euphratica]
Length=362

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 113/381 (30%), Positives = 182/381 (48%), Gaps = 48/381 (13%)
 Frame = +2

Query  125   RRNSNENEG---SLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             R + N  +G   S   KS +V+ EY++A RT S+ + + K Q          +V G  +F
Sbjct  7     RASKNRKDGKEFSDACKSLNVNEEYLSALRTQSFADFFTKAQS---------LVNGP-SF  56

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
             P       S   L  G ES+P     ++L    +  +P+       L+  YF ++ EA  
Sbjct  57    PTQCHRKFSEILLEPGQESIP-----VILESALLSRVPELEG----LMLNYFDVSAEASN  107

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFD  655
             IC  LLK + Q ++ Y  +++ + +I++    S E+V     E+ S  +  N  S     
Sbjct  108   ICSHLLKNINQIQSSYVFLQRVLNRIDDY---SPEKVKLIVPELNSFIIQSNPFSTPNKH  164

Query  656   D---VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFV  826
             D   + D +L +L+ L SKR ++ R+ K +     A G  +   C+   IT  +L  H +
Sbjct  165   DFKLINDRYLLVLNHLKSKRNKVARKLKLIACVHKATGICIAAACSLIAITTIVLGAHTL  224

Query  827   VCTMAVPGLIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSR  994
                +  P + +L L   KK     K  + G   + G    LDVAAKG ++L  D  T+S 
Sbjct  225   TALVMGPAIFSLPLKHFKKQLTSFKFLRSGFLRKVG--QQLDVAAKGTYILNRDFDTISS  282

Query  995   LVGRLSDEMEHNKTIADLWAMKHCDD-----VLKEVVSSK-NFAIQEEWALEVLKELEQH  1156
             LV RL DE+EH+K +   + ++  +D     V+KE+  S   F  Q E       ELE+H
Sbjct  283   LVSRLHDEVEHDKAMIQ-FCLERIEDKFSLQVIKELKKSDMGFRKQVE-------ELEEH  334

Query  1157  IYLCFLNIVRSRRMIVQEIVG  1219
             +YLC L I R+R ++++EI  
Sbjct  335   LYLCLLTINRARALVIEEITA  355



>ref|XP_007019520.1| Uncharacterized protein TCM_035624 [Theobroma cacao]
 gb|EOY16745.1| Uncharacterized protein TCM_035624 [Theobroma cacao]
Length=382

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 119/415 (29%), Positives = 195/415 (47%), Gaps = 54/415 (13%)
 Frame = +2

Query  5     FSLSLSIYIHSFFQLHRLNMHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSH  184
             + LS S ++ SFF ++   M    F+       A  TK       E E    RKS +V+ 
Sbjct  2     YKLSDSCFVVSFFVINEAIMSWANFR-------ALKTKR-----GEKELRDARKSLNVNE  49

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSP  364
             EY++A RT SYVE + K Q  LA   S         F L          L    +++PS 
Sbjct  50    EYLSALRTKSYVEFFSKAQ-LLANEPSSPSYFHHQFFQL----------LEPCQDTIPS-  97

Query  365   GCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV  544
                 +L      ++P+  S    L+  YF ++ EA  IC  LL  + Q + +Y  +++ +
Sbjct  98    ----ILESAIFSKIPELKS----LILNYFDISAEASKICGHLLTKINQFQDNYHFIQQTL  149

Query  545   EKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR---FDDVRDDHLGLLSRLTSKRGRI  715
             +  ++    + ++V R   E+ S  +  N  S      F  + D +  +L  L SKR ++
Sbjct  150   DSFDDY---TPKKVRRTISELNSFIVLNNPFSNPNKHDFKIIHDKYASVLHHLKSKRKKV  206

Query  716   ERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK----  883
              RR K ++    A G  L   C   +I   ++A H +      P +++    + KK    
Sbjct  207   ARRMKLIKFVHKASGVCLTAACGLALIIAIVIAAHTLAALFMAPAVVSFPAKLFKKKLFS  266

Query  884   LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKH  1063
                 KRG   + G    LDVAAKG ++L  D  T+SRLV RL DE+EHNK +  +   + 
Sbjct  267   FPCLKRGFLRKIG--EQLDVAAKGTYILNRDFDTMSRLVSRLHDEVEHNKAMIQICLERR  324

Query  1064  CD----DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              D     V+KE+  S N  ++++     ++ELE+H+YLC + I R+R ++++E+ 
Sbjct  325   EDRFSVQVVKELKKS-NVGVRKQ-----VEELEEHVYLCLVTINRARALVIKEVT  373



>ref|XP_010064985.1| PREDICTED: UPF0496 protein At1g20180-like [Eucalyptus grandis]
Length=347

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 117/357 (33%), Positives = 176/357 (49%), Gaps = 58/357 (16%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             S+  EY  A  T+SYVE+++ VQ QL         G  ++  L+S+   S  P +   ++
Sbjct  34    SIDEEYGKALATDSYVEVFNIVQDQL---------GKPSSLKLSSAPLKSQIPYLHLSQN  84

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             L SP       QE + EL +   N HPL   YF   LEAC +CE L+  V Q RA+ + +
Sbjct  85    LLSPR------QETLIELIKTL-NLHPLFVNYFKDGLEACRVCELLILSVHQIRANNQWI  137

Query  533   KKAV---EKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRL  694
             +KA+   +KI++    ++ Q      E+++ S   N    V   +F DV       L +L
Sbjct  138   EKAIKLTKKIDDATSGTDNQCRMICEELSAFSRQMNPFCLVSKEKFHDVCQAFAMRLRKL  197

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM  874
              +K  +  RR K  R+ K ++GS   +GCT                           LG+
Sbjct  198   KAKHKKTMRRAKLKRIAK-SMGS---MGCT---------------------------LGL  226

Query  875   VKKLKEAKRGIPS---RKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIAD  1045
              KK  +  +G P    ++ L + LDVAAKG F LIN ++T+S + G L DE+EH K  A+
Sbjct  227   QKKRIKPVQGNPKMTRQEVLGVQLDVAAKGHFTLINYMATMSIVAGSLYDEVEHMKVRAN  286

Query  1046  LWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             +       D +KEVV  K+F  +  + LE L+ELE    LC  +I  SRR I++EI+
Sbjct  287   MCVQSGKSDTIKEVV--KSFDQRNTYFLEQLEELENQACLCLRDINASRRSIMKEIM  341



>ref|XP_008445326.1| PREDICTED: UPF0496 protein At1g20180-like [Cucumis melo]
Length=378

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 205/405 (51%), Gaps = 66/405 (16%)
 Frame = +2

Query  86    FSKMKSAFITKSPRRNSNENEGSLGRKSS--SVSHEYMAAFRTNSYVEIYDKVQGQLAAA  259
             ++ ++SA      R +S +N+ +    S+  +++ EY AAFRTNSYVE            
Sbjct  7     WTSLRSAISNLKERSSSKKNKANANALSNKLNLNEEYQAAFRTNSYVEF-----------  55

Query  260   RSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA----  427
                       T    ++SSSSSS L+S         C   L Q + + L    SN     
Sbjct  56    ----------TATTNNTSSSSSSSLMS---------C---LLQPDQDMLHNITSNGGHVH  93

Query  428   -HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNR----  592
              H LL +YF  + EA   C  LL+ + QT+ ++  +  A  K+  + L +E+  N     
Sbjct  94    NHDLLIQYFQASFEAFETCRLLLQALNQTKINHHILVNATIKLTAMALRAEDDDNGNHGL  153

Query  593   AYGE---IASLSLFGN---------TLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRL  736
              YGE   + SLS F +         T    RF  + + H  LL +L SKR     + +  
Sbjct  154   VYGEDDRLISLSSFSHLKDPNFSILTRIGGRFLALHESHSELLQKLASKRNETRSKLRLK  213

Query  737   RVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL-IALSLGMVKKLKEAKRGIP-  910
             R+ K A    LLI   A ++   +LA+H +V  +A PGL IA  +G++KK  +    +P 
Sbjct  214   RLRKRAAKGCLLISNAAVLVALLLLALHSLVGIVAAPGLLIACFVGLLKKKVKRDYKLPF  273

Query  911   SRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW--AMKHCDDVLKE  1084
             + +     +++AA+G ++ +NDL T+SR+  RL  E+EH + + ++W  + +   ++LKE
Sbjct  274   TLETSLQQMEIAARGTYITMNDLDTLSRMAARLDVEVEHLRAVGEMWMRSSRSGCEILKE  333

Query  1085  VVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
                   F +++E  +E +KEL+QHIYLCF  I RSRR+++ EI+G
Sbjct  334   ------FVVEDEAIVEQMKELQQHIYLCFHTINRSRRLVMNEIMG  372



>ref|XP_002524292.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38032.1| conserved hypothetical protein [Ricinus communis]
Length=407

 Score =   129 bits (325),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 108/366 (30%), Positives = 179/366 (49%), Gaps = 43/366 (12%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
             GR+S +V+ EY++A RT SYV+ + K Q           +  ++ FP       S   L 
Sbjct  21    GRESLNVNEEYVSALRTQSYVDFFTKAQ----------TLVNESPFPSLCHHKFSEVLLE  70

Query  338   SGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
              G E++P+     +L      ++P+  +    L+ +YF L+ EA  IC  LLK + Q ++
Sbjct  71    PGQEAIPA-----ILESATFSKIPELKA----LMLKYFELSAEASKICSHLLKNINQIQS  121

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDD---VRDDHLGLLS  688
             +Y+ ++ A++    +   S E+V     ++ S  +  N  S    +D   + D +  +L 
Sbjct  122   NYEFIRGAIDST--IDDYSPEKVKLIVSKLNSFIIQRNPFSTPDKNDFKLINDKYSSVLH  179

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L SKR ++ R+ + +     A G  +   C    I+  ++A H +   +  P + +  +
Sbjct  180   HLKSKRKKVGRKIRLITCINKASGVCITAACGLIAISAIVIAAHTLTALVMGPAIFSFPV  239

Query  869   GMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
                KK    L+  + GI  + G    LDVAAKG ++L  D  T+SRLV RL DE+EHNK 
Sbjct  240   KGFKKKLMSLRFMRSGILRQIG--QQLDVAAKGTYILNRDFDTMSRLVARLHDEVEHNKA  297

Query  1037  IADLWAMKHCDD-----VLKEVVSSKN-FAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
             +      +  DD     V+KE+  S   F  Q E       ELE+H+YLC L I R+R +
Sbjct  298   MIQFCLERREDDKFSLQVMKELKKSDTGFRKQVE-------ELEEHVYLCLLTINRARAL  350

Query  1199  IVQEIV  1216
             +V+E+ 
Sbjct  351   VVKEMT  356



>ref|XP_007199021.1| hypothetical protein PRUPE_ppa017714mg [Prunus persica]
 gb|EMJ00220.1| hypothetical protein PRUPE_ppa017714mg [Prunus persica]
Length=364

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 182/364 (50%), Gaps = 41/364 (11%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             RKS +++ EY++AFRT SY + Y+K Q  +    S      D+ F            L  
Sbjct  22    RKSFNLNEEYLSAFRTKSYADFYNKAQLLVNEPSSSFSYSHDHKFSEVL--------LEP  73

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
             G E++P      +L  E + ++P+       L+  YF ++ EA  IC  LLK + + +++
Sbjct  74    GQEAIPG-----ILESEILSKVPELKG----LMLNYFDISAEASKICSHLLKSIKRIQSN  124

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF--GNTLSAVR------FDDVRDDHL  676
             Y+ V++A++K E+         N+    ++ L+LF   N ++         F+ + D + 
Sbjct  125   YRVVQQALDKFEDYS------PNKIKSFVSELNLFILQNNINPFSNPNNHDFELIHDKYS  178

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              +L  L   R ++ R+ K ++ FK A G  +   C+   I+  +LAVH +   +  P + 
Sbjct  179   LVLHHLKLMRKKVSRKIKLIKFFKKASGICITAACSLIAISAVVLAVHTLTALLMGPAIF  238

Query  857   ALSLGMVKKLKEAKRGIPSRKGLYMP-----LDVAAKGLFVLINDLSTVSRLVGRLSDEM  1021
             +      K+LK+    IP  +   +      LDVAAKG ++L  D  T+SRLV R+ DE+
Sbjct  239   SCPF---KRLKKKLSSIPFLRSRILTKVGEQLDVAAKGTYILNRDFDTISRLVARIHDEV  295

Query  1022  EHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
             EHNK++      +  D    +VV  K     +    + ++EL++H+YLC + I R+R ++
Sbjct  296   EHNKSMIRFCLERREDKFSLQVV--KELKKSDIGFRKQVEELQEHVYLCLVTINRARALV  353

Query  1202  VQEI  1213
             ++E+
Sbjct  354   IKEM  357



>ref|XP_008347375.1| PREDICTED: UPF0496 protein At1g20180-like [Malus domestica]
Length=268

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 144/269 (54%), Gaps = 36/269 (13%)
 Frame = +2

Query  506   QTRADYKSVKKAVEKI---------EELGLSSEEQVNRAYGEIASLSLFGNTLSAV---R  649
             QTRA+ +  KK   K+         + + ++ ++Q    +GE+ + +   N LS V   +
Sbjct  3     QTRAENRHTKKLXLKLSXRVRILNNDNIDITDDKQCLAIFGELGTFARAKNPLSIVSPGQ  62

Query  650   FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV  829
             F D+ D +  L +RLT K  ++ R  KR R+ K      L++  TA +I + + A+H ++
Sbjct  63    FRDIHDSYAALFNRLTLKHKKVRRAAKRNRICKKVGEVGLVLSHTALLIAWLVFAIHSMI  122

Query  830   CTMAVPGLIALSLGM-VKKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLV  1000
               +  P L+A SLG+ V+K+  A   + +R  +     LDVAA+G+++LIND  T+SR+V
Sbjct  123   GIVVAPALMACSLGLCVRKMDSAAEWLNARFPESHGKQLDVAAQGVYILINDFDTMSRMV  182

Query  1001  GRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWAL--EVLKELE--------  1150
              RL +E+EH K +A +     C   ++ ++++ N      + +  +V++E          
Sbjct  183   RRLHNEVEHRKVVAGI-----CVRSVRSIITTSNGGSASNFDIFKKVVREFHASEASFLE  237

Query  1151  ------QHIYLCFLNIVRSRRMIVQEIVG  1219
                   +HIYLC L I RSRR+++QEI+ 
Sbjct  238   QLEELEEHIYLCLLTINRSRRLVIQEILA  266



>ref|XP_009800794.1| PREDICTED: UPF0496 protein At3g49070-like isoform X2 [Nicotiana 
sylvestris]
Length=378

 Score =   127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 114/358 (32%), Positives = 181/358 (51%), Gaps = 38/358 (11%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKV--QGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLP  358
             EY  AFRT SY + + +V   G+   + +K IVG       TS++   S  L   H   P
Sbjct  32    EYAHAFRTESYADFWTRVLALGEKITSPTK-IVGS------TSAARLPSYRLFVEHLLDP  84

Query  359   S-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P    +L       L Q     + LL+EYF  T EA  +C  LLK V  TR+ YKS+K
Sbjct  85    DQPTVTRILA------LIQTHPQTYSLLSEYFSQTAEASLLCSVLLKKVESTRSKYKSLK  138

Query  536   KAVEKIEELGLSSEEQVNRAYGEIA----SLSLF-GNTLSAVRFDDVRDDHLGLLSRLTS  700
               ++ +++   S  + + +    +A    SL+ F  +  S+++F  V+ +   LL +L  
Sbjct  139   FTLDSLQKTPYSHVDPMPKILTRLAKFCNSLNPFVSSASSSIQFHAVQANCSQLLKQLEL  198

Query  701   KRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTIL-AVHFVVCTMAVPGLIALSLGMV  877
             +R +   R K   + K+  GS + +   A  ++ TI+ A H +   +A P ++A S    
Sbjct  199   RRDKT--RAKLRLMNKLKRGSAVFL--VALTVSLTIIVATHALALLVAAPIVMAASFQFA  254

Query  878   KKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAM  1057
                K A             LD+AAKG ++LI DL T+SRLVGRL+DE+E  + I   W  
Sbjct  255   SSKKLASWS--------AQLDIAAKGTYILIRDLDTISRLVGRLTDELEDLQAIVRFWLE  306

Query  1058  KHCDDVLKEVVSSKNFA--IQEEWA--LEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +  D V  ++ +S   A  +++ +A   E L ELE+H+YLCF+ I R+R +++ EI+ 
Sbjct  307   RGGDPVQLQLQASGEVARQLKKNYASFAEQLDELEEHLYLCFMTINRARNLVITEIMN  364



>ref|XP_009800793.1| PREDICTED: UPF0496 protein At3g49070-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   127 bits (319),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 114/358 (32%), Positives = 181/358 (51%), Gaps = 38/358 (11%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKV--QGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLP  358
             EY  AFRT SY + + +V   G+   + +K IVG       TS++   S  L   H   P
Sbjct  33    EYAHAFRTESYADFWTRVLALGEKITSPTK-IVGS------TSAARLPSYRLFVEHLLDP  85

Query  359   S-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P    +L       L Q     + LL+EYF  T EA  +C  LLK V  TR+ YKS+K
Sbjct  86    DQPTVTRILA------LIQTHPQTYSLLSEYFSQTAEASLLCSVLLKKVESTRSKYKSLK  139

Query  536   KAVEKIEELGLSSEEQVNRAYGEIA----SLSLF-GNTLSAVRFDDVRDDHLGLLSRLTS  700
               ++ +++   S  + + +    +A    SL+ F  +  S+++F  V+ +   LL +L  
Sbjct  140   FTLDSLQKTPYSHVDPMPKILTRLAKFCNSLNPFVSSASSSIQFHAVQANCSQLLKQLEL  199

Query  701   KRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTIL-AVHFVVCTMAVPGLIALSLGMV  877
             +R +   R K   + K+  GS + +   A  ++ TI+ A H +   +A P ++A S    
Sbjct  200   RRDKT--RAKLRLMNKLKRGSAVFL--VALTVSLTIIVATHALALLVAAPIVMAASFQFA  255

Query  878   KKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAM  1057
                K A             LD+AAKG ++LI DL T+SRLVGRL+DE+E  + I   W  
Sbjct  256   SSKKLASWS--------AQLDIAAKGTYILIRDLDTISRLVGRLTDELEDLQAIVRFWLE  307

Query  1058  KHCDDVLKEVVSSKNFA--IQEEWA--LEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +  D V  ++ +S   A  +++ +A   E L ELE+H+YLCF+ I R+R +++ EI+ 
Sbjct  308   RGGDPVQLQLQASGEVARQLKKNYASFAEQLDELEEHLYLCFMTINRARNLVITEIMN  365



>ref|XP_008237859.1| PREDICTED: UPF0496 protein At1g20180-like [Prunus mume]
Length=364

 Score =   126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 101/364 (28%), Positives = 181/364 (50%), Gaps = 41/364 (11%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             +KS +++ EY++AFRT SY + Y+K Q  +    S      D+ F            L  
Sbjct  22    QKSFNLNDEYLSAFRTKSYADFYNKAQLLVNEPSSSFSYSNDHKFSEVL--------LEP  73

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
             G E++P      +L    + ++P+       L+  YF ++ EA  IC  LLK + + +++
Sbjct  74    GQEAIPG-----ILESAILSKVPELKG----LMLNYFDISAEASKICSHLLKSIKRIQSN  124

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF--GNTLSAVR------FDDVRDDHL  676
             ++ V++A++K E+         N+    ++ L+LF   N ++         F+ + D + 
Sbjct  125   HRVVQQALDKFEDFS------PNKIKSIVSELNLFILQNNINPFSNPNNHDFELIHDKYS  178

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              +L  L   R  + R+ K ++ FK A G  +   C+   I+  +LAVH +   +  P +I
Sbjct  179   SVLHHLKLMRKNVSRKIKLIKFFKKASGICITAACSLIAISAVVLAVHTLTALLMGPAII  238

Query  857   ALSLGMVKKLKEAKRGIPSRKGLYMP-----LDVAAKGLFVLINDLSTVSRLVGRLSDEM  1021
             +      K+LK+    IP  +   +      LDVAAKG ++L  D  T+SRLV RL DE+
Sbjct  239   SFPF---KRLKKKLSSIPFLRSRILTKVGEQLDVAAKGTYILNRDFDTMSRLVARLHDEV  295

Query  1022  EHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
             EHNK++      +  D    +VV  K     +    + ++EL++H+YLC + I R+R ++
Sbjct  296   EHNKSMIRFCLERREDKFSLQVV--KELKKSDIGFRKQVEELQEHVYLCLVTINRARALV  353

Query  1202  VQEI  1213
             ++E+
Sbjct  354   IKEM  357



>ref|XP_010665136.1| PREDICTED: UPF0496 protein At1g20180-like [Vitis vinifera]
Length=366

 Score =   126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 102/372 (27%), Positives = 171/372 (46%), Gaps = 55/372 (15%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
              R+S +V+ EY+ A RT SY + + K Q                              L+
Sbjct  21    ARRSLNVNEEYLCALRTKSYADFFTKAQ------------------------------LL  50

Query  338   SGHESLPSPGCKLLLCQENMEELPQQASNAH--------------PLLNEYFLLTLEACA  475
                 S PS  C +   +  +E  P Q + A                L+  YF ++ EA  
Sbjct  51    VKQPSSPSNYCHVKFSEVLLE--PGQDTIADILESAILSKKPELKGLILNYFDMSAEASK  108

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFD  655
             IC  LLK + Q  A+Y+ +++ ++  +       E +         L+   ++LS   F 
Sbjct  109   ICSHLLKSISQLLANYQFIQRVLDTTDNYSPDGFESMMSQLNSFIILNNPFSSLSKHDFK  168

Query  656   DVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCT  835
              +RD +  +L  L SKR  + R+ K ++ FK A G  + +G     +T  ++A H +   
Sbjct  169   QIRDKYSSVLHHLKSKRKSVARKIKLIKYFKKASGVFVTVGFGLVAVTAMVIAAHTLTAL  228

Query  836   MAVPGLIALSLG-MVKKLKEA---KRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVG  1003
             +  P + +  +    KKL +A   + G+  + G    LDVAAKG ++L  D  T+SRLV 
Sbjct  229   LMGPAIFSFPIKRFKKKLLDARFLRSGLLRKVG--QQLDVAAKGTYILNRDFDTMSRLVA  286

Query  1004  RLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNI  1180
             RL DE+EHNK +      +  D   L+EVV  K     +    + ++ELE+H+YLC + I
Sbjct  287   RLHDEVEHNKAMIQFCLERREDRFSLQEVV--KELKKSDIGFRKQVEELEEHVYLCLVTI  344

Query  1181  VRSRRMIVQEIV  1216
              R+R ++++E++
Sbjct  345   NRARALVIKEMI  356



>ref|XP_011044296.1| PREDICTED: UPF0496 protein At1g20180-like [Populus euphratica]
Length=379

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 175/367 (48%), Gaps = 45/367 (12%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
              RKS +V+ EY++A RT SY + + K Q           +  + +FP       S   L 
Sbjct  37    ARKSLNVNEEYLSALRTQSYADFFTKAQS----------LVNEPSFPSYCHRKFSEILLE  86

Query  338   SGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
              G +S+P+     +L    + ++P+       L+  YF L+ EA  +C  LLK + Q ++
Sbjct  87    PGQDSIPA-----ILESAFLSKVPELKG----LMLNYFDLSAEASNVCSYLLKNINQIQS  137

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDD---VRDDHLGLLS  688
              Y+ +++ +  I++    S +++     E+ S  +  N  S     D   + D +  +L+
Sbjct  138   SYQFIQRVLNSIDDY---SPDKLKLIVSELNSFIVQSNPFSTPNKHDFKLINDRYSSVLN  194

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L SKR ++ R  K +     A G  +   C    I+  +LA H +   +  P +++  L
Sbjct  195   HLKSKRKKVARTMKFIAYINKASGICITAACGLIAISAIVLAAHTLTVLVIGPAILSFPL  254

Query  869   GMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
                KK     K  + G   + G    LDVAAK  ++L  D  T+S LV RL DE+EH+K 
Sbjct  255   KRFKKKLLSFKFLRSGFLRKVG--QQLDVAAKATYILNKDFDTMSTLVARLHDEVEHDKA  312

Query  1037  IADLWAMKHCDD-----VLKEVVSSKN-FAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
             +   + +K  +D     V+KE+  S + F  Q E       ELE+H+YLC L I R+R +
Sbjct  313   MIQ-FCLKRKEDRFSFQVIKELKKSDSGFRKQVE-------ELEEHVYLCLLTINRARAL  364

Query  1199  IVQEIVG  1219
             +++E+  
Sbjct  365   VIKEMTA  371



>ref|XP_009376530.1| PREDICTED: UPF0496 protein At1g20180-like [Pyrus x bretschneideri]
Length=365

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 100/363 (28%), Positives = 176/363 (48%), Gaps = 38/363 (10%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI-  337
             RKS +++ EY++AFRT SY + ++K Q          +V   ++ PL  +     + ++ 
Sbjct  22    RKSFNLNEEYLSAFRTKSYADFFNKAQL---------LVNEPSSSPLNYNPDHKLTEVLL  72

Query  338   -SGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTR  514
               G E++P      +L    + ++P+       L+  +F L+ EA  IC  LLK +   +
Sbjct  73    EPGQEAIPD-----ILESAILSKVPKLKG----LMLNFFDLSAEASKICSHLLKSINHVQ  123

Query  515   ADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR-----FDDVRDDHLG  679
             + Y  V++ ++K E+    S +++     E+  L L  N           F+ + +++  
Sbjct  124   SSYHFVQQELDKFEDY---SPDKIKSIISELNVLILQNNINPFPNPNNHDFELIHENYSS  180

Query  680   LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIA  859
             +L  L S R ++ R+ K ++ FK A G  +   C+   IT  +L  H +   +  P LI+
Sbjct  181   VLHHLKSMRKKVSRKIKLIKCFKKATGICITAACSLIAITAVVLVAHTLTALLMGPALIS  240

Query  860   LSLGMVKKLKEAKRGIPSRKGLYMP-----LDVAAKGLFVLINDLSTVSRLVGRLSDEME  1024
                   K  K+    IP  +   +      LDVAAKG +VL  D  T+SRLV RL DE+E
Sbjct  241   FPF---KSFKKKLSSIPFLRSRILTKVGEQLDVAAKGTYVLNMDFDTMSRLVARLHDEVE  297

Query  1025  HNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
             HNK +      +  D    +VV  K     +    + ++EL +H+YLC + I R+R +++
Sbjct  298   HNKAMIRFCLERREDKFSLQVV--KELKKTDVGFRKQVEELREHLYLCLVTINRARALVI  355

Query  1205  QEI  1213
             +E+
Sbjct  356   KEM  358



>gb|KGN62262.1| hypothetical protein Csa_2G346030 [Cucumis sativus]
Length=379

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 117/394 (30%), Positives = 190/394 (48%), Gaps = 68/394 (17%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             +S  + +  N  +L  K + ++ EY AAFRTNSYVE                        
Sbjct  22    RSSSKKNKANANALSNKLN-LNEEYQAAFRTNSYVEF-----------------------  57

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA-----HPLLNEYFLLT  460
                          I+ + S PS     LL  +    L    SN      H LL +YF  +
Sbjct  58    -----------TAITNNTSSPSSLISCLLEPDQDMLLHNITSNGGHVHDHDLLIQYFQAS  106

Query  461   LEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVN----RAYGEIASL---S  619
              EA   C+ LL+ + QT+ ++  +  A  K+  + L + +  N    R YGE   L   S
Sbjct  107   FEAFETCQLLLQALNQTKINHHILVNATVKLTTMALRAGDDDNGNHGRVYGEDDPLILSS  166

Query  620   LFG-------NTLSAV--RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
              F        + L+ +  RF  + + H  LL +L SK+    R+ +  R+ K      LL
Sbjct  167   FFSRLKNPNFSILNQIGSRFLALHESHSELLQKLASKQNETRRKLRLKRIRKRVAKGCLL  226

Query  773   IGCTAFMITFTILAVHFVVCTMAVPGL-IALSLGMVKKLKEAKRGIP-SRKGLYMPLDVA  946
             I   A ++   +LA+H +V  +A PGL IA  +G++KK  +    +P + +     +++A
Sbjct  227   ISNAAVLVALLLLALHSLVGIVAAPGLLIACFVGLLKKKVKRDYKLPFTPETSLQQMEIA  286

Query  947   AKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW---AMKHCDDVLKEVVSSKNFAIQE  1117
             A+G ++ +NDL T+SR+  RL  E+EH + + ++W   +   C+ +LKE      F +++
Sbjct  287   ARGTYITMNDLDTLSRMAARLDVEVEHLRAVGEMWMRSSRSRCE-ILKE------FVVED  339

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             E  +E +KEL+QHIYLCF  I RSRR+++ E +G
Sbjct  340   EAIVEQMKELQQHIYLCFHTINRSRRLVMDETMG  373



>ref|XP_004143078.1| PREDICTED: UPF0496 protein At1g20180-like [Cucumis sativus]
 ref|XP_004161096.1| PREDICTED: UPF0496 protein At1g20180-like [Cucumis sativus]
Length=394

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 117/394 (30%), Positives = 190/394 (48%), Gaps = 68/394 (17%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             +S  + +  N  +L  K + ++ EY AAFRTNSYVE                        
Sbjct  37    RSSSKKNKANANALSNKLN-LNEEYQAAFRTNSYVEF-----------------------  72

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA-----HPLLNEYFLLT  460
                          I+ + S PS     LL  +    L    SN      H LL +YF  +
Sbjct  73    -----------TAITNNTSSPSSLISCLLEPDQDMLLHNITSNGGHVHDHDLLIQYFQAS  121

Query  461   LEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVN----RAYGEIASL---S  619
              EA   C+ LL+ + QT+ ++  +  A  K+  + L + +  N    R YGE   L   S
Sbjct  122   FEAFETCQLLLQALNQTKINHHILVNATVKLTTMALRAGDDDNGNHGRVYGEDDPLILSS  181

Query  620   LFG-------NTLSAV--RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLL  772
              F        + L+ +  RF  + + H  LL +L SK+    R+ +  R+ K      LL
Sbjct  182   FFSRLKNPNFSILNQIGSRFLALHESHSELLQKLASKQNETRRKLRLKRIRKRVAKGCLL  241

Query  773   IGCTAFMITFTILAVHFVVCTMAVPGL-IALSLGMVKKLKEAKRGIP-SRKGLYMPLDVA  946
             I   A ++   +LA+H +V  +A PGL IA  +G++KK  +    +P + +     +++A
Sbjct  242   ISNAAVLVALLLLALHSLVGIVAAPGLLIACFVGLLKKKVKRDYKLPFTPETSLQQMEIA  301

Query  947   AKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW---AMKHCDDVLKEVVSSKNFAIQE  1117
             A+G ++ +NDL T+SR+  RL  E+EH + + ++W   +   C+ +LKE      F +++
Sbjct  302   ARGTYITMNDLDTLSRMAARLDVEVEHLRAVGEMWMRSSRSRCE-ILKE------FVVED  354

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             E  +E +KEL+QHIYLCF  I RSRR+++ E +G
Sbjct  355   EAIVEQMKELQQHIYLCFHTINRSRRLVMDETMG  388



>ref|XP_008806163.1| PREDICTED: putative UPF0496 protein 2 [Phoenix dactylifera]
Length=384

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 119/381 (31%), Positives = 176/381 (46%), Gaps = 33/381 (9%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             SV  EY  AFRT S+V+++ KV  QL     + I     +       +       S H S
Sbjct  15    SVDEEYSNAFRTKSFVDMWAKVHHQL----RRTISSPSPSHGHQEGQAEEVKDRRSSHSS  70

Query  353   LPSPGCKLLLCQENMEELPQQAS---------------NAHPLLNEYFLLTLEACAICES  487
               S  C   L +  +E  P Q S               + H LL +YF  T EACA C +
Sbjct  71    PLSYRCYAHLSEFLLE--PSQESLLAATASAGDGVAHFHVHSLLLDYFDTTYEACAACTT  128

Query  488   LLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRD  667
             LL  + + R+ ++S+++ + K+    L S      A+ ++ S     N LS       R 
Sbjct  129   LLASIDRARSHHRSIRRLLLKLARARLDSN---CTAFAKLKSHVELDNPLSPENLAHFRH  185

Query  668   DHL---GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV---  829
              H     L+ RLT+   RI R  K +R  K A G  L+  C A M+   ++AVH VV   
Sbjct  186   VHACYGSLVDRLTTANRRIARWAKLIRAAKKASGVILIGACGAAMVAALVIAVHTVVGIG  245

Query  830   -CTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGR  1006
                +A P ++A      + +     G    K +   +D AAKG +++  DL TVSR+V R
Sbjct  246   LAAVAAPAVVAGPGAAARSMWGRMAGKSHLKRVGAQVDSAAKGAYIVGRDLDTVSRMVRR  305

Query  1007  LSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVR  1186
               DE+EH + +A L        +++E         +EE A + L ELE+H+YLC + I R
Sbjct  306   AHDEVEHGRDVARLVLRNRERPLVREAARELEGG-KEELAGQ-LDELEEHVYLCLITINR  363

Query  1187  SRRMIVQEIVGRV*PAHLAKS  1249
             SRRM+ QE++G   P   A S
Sbjct  364   SRRMVAQEMMGGAAPPPAATS  384



>ref|XP_010102653.1| hypothetical protein L484_004321 [Morus notabilis]
 gb|EXB93835.1| hypothetical protein L484_004321 [Morus notabilis]
Length=441

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 112/365 (31%), Positives = 177/365 (48%), Gaps = 42/365 (12%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKV----QGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             V  EY  AFRT SY++ + +V     G  + A S E          T+++   S  L + 
Sbjct  99    VREEYANAFRTESYIDFWTRVIELSNGHCSPAMSVES---------TTAARLPSYRLFAE  149

Query  344   HESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
             H   P+    + +      +L       H LL++YF  T     +C  LLK + +TR  Y
Sbjct  150   HLLDPNQATVIRIL-----DLTHNGPKIHTLLSDYFTQTANTSILCGLLLKEIERTRVKY  204

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIA----SLSLFGNTLSAV-RFDDVRDDHLGLLS  688
             +S K  ++ +E   L  E +++     +     S++ F + +S+  R   V+    GLL 
Sbjct  205   RSFKTTLQSLETAQLLPENRLSNIKTLLTECSNSINPFVSLISSPNRVRVVQSGCSGLLQ  264

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTL-LIGCTAFMITFTILAVHFVVCTMAVPGLIALS  865
             RL S R +   R K   + K+  GS L L+  TA +    I+  H +   +A+P LI+ S
Sbjct  265   RLESSRDKA--RAKLQLINKLKHGSALVLVALTASL--SVIVVTHALSLVVAIPSLISAS  320

Query  866   LGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIAD  1045
             + +    K A+        +   LD A KG ++L  DL T+SRLV RL+DE+EH + +A 
Sbjct  321   IELASARKLAR--------VMAQLDAATKGTYILSRDLDTISRLVTRLNDELEHIRVMAK  372

Query  1046  LWAMKHCDDVLK---EVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              W +   DD L+   EV  ++     E    E L ELE+H+YLCF+ I R+R ++V+EI+
Sbjct  373   FW-LDRGDDWLQASGEV--ARQLKRNESSFNEQLDELEEHLYLCFMTINRARNLVVKEIL  429

Query  1217  GRV*P  1231
                 P
Sbjct  430   NPAEP  434



>ref|XP_007218328.1| hypothetical protein PRUPE_ppa008472mg [Prunus persica]
 gb|EMJ19527.1| hypothetical protein PRUPE_ppa008472mg [Prunus persica]
Length=330

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/359 (28%), Positives = 167/359 (47%), Gaps = 43/359 (12%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V+ EY  AFRT SY++ + +V     A  + ++   +   P+ S++++         E L
Sbjct  5     VTEEYANAFRTESYLDFWTRV----VALSNGDLTKSNKRMPMESTTAARLPSYRLFAEHL  60

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P       Q  +  +   A +   LL++YF  T +A  +C  LLK + +TR  Y+S+K
Sbjct  61    LDPD------QPMVARILTMAPDHPTLLSDYFTQTADASILCGLLLKDIDRTRVKYRSIK  114

Query  536   KAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRI  715
              +++ + +   S+ E + R       L+   + LS +R   ++     LL RL S R + 
Sbjct  115   TSLQSLNDR--STPETLTR-------LTKLTSALSLIRIQAIQAGCSKLLKRLESTRNKA  165

Query  716   ERRTKRLRVFKVALGSTLLIGCTAFMITFT-----ILAVHFVVCTMAVPGLIALSLGMVK  880
                       K+ L + L  G   F++  T     I+  H +   +A+P  IA SL +  
Sbjct  166   R--------AKLRLANKLRAGSAIFLVALTASLSVIVVTHALALVVAMPAFIAASLDLAS  217

Query  881   KLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK  1060
               + A+        +   LD A KG ++L  DL TVSRLV RL+DE+EH   +   W  +
Sbjct  218   ARRLAR--------MAAQLDAATKGTYILNRDLETVSRLVARLNDEIEHMHGMVTFWVGR  269

Query  1061  HCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV*PAH  1237
               D         +     +    + L ELE+H+YLCF+ I R+R ++V+EI+    P H
Sbjct  270   GEDWSQASGEVGRQLKKNDCSFRQQLDELEEHLYLCFMTINRARNLVVKEILD---PGH  325



>ref|XP_002513670.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49073.1| conserved hypothetical protein [Ricinus communis]
Length=370

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 179/372 (48%), Gaps = 43/372 (12%)
 Frame = +2

Query  149   GSLGRKSSS----VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssss  316
             GS+G  + S    V  EY  AFRT SY E +  V   LA +    + G     P+ S+++
Sbjct  10    GSIGTPNLSIGVDVREEYANAFRTESYNEFWTHV---LALSDGDSVTG----IPVESTTA  62

Query  317   ssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLK  496
             +         E L  P    +    ++  L    + AH LL+EYF  T  A  +C  LLK
Sbjct  63    ARLPSYRLFVEHLLDPDQSTV---THILTLAHNPTKAHSLLSEYFTQTANASLLCGLLLK  119

Query  497   IVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL--SAVRFDDVRD-  667
              +  TRA Y+S+K  ++ ++   LS +++ N     +   + + N    SA   + VR  
Sbjct  120   DIDHTRARYRSLKTTLQSMDTTLLSPQKRSNIILTRLTEFTTYLNPFHWSAPSPNQVRII  179

Query  668   --DHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMA  841
               D   LL  L S R +   R +     K+  GS L +      +T  ILA H +   +A
Sbjct  180   QVDCSKLLKSLESTRDKA--RAQLHLKSKLKHGSALFVAALTASLTI-ILATHALALLVA  236

Query  842   VPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEM  1021
              PGL+  S     KL  + R +     +   LD+AAKG ++L  DL T+SRLV RL+DEM
Sbjct  237   TPGLVMAS----SKLASSSRRLVK---VSAQLDMAAKGTYILCRDLETISRLVARLNDEM  289

Query  1022  EHNKTIADLWA------MKHCDDVLKEVVSSK-NFAIQEEWALEVLKELEQHIYLCFLNI  1180
             EH +     W       ++   +V++++  +  +F  Q       L E+E+H+YLCF+ I
Sbjct  290   EHMRATIKFWVQRGEVWLQANGEVVRQLKKNDCSFGQQ-------LDEMEEHLYLCFMTI  342

Query  1181  VRSRRMIVQEIV  1216
              R+R ++++E++
Sbjct  343   NRARNLVLKEVL  354



>ref|XP_004309191.1| PREDICTED: UPF0496 protein At3g49070-like [Fragaria vesca subsp. 
vesca]
Length=367

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 170/350 (49%), Gaps = 33/350 (9%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V+ EY  AFRT SY++ + +V      A S     G     + S++++  S      E+L
Sbjct  32    VTEEYANAFRTESYLDFWTRV-----VALSNAGSTGSKLIQMESTTAARLSSYRLFVENL  86

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P   ++     +  + +    +  LL++YF  T +A A+C  LLK + +TR  Y+S++
Sbjct  87    LDPDQTIV---TRILAMTRNHPKSFALLSDYFTQTADASALCGLLLKDIDRTRVKYRSIR  143

Query  536   KAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRI  715
              A++ +      +          +  L+ F   LS +R   ++     LL RL   R + 
Sbjct  144   TALQSLNNCLTPTT---------LNQLTKFSIILSPIRIQSIQAGCSNLLKRLELTRNKT  194

Query  716   ERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEA  895
               + +    F+ A  +  L+  TA +    I+  H +   +A P LIA SL +    + A
Sbjct  195   RAKLRLAGKFQTA-SAIFLVAVTATL--SVIIVTHALALVVAAPTLIATSLDLTSSRRLA  251

Query  896   KRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV  1075
             +        +   LD A KG +++  DL TVSRL+ RL+DE+EH + +   W  +  +D 
Sbjct  252   R--------MATQLDAATKGAYIVSRDLETVSRLMARLNDELEHMRGMVQFWVERAEEDW  303

Query  1076  LK---EVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             L+   EV  ++     +    + L ELE+H+YLCF+NI R+R ++V+EI+
Sbjct  304   LQPGGEV--ARQLKKNDCSFRQKLDELEEHLYLCFMNINRARNLVVKEIL  351



>ref|XP_009595974.1| PREDICTED: UPF0496 protein At1g20180-like [Nicotiana tomentosiformis]
Length=349

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 177/362 (49%), Gaps = 38/362 (10%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             +KS +V+ EY+ A RT SY E + K Q  +    S   +   NTF               
Sbjct  6     QKSLNVNEEYLGALRTKSYGEFFTKAQLLVNELTSPSQLS-HNTFS--------------  50

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
               E L  P  + +         P +  +   LL+ YF ++ EA   C  +LK + Q ++D
Sbjct  51    --EILLEPRQETITTILESAIFPSKKYDLKSLLSNYFNVSAEASKFCIHILKSINQVQSD  108

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR---FDDVRDDHLGLLSR  691
             Y  V++ ++ I+    S+ +Q      E+ S  +  N  S ++   F  + D++  +L  
Sbjct  109   YGFVQQVLDSID--NCSNGDQFGYLVLELRSFIIHNNPFSELKKQDFTRLNDEYSLVLQH  166

Query  692   LTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLG  871
             L SK+ R+ R+ K ++      G  +   C   ++   +LA H +   +  P +++L L 
Sbjct  167   LKSKKKRVARKIKLIKCVNKTSGVCVTAACGLVVVAALVLAAHTLAAIVMGPAILSLPLK  226

Query  872   MVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTI  1039
              +KK    ++  K G   +  +   LDVAAKG ++L  D  T+SRLV RL +E++HNK +
Sbjct  227   PLKKKIMNIRFLKCGFLRK--VREQLDVAAKGTYILNMDFDTMSRLVARLHNEIDHNKAM  284

Query  1040  ADLWAMKHCD----DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
               L   +  D    +VLKE+  S N   +++     ++ELE+H+YLC L I R+R ++++
Sbjct  285   IQLCLDRREDRFSLEVLKELKKS-NIGFKKQ-----VEELEEHVYLCLLTINRARALVIK  338

Query  1208  EI  1213
             EI
Sbjct  339   EI  340



>ref|XP_008234194.1| PREDICTED: UPF0496 protein At3g49070 [Prunus mume]
Length=354

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 101/359 (28%), Positives = 167/359 (47%), Gaps = 43/359 (12%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V+ EY  AFRT SY++ + +V     A  + +    +   P+ S++++         E L
Sbjct  31    VTEEYANAFRTESYLDFWTRV----VALSNGDSTKSNKRMPMESTTAARLPSYRLFAEHL  86

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P       Q  +  +   A N   LL++YF  T +A  +C  LLK + +TR  Y+S+K
Sbjct  87    LDPD------QPMVARILTMAPNHPTLLSDYFTQTADASILCGLLLKDIDRTRVKYRSIK  140

Query  536   KAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRI  715
              +++ + +   S+ E + R      +LSL       +R   ++     LL RL S R + 
Sbjct  141   TSLQSLNDR--STPETLTRLTKLTTALSL-------IRVQAIQAGCSNLLKRLESTRNKA  191

Query  716   ERRTKRLRVFKVALGSTLLIGCTAFMITFT-----ILAVHFVVCTMAVPGLIALSLGMVK  880
                       K+ L + L +G   F++  T     I+  H +   +A+P  IA SL +  
Sbjct  192   R--------AKLRLANKLRVGSAIFLVALTASLSVIVVTHALALVVAMPTFIAASLDLAS  243

Query  881   KLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK  1060
               + A+        +   LD A KG ++L  DL TVSRLV RL+DE+EH   +   W  +
Sbjct  244   ARRLAR--------MAAQLDAATKGTYILNRDLETVSRLVARLNDEIEHMHGMVTFWVGR  295

Query  1061  HCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV*PAH  1237
               D        ++     +    + L ELE+H+YLCF+ I R+R ++V+EI+    P H
Sbjct  296   GEDWSQANGEVARQLKKNDCSFRQQLDELEEHLYLCFMTINRARNLVVKEILD---PGH  351



>ref|XP_009777697.1| PREDICTED: UPF0496 protein At1g20180-like [Nicotiana sylvestris]
Length=317

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/281 (30%), Positives = 149/281 (53%), Gaps = 21/281 (7%)
 Frame = +2

Query  404   LPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQ  583
              P +  +   LL+ YF ++ EA   C  +LK + Q ++DY  V++ ++ I+    S+ +Q
Sbjct  35    FPSKKYDLKSLLSNYFNISAEASKFCSHILKSINQVQSDYGFVEQVLDSID--NCSNGDQ  92

Query  584   VNRAYGEIASLSLFGNTLSAVR---FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
                   E+ S  +  N  S ++   F  + D++  +L RL SK+ R+ R+ K ++     
Sbjct  93    FGYLLLELRSFIIHNNPFSDLKKQDFTRINDEYSSVLQRLKSKKKRVARKIKLIKCVNKT  152

Query  755   LGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK----LKEAKRGIPSRKG  922
              G  +   C   ++   +LA H +  ++  P +++ +L  +KK    ++  K G   + G
Sbjct  153   SGVCVTAACGLVVVAALVLATHALAASVMGPAILSRTLKPLKKKIMNIRFLKCGFLRKAG  212

Query  923   LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD----DVLKEVV  1090
                 LDVAAKG ++L  D  T+SRLV RL +E++HNK +  L   +  D    +VLKE+ 
Sbjct  213   --EQLDVAAKGTYILNMDFDTMSRLVARLHNEIDHNKAMIQLCLDRREDRFSLEVLKELK  270

Query  1091  SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
              S N   ++      ++ELE+H+YLC L I R+R ++++EI
Sbjct  271   KS-NIGFKKP-----VEELEEHVYLCLLTINRARALVIKEI  305



>emb|CDY66065.1| BnaCnng49510D [Brassica napus]
Length=385

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 128/387 (33%), Positives = 200/387 (52%), Gaps = 36/387 (9%)
 Frame = +2

Query  113   TKSPRRNSNENEGSLGRKSS--SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD  286
             T S R+  N  +  L   +   SV+ EY  AFRTNSY+EI  K + QL      ++    
Sbjct  14    TYSARQAENSEKECLRSLTCKLSVNEEYKEAFRTNSYLEIRTKAEDQLGITFFSKLSSPS  73

Query  287   NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLE  466
             ++     S  +        H  L  P       QE ++ L Q  S  H LL ++F  + E
Sbjct  74    SSDLSFHSHFT--------HYLLDPP-------QETLDALMQDTS-FHYLLVKFFDFSSE  117

Query  467   ACAICESLLKIVLQTRADYKSVKKAVEKIEELG-------LSSEEQVNRAYGEIASLSLF  625
             AC +CESLL+ + Q + ++  VK+ ++  +++         S E+     + E++  ++ 
Sbjct  118   ACDVCESLLQCIQQIKINHMKVKRVIKIGKKVCNGAKTPEYSPEKLCALIFQELSRYAVL  177

Query  626   GNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFM  793
              N L  +    +F  V D +  LL+RL SKR RI R+ +     K   G +L I   A +
Sbjct  178   KNPLYCIINEAQFPRVNDANSDLLARLKSKRRRIRRKIRLFTFCKKLGGYSLKISHIAIV  237

Query  794   ITFTILAVHFVVCTMAVPGLIALSLGMVKKLK----EAKRGIPSR-KGLYMPLDVAAKGL  958
             ITF I+A+H ++  +A P L+ L   + KK      E K    ++ + L   +D+AAKG 
Sbjct  238   ITFLIVALHSILGVLAAPVLLGLCCLLRKKKTKRKMENKSKTDTKLEKLGAQMDIAAKGT  297

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             F+++NDL T+SRL GRL DE+EH K +A + A     +VLKE +  + F   EE   E+L
Sbjct  298   FIIMNDLDTLSRLAGRLCDEIEHRKAVAAMCAKSGKVEVLKEAL--RAFNGNEERFSELL  355

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +ELE+H+YLCF  I  SRR+++ +  G
Sbjct  356   QELEEHLYLCFHTINISRRLVLAQTTG  382



>ref|XP_010275646.1| PREDICTED: UPF0496 protein At3g49070 [Nelumbo nucifera]
Length=365

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 108/364 (30%), Positives = 170/364 (47%), Gaps = 52/364 (14%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD--NTFPLTssssssssP---LIS  340
             V  EY  AFRT SY+E + +V          ++  GD   + P+ S+++++  P   L +
Sbjct  32    VREEYANAFRTESYIEFWTRVL---------DLTHGDAATSIPMESTTAAARLPSYRLFA  82

Query  341   GHESLPS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
              H   P  P    +L        PQ  S  H LL  YF  T  A  +C  LLK + QTR 
Sbjct  83    EHLLDPDQPAVTKILALSQ----PQNHSENHSLLTNYFSETANASLLCGLLLKDIDQTRT  138

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR-FDDVRDDHLGLLSRL  694
              Y  +K  +E ++         ++R      SL+ F ++ S+ R    V+     LL +L
Sbjct  139   RYHPLKTTIESLDTTKCFPV-LLDRLAEFSNSLNPFDSSASSPRRVQAVQASCNELLKQL  197

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT-----ILAVHFVVCTMAVPGLIA  859
                    E R ++ R  ++ L + L  G   F++  T     I A H     +AVPG + 
Sbjct  198   -------ELRREKARA-QLQLVNGLKRGSAIFLVVLTASVVIIAATHAFAMLVAVPGFVT  249

Query  860   LSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTI  1039
              SL +    + A+        +   LD AAKG ++L  DL T+SRLV RL  E+EH   +
Sbjct  250   ASLKLASTRRLAR--------MSAQLDAAAKGTYILNRDLETISRLVARLDGELEHVHAM  301

Query  1040  ADLWAMKHCDDV--LKEV---VSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
                W  +  D +  ++EV   +   N +  E+     L ELE+H+YLCF+ I R+R ++V
Sbjct  302   VRFWLERRDDQIHAIREVARQLRKNNSSFSEQ-----LDELEEHLYLCFMTINRARSLVV  356

Query  1205  QEIV  1216
             +E++
Sbjct  357   KEVL  360



>ref|XP_011076482.1| PREDICTED: UPF0496 protein At3g49070 [Sesamum indicum]
Length=420

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 103/357 (29%), Positives = 174/357 (49%), Gaps = 41/357 (11%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKV----QGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             EY  AFRT SY + + +V    +G L   RS     G +T     S    +  L+   +S
Sbjct  80    EYANAFRTESYNDFWTQVLALNKGDLMTHRSL----GSSTAARLPSYRLFAEHLLDPDQS  135

Query  353   LPSPGCKLL-LCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKS  529
               +   ++L L + N + L         LL+EYF  T +A  +C  LLK +   R  +KS
Sbjct  136   TVT---RILGLTRTNPKILS--------LLSEYFSNTSDASHLCGLLLKDIDHMRKKHKS  184

Query  530   VKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNT----LSA---VRFDDVRDDHLGLLS  688
             +    E  +     S   + R    +A ++LF  +    LSA    RF  V++    LL 
Sbjct  185   LGDPFESPQN---GSGPDIRRLPIVLARVTLFSKSNPFCLSAPSMSRFQAVQNSCSNLLK  241

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
             +L ++R + + + ++L+  K    + LL+  TA ++   ++A H  V  +A PG++  SL
Sbjct  242   QLETRRDKTQSKIRQLKKLKCG-SAVLLVAVTASLLI--VIAAHAFVMLVAAPGVLTASL  298

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
              ++         I +       LD AAKG ++L+ DL T+SRLV RL++E+EH + +  +
Sbjct  299   ELI--------SIDNLARWSAQLDAAAKGTYILMRDLDTISRLVARLNNELEHVEALIQM  350

Query  1049  WAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             W  +  D +              +  +E L ELE+H+YLCF+ I R+R ++++EI+ 
Sbjct  351   WVERKDDRLQASEEVGYQLKKNNQSFIEQLDELEEHLYLCFMTINRARNLVIKEILN  407



>ref|XP_010662696.1| PREDICTED: UPF0496 protein At3g49070 [Vitis vinifera]
Length=351

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 114/360 (32%), Positives = 169/360 (47%), Gaps = 58/360 (16%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDN--TFPLTssssssssPLISGHESLP  358
             EY  AFRT SY+E + +V           +  GD+  + P+ S++++  S      E L 
Sbjct  34    EYANAFRTESYIEFWTRVL---------TLTHGDSATSIPIESTTAARLSSYRLFAEYLL  84

Query  359   SPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKK  538
              P    +     +  L Q     H +L EYF  T  A  +C  LLK + + R  Y+S+K 
Sbjct  85    DPDQPTV---TQLLALAQSRPKNHSILAEYFSETANASFLCSLLLKDINRIRVWYRSLKS  141

Query  539   AVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIE  718
                 +E  G +    VNR          F   L+ VR   ++    GLL RL  + GR +
Sbjct  142   T---LESHGATELLPVNR----------FPVILARVRV--IQTGCSGLLKRL--ELGRDK  184

Query  719   RRTKRLRVFKVALGST-LLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEA  895
              R K   V  +  GS  LL+  TA +    I   H +   +A PGLIA S  +    K A
Sbjct  185   ARAKLQLVKSIKCGSAILLVALTASVAV--IATTHALAMLVAAPGLIAASFELASTRKLA  242

Query  896   KRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV  1075
             +R           LD AAKG ++L  D+  +SRLV RL++E+EH   +   W ++H +D 
Sbjct  243   RRS--------AQLDAAAKGTYILNKDMDMISRLVARLNNELEHISGMVRFW-LEHKEDN  293

Query  1076  LK---EVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV*P  1231
             L+   EV      +  NF+ Q       L ELE+H+YLCF+ I R R ++V+EI+ +  P
Sbjct  294   LQASGEVARQLKENDSNFSQQ-------LDELEEHLYLCFMTINRGRTLVVKEIMDQGPP  346



>ref|XP_010550544.1| PREDICTED: UPF0496 protein At3g49070 [Tarenaya hassleriana]
Length=368

 Score =   115 bits (288),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 116/395 (29%), Positives = 186/395 (47%), Gaps = 66/395 (17%)
 Frame = +2

Query  80    KKF-SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAA  256
             KKF S   S   T SP+           R    V  EY  AFRT SY + + +V  QL+ 
Sbjct  10    KKFLSYTASGATTTSPK----------SRDDVDVREEYANAFRTESYNQFWTRVT-QLSH  58

Query  257   ARSKEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPL  436
              +S      +++   ++S+   S  L + +   P P     +    +  L +       L
Sbjct  59    KKSATCSPIESS---STSARLMSYRLFAQNLLDPDP-----ITVTRILYLTRTRRLTRFL  110

Query  437   LNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE-KIEELGLSSE-EQVNRAYGEIA  610
             L+ Y+  T  A  IC  LL+ V + R+ Y+S+K  +E K + L L ++  ++++ +    
Sbjct  111   LSSYYSETANAFLICSILLRSVDRIRSKYESLKTQIEFKADPLDLINQFMELSKWFRPFV  170

Query  611   SLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLR----------VFKVALG  760
             S        S  R   V+++   LL+RL S R +   RTK LR          +F VAL 
Sbjct  171   S--------SGFRIRVVQNNCSNLLNRLESSRDKT--RTK-LRFINGLRHGSGMFVVALT  219

Query  761   STLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL---GMVKKLKEAKRGIPSRKGLYM  931
             +TL++           +A H     +A P L+       G+ KKL               
Sbjct  220   TTLIV----------TIASHAFALFIAGPSLLTARFKPAGLTKKLMRTA----------A  259

Query  932   PLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAI  1111
              LD+AAKG ++L  DL T+SRLV R +DE+EH + +A+ WA++  D V  +   ++   +
Sbjct  260   QLDIAAKGTYILSRDLDTISRLVSRFNDEVEHARAVAEFWAVRGLDRVRAKEEVARQMKM  319

Query  1112  QEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
               E   E L ELE+H++LCF+ I R+R ++V+EI+
Sbjct  320   TGESLSEQLDELEEHLHLCFMTINRARNLVVREIL  354



>gb|EYU25118.1| hypothetical protein MIMGU_mgv1a009025mg [Erythranthe guttata]
Length=355

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 105/366 (29%), Positives = 179/366 (49%), Gaps = 50/366 (14%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             ++ ++  EY  AFRT SY + +  V      A +K ++    +   T+++   S  L + 
Sbjct  21    ETPNLREEYANAFRTESYNDFWSNV-----LALNKGVLTTHRSLGSTTAARLPSYRLFAE  75

Query  344   HESLPSPGCKLLLCQENMEELPQQASNAHP----LLNEYFLLTLEACAICESLLKIVLQT  511
             H         LL   ++        +  HP    L+ +YF  T +A  +C  LLK + + 
Sbjct  76    H---------LLDPDQSTVARILGLTRTHPKISSLMTDYFTNTSDASHLCGLLLKDIDRM  126

Query  512   RADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNT-------LSAVRFDDVRDD  670
             R  YKSVK   +        S ++ N     +  +++F  +        S  RF  V+  
Sbjct  127   RRRYKSVKDPSQN------GSGQETNHLPIVLTRMTIFSRSNPFCPLAPSMSRFQAVQSS  180

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                LL +L  +R +   + +RL+  K    +  L+  TA ++   I+A H +V  +A PG
Sbjct  181   SSSLLKKLELRRDKTHAKMRRLKKLKFG-SAVFLVALTASLLV--IVAAHALVLLVAAPG  237

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             ++  SL ++   K A+            LD AAKG ++LI DL T+SRLV RL++E+EH 
Sbjct  238   VMTASLELISIEKLARWS--------AQLDAAAKGTYILIRDLDTISRLVTRLNNELEHV  289

Query  1031  KTIADLWAMKHCDDVLKEVVSSKNFAIQ----EEWALEVLKELEQHIYLCFLNIVRSRRM  1198
             + +  LW ++  DD L+   +S+  A Q    ++  +E L ELE+H+YLCF+ I R+R +
Sbjct  290   EALMKLW-LERGDDRLQ---ASEEVACQLKKNDQSFVEQLDELEEHLYLCFMTINRARNL  345

Query  1199  IVQEIV  1216
             + +EI+
Sbjct  346   VTKEII  351



>ref|XP_009149505.1| PREDICTED: UPF0496 protein At1g20180 isoform X1 [Brassica rapa]
Length=391

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 135/390 (35%), Positives = 205/390 (53%), Gaps = 36/390 (9%)
 Frame = +2

Query  113   TKSPRRNSNENEG--SLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD  286
             T S R+ ++E E   SL  K S V+ EY  AFRTNSY+EI  K + QL    S ++    
Sbjct  14    TYSARQENSEKECRRSLTCKLS-VNEEYQEAFRTNSYLEIRTKAEDQLGITFSSKLSSPS  72

Query  287   NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLE  466
              T   +SSS  S     + +   P         QE ++ L Q  S  H LL ++F  + +
Sbjct  73    PTTSPSSSSDLSFHSHFTDYLLDPP--------QETLDALMQDTS-FHYLLAKFFDFSSD  123

Query  467   ACAICESLLKIVLQTRADYKSVKKAVE---------KIEELGLSSEEQVNRAYGEIASLS  619
             AC +CESLL+ + Q + ++  +K+ ++         K  E   S E      + E++  +
Sbjct  124   ACDVCESLLQCIQQIKINHMKLKRVIKIGKRVCNGAKTPEC--SRENLCALIFQELSKYA  181

Query  620   LFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGS-TLLIGCT  784
             L  N L  +    +F  V D +  LL+RL SKR RI R+ +    F   LGS +L+I   
Sbjct  182   LLKNPLYCIINETQFPRVNDANPDLLARLKSKRRRIRRKIRLF-TFCKKLGSYSLVISHI  240

Query  785   AFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSR-----KGLYMPLDVAA  949
             A +IT   +A+H ++  +A P L+ L   + KK  + K    S+     + L   +D+AA
Sbjct  241   AIVITLLTVALHSILGVLAAPALLGLCCLLRKKKTKRKMKNKSKTDTKLEKLGAQMDIAA  300

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWAL  1129
             KG F+++NDL T+SRL GRL DE+EH K +A + A     +VLKE +  + F   EE   
Sbjct  301   KGTFIMMNDLDTLSRLAGRLCDEIEHRKAVAAMCAKSGKVEVLKEAL--RVFNGHEERFS  358

Query  1130  EVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             E+L+ELE+H+YLCF  I  SRR+++ +  G
Sbjct  359   ELLQELEEHLYLCFHTINISRRLVLAQTTG  388



>ref|XP_010671658.1| PREDICTED: UPF0496 protein At3g49070 [Beta vulgaris subsp. vulgaris]
Length=372

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 112/365 (31%), Positives = 174/365 (48%), Gaps = 52/365 (14%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSP  364
             EY  AFRT SY E + +V     A   K+ V  ++    TS++   S  L + H   P  
Sbjct  34    EYANAFRTESYNEFWARV----LALTHKDSVARESKGS-TSATRLLSYRLFAEHLLEPDQ  88

Query  365   GC--KLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKK  538
                 KLL   +N    P+  S    LL+ YF  T  A  +C  LLK   Q R  YK++KK
Sbjct  89    PTVTKLLSFTQNQ---PKNTS----LLSNYFEQTANASILCGQLLKDTDQLRIRYKALKK  141

Query  539   AVEKIEELGLSSEEQVN-------RAYGEIASLSLFGNTLSAV-RFDDVRDDHLGLLSRL  694
              + K  E+  +     N       R      S++ F +  S + RF  V+     LL +L
Sbjct  142   TL-KYFEVPQNPSSSTNHLPTILMRLVKITKSINPFVHPSSLLTRFQAVKSGCSELLKQL  200

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT-----ILAVHFVVCTMAVPG-LI  856
              S+R ++          K+ + ++L  G   F++  T     I+  HFV   MAVPG +I
Sbjct  201   ESRRDKVRA--------KLHVRNSLKAGSAIFLVALTTSITIIVLTHFVAMAMAVPGFII  252

Query  857   ALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
             A ++ +  K+L +              LD AAKG ++L  DL T+SRLV RL D++EH +
Sbjct  253   AYNVPISTKQLTKTS----------AQLDAAAKGTYILNRDLDTISRLVARLDDDLEHIR  302

Query  1034  TIADLWAMKHCDDVLKEVVS---SKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
              + + W M   +D L+       ++     +   ++ L ELE+H+YLCF+ I R+R ++V
Sbjct  303   AMVEFW-MDRAEDHLQAQAGEELARQLKKNDMKLIDQLDELEEHLYLCFMTINRARNLVV  361

Query  1205  QEIVG  1219
             +EI+ 
Sbjct  362   KEILD  366



>ref|XP_009368752.1| PREDICTED: UPF0496 protein At3g49070 [Pyrus x bretschneideri]
Length=271

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 138/270 (51%), Gaps = 33/270 (12%)
 Frame = +2

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEI  607
             H LL++YF  T +A  +C  LL  + +TR  Y+S+K  ++ +     S+ + + R     
Sbjct  16    HVLLSDYFTQTADASILCGLLLNDINRTRVKYQSIKSTLQSLN--NHSTPKTLTR-----  68

Query  608   ASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL-LIGCT  784
               L+ F   LS +R    +     LL RL S R +   R K   V K+ +GST+ L+  T
Sbjct  69    --LTRFTPILSLIRIQATQAGCSNLLKRLESTRDKA--RAKLQLVKKLRVGSTIFLVALT  124

Query  785   AFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFV  964
             A +    I+  H +   +A+P  +A SL     L   KR I     +   LD A KG ++
Sbjct  125   ASL--SVIVVTHAIALVVAMPAFLAASLD----LASPKRLIK----MTSQLDAATKGTYI  174

Query  965   LINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV------LKEVVSSKNFAIQEEWA  1126
             L  DL TVSRLV RL+DE+EH + +   W  +  +D       L   +   + + +++  
Sbjct  175   LNRDLETVSRLVARLNDELEHMRRMVKFWVERGEEDWSQAGGELARQLKKNDCSFRQQ--  232

Query  1127  LEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                L ELE+H+YLCF+ I R+R ++V+EI+
Sbjct  233   ---LDELEEHLYLCFMTINRARNLVVKEIL  259



>ref|XP_007143548.1| hypothetical protein PHAVU_007G080900g [Phaseolus vulgaris]
 gb|ESW15542.1| hypothetical protein PHAVU_007G080900g [Phaseolus vulgaris]
Length=362

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 106/370 (29%), Positives = 166/370 (45%), Gaps = 61/370 (16%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             KS +   EY    RT  YV+ Y+KVQ  L A +       DN                  
Sbjct  30    KSINFHDEYHRTLRTKPYVDFYNKVQ--LLANQPSINYSHDN------------------  69

Query  344   HESLPSPGCKLLL--CQENMEELPQQAS-NAHP----LLNEYFLLTLEACAICESLLKIV  502
                      K+LL  CQE +  +    + +  P    L+  YF ++ EA  IC  LLK +
Sbjct  70    -------FSKVLLEPCQETISSIVDSGTLSKTPKLKNLMLSYFDISAEASHICCHLLKSI  122

Query  503   LQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDD---VRDDH  673
              Q  + Y+ V++ ++  +     + E V     E+ S +   + LS ++  D   + D H
Sbjct  123   SQIHSYYQFVQRVLDIKDGDSFETFEVV---IFELNSFTYSNDPLSNLKNHDFKLINDKH  179

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               +L  L S R R+ R+ K ++         +   C    IT  ++A H     +  P +
Sbjct  180   SSVLCHLKSMRRRVARKIKLMKYLMKTSWFCVTAACGLVAITAMVIATHTFTAVILGPAI  239

Query  854   IALSLGMVKKLKEAKRGIP-SRKG----LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             ++      K LK   RG   SRKG    +Y  LD+AAKG ++L  D  T+SRLV RL DE
Sbjct  240   LSFPF---KHLKRKLRGYKFSRKGSLSKVYDQLDIAAKGTYILNRDFDTMSRLVSRLHDE  296

Query  1019  MEHNKTIADLWAMKHCDDVLKEVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIV  1183
             +EHN+T+   + +   D +  +VV     S   F  Q E       ELE+H+YLC   I 
Sbjct  297   IEHNRTMVQ-FCLDRKDKLSLQVVGELRKSDVGFRKQVE-------ELEEHVYLCLATIN  348

Query  1184  RSRRMIVQEI  1213
             ++R ++++E+
Sbjct  349   QARTLVIREM  358



>ref|XP_007143549.1| hypothetical protein PHAVU_007G080900g [Phaseolus vulgaris]
 gb|ESW15543.1| hypothetical protein PHAVU_007G080900g [Phaseolus vulgaris]
Length=356

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 106/370 (29%), Positives = 166/370 (45%), Gaps = 61/370 (16%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             KS +   EY    RT  YV+ Y+KVQ  L A +       DN                  
Sbjct  24    KSINFHDEYHRTLRTKPYVDFYNKVQ--LLANQPSINYSHDN------------------  63

Query  344   HESLPSPGCKLLL--CQENMEELPQQAS-NAHP----LLNEYFLLTLEACAICESLLKIV  502
                      K+LL  CQE +  +    + +  P    L+  YF ++ EA  IC  LLK +
Sbjct  64    -------FSKVLLEPCQETISSIVDSGTLSKTPKLKNLMLSYFDISAEASHICCHLLKSI  116

Query  503   LQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDD---VRDDH  673
              Q  + Y+ V++ ++  +     + E V     E+ S +   + LS ++  D   + D H
Sbjct  117   SQIHSYYQFVQRVLDIKDGDSFETFEVV---IFELNSFTYSNDPLSNLKNHDFKLINDKH  173

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL  853
               +L  L S R R+ R+ K ++         +   C    IT  ++A H     +  P +
Sbjct  174   SSVLCHLKSMRRRVARKIKLMKYLMKTSWFCVTAACGLVAITAMVIATHTFTAVILGPAI  233

Query  854   IALSLGMVKKLKEAKRGIP-SRKG----LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             ++      K LK   RG   SRKG    +Y  LD+AAKG ++L  D  T+SRLV RL DE
Sbjct  234   LSFPF---KHLKRKLRGYKFSRKGSLSKVYDQLDIAAKGTYILNRDFDTMSRLVSRLHDE  290

Query  1019  MEHNKTIADLWAMKHCDDVLKEVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIV  1183
             +EHN+T+   + +   D +  +VV     S   F  Q E       ELE+H+YLC   I 
Sbjct  291   IEHNRTMVQ-FCLDRKDKLSLQVVGELRKSDVGFRKQVE-------ELEEHVYLCLATIN  342

Query  1184  RSRRMIVQEI  1213
             ++R ++++E+
Sbjct  343   QARTLVIREM  352



>ref|XP_008806164.1| PREDICTED: putative UPF0496 protein 2 [Phoenix dactylifera]
Length=323

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 103/361 (29%), Positives = 159/361 (44%), Gaps = 77/361 (21%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             +V  EY  AFR+ SY +I  +VQ  L    SK      +   L        S +I     
Sbjct  24    AVKEEYRGAFRSKSYTDICTQVQKHLKTTSSKRKSRNQDYTHLLEPKQEVLSSIIHCTTH  83

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             LPS                        LL +YF  +L AC +C SL++ + Q RAD++ +
Sbjct  84    LPS------------------------LLLDYFDASLHACNLCGSLIESIDQARADHRIL  119

Query  533   KKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSA---VRFDDVRDDHLGLLSRLTSK  703
             ++ +E +      +E+Q +     +   S   N  S     RF+ + + +  +  +L S 
Sbjct  120   RRVLE-LATASQCTEDQHHSMASNLVLFSKLDNPFSGPNPTRFERIHEAYGSMARQLVSA  178

Query  704   RGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKK  883
               ++ RR   LR   + +G    IG                  + A  G+IA    MV+ 
Sbjct  179   HRKLMRR---LRCMNLGVG----IG------------------SAATCGVIA----MVEN  209

Query  884   LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL-----  1048
             +   + G  +R+G    LD AA+G F L     T+SR+V RL DE+EH + +  L     
Sbjct  210   VVVGEEGSVAREG--SQLDAAARGAFALDRGFDTMSRMVRRLHDEVEHGRDVIRLFMEEE  267

Query  1049  -----WAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                  W M      L+EVV  +   + E   +E L ELE+H+ LCFLNI  +RRM+++EI
Sbjct  268   DMEGGWMM------LREVV--RELQLSEGRFMEQLAELEEHVCLCFLNINSARRMVLEEI  319

Query  1214  V  1216
             V
Sbjct  320   V  320



>gb|KCW70525.1| hypothetical protein EUGRSUZ_F03728 [Eucalyptus grandis]
Length=323

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 104/326 (32%), Positives = 161/326 (49%), Gaps = 49/326 (15%)
 Frame = +2

Query  266   KEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNE  445
             ++ +G  ++  L+S+   S  P +   ++L SP       QE + EL +   N HPL   
Sbjct  32    QDQLGKPSSLKLSSAPLKSQIPYLHLSQNLLSPR------QETLIELIK-TLNLHPLFVN  84

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAV---EKIEELGLSSEEQVNRAYGEIASL  616
             YF   LEAC +CE L+  V Q RA+ + ++KA+   +KI++    ++ Q      E+++ 
Sbjct  85    YFKDGLEACRVCELLILSVHQIRANNQWIEKAIKLTKKIDDATSGTDNQCRMICEELSAF  144

Query  617   SLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
             S   N    V   +F DV       L +L +K  +  RR K  R+ K ++GS   +GCT 
Sbjct  145   SRQMNPFCLVSKEKFHDVCQAFAMRLRKLKAKHKKTMRRAKLKRIAK-SMGS---MGCT-  199

Query  788   FMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPS---RKGLYMPLDVAAKGL  958
                                       LG+ KK  +  +G P    ++ L + LDVAAKG 
Sbjct  200   --------------------------LGLQKKRIKPVQGNPKMTRQEVLGVQLDVAAKGH  233

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             F LIN ++T+S + G L DE+EH K  A++       D +KEVV  K+F  +  + LE L
Sbjct  234   FTLINYMATMSIVAGSLYDEVEHMKVRANMCVQSGKSDTIKEVV--KSFDQRNTYFLEQL  291

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIV  1216
             +ELE    LC  +I  SRR I++EI+
Sbjct  292   EELENQACLCLRDINASRRSIMKEIM  317



>ref|XP_007038771.1| Uncharacterized protein TCM_015222 [Theobroma cacao]
 gb|EOY23272.1| Uncharacterized protein TCM_015222 [Theobroma cacao]
Length=593

 Score =   114 bits (285),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 109/367 (30%), Positives = 166/367 (45%), Gaps = 47/367 (13%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPL--TssssssssPLI  337
             +S  V  EY  AFRT SY + + +V   LA +    I       P+  T+++  SS  L 
Sbjct  167   RSIDVREEYANAFRTESYNDFWTRV---LAIS---HIDSATCISPIDSTTAARLSSYRLF  220

Query  338   SGHESLPS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTR  514
             + H   P  P    +L       L Q     H LL +YF  T  A  +C  LLK +  TR
Sbjct  221   AEHLLDPDQPTVSRILT------LIQNRPTTHSLLLDYFSQTANASLLCGLLLKDIDHTR  274

Query  515   ADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL--------SAVRFDDVRDD  670
               Y+S + + + +E    S+  Q     G +  L  F N+         S+ R   ++  
Sbjct  275   VKYRSFRTSFQALEIAQFSNGNQF---LGIVTRLIEFSNSPNPFLSTAPSSSRVRVIQAG  331

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT-----ILAVHFVVCT  835
                LL RL S R +           K+ L ++L  G   F++  T     I+A H +   
Sbjct  332   CCDLLERLESSRDKAR--------AKLHLINSLQHGSGVFLVALTASLTIIVASHALALV  383

Query  836   MAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSD  1015
             +A PGLIA SL +    + A+            LD AAKG ++L  DL T+SRLV RL+D
Sbjct  384   VAAPGLIAASLELASMRRLARES--------AQLDAAAKGTYILNRDLDTISRLVARLND  435

Query  1016  EMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRR  1195
             E+E    +   W  +  D +      ++     +    + L ELE+H+YLCF+ I R+R 
Sbjct  436   ELEDMSAMVKFWLDRGEDRLQASGEVARQLKKNDANFTQQLDELEEHLYLCFMTINRARN  495

Query  1196  MIVQEIV  1216
             ++V+EI+
Sbjct  496   LVVREIL  502



>ref|XP_010930967.1| PREDICTED: UPF0496 protein At1g20180-like [Elaeis guineensis]
Length=357

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 103/357 (29%), Positives = 165/357 (46%), Gaps = 31/357 (9%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             KS SV+ EY+   RT SYVE   K   QL A    +    +N    T         L   
Sbjct  22    KSVSVNEEYLNVLRTQSYVEFTTK--AQLLANEHSDTSKSNNYAMETL--------LQPE  71

Query  344   HESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
              +++PS     LL      + P   S+   L+  YF  + EA  IC  LL+ + +T + Y
Sbjct  72    QDAIPS-----LLKAPIFTKAP---SDLKLLITSYFETSAEASRICGHLLRSINETHSHY  123

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL---SAVRFDDVRDDHLGLLSRL  694
             + +++    +   G  S   +     E+ S ++  N     S   F+ + D +  +L  L
Sbjct  124   QCIQRI---LRNFGDHSPADMKSTISELDSFAVLSNPFPNPSQQDFNLIHDQYSSILHHL  180

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALS-LG  871
               KR ++ RR K +   K   G +L + C    +   ++AVH +   +  P L+ LS L 
Sbjct  181   KLKRNKVARRNKLIECIKKVSGISLTVICGVVALVAIVIAVHSLSGFLMGPALMGLSPLN  240

Query  872   MVKKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIAD  1045
             + KK    K    S+  K L   LDVAAKG ++L  D  T+SRLV  L +E+EH   +  
Sbjct  241   LRKKFSNLK-CFQSQFLKKLEDQLDVAAKGTYILNRDFDTMSRLVASLYNEVEHYIEMIR  299

Query  1046  LWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                 +  D   L+EVV  K    +     + +KEL++H+ LC + I ++R ++++EI
Sbjct  300   FCLKRREDKFPLQEVV--KELKRRSHGFKQQVKELQEHVCLCLVTINKARLLVIKEI  354



>ref|XP_002306700.2| hypothetical protein POPTR_0005s21510g [Populus trichocarpa]
 gb|EEE93696.2| hypothetical protein POPTR_0005s21510g [Populus trichocarpa]
Length=269

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/274 (30%), Positives = 136/274 (50%), Gaps = 25/274 (9%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIAS  613
             +LN YF L+ EA  +C  L+K + Q ++ Y+ +++ +  I++    S +++     E+ S
Sbjct  1     MLN-YFDLSAEASNVCSYLVKNINQIQSSYQFIQRVLNSIDDY---SPDKLKLIVSELNS  56

Query  614   LSLFGNTLSAVRFDD---VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCT  784
               +  N  S     D   + D +  +L+ L SKR ++ R+ K +     A G  +   C 
Sbjct  57    FIVQSNPFSTPNKHDFKLINDRYSSVLNHLKSKRKKVARKMKFIAYIHKASGICITAACG  116

Query  785   AFMITFTILAVHFVVCTMAVPGLIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAK  952
                I+  +LA H +   +  P +++  L   KK     K  + G   + G    LDVAAK
Sbjct  117   LIAISAIVLAAHTLTVVVMGPAILSFPLKRFKKKLLSFKFLRSGFLRKVG--QQLDVAAK  174

Query  953   GLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD----DVLKEVVSSKN-FAIQE  1117
               ++L  D  T+SRLV RL DE+EH+K +      +  D     V+KE+  S + F  Q 
Sbjct  175   ATYILNRDFDTMSRLVARLHDEVEHDKAMIQFCLERKEDRFSFQVIKELKKSDSGFRKQV  234

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             E       ELE+H+YLC L I R+R ++++E+  
Sbjct  235   E-------ELEEHVYLCLLTINRARALVIKEMTA  261



>ref|XP_008781640.1| PREDICTED: UPF0496 protein At1g20180-like [Phoenix dactylifera]
Length=356

 Score =   110 bits (274),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 168/359 (47%), Gaps = 35/359 (10%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             KS SV+ EY+ A RT SYVE+  K   QL A    +    +N    T         L   
Sbjct  21    KSISVNKEYLNALRTQSYVELTTK--AQLLANEHSDTPKSNNYAMETL--------LKPD  70

Query  344   HESLPSPGCKLLLCQENMEELP---QQASNAHPLLNEYFLLTLEACAICESLLKIVLQTR  514
              +++PS           + E P   +  S+   L++ YF  + EA  IC  LL+ + +T 
Sbjct  71    QDAIPS-----------LLEAPIFTKAQSDLKLLISSYFETSAEASRICGHLLRSINETH  119

Query  515   ADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL---SAVRFDDVRDDHLGLL  685
             + Y+ +++ ++   +    S   +     E+ S +L  N     S   F  + D +  +L
Sbjct  120   SHYQCIQRILKNFSD---HSPAGMKSTISELDSFALLSNPFPNPSQQDFKLIHDQYSSIL  176

Query  686   SRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALS  865
               L  KR ++ RR K +   K   G +L + C    +   ++AVH +   +  P L+ LS
Sbjct  177   HHLKLKRSKVARRIKLIECIKKVSGISLTVVCGVVGLVAIVIAVHSLSGFLMGPALMGLS  236

Query  866   LGMVKKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTI  1039
                +KK     +   S+  + L   LD AAKG ++L  D  T+S+LV  L +E+EH K +
Sbjct  237   PLHLKKKSSNLKYFQSKFLRKLDDQLDAAAKGTYILNRDFDTMSQLVASLYNEVEHYKAM  296

Query  1040  ADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                   +  D   L+EV+  K    + +   + ++EL++H+ LC + I R+R ++++EI
Sbjct  297   IRFCLERREDKFPLQEVM--KELKRRSQVFKQQVEELQEHVCLCLVTINRARVLVIKEI  353



>gb|KDP30764.1| hypothetical protein JCGZ_15193 [Jatropha curcas]
Length=373

 Score =   109 bits (273),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 96/354 (27%), Positives = 162/354 (46%), Gaps = 17/354 (5%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             +S +V+ EY++A RT SY++ + K Q  +    S                S     L   
Sbjct  23    QSLNVNEEYVSALRTQSYIDFFAKAQSLVNEPPSSSSPLSPFPSSCYKKFSEFL--LEPD  80

Query  344   HESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
              E++P+    +L       ++P+  +    L+  YF ++ EA  IC  LL  + Q ++ Y
Sbjct  81    QETIPA----ILESTTIFSKIPELKT----LILNYFEISAEASKICSHLLTNISQIQSHY  132

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRL  694
             + +++ ++   +    S E+V     E+ S     N  S+     F  + + +   L+ L
Sbjct  133   QYIQRVIDTTIDDFDYSPEKVKLIVSELNSFIFQRNPFSSPNKHEFKLIHEKYSLALNHL  192

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM  874
               KR ++ R+ K +     A G  +   C    I+  +LA H +   +  P +    L  
Sbjct  193   KLKRKKVARKIKLMTCIHKASGVCITAACCLIAISAIVLAAHTLTALVMGPVIFGFPLKS  252

Query  875   VKK-LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW  1051
              KK     + G    KG    LDVAAKG ++L  D  T+SRLVGRL DE+EHNK +    
Sbjct  253   FKKSFGFLRSGSYLMKGC-QQLDVAAKGTYILNRDFDTMSRLVGRLHDEVEHNKEVIKFC  311

Query  1052  AMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
               +       +VV  K     +    + ++ELE+HIYLC L I R+R ++++E+
Sbjct  312   LERREHKFFLQVV--KELKKGDVGFRKQIEELEEHIYLCLLTINRARGLVIKEM  363



>ref|XP_004496535.1| PREDICTED: UPF0496 protein At3g49070-like isoform X1 [Cicer arietinum]
 ref|XP_004496536.1| PREDICTED: UPF0496 protein At3g49070-like isoform X2 [Cicer arietinum]
 ref|XP_004496537.1| PREDICTED: UPF0496 protein At3g49070-like isoform X3 [Cicer arietinum]
Length=366

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 105/364 (29%), Positives = 162/364 (45%), Gaps = 51/364 (14%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY  AFRT SY+E +  V     A   K  +  + +   T+S+   S  L + H   
Sbjct  36    VREEYANAFRTESYIEFWTHVVEYSNAECRKSCLSTEES---TTSTRLPSYRLFAEHLLD  92

Query  356   PS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             P  P    +L Q  ++  P+     H LL +YF  T  A  +C  LLK +   R  Y+S+
Sbjct  93    PDQPTVTQILAQTKLQ--PE----IHSLLKDYFTHTANASLLCSHLLKDIDSVRVKYRSL  146

Query  533   KKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL--------SAVRFDDVRDDHLGLLS  688
                ++ +      S  Q+      +A L  F N+L        S  R      +   L  
Sbjct  147   NTILQCV------STNQIPSPIV-VAHLIEFSNSLNPFSISGPSPCRVRVSLGNCFDLQK  199

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
             RL S R     + K + + K      +++  TA ++   +   H     +A+PGL  ++L
Sbjct  200   RLESSRDNARAKLKMVTMLKRCSNCFVVVVITASLVVLVV--AHGFALLVAMPGLALMNL  257

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
                +KL +          +   LD AAKG ++L  DL T SRLV RL+DEMEH + +   
Sbjct  258   ASKRKLTK----------VTAQLDAAAKGTYILNKDLETTSRLVARLNDEMEHLRVMVKF  307

Query  1049  WAMKHCDDVLK--EVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
             W  +  D +    EVV     +  NF+ Q       L ELE+H+YLCF+ I R+R +++ 
Sbjct  308   WLERKEDKIQADGEVVRLLKKNQCNFSDQ-------LDELEEHLYLCFMTINRARNLVLN  360

Query  1208  EIVG  1219
             +I  
Sbjct  361   QITD  364



>emb|CDP05163.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   109 bits (273),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 180/371 (49%), Gaps = 39/371 (11%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPS-  361
             EY  AFRT S+ E +++V      A  K      +T   T++S   S  L   H   P  
Sbjct  23    EYANAFRTESFNEFWERV-----LALGKGNSAAHSTLGSTTASRLPSYRLFVDHLLDPDQ  77

Query  362   PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKA  541
             P    +L      +   QA     LL++YF  T  A  +C  LL+ V QTR  YKS+KK 
Sbjct  78    PTVTRILDLTRTRDPQSQA-----LLSDYFFETANASFLCSHLLRDVDQTRIKYKSLKKT  132

Query  542   VEKIEEL-------GLSSEEQVNRAYGEIASLSLFGNTLSAV-RFDDVRDDHLGLLSRLT  697
             ++ +  +        L      +R    + S++ F  + S+  R   V+     LL RL 
Sbjct  133   LDALPPIVQISPIIPLPVSSNHHRLLEFLKSVNPFVPSASSPDRIQMVQTHCSDLLKRLE  192

Query  698   SKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMV  877
             S R +   R K   + K+  GS + +      +T  I A H +   +A P LIA SL +V
Sbjct  193   SSRDKA--RVKLDLIAKLERGSAVFLVVLTASLTI-IAAAHALALLVAAPCLIATSLELV  249

Query  878   KKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAM  1057
                K+  RG          LD AAKG ++++ DL T+SRLVGRLSDE++H  ++   +++
Sbjct  250   SA-KKLARG-------SAQLDAAAKGTYIVVRDLDTISRLVGRLSDELDHMHSVVR-FSL  300

Query  1058  KHCDDVLKEVVSSKNFAIQEEWA--LEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV*P  1231
             +  DD L+   +S   A Q +     + L ELE+H+YLCF+ I R+R ++++EI+    P
Sbjct  301   ERGDDRLQ---ASGEVARQLKLNGFTDQLDELEEHLYLCFMTINRARNLVLKEILD---P  354

Query  1232  AHLAKSAISFA  1264
              H   ++ S +
Sbjct  355   GHPTSNSASVS  365



>gb|KGN50304.1| hypothetical protein Csa_5G166480 [Cucumis sativus]
Length=356

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 170/363 (47%), Gaps = 42/363 (12%)
 Frame = +2

Query  167   SSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH  346
              + V  EY  AFRT SY++ + +V     A  + + +    +   T+++  SS  L   H
Sbjct  14    DTDVGEEYANAFRTESYIDFWTRV----VALNNGDNLTAQVSLESTTATRLSSYRLFVEH  69

Query  347   -ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
                 P P  K +L        P   S    LL+ YF  T  A  +C  +LK ++  R   
Sbjct  70    LLDPPQPTIKTILTAHLG---PNSCS---LLLDHYFSHTANASLLCSRILKQIVHLRLKL  123

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLG---LLSRL  694
              S+ +  ++        ++ + R + E ++ S   N+      + V+    G   LL RL
Sbjct  124   HSLDQNKQEFNHDDSHFKQLLVRLF-EFSNDST-PNSFVPYCMEQVQIIQNGCSKLLKRL  181

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV-HFVVCTMAVPGLIALSLG  871
                R +   + KR+R F+ +  +  L+  TA   +FT++ V H +   +A PG +  ++ 
Sbjct  182   EYSRDKTRDKLKRVRYFQHS-SAGFLVAITA---SFTVIVVTHGIALFVAAPGFLVGAIK  237

Query  872   MVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW  1051
             + KK ++  + +         L+VAAKG + L  D  T+ RLV RLS E+EH K +A  W
Sbjct  238   LAKKSRKLAKEVAQ-------LNVAAKGTYTLNRDFDTIGRLVARLSHELEHMKVMAKFW  290

Query  1052  AMKHCDD--VLKEVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
               K  D    + E+      S +NF  Q       L ELE+H+YLCF+ I R+R ++V+E
Sbjct  291   LDKGGDKRWAIDELARQLNQSHENFNQQ-------LDELEEHLYLCFMTINRARNLVVKE  343

Query  1211  IVG  1219
             I+ 
Sbjct  344   ILN  346



>emb|CAN76069.1| hypothetical protein VITISV_028178 [Vitis vinifera]
Length=453

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/376 (26%), Positives = 159/376 (42%), Gaps = 91/376 (24%)
 Frame = +2

Query  134   SNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTsss  313
             S+  +    R+S +V+ EY+ A RT SY + + K Q                        
Sbjct  144   SDGKDSEKARRSLNVNEEYLCALRTKSYADFFTKAQ------------------------  179

Query  314   sssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAH--------------PLLNEYF  451
                   L+    S PS  C +   +  +E  P Q + A                L+  YF
Sbjct  180   ------LLVKQPSSPSNYCHVKFSEVLLE--PGQDTIADILESAILSKKPELKGLILNYF  231

Query  452   LLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGN  631
              ++ EA  IC  LLK + Q  A+Y+ +++ ++  +       E +         L+   +
Sbjct  232   DMSAEASKICSHLLKSISQLLANYQFIQRVLDTTDNYSPDGFESMMSQLNSFIILNNPFS  291

Query  632   TLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTIL  811
             +LS   F  +RD +  +L  L SKR  + R+ K ++ FK A G  + +G           
Sbjct  292   SLSKHDFKQIRDKYSSVLHHLKSKRKSVARKIKLIKYFKKASGVFVTVGF----------  341

Query  812   AVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVS  991
                         GL+A++                     M LDVAAKG ++L  D  T+S
Sbjct  342   ------------GLVAVTA--------------------MQLDVAAKGTYILNRDFDTMS  369

Query  992   RLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQHIYLC  1168
             RLV RL DE+EHNK +      +  D   L+EVV  K     +    + ++ELE+H+YLC
Sbjct  370   RLVARLHDEVEHNKAMIQFCLERREDRFSLQEVV--KELKKSDIGFRKQVEELEEHVYLC  427

Query  1169  FLNIVRSRRMIVQEIV  1216
              + I R+R ++++E++
Sbjct  428   LVTINRARALVIKEMI  443



>ref|XP_006434470.1| hypothetical protein CICLE_v10003841mg [Citrus clementina]
 gb|ESR47710.1| hypothetical protein CICLE_v10003841mg [Citrus clementina]
Length=358

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 98/373 (26%), Positives = 172/373 (46%), Gaps = 36/373 (10%)
 Frame = +2

Query  131   NSNENEGSL--GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLT  304
             NS  ++  L   RKS +++ EY++A RT S+ E   K Q  +    S          P  
Sbjct  9     NSRRDDEELREARKSLNINEEYLSALRTKSFAECLSKAQLFVTEPSS----------PSC  58

Query  305   ssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICE  484
                      L    +++PS     +L    + ++P+       LL  YF ++ EA +IC 
Sbjct  59    RHEKFCEILLEPDQDTIPS-----ILESAVLSKVPELKD----LLLNYFDISAEASSICG  109

Query  485   SLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLS---AVRFD  655
              LLK +   R +Y+ ++ A++  ++      ++V      + SL +  N  S      F 
Sbjct  110   QLLKNINDVRYEYRFIQLALDTADDDQTEPHDKVKLIVSNLNSLIILTNPFSNPSTNEFK  169

Query  656   DVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCT  835
              + D +  +L  L SKR ++ R+ K +     A G  +   C+   I   ++A H +   
Sbjct  170   VIHDKYSSVLHNLKSKRKKVARKIKLINYVHKASGICITAVCSLIAIAAVVVAAHALTAL  229

Query  836   MAVPGLIALSLGMVKKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRL  1009
             +  P +++      KK     R + S   + +   LDVAAKG ++L  D  T+ RLV RL
Sbjct  230   LIGPMILSFPTKCFKKKPFNFRFLRSGFLRKVRKQLDVAAKGTYILNRDFDTMGRLVARL  289

Query  1010  SDEMEHNKTIADLWAMKHCDD----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLN  1177
              DE+EHNK +      +  D     V+KE +   +   Q++     ++ELE+H+YLC + 
Sbjct  290   HDEVEHNKVMIQFCLDRREDKFALHVMKE-IKKNHVGFQKQ-----VEELEEHVYLCLVT  343

Query  1178  IVRSRRMIVQEIV  1216
             I R+R  +++E++
Sbjct  344   INRARSQVIKEMI  356



>ref|XP_004143745.1| PREDICTED: UPF0496 protein At3g49070-like, partial [Cucumis sativus]
Length=353

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 170/363 (47%), Gaps = 42/363 (12%)
 Frame = +2

Query  167   SSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH  346
              + V  EY  AFRT SY++ + +V     A  + + +    +   T+++  SS  L   H
Sbjct  11    DTDVGEEYANAFRTESYIDFWTRV----VALNNGDNLTAQVSLESTTATRLSSYRLFVEH  66

Query  347   -ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
                 P P  K +L        P   S    LL+ YF  T  A  +C  +LK ++  R   
Sbjct  67    LLDPPQPTIKTILTAHLG---PNSCS---LLLDHYFSHTANASLLCSRILKQIVHLRLKL  120

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLG---LLSRL  694
              S+ +  ++        ++ + R + E ++ S   N+      + V+    G   LL RL
Sbjct  121   HSLDQNKQEFNHDDSHFKQLLVRLF-EFSNDST-PNSFVPYCMEQVQIIQNGCSKLLKRL  178

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV-HFVVCTMAVPGLIALSLG  871
                R +   + KR+R F+ +  +  L+  TA   +FT++ V H +   +A PG +  ++ 
Sbjct  179   EYSRDKTRDKLKRVRYFQHS-SAGFLVAITA---SFTVIVVTHGIALFVAAPGFLVGAIK  234

Query  872   MVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW  1051
             + KK ++  + +         L+VAAKG + L  D  T+ RLV RLS E+EH K +A  W
Sbjct  235   LAKKSRKLAKEVAQ-------LNVAAKGTYTLNRDFDTIGRLVARLSHELEHMKVMAKFW  287

Query  1052  AMKHCDD--VLKEVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
               K  D    + E+      S +NF  Q       L ELE+H+YLCF+ I R+R ++V+E
Sbjct  288   LDKGGDKRWAIDELARQLNQSHENFNQQ-------LDELEEHLYLCFMTINRARNLVVKE  340

Query  1211  IVG  1219
             I+ 
Sbjct  341   ILN  343



>ref|XP_002322490.1| hypothetical protein POPTR_0015s12800g [Populus trichocarpa]
 gb|EEF06617.1| hypothetical protein POPTR_0015s12800g [Populus trichocarpa]
Length=395

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 112/382 (29%), Positives = 178/382 (47%), Gaps = 78/382 (20%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY  AFRT SY   + ++Q               N  P T +        +   ES 
Sbjct  53    VREEYANAFRTESYNLFWARLQAL------------SNRDPTTCT--------VLAAEST  92

Query  356   PS----PGCKLLLCQENMEELPQQAS------------NAHPLLNEYFLLTLEACAICES  487
              S    P  +L +  EN+ + P Q++            + H LL++YF  T  A  +C  
Sbjct  93    TSAARLPSYRLFV--ENLLD-PDQSTVIRTLSLIHTRPSTHSLLSKYFTQTANASLLCGL  149

Query  488   LLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF---GNTLSAVRFDD  658
             LLK +   R  Y+S+K  +++I +    + E + R    + + + F   G+T S V+   
Sbjct  150   LLKDIDHIRVKYRSLKATLDQIPKTQFPNPEILTRVTEFVNARNPFDRSGSTPSRVQV--  207

Query  659   VRDDHLGLLSRLTSKRGRIERR---TKRLR----VFKVALGSTLLIGCTAFMITFTILAV  817
             ++ D   LL +L SKR + + +     +L+    +F VAL ++L I          I+A 
Sbjct  208   MQADCFKLLKQLESKRDKAKAKLNLKNKLKHSSAIFLVALTASLTI----------IIAT  257

Query  818   HFVVCTMAVPGLI-ALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSR  994
             H +   +A PGLI A SLG     +   R       +   LD AAKG ++L  DL T+SR
Sbjct  258   HALALLVATPGLITATSLGPGSSTRRLAR-------VAAQLDAAAKGTYILSRDLETISR  310

Query  995   LVGRLSDEMEHNKTIADLWAMKHCDD-------VLKEVVSSKNFAIQEEWAL-EVLKELE  1150
             LV R+ DEMEH  +    + ++  DD       +  E+V  +   I E  +    + +LE
Sbjct  311   LVNRVKDEMEHLHSTVK-YLVERGDDEGNWLHGINGELVVRQFSKINECCSFSNQVDDLE  369

Query  1151  QHIYLCFLNIVRSRRMIVQEIV  1216
             +H+YLCFL I R+R ++++EIV
Sbjct  370   EHLYLCFLTINRARNLVLKEIV  391



>gb|KFK34197.1| hypothetical protein AALP_AA5G114000 [Arabis alpina]
Length=370

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 174/383 (45%), Gaps = 41/383 (11%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             SK+K    + +   NS+   G        V  EY  AFRT SY + + +V   +   R K
Sbjct  7     SKIKRILASTAASGNSSPKVGD----DVDVREEYANAFRTESYNQFWTRV---ICLNRKK  59

Query  269   EIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEY  448
               V        ++S+   S  L +  ++L  P    +     + +L +       LL++Y
Sbjct  60    STVSSSPIKSSSTSARLMSYRLFA--QNLLDPDTNTV---TRILDLSRVGRLPRTLLSDY  114

Query  449   FLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQ---VNRAYGEIASLS  619
             FL T  A  +C  LLK + + R+ Y+S+K   +      L+  +    ++R +    S  
Sbjct  115   FLETANAFLLCTLLLKNIHRLRSKYESLKPKCQSENNNSLALMDHFTDLSRWFDPFTS--  172

Query  620   LFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMIT  799
                   S  R    +   L LL RL S R +   + K +     + G  L++  TA +I 
Sbjct  173   ------SGSRIQLTKSSCLNLLKRLESSRNKTRAKLKLINGLTHSSG-VLVLALTATLIV  225

Query  800   FTILAVHFVVCTMAVPGLIA---LSLGMVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVL  967
                +A H     +A P L+      +G+  KL K   R           LDVAAKG ++L
Sbjct  226   --TIASHAFALFIAGPTLLTGRFKPVGLRNKLTKNTAR-----------LDVAAKGAYIL  272

Query  968   INDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKEL  1147
               DL T+SRLV R++DE+EH + +AD W  +    V      ++     EE   E L EL
Sbjct  273   SRDLDTISRLVTRINDEVEHVRAMADFWVGRGSGRVRAGEEVARELKRCEENFSEELDEL  332

Query  1148  EQHIYLCFLNIVRSRRMIVQEIV  1216
             E+HIYLCF+ I R+R +++++I+
Sbjct  333   EEHIYLCFMTINRARNLVIRQIL  355



>ref|XP_004158156.1| PREDICTED: UPF0496 protein At3g49070-like [Cucumis sativus]
Length=371

 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 170/363 (47%), Gaps = 42/363 (12%)
 Frame = +2

Query  167   SSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH  346
              + V  EY  AFRT SY++ + +V     A  + + +    +   T+++  SS  L   H
Sbjct  29    DTDVGEEYANAFRTESYIDFWTRV----VALNNGDNLTAQVSLESTTATRLSSYRLFVEH  84

Query  347   -ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADY  523
                 P P  K +L        P   S    LL+ YF  T  A  +C  +LK ++  R   
Sbjct  85    LLDPPQPTIKTIL---TAHLGPNSCS---LLLDHYFSHTANASLLCSRILKQIVHLRLKL  138

Query  524   KSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLG---LLSRL  694
              S+ +  ++        ++ + R + E ++ S   N+      + V+    G   LL RL
Sbjct  139   HSLDQNKQEFNHDDSHFKQLLVRLF-EFSNDST-PNSFVPYCMEQVQIIQNGCSKLLKRL  196

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV-HFVVCTMAVPGLIALSLG  871
                R +   + KR+R F+ +  +  L+  TA   +FT++ V H +   +A PG +  ++ 
Sbjct  197   EYSRDKTRDKLKRVRYFQHS-SAGFLVAITA---SFTVIVVTHGIALFVAAPGFLVGAIK  252

Query  872   MVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW  1051
             + KK ++  + +         L+VAAKG + L  D  T+ RLV RLS E+EH K +A  W
Sbjct  253   LAKKSRKLAKEVAQ-------LNVAAKGTYTLNRDFDTIGRLVARLSHELEHMKVMAKFW  305

Query  1052  AMKHCDD--VLKEVV-----SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
               K  D    + E+      S +NF  Q       L ELE+H+YLCF+ I R+R ++V+E
Sbjct  306   LDKGGDKRWAIDELARQLNQSHENFNQQ-------LDELEEHLYLCFMTINRARNLVVKE  358

Query  1211  IVG  1219
             I+ 
Sbjct  359   ILN  361



>gb|KFK34198.1| hypothetical protein AALP_AA5G114000 [Arabis alpina]
Length=369

 Score =   107 bits (266),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 164/354 (46%), Gaps = 37/354 (10%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY  AFRT SY + + +V   +   R K  V        ++S+   S  L +  ++L
Sbjct  31    VREEYANAFRTESYNQFWTRV---ICLNRKKSTVSSSPIKSSSTSARLMSYRLFA--QNL  85

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
               P    +     + +L +       LL++YFL T  A  +C  LLK + + R+ Y+S+K
Sbjct  86    LDPDTNTV---TRILDLSRVGRLPRTLLSDYFLETANAFLLCTLLLKNIHRLRSKYESLK  142

Query  536   KAVEKIEELGLSSEEQ---VNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKR  706
                +      L+  +    ++R +    S        S  R    +   L LL RL S R
Sbjct  143   PKCQSENNNSLALMDHFTDLSRWFDPFTS--------SGSRIQLTKSSCLNLLKRLESSR  194

Query  707   GRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIA---LSLGMV  877
              +   + K +     + G  L++  TA +I    +A H     +A P L+      +G+ 
Sbjct  195   NKTRAKLKLINGLTHSSG-VLVLALTATLIV--TIASHAFALFIAGPTLLTGRFKPVGLR  251

Query  878   KKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWA  1054
              KL K   R           LDVAAKG ++L  DL T+SRLV R++DE+EH + +AD W 
Sbjct  252   NKLTKNTAR-----------LDVAAKGAYILSRDLDTISRLVTRINDEVEHVRAMADFWV  300

Query  1055  MKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              +    V      ++     EE   E L ELE+HIYLCF+ I R+R +++++I+
Sbjct  301   GRGSGRVRAGEEVARELKRCEENFSEELDELEEHIYLCFMTINRARNLVIRQIL  354



>ref|XP_009149769.1| PREDICTED: UPF0496 protein At3g49070 [Brassica rapa]
Length=371

 Score =   107 bits (266),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 112/369 (30%), Positives = 173/369 (47%), Gaps = 39/369 (11%)
 Frame = +2

Query  131   NSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTss  310
             NS+  +G        V  EY  AFRT SY + + +V   ++  R K  +   ++   +SS
Sbjct  20    NSSPKDGD----DVDVREEYANAFRTESYNQFWTRV---ISLNRKKPTLSSSSSPIESSS  72

Query  311   ssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESL  490
             +S+          +L  PG   +     + +L +    A  LL +YFL T  A  +C  L
Sbjct  73    TSARLMSYRLFAHNLLEPGPNTV---NRILDLSRVRRPARSLLADYFLETANAFLLCTLL  129

Query  491   LKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAY-GEIASLSLFGNTL--SAVRFDDV  661
             LK + + R+ Y+S+K            SE   + A+  +   LS + +    S  R    
Sbjct  130   LKNIHRLRSKYESLKPK--------FHSETHSSLAFLDQFTELSRWFDPFISSGSRIQLT  181

Query  662   RDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMA  841
             R   L LL RL S R +   + K +     + G  +L   T  ++T   +A H     +A
Sbjct  182   RTGCLSLLKRLESSRDKTRTKLKLINGLTHSSGLLVLALTTTLIVT---IASHAFALFIA  238

Query  842   VPGLIA---LSLGMVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRL  1009
              P L+      +G+  KL K A R           LDVAAKG ++L  DL T+SRLV R+
Sbjct  239   GPTLLTGRFKPVGLRNKLTKTAAR-----------LDVAAKGTYILSRDLDTISRLVTRI  287

Query  1010  SDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRS  1189
             +DE+EH + +A+ WA +    V      ++     EE   E L ELE+HIYLCF+ I R+
Sbjct  288   NDEVEHVRGMAEFWAGRGSGRVRGGEEVARELKRCEESFSEELDELEEHIYLCFMTINRA  347

Query  1190  RRMIVQEIV  1216
             R ++V+EI+
Sbjct  348   RNLVVREIM  356



>ref|XP_008436996.1| PREDICTED: UPF0496 protein At3g49070 isoform X1 [Cucumis melo]
Length=371

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 104/366 (28%), Positives = 175/366 (48%), Gaps = 42/366 (11%)
 Frame = +2

Query  170   SSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHE  349
             + V  EY  AFRT SY++ + +V     A  + + +    +   T+++  SS  L   H 
Sbjct  30    TDVGEEYANAFRTESYIDFWTRV----VALNNGDNLTAQVSLESTTATRLSSYRLFVEHL  85

Query  350   -SLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
                P P  K +L        P   S    LL+ YF  T  A  +C  +LK ++  R   +
Sbjct  86    LDPPQPTIKRML---TAHLGPNSCS---LLLDHYFSHTSNASLLCSRILKHIVHLRLKLR  139

Query  527   SVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLG---LLSRLT  697
             S+ +  ++      S  +Q+     E ++ S   N+      + V+    G   LL RL 
Sbjct  140   SLDQNKQEFN-YDDSHFKQLLVCLVEFSNNST-PNSFVPYCMEQVQIIQNGCSKLLKRLE  197

Query  698   SKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAV-HFVVCTMAVPGLIALSLGM  874
               R + + + KR+R F+ +  +  L+  TA   +FTI+ V H +   +A PG +  ++ +
Sbjct  198   YSRDKAQDKLKRVRYFQHS-SAGFLVAITA---SFTIIVVTHGIALFVAAPGFLVGAIKL  253

Query  875   VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWA  1054
             VKK ++  + +         L+VAAKG + L  D  T+ RLV RLS E+EH + +   W 
Sbjct  254   VKKSRKLAKKVAQ-------LNVAAKGTYTLNRDFDTIGRLVARLSHELEHMRVMTKFWL  306

Query  1055  MKHCD------DVLKEV-VSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
              +  D      ++L+++  S +NF  Q       L ELE+H+YLCF+ I R+R ++V+EI
Sbjct  307   DRGEDKRWAIGELLRQLNQSHENFNQQ-------LDELEEHLYLCFMTINRARNLVVKEI  359

Query  1214  VGRV*P  1231
             +    P
Sbjct  360   LDSSAP  365



>ref|XP_006404181.1| hypothetical protein EUTSA_v10010462mg [Eutrema salsugineum]
 gb|ESQ45634.1| hypothetical protein EUTSA_v10010462mg [Eutrema salsugineum]
Length=374

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 169/364 (46%), Gaps = 38/364 (10%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY  AFRT SY + + +V  QL+  +S            ++SS   S  L + +   
Sbjct  31    VREEYANAFRTESYNQFWTRVI-QLSRKKSTVSSSSSPIESSSTSSRLMSYRLFAHNLLD  89

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
             P P     +      +L +       LL++YFL T  A  +C  LLK V + R+ Y+S+K
Sbjct  90    PDPNTITRIL-----DLSRVGRPTRTLLSDYFLETANAFLLCTLLLKNVHRLRSKYESLK  144

Query  536   K--AVEKIEELGLSSEEQ---VNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTS  700
                 +E   +  L+  +Q   ++R +    S        S  R    R   L LL RL S
Sbjct  145   PKFQLENNNKDSLTFMDQFVELSRWFDPFLS--------SGSRIQLTRTGCLNLLKRLES  196

Query  701   KRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIA---LSLG  871
              R +   + K +     + G  +L   T  ++T   +A H     +A P L+      +G
Sbjct  197   SRDKTRAKLKLINGLTHSSGILVLALTTTLIVT---IASHAFALFIAGPTLLTGRFKPVG  253

Query  872   MVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
             +  +L K A R           LDVAAKG ++L  DL T+SRLV R++DE+EH + +A+ 
Sbjct  254   LRNRLTKTAAR-----------LDVAAKGTYILSRDLDTISRLVTRINDEVEHVRAMAEF  302

Query  1049  WAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV-GRV  1225
             W  +    V      ++     EE   E L ELE+HIYLCF+ I R+R ++V++I+   V
Sbjct  303   WVGRGSGRVRAGEEVARELKRCEESFGEELDELEEHIYLCFMTINRARNLVVRQILDSDV  362

Query  1226  *PAH  1237
              P H
Sbjct  363   SPPH  366



>gb|KEH43679.1| UPF0496 plant-like protein [Medicago truncatula]
Length=364

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 105/382 (27%), Positives = 172/382 (45%), Gaps = 31/382 (8%)
 Frame = +2

Query  95    MKSAFITKSPRRNSNENEGSLGRKSS-------SVSHEYMAAFRTNSYVEIYDKVQGQLA  253
             MK+    K  RR       S+ R SS        V  EY  AFRT SYVE + +V     
Sbjct  1     MKTEMKNKLVRRIKKMLPCSVCRSSSPNHQTHVDVREEYANAFRTESYVEFWTRVVSYSN  60

Query  254   AARSKEIVGGDNTFPLTssssssssPLISGHESLPS-PGCKLLLCQENMEELPQQASNAH  430
               + +  +  + +   T+S+   S  L + H   P  P    +L Q  ++  P+  S   
Sbjct  61    GPQRRSCLSREES---TTSTRLPSYRLFAEHLLDPDQPTVTQILTQTKLQ--PEIQS---  112

Query  431   PLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIA  610
              LL +YF  T  A  +C  LLK +   R  Y+S+   ++ +    + S + V        
Sbjct  113   -LLLDYFAYTSNASVLCSHLLKDIDGVRVKYRSLNTILQCVTTNQIPSPKVVAHLIEFSN  171

Query  611   SLSLFGNT-LSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
             SL+ F  +  S  R          L  +L S R     + K + +F+    + +++  TA
Sbjct  172   SLNPFSTSGPSPCRVRSTLCQCSELQKQLESSRDNARAKLKMVTMFE-HCSTCVVVVITA  230

Query  788   FMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVL  967
              ++   +   H     +A+PGL  ++LG  +KL +          +   LD AAKG ++L
Sbjct  231   SLVVLVM--AHGFALLVAMPGLALMNLGSKRKLTK----------VTAQLDAAAKGTYIL  278

Query  968   INDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKEL  1147
               DL T SRLV RL+DE EH +T+   W  +  D +  +    +     +    ++L EL
Sbjct  279   NKDLETTSRLVARLNDEFEHIRTMVKFWLERKEDKIQVDGEVGRLLKKNQCNFSDLLDEL  338

Query  1148  EQHIYLCFLNIVRSRRMIVQEI  1213
             E+H+YLCF+ I R+R +++ +I
Sbjct  339   EEHVYLCFMTINRARDLVLNQI  360



>ref|XP_009382157.1| PREDICTED: UPF0496 protein 3-like [Musa acuminata subsp. malaccensis]
Length=387

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 110/378 (29%), Positives = 168/378 (44%), Gaps = 39/378 (10%)
 Frame = +2

Query  125   RRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQG---QLAAARSKEIVGGDNTF  295
             RR   E    +   S ++S EY   FRT SY E + +V G      AA      G     
Sbjct  16    RREKCEVVAPISSSSFNLSEEYTNNFRTESYHEFWAQVLGLAFDDGAALDPRGSGTTARL  75

Query  296   PLTssssssssPLISGHESLPS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEAC  472
             P        S  L++ H   P  P    +L        P    + H LL++Y+  T +A 
Sbjct  76    P--------SHRLLAEHLLHPDQPTVTKILAHIRTRCRP----DIHALLSDYYAETADAS  123

Query  473   AICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL-----  637
              +C  LLK + Q R  Y+  K A+  +      S   +      +  +S   N       
Sbjct  124   LLCGLLLKDIGQIRRRYRPFKAALHSVI-YDSQSHHGLQTIIDNLVDISKTTNPFLSSAS  182

Query  638   SAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALG-STLLIGCTAFMITFTILA  814
             S  +F  V+     LL RL S+R ++  + + +   K AL  S +++   +  I    + 
Sbjct  183   SQSKFRAVQHGCADLLKRLGSRRKKVMAKLRFINRLKRALAISAVVVLAASASIVGACVT  242

Query  815   VHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSR  994
             +H +V       LIAL + +    + A    P R  +   LD AAKG ++L  DL T+SR
Sbjct  243   MHALV------ALIALPVFLSASSRMASSRWPGR--VMAQLDAAAKGTYILNRDLDTISR  294

Query  995   LVGRLSDEMEHNKTIADL--WAMKHCDDVLKEVVS--SKNFAIQEEWALEVLKELEQHIY  1162
             LV RL DE EH   +  L  W   H   + +EVV   SKN A   +     L ELE+H+Y
Sbjct  295   LVARLDDEAEHMLALLSLCEWHDGHRRRLTQEVVRQISKNLASFNQQ----LDELEEHLY  350

Query  1163  LCFLNIVRSRRMIVQEIV  1216
             LCF+ I ++RR++++E++
Sbjct  351   LCFMTINKARRLVMKELL  368



>ref|XP_003592217.1| hypothetical protein MTR_1g100200 [Medicago truncatula]
Length=366

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 105/382 (27%), Positives = 172/382 (45%), Gaps = 31/382 (8%)
 Frame = +2

Query  95    MKSAFITKSPRRNSNENEGSLGRKSS-------SVSHEYMAAFRTNSYVEIYDKVQGQLA  253
             MK+    K  RR       S+ R SS        V  EY  AFRT SYVE + +V     
Sbjct  3     MKTEMKNKLVRRIKKMLPCSVCRSSSPNHQTHVDVREEYANAFRTESYVEFWTRVVSYSN  62

Query  254   AARSKEIVGGDNTFPLTssssssssPLISGHESLPS-PGCKLLLCQENMEELPQQASNAH  430
               + +  +  + +   T+S+   S  L + H   P  P    +L Q  ++  P+  S   
Sbjct  63    GPQRRSCLSREES---TTSTRLPSYRLFAEHLLDPDQPTVTQILTQTKLQ--PEIQS---  114

Query  431   PLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIA  610
              LL +YF  T  A  +C  LLK +   R  Y+S+   ++ +    + S + V        
Sbjct  115   -LLLDYFAYTSNASVLCSHLLKDIDGVRVKYRSLNTILQCVTTNQIPSPKVVAHLIEFSN  173

Query  611   SLSLFGNT-LSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
             SL+ F  +  S  R          L  +L S R     + K + +F+    + +++  TA
Sbjct  174   SLNPFSTSGPSPCRVRSTLCQCSELQKQLESSRDNARAKLKMVTMFE-HCSTCVVVVITA  232

Query  788   FMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVL  967
              ++   +   H     +A+PGL  ++LG  +KL +          +   LD AAKG ++L
Sbjct  233   SLVVLVM--AHGFALLVAMPGLALMNLGSKRKLTK----------VTAQLDAAAKGTYIL  280

Query  968   INDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKEL  1147
               DL T SRLV RL+DE EH +T+   W  +  D +  +    +     +    ++L EL
Sbjct  281   NKDLETTSRLVARLNDEFEHIRTMVKFWLERKEDKIQVDGEVGRLLKKNQCNFSDLLDEL  340

Query  1148  EQHIYLCFLNIVRSRRMIVQEI  1213
             E+H+YLCF+ I R+R +++ +I
Sbjct  341   EEHVYLCFMTINRARDLVLNQI  362



>gb|AES62468.2| UPF0496 plant-like protein [Medicago truncatula]
Length=341

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 96/353 (27%), Positives = 164/353 (46%), Gaps = 24/353 (7%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             ++ + V  EY  AFRT SYVE + +V       + +  +  + +   T+S+   S  L +
Sbjct  7     QQCADVREEYANAFRTESYVEFWTRVVSYSNGPQRRSCLSREES---TTSTRLPSYRLFA  63

Query  341   GHESLPS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
              H   P  P    +L Q  ++  P+  S    LL +YF  T  A  +C  LLK +   R 
Sbjct  64    EHLLDPDQPTVTQILTQTKLQ--PEIQS----LLLDYFAYTSNASVLCSHLLKDIDGVRV  117

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNT-LSAVRFDDVRDDHLGLLSRL  694
              Y+S+   ++ +    + S + V        SL+ F  +  S  R          L  +L
Sbjct  118   KYRSLNTILQCVTTNQIPSPKVVAHLIEFSNSLNPFSTSGPSPCRVRSTLCQCSELQKQL  177

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGM  874
              S R     + K + +F+    + +++  TA ++   +   H     +A+PGL  ++LG 
Sbjct  178   ESSRDNARAKLKMVTMFE-HCSTCVVVVITASLVVLVM--AHGFALLVAMPGLALMNLGS  234

Query  875   VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWA  1054
              +KL +          +   LD AAKG ++L  DL T SRLV RL+DE EH +T+   W 
Sbjct  235   KRKLTK----------VTAQLDAAAKGTYILNKDLETTSRLVARLNDEFEHIRTMVKFWL  284

Query  1055  MKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
              +  D +  +    +     +    ++L ELE+H+YLCF+ I R+R +++ +I
Sbjct  285   ERKEDKIQVDGEVGRLLKKNQCNFSDLLDELEEHVYLCFMTINRARDLVLNQI  337



>gb|KEH43678.1| UPF0496 plant-like protein [Medicago truncatula]
Length=344

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 96/348 (28%), Positives = 162/348 (47%), Gaps = 24/348 (7%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY  AFRT SYVE + +V       + +  +  + +   T+S+   S  L + H   
Sbjct  15    VREEYANAFRTESYVEFWTRVVSYSNGPQRRSCLSREES---TTSTRLPSYRLFAEHLLD  71

Query  356   PS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             P  P    +L Q  ++  P+  S    LL +YF  T  A  +C  LLK +   R  Y+S+
Sbjct  72    PDQPTVTQILTQTKLQ--PEIQS----LLLDYFAYTSNASVLCSHLLKDIDGVRVKYRSL  125

Query  533   KKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNT-LSAVRFDDVRDDHLGLLSRLTSKRG  709
                ++ +    + S + V        SL+ F  +  S  R          L  +L S R 
Sbjct  126   NTILQCVTTNQIPSPKVVAHLIEFSNSLNPFSTSGPSPCRVRSTLCQCSELQKQLESSRD  185

Query  710   RIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLK  889
                 + K + +F+    + +++  TA ++   ++  H     +A+PGL  ++LG  +KL 
Sbjct  186   NARAKLKMVTMFE-HCSTCVVVVITASLVV--LVMAHGFALLVAMPGLALMNLGSKRKLT  242

Query  890   EAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD  1069
             +          +   LD AAKG ++L  DL T SRLV RL+DE EH +T+   W  +  D
Sbjct  243   K----------VTAQLDAAAKGTYILNKDLETTSRLVARLNDEFEHIRTMVKFWLERKED  292

Query  1070  DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
              +  +    +     +    ++L ELE+H+YLCF+ I R+R +++ +I
Sbjct  293   KIQVDGEVGRLLKKNQCNFSDLLDELEEHVYLCFMTINRARDLVLNQI  340



>gb|EYU41111.1| hypothetical protein MIMGU_mgv1a008146mg [Erythranthe guttata]
Length=383

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 105/384 (27%), Positives = 175/384 (46%), Gaps = 73/384 (19%)
 Frame = +2

Query  170   SSVSHEYMAAFRTNSYVEIYDKVQG-QLAAARSKEIVGGDNTFPLTssssssssPLISGH  346
             +SV+ EY+ A RT S+ +++ +VQ  QL           DN             P++   
Sbjct  27    TSVNQEYLCAVRTKSFADLFLQVQVLQL----------NDN-------------PILISS  63

Query  347   ESLPSPGCKLLLCQENMEELPQQAS-------NAH---PLLNEYFLLTLEACAICESLLK  496
             E L +PG      QE +  +   +S       ++H    LL +YF ++ +A + C  LLK
Sbjct  64    EFLLNPG------QETITSILDSSSLFSKNNKSSHVLKSLLLDYFQISADASSFCSHLLK  117

Query  497   IVLQTRADYKSVKKAV----------EKIEELGLSSEEQVNRAYGEIASLSL-------F  625
              +   ++ Y  + +             +  +   SS++Q    + E+ S  +       F
Sbjct  118   SLNHLQSYYNIIHQLTYNAIGNEHDHREYYDNYSSSDDQFGSVFSELRSCVVLINNSPKF  177

Query  626   GNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT  805
              N  +   F  + + H  +L +L   R ++ R+ K ++ F  A        C        
Sbjct  178   SNLNNKQEFKKIHEKHFSVLQQLKFNRKKVARKIKMVKCFNTASRVCATTACGLVAGAAV  237

Query  806   ILAVHFVVCTMAVPGLIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLIN  973
              LA H +   +  P + +L L  +K+    L+  K G+   + L   LD AAKG ++L  
Sbjct  238   FLAAHTLTLLLVGPAIFSLPLKPLKRKIRNLRFFKCGLL--RKLVDQLDAAAKGAYILNR  295

Query  974   DLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD----DVLKEVVSSKNFAIQEEWALEVLK  1141
             D  T+SRLVGRL DE+EHNK + +L   +  D     VLKE+   K + +  +  +E   
Sbjct  296   DFDTISRLVGRLRDEIEHNKKMIELCFERREDRLSFQVLKEI---KKYELGFKKQVE---  349

Query  1142  ELEQHIYLCFLNIVRSRRMIVQEI  1213
             ELE+H+YLC + I R+R M+V+EI
Sbjct  350   ELEEHVYLCLVTINRARAMVVKEI  373



>gb|KDO83745.1| hypothetical protein CISIN_1g045225mg, partial [Citrus sinensis]
Length=353

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/362 (27%), Positives = 167/362 (46%), Gaps = 34/362 (9%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
              RKS +++ EY++A RT S+ E   K Q  +    S          P           L 
Sbjct  7     ARKSLNINEEYLSALRTKSFAECLSKAQLFVTEPSS----------PSCRHEKFCEILLE  56

Query  338   SGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
                +++PS     +L    + ++P+       LL  YF ++ EA +IC  LLK +   R 
Sbjct  57    PDQDTIPS-----ILESAVLSKVPELKD----LLLNYFDISAEASSICGQLLKNINDVRY  107

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLS---AVRFDDVRDDHLGLLS  688
             +Y+ ++ A++  ++      ++V      + SL +  N  S      F  + D +  +L 
Sbjct  108   EYRFIQLALDTADDDQTEPHDKVKLIVSNLNSLIILTNPFSNPSTNEFKVIHDKYSSVLH  167

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L SKR ++ R+ K +     A G  +   C+   I   +LA H +   +  P +++   
Sbjct  168   NLKSKRKKVARKIKLINYVHKASGICITAVCSLIAIAAVVLAAHALTALLIGPMILSFPT  227

Query  869   GMVKKLKEAKRGIPSR--KGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIA  1042
                KK     R + S   + +   LDVAAKG ++L  D  T+ RLV RL DE+EHNK + 
Sbjct  228   KCFKKKLFNFRFLRSGFLRKVRKQLDVAAKGTYILNRDFDTMGRLVARLHDEVEHNKVMI  287

Query  1043  DLWAMKHCDD----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
                  +  D     V+KE +   +   Q++     ++ELE+H+YLC + I R+R  +++E
Sbjct  288   QFCLDRREDKFALHVMKE-IKKNHVGFQKQ-----VEELEEHVYLCLVTINRARSQVIKE  341

Query  1211  IV  1216
             +V
Sbjct  342   MV  343



>emb|CDY08106.1| BnaA06g16200D [Brassica napus]
Length=372

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 178/374 (48%), Gaps = 48/374 (13%)
 Frame = +2

Query  131   NSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTss  310
             NS+  +G        V  EY  AFRT SY + + +V   ++  R K  +   ++ P+ SS
Sbjct  20    NSSPKDGD----DVDVREEYANAFRTESYNQFWTRV---ISLNRKKPTLSSSSSSPIESS  72

Query  311   ssssssPLIS----GHESL-PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACA  475
             S+S+   L+S     H  L P P          + +L +    A  LL +YFL T  A  
Sbjct  73    STSAR--LMSYRLFAHNLLEPDPNT-----VNRILDLFRVGRPARSLLADYFLETANAFL  125

Query  476   ICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAY-GEIASLSLFGNTL--SAV  646
             +C  LLK + + R+ Y+S+K   +        SE   + A+  +   LS + +    S  
Sbjct  126   LCTLLLKNIHRLRSKYESLKPKFQ--------SETHSSLAFLDQFTELSRWFDPFISSGS  177

Query  647   RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFV  826
             R    R   L LL RL S R +   + K +     + G  +L   T  ++T   +A H  
Sbjct  178   RIQLTRTGCLSLLKRLESSRDKTRTKLKLMNGLTHSSGLLVLALTTTLIVT---IASHAF  234

Query  827   VCTMAVPGLIA---LSLGMVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSR  994
                +A P L+      +G+  KL K A R           LDVAAKG ++L  DL T+SR
Sbjct  235   ALFIAGPTLLTGRFKPVGLRNKLTKTAAR-----------LDVAAKGTYILSRDLDTISR  283

Query  995   LVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
             LV R++DE+EH + +A+ WA +    V      ++     EE   E L ELE+HIYLCF+
Sbjct  284   LVTRINDEVEHVRAMAEFWAGRGSGRVRGGEEVARELKRCEESFSEELDELEEHIYLCFM  343

Query  1175  NIVRSRRMIVQEIV  1216
              I R+R ++V+EI+
Sbjct  344   TINRARNLVVREIM  357



>ref|NP_190476.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SMU4.1|U496N_ARATH RecName: Full=UPF0496 protein At3g49070 [Arabidopsis thaliana]
 emb|CAB62003.1| putative protein [Arabidopsis thaliana]
 gb|AEE78496.1| uncharacterized protein AT3G49070 [Arabidopsis thaliana]
Length=416

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 133/266 (50%), Gaps = 25/266 (9%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIAS  613
             LL++YFL T  A  +C  LLK +   R+ Y+S+K          L+  +Q    + EI+ 
Sbjct  153   LLSDYFLETANAFLLCTQLLKNIHHLRSKYESLKPKFHSENHNSLALIDQ----FTEISK  208

Query  614   LSLFGNTLSA-VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAF  790
                F   +S+  R   +R   L LL RL S+R +   + K +     + G  +L   T  
Sbjct  209   W--FDPFISSGSRIQLIRSGCLYLLKRLESRRDKTRAKLKLINGLTHSSGLLVLALTTTL  266

Query  791   MITFTILAVHFVVCTMAVPGLIALSL---GMVKKL-KEAKRGIPSRKGLYMPLDVAAKGL  958
             ++T   +A H     +A P L+A      G+  KL K A R           LDVAAKG 
Sbjct  267   IVT---IASHAFALFLAAPTLLASQFKPAGLRNKLTKTAAR-----------LDVAAKGT  312

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             ++L  DL T+SRLV R++DE+ H + +A+ W  +    V      ++     EE   E L
Sbjct  313   YILSRDLDTISRLVTRINDEVNHVRAMAEFWVGRGSGRVRGSEEVARELKRCEESFSEEL  372

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIV  1216
              ELE+HIYLCF+ I R+R ++V+EI+
Sbjct  373   DELEEHIYLCFMTINRARNLLVKEIL  398



>emb|CDY05899.1| BnaC08g20760D [Brassica napus]
Length=371

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 112/373 (30%), Positives = 174/373 (47%), Gaps = 47/373 (13%)
 Frame = +2

Query  131   NSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTss  310
             NS+  +G        V  EY  AFRT SY + + +V   ++  R K  +   ++   +SS
Sbjct  20    NSSPKDGD----DVDVREEYANAFRTESYNQFWTRV---ISLNRKKSTLSPPSSPIESSS  72

Query  311   ssssssPL-ISGHESL-PSPGC--KLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAI  478
             +S+      +  H  L P P    K+L+       L +       LL++YFL T  A  +
Sbjct  73    TSARLMSYRLFAHNLLEPDPNTVTKILV-------LSRVGRPTRTLLSDYFLETANAFLL  125

Query  479   CESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQ---VNRAYGEIASLSLFGNTLSAVR  649
             C  LLK + + R+ Y+S K   +      L+  +Q   ++R +    S        S  R
Sbjct  126   CTLLLKNIHRLRSKYESPKPKFQSETHNSLAFLDQFTELSRWFDPFIS--------SGSR  177

Query  650   FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV  829
                 R   L LL R+ S R +   + K +     + G  +L   T  ++T   +A H   
Sbjct  178   IQLTRTGCLSLLKRIESSRDKTRTKLKLMNGLTHSSGLLVLALTTTLIVT---IASHAFA  234

Query  830   CTMAVPGLIA---LSLGMVKKL-KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRL  997
               +A P L+      +G+  KL K A R           LDVAAKG ++L  DL T+SRL
Sbjct  235   LFIAGPTLLTGRFKPVGLRNKLTKTAAR-----------LDVAAKGTYILSRDLDTISRL  283

Query  998   VGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLN  1177
             V R++DE+EH + +A+ WA +    V      ++     EE   E L ELE+HIYLCF+ 
Sbjct  284   VTRINDEVEHVRAMAEFWAGRGSGRVRGGEEVARELKRCEESFSEELDELEEHIYLCFMT  343

Query  1178  IVRSRRMIVQEIV  1216
             I R+R ++V+EI+
Sbjct  344   INRARNLVVREIM  356



>gb|KDP42179.1| hypothetical protein JCGZ_02909 [Jatropha curcas]
Length=346

 Score =   103 bits (258),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 101/359 (28%), Positives = 160/359 (45%), Gaps = 45/359 (13%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY  AFRT SY + + +V   L+   S   +  D+    T+++   S  L   H   
Sbjct  23    VREEYANAFRTESYNDFWTRVLS-LSDPTSSMSIPVDS----TTAARLPSYRLFFEHLLD  77

Query  356   PS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
             P  P    +L       L +     H LL +YF  T  A  +C SLLK +  TR  Y+S+
Sbjct  78    PDQPTVTKILA------LTRNPPKTHSLLTQYFSQTANASLLCGSLLKDIDHTRVRYRSL  131

Query  533   KKAVEKIEELGLSSEEQVNRAYGEIASLSLF-GNTLSAVRFDDVRDDHLGLLSRLTSKRG  709
             K A++ ++   LS E  + R      SL+ F  +  SA +   ++ D   LL +L S R 
Sbjct  132   KTAIKSLD--PLSPEILLTRLTEFTNSLNPFHWSAPSASQVRAIQADCANLLKQLESSRD  189

Query  710   RIERRTKRLRVFKVALGSTLLIGCTAFMITFT-------ILAVHFVVCTMAVPGLIALSL  868
             + +         K+ L S L      F++ FT             ++         +L L
Sbjct  190   KAKA--------KLQLNSKLKHSSALFVVAFTASLTVILATHALALLVAAPALLTASLEL  241

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
             G  K+L +              LD+AAKG ++L  DL T+SRLV R++DE+EH       
Sbjct  242   GSSKRLGKVS----------AQLDMAAKGTYILSRDLETISRLVARVNDEVEHMHETVKF  291

Query  1049  WAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV  1225
             W     +  +   +   N    E+     L ELE+H+YLC + I R+R ++++EI+ ++
Sbjct  292   WVESQGNGEVVRELKKTNCCFSEQ-----LDELEEHLYLCLMTINRARTLVLKEIIYKI  345



>ref|XP_011048768.1| PREDICTED: UPF0496 protein At3g49070 [Populus euphratica]
Length=375

 Score =   104 bits (259),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 144/284 (51%), Gaps = 39/284 (14%)
 Frame = +2

Query  422   NAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYG  601
             + H LL++YF  T  A  +C  LLK +   R  Y+S+K  +++I +    +   + R   
Sbjct  108   STHSLLSKYFAQTANASLLCGLLLKDIDHIRVKYRSLKATLDQIPKTQFPNPTILTRITE  167

Query  602   EIASLSLF---GNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERR---TKRLR----VFKV  751
              + + + F   G+T S V+   ++ D   LL +L SKR + + R     +L+    VF V
Sbjct  168   FVRARNPFDRSGSTPSRVQV--MQADCFELLKQLESKRDKAKARLNLKNKLKHSSAVFLV  225

Query  752   ALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI-ALSLGMVKKLKEAKRGIPSRKGLY  928
             AL ++L I          I+A H +   +A PGLI A SLG     +   R       + 
Sbjct  226   ALTASLTI----------IIATHALALLVATPGLIIATSLGPGSSTRRLAR-------VA  268

Query  929   MPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLK-------EV  1087
               LD AAKG ++L  DL T+SRLV R+ DEMEH  +    + ++  DD  K       E+
Sbjct  269   AQLDAAAKGTYILSRDLETISRLVNRVKDEMEHMHSTVK-YLVERGDDEGKWLHGINGEL  327

Query  1088  VSSKNFAIQEEWAL-EVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             V  +   I E  +    + +LE+H+YLCFL I R+R ++++EI+
Sbjct  328   VVRQFSKINECCSFSNQVDDLEEHLYLCFLTINRARNLVLKEIL  371



>ref|XP_010935394.1| PREDICTED: putative UPF0496 protein 2 [Elaeis guineensis]
Length=314

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 98/357 (27%), Positives = 155/357 (43%), Gaps = 76/357 (21%)
 Frame = +2

Query  170   SSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHE  349
             S+V  EY+ AFRT S+ ++  ++Q  L    S   +   +   L        S +I    
Sbjct  23    STVKEEYLGAFRTKSFTDMCIQIQKHLNTTNSNGKLKNQDYTHLLEPKQEVLSSIIHRTT  82

Query  350   SLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKS  529
              LPS                        LL +YF  +L AC  C SL++ + Q RAD++ 
Sbjct  83    HLPS------------------------LLLDYFDASLHACNFCGSLIESIHQARADHR-  117

Query  530   VKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSA---VRFDDVRDDHLGLLSR-LT  697
             + + V  +   G  +E+Q +     +   S   N  S     +F  + + + GL++R L 
Sbjct  118   ILRGVLDLATAGHRTEDQHHSMASNLVLFSRLDNPFSGPNPTKFQRIHEAY-GLMARQLV  176

Query  698   SKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMV  877
             S  G++ +R +                                 C     G+IA+    V
Sbjct  177   SAHGKVVQRPR---------------------------------CMNLPCGVIAMVENFV  203

Query  878   KKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWA-  1054
                   + G  +RKG    LD AA+  F L  D  T+SR+V RL DE+EH + +  L+  
Sbjct  204   -----GEDGSVARKGAQ--LDAAARLAFALDWDFDTMSRMVRRLHDEVEHGRDVIRLFME  256

Query  1055  ---MKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                M+    VL+EVV  +   + E   +  L ELE+H+ LCFLNI R+RRM+++E+V
Sbjct  257   DGDMEGGWMVLREVV--RELQVSERCFMNQLVELEEHVCLCFLNINRARRMVLEEMV  311



>ref|XP_007152005.1| hypothetical protein PHAVU_004G093700g [Phaseolus vulgaris]
 gb|ESW23999.1| hypothetical protein PHAVU_004G093700g [Phaseolus vulgaris]
Length=348

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 97/380 (26%), Positives = 172/380 (45%), Gaps = 54/380 (14%)
 Frame = +2

Query  116   KSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTF  295
             ++P+   +  +     KS +   EY+ A R+ SYV+ +DK Q     A    I    N +
Sbjct  6     RAPKATQDAKQPKDLSKSVNFHEEYLRALRSKSYVDFFDKAQ---LLAHQPSIYSNQNKY  62

Query  296   PLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQ-----QASNAHPLLNEYFLLT  460
                              E+L  PG      QE +  +       Q S    L+ +YF ++
Sbjct  63    S----------------ETLLEPG------QETVHNIIDTTILSQKSELKNLMLDYFDIS  100

Query  461   LEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLS  640
              EA  IC  LL  + Q + +YK +++A+E ++     S++++     ++ S S+  N  S
Sbjct  101   AEASLICSHLLNTINQVQCNYKFIERALEIMDNDDDDSQQKLKLIIVKLNS-SILTNPFS  159

Query  641   AVRFDD---VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTIL  811
              ++  D   + D++  +L+RL S R  +ER  K L+ +        L+GC    IT   L
Sbjct  160   DLKCHDFKLISDENASVLNRLKSMRKMLERNFK-LKTYLKTSEFCDLVGCDIVAITTRTL  218

Query  812   AVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIP--SRKGL---YMPLDVAAKGLFVLIND  976
                     +  P ++  +       K  ++ +P  SR+ L      L++AAKG ++L  D
Sbjct  219   TA------LVTPTILNFTC------KNLEKELPRFSRRFLGKVCEQLEIAAKGTYILNKD  266

Query  977   LSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQH  1156
             L T+SRLV RL D++EH +        K       ++V  K     ++   + ++EL++H
Sbjct  267   LDTMSRLVDRLYDDIEHIRAKIQFCLDKKIHKFSLQIV--KELRKSDDGFRKTVEELKEH  324

Query  1157  IYLCFLNIVRSRRMIVQEIV  1216
               LC + I RSR ++ +E+ 
Sbjct  325   ACLCLVTINRSRDLVTKEMT  344



>ref|XP_010060591.1| PREDICTED: UPF0496 protein At3g49070 [Eucalyptus grandis]
 gb|KCW90656.1| hypothetical protein EUGRSUZ_A02757 [Eucalyptus grandis]
Length=362

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 173/364 (48%), Gaps = 56/364 (15%)
 Frame = +2

Query  182   HEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGH---ES  352
              EY  AFRT SY + + +V            +  DN  P   + S++++ L S     E 
Sbjct  33    EEYANAFRTESYNDFWARVLA----------LSDDNPPPRDPAGSTAAARLPSYRLFVEH  82

Query  353   LPSPGCKLLLCQENMEEL-PQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKS  529
             L  P    ++   ++  + P Q S    LL EYF  T +A  +C +LLK V +TR  Y+S
Sbjct  83    LLEPDQPAVIRILDLARIRPAQKS----LLAEYFSETAKASVLCGALLKHVDRTRVQYRS  138

Query  530   VKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV--------RFDDVRDDHLGLL  685
             VK A   +  LG S    +N+    +  L+ F N  S +        + +  +     LL
Sbjct  139   VKSA---LRSLGNSQFRSLNQFPNIVTRLTEFLNCESPLTSSSSSTAQMESTQAGCAALL  195

Query  686   SRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT-ILAVHFVVCTMAVPGLIAL  862
             SRL S R + + + K +          L  G   F+I  T  LA+  +   +A+      
Sbjct  196   SRLESSRSKAKAKLKTI--------DRLQHGSAMFLIVVTGSLAIIILSHGLAMLVAAPA  247

Query  863   SLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIA  1042
                   ++  AK G+  RK L   LD AAKG + L  D+ T+SRLV R++DE+EH +T+ 
Sbjct  248   VAAASFEMAPAK-GL--RKVLAQ-LDAAAKGTYTLKRDMDTISRLVARINDELEHMRTMV  303

Query  1043  DLWAMKHCDDVLK---EVVSSK---NFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIV  1204
               W +   DD ++   +V   +   NFA Q       L ELE+H+YLCF+ + R+R ++V
Sbjct  304   RFW-LDRGDDKIQAGGKVTLGENECNFAQQ-------LDELEEHLYLCFMTVNRARNLVV  355

Query  1205  QEIV  1216
             +E++
Sbjct  356   KELL  359



>ref|XP_002877644.1| hypothetical protein ARALYDRAFT_906162 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53903.1| hypothetical protein ARALYDRAFT_906162 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 132/266 (50%), Gaps = 25/266 (9%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIAS  613
             LL +YFL T  A  +C  LLK + + R+ Y+S+K   +      L   +Q    + EI+ 
Sbjct  111   LLTDYFLETANAFLLCTLLLKNIHRLRSKYESLKPKFQSENHNSLDLVDQ----FTEISK  166

Query  614   LSLFGNTLSA-VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAF  790
                F   +S+  R   +R   L LL RL S R +   + K +     + G  +L   T  
Sbjct  167   W--FDPFISSGSRIQLIRSSCLDLLKRLESSRDKTRAKLKLINGLTHSSGLLVLALTTTL  224

Query  791   MITFTILAVHFVVCTMAVPGLIALSL---GMVKKL-KEAKRGIPSRKGLYMPLDVAAKGL  958
             ++T   +A H     +A P L+       G+  KL K A R           LDVAAKG 
Sbjct  225   IVT---IASHAFALFIAGPTLLTGRFKPAGLRNKLTKTAAR-----------LDVAAKGT  270

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             ++L  DL T+SRLV R++DE++H + +A+ W  +    V      ++     EE   E L
Sbjct  271   YILSRDLDTISRLVTRINDEVDHVRAMAEFWVGRGSGRVRGSEEVARELKRCEESFSEEL  330

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIV  1216
              ELE+HIYLCF+ I R+R ++V+E++
Sbjct  331   DELEEHIYLCFMTINRARNLVVREVL  356



>ref|XP_006421982.1| hypothetical protein CICLE_v10006929mg [Citrus clementina]
 ref|XP_006490480.1| PREDICTED: UPF0496 protein At3g49070-like [Citrus sinensis]
 gb|ESR35222.1| hypothetical protein CICLE_v10006929mg [Citrus clementina]
Length=370

 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 176/388 (45%), Gaps = 46/388 (12%)
 Frame = +2

Query  92    KMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKE  271
             K  SA I K     ++  + S  R    V  EY  AFRT SY E + +V        +K 
Sbjct  3     KRISARIRKCLSHAASSADISSQRTDVDVREEYAHAFRTESYNEFWTRVLALSNKDSAKS  62

Query  272   IVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYF  451
             I         T+++  SS  L +  E L  P    ++   ++ + P        L+ +YF
Sbjct  63    I-----QVESTTAARLSSYRLFA--EQLLDPDQSTVIRILDLVKTPS-------LIFDYF  108

Query  452   LLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGN  631
               T  A      LLK +   R  Y+S K  V  ++         V+     +   S   N
Sbjct  109   TQTANASLFFGPLLKDIDNVRIKYRSFKVIVNSLQNAHALPINYVSSVVIRLTEFSNLSN  168

Query  632   TLSAV-----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMI  796
               ++      RF  V+     LL +L S R +   R + + + K    + LL    A  I
Sbjct  169   PFASAAPTTRRFRVVQAGCGKLLKQLESSRDKARARLQLINITKHGSATFLL----AITI  224

Query  797   TFT-ILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLIN  973
             + T I+A H +   +A PGLIA SL    +L   +R +     +   LD AAKG ++L  
Sbjct  225   SLTVIVASHALALLVAAPGLIAASL----ELASTRRLV----RVSTQLDAAAKGTYILNR  276

Query  974   DLSTVSRLVGRLSDEMEHNKTIADLW------AMKHCDDVLKEVV-SSKNFAIQEEWALE  1132
             DL T+SRLV RL+DE+EH ++    W       ++   +V ++++ +  +F+ Q      
Sbjct  277   DLDTISRLVARLNDELEHMRSTVKFWLDRGEARLQASGEVARQLLKNDASFSQQ------  330

Query  1133  VLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              L ELE+H+YLCF+ + R+R ++++EI+
Sbjct  331   -LDELEEHLYLCFMTVNRARNLVMKEIL  357



>ref|XP_010933135.1| PREDICTED: UPF0496 protein 3 [Elaeis guineensis]
Length=374

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 108/402 (27%), Positives = 183/402 (46%), Gaps = 50/402 (12%)
 Frame = +2

Query  62    MHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQ  241
             MH+    KFS  +     +  RR+  E    +   S ++  EY   FRT SY E + +V 
Sbjct  1     MHM----KFSIFRDC--KRQARRDKCEVVAPISSASFNLCEEYANTFRTESYNEFWARVL  54

Query  242   G----QLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPS-PGCKLLLCQENMEEL  406
                  Q AA +S+E        P        S  L++ H   P  P    +L        
Sbjct  55    DLTLVQGAALKSRESSAAAR-LP--------SDRLLAEHLLDPDQPTVTKILAHVRRHCH  105

Query  407   PQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLS--SEE  580
             P+     H LL++Y+  T  A  +C  LLK + Q R  Y+ +K  +  +   G S  S  
Sbjct  106   PE----THVLLSDYYAETANASLLCGLLLKAIEQLRLRYRPLKATLNSLISNGQSRLSLP  161

Query  581   QVNRAYGEIASLSLFGNTL--SAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
              ++    +++++    N+L  S  +F  V+D    LL RL S+R + + + + +   K  
Sbjct  162   AIDHYLADLSTILTPSNSLGSSQCQFRAVQDGSANLLKRLESRRKKAKAKLRFINHLKRG  221

Query  755   LGSTLLIGCTAFMITFTI-LAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYM  931
             L +  LI  TA      + +A+H +V  +A+P     +         A  G  +R  +  
Sbjct  222   L-AIFLIALTASTSALGVCMALHALVAVVALP-----TFLSASSSWLASTGWLAR--VLA  273

Query  932   PLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKH-------CDDVLKEVV  1090
              LD A KG ++L  +L T+SRLV RL DE+EH   +  L   +H         +V++++ 
Sbjct  274   QLDAATKGTYILNRELDTISRLVARLHDEVEHMLALLRLCCERHGGGRRRLTQEVVRQIW  333

Query  1091  SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              +     Q+      L ELE+H+YLCF+ I ++R ++++E++
Sbjct  334   KNDASFNQQ------LDELEEHLYLCFMTINKARSLVMKEVL  369



>gb|KDO51964.1| hypothetical protein CISIN_1g046315mg, partial [Citrus sinensis]
Length=353

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 167/365 (46%), Gaps = 46/365 (13%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             R    V  EY  AFRT SY E + +V        +K I         T+++  SS  L +
Sbjct  9     RTDVDVREEYAHAFRTESYNEFWTRVLALSNKDSAKSI-----QVESTTAARLSSYRLFA  63

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
               E L  P    ++   ++ + P        L+ +YF  T  A      LLK +   R  
Sbjct  64    --EQLLDPDQSTVIRILDLVKTPS-------LIFDYFTQTANASLFFGPLLKDIDNVRIK  114

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV-----RFDDVRDDHLGLL  685
             Y+S K  V  ++         V+     +   S   N  ++      RF  V+     LL
Sbjct  115   YRSFKVIVNSLQNAHALPINYVSSVVIRLTEFSNLSNPFASAAPTTRRFRVVQAGCGKLL  174

Query  686   SRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT-ILAVHFVVCTMAVPGLIAL  862
              +L S R +   R + + + K    + LL    A  I+ T I+A H +   +A PGLIA 
Sbjct  175   KQLESSRDKARARLQLINITKHGSATFLL----AITISLTVIVASHALALLVAAPGLIAA  230

Query  863   SLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIA  1042
             SL    +L   +R +     +   LD AAKG ++L  DL T+SRLV RL+DE+EH ++  
Sbjct  231   SL----ELASTRRLV----RVSTQLDAAAKGTYILNRDLDTISRLVARLNDELEHMRSTV  282

Query  1043  DLW------AMKHCDDVLKEVV-SSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
               W       ++   +V ++++ +  +F+ Q       L ELE+H+YLCF+ + R+R ++
Sbjct  283   KFWLDRGEVRLQASGEVARQLLKNDASFSQQ-------LDELEEHLYLCFMTVNRARNLV  335

Query  1202  VQEIV  1216
             ++EI+
Sbjct  336   MKEIL  340



>ref|XP_010314477.1| PREDICTED: UPF0496 protein At1g20180-like isoform X1 [Solanum 
lycopersicum]
Length=367

 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 112/364 (31%), Positives = 170/364 (47%), Gaps = 34/364 (9%)
 Frame = +2

Query  158   GRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLI  337
             GR+S +V+ EY  A RT SY E + K    L    +  I       PL+ +S  S    I
Sbjct  21    GRRSLNVNEEYQGALRTKSYGEFFMKAHDLLVNNNNNNINQ-----PLSPNSQYSLFSDI  75

Query  338   SGHESLPSPGCKLLL-CQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTR  514
                  L  PG + +    E+    P++  N  PLL  YF ++ +A   C  +LK + Q +
Sbjct  76    -----LLEPGQETITNILESTNIFPKKY-NLKPLLLNYFNISAKASKFCSHILKTINQVQ  129

Query  515   ADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRL  694
              DY  V++ +E I+    SS       Y  I +       L    F  + D++  +L RL
Sbjct  130   NDYDFVEQILESIDN-NFSSHLIPELRYYIIHNNQFLD--LKKQDFTRINDEYSSILQRL  186

Query  695   TSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGL---IALS  865
             + KR +I R+ K +       G  +   C    +   +LA H +   +  P +   I L 
Sbjct  187   SLKRKKIARKIKFIECVNKVSGVFVTTTCGLVAVAAVVLAAHTLAALIMGPAILTIIPLK  246

Query  866   LGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
                + K    L+  K G   + G    LDVAAKG ++L  D  T+SRLV RL DE+EHNK
Sbjct  247   RSKINKFTNRLRFLKCGFLRKIG--AQLDVAAKGTYILNRDFDTMSRLVDRLHDEIEHNK  304

Query  1034  TIADLWAMKHCDD----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
              +  L   +  D     VLKE+  S N   +++     ++ELE+H+YLC L I R+R ++
Sbjct  305   AMIKLCLDRREDSISLKVLKELKKS-NVGFRKQ-----VEELEEHVYLCLLTINRARNLV  358

Query  1202  VQEI  1213
             + EI
Sbjct  359   INEI  362



>ref|XP_004237798.1| PREDICTED: UPF0496 protein At1g20180-like [Solanum lycopersicum]
Length=365

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 98/384 (26%), Positives = 177/384 (46%), Gaps = 44/384 (11%)
 Frame = +2

Query  95    MKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEI  274
             M+     K  ++ + + + SL     +V+ EY+ A RT SY + + K Q  +  A S   
Sbjct  2     MEGDITIKDKKKMTRDTQISL-----NVNDEYLGALRTKSYDDFFTKAQLLVNEASSPN-  55

Query  275   VGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFL  454
                              S L +  + L  P  +++         P +  N   LL  YF 
Sbjct  56    -----------------SQLCTFSKILLDPSQEIITSILETTIFPTKKYNLKSLLTNYFN  98

Query  455   LTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNT  634
             ++ +A   C  +LK + Q ++ Y  + + ++ ++    S+ +Q+     E+ +  +  N 
Sbjct  99    ISADASKFCGRILKSISQIQSHYGFIDQVLDSMD--NFSNFDQLGYLVLELRTFIIHNNP  156

Query  635   LSAVR---FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT  805
              S ++   F  + D++  +L  L SK+  + R+ K ++      G  + + C   ++   
Sbjct  157   FSDLKKQDFTRINDEYSSVLQCLKSKKKSVVRKIKLIKCVHKTSGVCVTMACGVVVVAAL  216

Query  806   ILAVHFVVCTMAVPGLIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLIN  973
             +LA H     +  P ++ L L   KK     +  K G   + G    LDVA KG ++L  
Sbjct  217   VLAAHTFAAIVMGPVILTLPLKPFKKKIMSFRYLKCGFLRKVG--DQLDVATKGAYILNR  274

Query  974   DLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD----DVLKEVVSSKNFAIQEEWALEVLK  1141
             D   +SRLV RL DE++HNK +  L   K  D    +VLKE+  S N   +++     ++
Sbjct  275   DFDMISRLVDRLHDEIDHNKEMMQLCLDKREDRFSLEVLKELKKS-NIGFKKQ-----VE  328

Query  1142  ELEQHIYLCFLNIVRSRRMIVQEI  1213
             ELE+H+YLC L I R+R ++++E+
Sbjct  329   ELEEHVYLCLLTINRARALVIKEV  352



>ref|XP_007161536.1| hypothetical protein PHAVU_001G077600g [Phaseolus vulgaris]
 gb|ESW33530.1| hypothetical protein PHAVU_001G077600g [Phaseolus vulgaris]
Length=361

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 102/372 (27%), Positives = 162/372 (44%), Gaps = 45/372 (12%)
 Frame = +2

Query  134   SNENEGSLGRKSS-SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTss  310
             S E   S   K+S  V  EY  AFRT SY E + +V        S  +  G  T     S
Sbjct  16    SAECSTSPNHKTSWDVHEEYANAFRTESYTEFWTRVLAYSNNESSSSLSRGSTTSSRLPS  75

Query  311   ssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESL  490
                 +  L+   +   +    L  C+  +          H LL++YF  T  A  +C  L
Sbjct  76    YRLFAEHLLDPDQPTVTRALSLAQCRPKV----------HSLLSDYFAHTAGASLLCSHL  125

Query  491   LKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDD  670
             L+ + + R  Y S+K  +  +    + S   +      +   S F N  +A     +R  
Sbjct  126   LRDIDRLRVKYTSLKTILHSLPSNQIPSPMLIT----HLTEFSNFSNPFAASGL--LRPT  179

Query  671   HL---GLLSRLTSKRGRIERRTKRLRVFKVALGST-LLIGCTAFMITFTILAVHFVVCTM  838
             H     L +RL S R R   R K     K+  GS  LL+  TA ++   +   H     +
Sbjct  180   HAQCSDLQNRLESSRDRA--RAKLRLAAKIKCGSACLLVAVTASLVVLVM--SHGFALIV  235

Query  839   AVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             A+PG+ A++LG  +KL            +   L+ AAKG +++  DL T  RLV RL+DE
Sbjct  236   AMPGMAAVNLGSERKLV----------AVTAQLNAAAKGSYIVNKDLETTVRLVARLNDE  285

Query  1019  MEHNKTIADLWAMKHCDDV-----LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIV  1183
             +E+ +T    W  +  D V     +  ++   + +  E+     L ELE+H+YLCF+ I 
Sbjct  286   LEYMRTTVRFWLERKEDKVEADGGVVRLLKKNHCSFSEQ-----LDELEEHLYLCFMTIN  340

Query  1184  RSRRMIVQEIVG  1219
             R+R +++ +I  
Sbjct  341   RARDLVLCQITN  352



>ref|XP_010515252.1| PREDICTED: UPF0496 protein At3g49070 [Camelina sativa]
Length=376

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 86/279 (31%), Positives = 135/279 (48%), Gaps = 29/279 (10%)
 Frame = +2

Query  401   ELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEE  580
             ++ +    A  LL++YFL T  A  +C  LLK + + R+ Y+S+K   +      L+  +
Sbjct  102   DVSRVGRTARTLLSDYFLETANAFLLCTLLLKNIHRLRSKYESLKPKFQTENHSSLALID  161

Query  581   Q---VNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKV  751
             Q   ++R +    S        S  R   +R   L LL RL S R +   + K +     
Sbjct  162   QFTELSRWFEPFIS--------SGSRIQLIRCGCLDLLKRLESSRDKTRAKLKLINGLTH  213

Query  752   ALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL---GMVKKL-KEAKRGIPSRK  919
             + G  +L   T  ++T   +A H     +A P L+       G+  KL K A R      
Sbjct  214   SSGLLVLALTTTLIVT---IASHAFALFIAGPTLLTGRFKPAGLRNKLTKTAAR------  264

Query  920   GLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSK  1099
                  LDVAAKG ++L  DL T+SRLV R++DE++H + +A+ W  +    V       +
Sbjct  265   -----LDVAAKGTYILSRDLDTISRLVTRINDEVDHVRVMAEFWVGRGSGRVRGSEEVGR  319

Query  1100  NFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                  EE   E L ELE+HIYLCF+ I R+R ++V++I+
Sbjct  320   ELKRCEESFGEELDELEEHIYLCFMTINRARNLVVRQIL  358



>gb|KCW70523.1| hypothetical protein EUGRSUZ_F03726 [Eucalyptus grandis]
Length=278

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 137/274 (50%), Gaps = 42/274 (15%)
 Frame = +2

Query  422   NAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV---EKIEELGLSSEEQVNR  592
             N HPL+  YF   LEAC +CE L+  V QT+A+ + ++KA+   +KI++   S++ Q   
Sbjct  32    NLHPLIVNYFEDGLEACRVCELLILSVHQTQANNQWIEKAIKLTKKIDDATSSTDHQCRM  91

Query  593   AYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGS  763
                E+++ S   N    V   +F DV      LL +L +   +  RR K L+   +++G 
Sbjct  92    IREELSAFSQQMNPFCLVSKEKFHDVCQAFAMLLQKLKAMHKKTMRRAK-LKRIAMSMG-  149

Query  764   TLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPS---RKGLYMP  934
               L+GCT                           LG+ KK  +  +G P    ++   + 
Sbjct  150   --LMGCT---------------------------LGLHKKRTKPVQGNPKMTRQEAFGVQ  180

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
              DVAAKG F LIN L+T+S + G L DE+EH K  A++       D +KEVV  K F  +
Sbjct  181   FDVAAKGHFTLINYLATMSIVAGSLYDEVEHMKERANMCVRSGKSDTIKEVV--KRFDQR  238

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
               + LE L+ELE    LC  +I  SRR I++EI+
Sbjct  239   NTYFLEKLEELENLACLCLRDINASRRSIMKEIM  272



>ref|XP_006291302.1| hypothetical protein CARUB_v10017437mg [Capsella rubella]
 gb|EOA24200.1| hypothetical protein CARUB_v10017437mg [Capsella rubella]
Length=378

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 109/400 (27%), Positives = 176/400 (44%), Gaps = 42/400 (11%)
 Frame = +2

Query  89    SKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             SK+K    + +   +S+  +G     +  V  EY  AFRT SY + + +V          
Sbjct  7     SKIKRILASTASGDSSSPKDGD----AVDVREEYANAFRTESYNQFWSRVVHLSRKKSKV  62

Query  269   EIVGGDNTFPLTssssssssPLISGHESL-PSPGCKLLLCQENMEELPQQASNAHPLLNE  445
                   +    +S+S+   S  +  H  L P P     +   +     +    A  LL++
Sbjct  63    SSSSSSSPIESSSTSARLMSYRLFAHNLLDPDPNTITRILDAS-----RVGRTARTLLSD  117

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQ---VNRAYGEIASL  616
             YFL T  A  +C  LLK + + R+ Y+S+K   +      L+  +Q   ++R +    S 
Sbjct  118   YFLETANAFLLCTLLLKNIHRLRSKYESLKPKFQPENHSSLALIDQFTELSRWFDPFIS-  176

Query  617   SLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMI  796
                    S  R   +R   L LL RL S R +   + K +     + G  +L   T  ++
Sbjct  177   -------SGSRIQLIRCGCLDLLKRLESSRDKTRSKLKLINGLTHSSGLLVLALTTTLIV  229

Query  797   TFTILAVHFVVCTMAVPGLIALSL---GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVL  967
             T   +A H     +A P L+       G+  KL +              LDVAAKG ++L
Sbjct  230   T---IASHAFALFIAGPTLLTGRFKPAGLRNKLTKTT----------ARLDVAAKGTYIL  276

Query  968   INDLSTVSRLVGRLSDEMEHNKTIADLW---AMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
               D+ T+SRLV R++DE++H + +A+ W            +EV  ++     EE   E L
Sbjct  277   SRDIDTISRLVTRINDEVDHVRAMAEFWVGRGGSGRVRGSEEV--ARELKRCEESFSEEL  334

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIVGRV*PAHLAKSAIS  1258
              ELE+HIYLCF+ I R+R ++V EI+    P   + + IS
Sbjct  335   DELEEHIYLCFMTINRARNLVVNEILDSNDPPPCSFAPIS  374



>ref|XP_006589491.1| PREDICTED: UPF0496 protein At1g20180-like [Glycine max]
 gb|KHN17018.1| UPF0496 protein [Glycine soja]
Length=271

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 133/265 (50%), Gaps = 10/265 (4%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIAS  613
             L+  YF ++ EA  IC  LLK + Q  ++Y+ +++A++ ++   L + + +   +G + S
Sbjct  8     LMLSYFDISAEASQICCHLLKSINQLHSNYQFIQRALDIMDGDSLETFDLI--TFG-LNS  64

Query  614   LSLFGNTLSAVRFDD---VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCT  784
              +   N  S ++  D   + D    +L  L S R ++ R+ K ++  K      +   C 
Sbjct  65    FNYSNNPFSNLKNHDFKLITDKLSSILHHLKSMRKKVGRKIKLMKYLKNTSEVCVTAACG  124

Query  785   AFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKR--GIPSRKGLYMPLDVAAKGL  958
                IT  ++A H +   +  P +++      K+   A    G  S+  +Y  L +AAKG 
Sbjct  125   IVAITAMVIAAHTLTAVIMGPAILSFPFKHFKRKLRAYEFSGKGSQSKVYDQLGIAAKGT  184

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             ++L  D  T+SRLV RL DE+EH++ +  L   +  D    +VV  K     +    + +
Sbjct  185   YILNRDFDTMSRLVARLHDEIEHSRAMVQLCLDRKEDKFSLQVV--KELKKSDVRFRKQV  242

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEI  1213
             +ELE+H  LC + I ++R ++V+EI
Sbjct  243   EELEEHACLCLVAINQARTLVVKEI  267



>ref|XP_010108625.1| hypothetical protein L484_017858 [Morus notabilis]
 gb|EXC19881.1| hypothetical protein L484_017858 [Morus notabilis]
Length=455

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/364 (25%), Positives = 174/364 (48%), Gaps = 38/364 (10%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             RKS +++ EY++A RT SY + ++K Q          +V  + + P       S + L  
Sbjct  107   RKSLNINEEYVSALRTKSYADFFNKAQ---------LLVNHEQSSPSYCHRKFSETLLEP  157

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
             G E++P     +L     + +LP+  +    L+ +YF ++ EA  IC  LL+ + Q +++
Sbjct  158   GQEAIPG----ILESALILSKLPELKT----LMLKYFDISAEASTICSHLLRSINQIQSN  209

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDD-----VRDDHLGLL  685
             +  +++ ++ I+++    E         I+ L+LF  T   +  +D     +R+ +  + 
Sbjct  210   HHFIQRLLDGIDDISRDQECSPENFKLIISELNLFIGTNPFLNPNDHDFKMIREKYSAVF  269

Query  686   SRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALS  865
               L S R ++ ++ K ++  + A G  +   C    +   +LA H +      P L    
Sbjct  270   QCLKSMRKKVRKKIKLIKGLQKASGICITAACGLVALAAIVLAAHTLTALFMGPALFGFP  329

Query  866   LG-MVKKLKE---AKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
             L  +V KL      + G   + G    LD+AAKG ++L  D  T+SRLV RL    +HNK
Sbjct  330   LKRLVNKLSNFSFLRSGFLRKVG--NQLDLAAKGTYILNRDFDTMSRLVARLGGTFDHNK  387

Query  1034  TIADLWAMKH----CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
              +     ++     C   +KE +   +F  +++     ++ELE+H+ L  + I R+R ++
Sbjct  388   KMIQSCLVRREYRFCLQAVKE-LKKGDFGFRKQ-----MEELEEHVILSLVTINRARALV  441

Query  1202  VQEI  1213
             ++E+
Sbjct  442   IKEM  445



>ref|XP_004985705.1| PREDICTED: UPF0496 protein 3-like isoform X3 [Setaria italica]
Length=379

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 101/362 (28%), Positives = 161/362 (44%), Gaps = 55/362 (15%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSP  364
             EY +AFRT SY + + +V           +  G    P          P  +G  S   P
Sbjct  40    EYTSAFRTESYNDFWARVL-------DITLAHGAGLVP---------RPGATGTASKRLP  83

Query  365   GCKLLLCQENMEELPQQASNA----------HP----LLNEYFLLTLEACAICESLLKIV  502
               +L    E++ E  Q+A  A          HP    LL  Y+  T  A  +C  LLK +
Sbjct  84    SYRLF--AEHLLEPDQRAVRAALASARKGRLHPGVRDLLAAYYNETASASFLCSHLLKDI  141

Query  503   LQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGE-IASLSLFGNTLSAVRFDDVRDDHL  676
              Q R  Y+ +K  + K+  ++G+SS   V+ A G+   +L++    L  V+         
Sbjct  142   EQIRLRYRPLKNTLRKLARDVGVSSLADVSAALGQPFTALAVSQGKLRQVQLSSA-----  196

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              LL  L S R +   R K L   + AL  +L+    A  +    + VH +    A P ++
Sbjct  197   DLLKSLDSSRKKARLRIKTLARLRQALSVSLITVVAAVAVVGAFIGVHILAAFAAFPMIM  256

Query  857   ALS-LGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
             + + LG+         G   R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH  
Sbjct  257   SPAWLGLFS-------GRTVRRAL-VQLEAAAKGTYILNRDMDTISRLVARVRDEGEHML  308

Query  1034  TIADLWAMKHC-----DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
              +  L             +++EV+  K     EE   + L ELE+H++LCF+ I ++R M
Sbjct  309   ALLQLCVEHRALAGEKGRLVQEVL--KQLCKNEENFRQQLDELEEHLFLCFMTINKARSM  366

Query  1199  IV  1204
             ++
Sbjct  367   VM  368



>ref|XP_004985704.1| PREDICTED: UPF0496 protein 3-like isoform X2 [Setaria italica]
Length=382

 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 101/362 (28%), Positives = 161/362 (44%), Gaps = 55/362 (15%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSP  364
             EY +AFRT SY + + +V           +  G    P          P  +G  S   P
Sbjct  43    EYTSAFRTESYNDFWARVL-------DITLAHGAGLVP---------RPGATGTASKRLP  86

Query  365   GCKLLLCQENMEELPQQASNA----------HP----LLNEYFLLTLEACAICESLLKIV  502
               +L    E++ E  Q+A  A          HP    LL  Y+  T  A  +C  LLK +
Sbjct  87    SYRLF--AEHLLEPDQRAVRAALASARKGRLHPGVRDLLAAYYNETASASFLCSHLLKDI  144

Query  503   LQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGE-IASLSLFGNTLSAVRFDDVRDDHL  676
              Q R  Y+ +K  + K+  ++G+SS   V+ A G+   +L++    L  V+         
Sbjct  145   EQIRLRYRPLKNTLRKLARDVGVSSLADVSAALGQPFTALAVSQGKLRQVQLSSA-----  199

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              LL  L S R +   R K L   + AL  +L+    A  +    + VH +    A P ++
Sbjct  200   DLLKSLDSSRKKARLRIKTLARLRQALSVSLITVVAAVAVVGAFIGVHILAAFAAFPMIM  259

Query  857   ALS-LGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
             + + LG+         G   R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH  
Sbjct  260   SPAWLGLFS-------GRTVRRAL-VQLEAAAKGTYILNRDMDTISRLVARVRDEGEHML  311

Query  1034  TIADLWAMKHC-----DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
              +  L             +++EV+  K     EE   + L ELE+H++LCF+ I ++R M
Sbjct  312   ALLQLCVEHRALAGEKGRLVQEVL--KQLCKNEENFRQQLDELEEHLFLCFMTINKARSM  369

Query  1199  IV  1204
             ++
Sbjct  370   VM  371



>ref|XP_004985703.1| PREDICTED: UPF0496 protein 3-like isoform X1 [Setaria italica]
Length=383

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 101/362 (28%), Positives = 161/362 (44%), Gaps = 55/362 (15%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSP  364
             EY +AFRT SY + + +V           +  G    P          P  +G  S   P
Sbjct  44    EYTSAFRTESYNDFWARVL-------DITLAHGAGLVP---------RPGATGTASKRLP  87

Query  365   GCKLLLCQENMEELPQQASNA----------HP----LLNEYFLLTLEACAICESLLKIV  502
               +L    E++ E  Q+A  A          HP    LL  Y+  T  A  +C  LLK +
Sbjct  88    SYRLF--AEHLLEPDQRAVRAALASARKGRLHPGVRDLLAAYYNETASASFLCSHLLKDI  145

Query  503   LQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGE-IASLSLFGNTLSAVRFDDVRDDHL  676
              Q R  Y+ +K  + K+  ++G+SS   V+ A G+   +L++    L  V+         
Sbjct  146   EQIRLRYRPLKNTLRKLARDVGVSSLADVSAALGQPFTALAVSQGKLRQVQLSSA-----  200

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              LL  L S R +   R K L   + AL  +L+    A  +    + VH +    A P ++
Sbjct  201   DLLKSLDSSRKKARLRIKTLARLRQALSVSLITVVAAVAVVGAFIGVHILAAFAAFPMIM  260

Query  857   ALS-LGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
             + + LG+         G   R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH  
Sbjct  261   SPAWLGLFS-------GRTVRRAL-VQLEAAAKGTYILNRDMDTISRLVARVRDEGEHML  312

Query  1034  TIADLWAMKHC-----DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
              +  L             +++EV+  K     EE   + L ELE+H++LCF+ I ++R M
Sbjct  313   ALLQLCVEHRALAGEKGRLVQEVL--KQLCKNEENFRQQLDELEEHLFLCFMTINKARSM  370

Query  1199  IV  1204
             ++
Sbjct  371   VM  372



>ref|XP_006600008.1| PREDICTED: UPF0496 protein At1g20180-like [Glycine max]
Length=400

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 97/366 (27%), Positives = 164/366 (45%), Gaps = 48/366 (13%)
 Frame = +2

Query  164   KSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISG  343
             KS +   EY  A RT SYV+ +DK Q     A    I    N F                
Sbjct  22    KSVNFHEEYHKALRTKSYVDFFDKAQ---LLANQPSIYSNHNKFS---------------  63

Query  344   HESLPSPGCKLLLCQENMEELPQQASNAHPLLN---EYFLLTLEACAICESLLKIVLQTR  514
              E L  P       QE +  +    S    L N    YF ++ EA  IC  LL+ + Q +
Sbjct  64    -EILLEPD------QETIYSVIDHISKTPELKNLMLSYFDISAEASFICSHLLQSINQVQ  116

Query  515   ADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVR-----FDDVRDDHLG  679
              +Y+ +++A+  +++    S E+      E+ S     N LS +      F  + D++  
Sbjct  117   CNYQFIERALGIMDDDD--SLEKFKLISFELNSFIFSKNPLSNLNINHDLFKLISDENSS  174

Query  680   -LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFM-ITFTILAVHFVVCTMAVPGL  853
              LL RL S R ++ R+ K +   K A  S + +     + IT  + A H +   +  P +
Sbjct  175   VLLHRLKSMRKKLGRKVKLMTYLKKA--SEICVAVYDLVAITANVTAAHTLSTLIMGPTI  232

Query  854   IALSLGMVKK-----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             +      + K     L+ ++R   S   +   LD+AAKG ++L  D  T++R+V RL DE
Sbjct  233   LNFPCKSLNKRELPHLRFSRRRFLS--NVCDQLDIAAKGTYILNKDFDTMTRVVARLYDE  290

Query  1019  MEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
             +EH +T+   +  K  D    ++V  K      +   + ++EL++H+YLC + I R+R +
Sbjct  291   IEHKRTMVQFFLDKKDDKFSLQMV--KELKKSGDGFRKQVEELKEHVYLCLVTINRARCL  348

Query  1199  IVQEIV  1216
             + +E+ 
Sbjct  349   VTEEMT  354



>ref|XP_002465856.1| hypothetical protein SORBIDRAFT_01g047060 [Sorghum bicolor]
 gb|EER92854.1| hypothetical protein SORBIDRAFT_01g047060 [Sorghum bicolor]
Length=382

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 161/366 (44%), Gaps = 50/366 (14%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESLPSP  364
             EY +AFRT SY + + +V           +  G    P       +    ++  + LPS 
Sbjct  40    EYTSAFRTESYNDFWARVL-------DITLAHGAGLVPRPGGGGGNG---VTPSKRLPS-  88

Query  365   GCKLLLCQENMEELPQQASNA----------HP----LLNEYFLLTLEACAICESLLKIV  502
                  L  E + E  Q+A  A          HP    LL  Y+  T  A  +C  LL+ +
Sbjct  89    ---YRLFAEQLLEPDQRAVRAALASPRSGKLHPGVRDLLATYYNETASASFLCSHLLRDI  145

Query  503   LQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGE-IASLSLFGNTLSAVRFDDVRDDHL  676
              Q R  Y+ +K  + K+  ++G+S+   V+ A G+  A+L++    L  V+         
Sbjct  146   EQIRLRYRPLKTTLRKLARDVGVSNLADVSAALGQPFAALAVSQGKLRQVQLSSA-----  200

Query  677   GLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
              LL  L + R +   R K L   +  L ++ +    A  +    + VH +    A P + 
Sbjct  201   DLLRSLDASRKKARLRIKSLARLRQLLSASFITVVAAVAVVGAFIGVHILAAFAAFPMMS  260

Query  857   ALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
                LG+         G   R+ L + L+ AAKG ++L  D+ T+SRLV RL DE EH   
Sbjct  261   PAWLGLFS-------GRSVRRAL-VQLEAAAKGTYILNRDMDTISRLVARLRDEGEHMLA  312

Query  1037  IADLW-----AMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
             +  L      A      +++EV+  K     EE   + L +LE+H++LCF+ I ++R M+
Sbjct  313   LLQLCVEHRAAAGEKGRLVQEVL--KQLCKNEESFRQQLDDLEEHLFLCFMTINKARSMV  370

Query  1202  VQEIVG  1219
             +  I G
Sbjct  371   MNFIAG  376



>ref|XP_008794309.1| PREDICTED: UPF0496 protein 3 [Phoenix dactylifera]
Length=362

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 96/375 (26%), Positives = 173/375 (46%), Gaps = 43/375 (11%)
 Frame = +2

Query  140   ENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQ----GQLAAARSKEIVGGDNTFPLTs  307
             E    +   S ++  EY   FRT SY+E + +V        AA + +E          ++
Sbjct  10    EAGAPISSASFNLCEEYANTFRTESYIEFWARVLDLTLAHGAALKPRES---------SA  60

Query  308   sssssssPLISGHESLPS-PGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICE  484
             ++   S  L + H   P  P    +L        P+     H LL++Y+  T  A  +C 
Sbjct  61    AARLPSDRLFAEHLLDPDQPTVTRILSHVRRHGHPE----THVLLSDYYAETANASLLCG  116

Query  485   SLLKIVLQTRADYKSVKKAVEKIEELGLS--SEEQVNRAYGEIA-SLSLFGNTLSA-VRF  652
              LLK + Q R  Y+ +K  +  +   G S  S + ++   G+++ +L  F +  S+  +F
Sbjct  117   LLLKEIEQLRLRYRPLKATLNSLISSGQSRLSLQAIDPYLGDLSKTLGPFDSLGSSQCQF  176

Query  653   DDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVC  832
               V+D    LL RL S R +   + + +   K  L   L++   +       +A+H +V 
Sbjct  177   RAVQDGSANLLKRLESSRKKARAKLRCINHLKRGLAIFLIVLTASTSALGVCMALHALVA  236

Query  833   TMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLS  1012
              +A+P  ++    +      A  G  +R  +    D AAKG ++L  +L T+SRLV RL 
Sbjct  237   VVALPTFLSAPPWL------ASAGSLAR--VLAQFDAAAKGTYILNRELDTISRLVARLH  288

Query  1013  DEMEHNKTIADLWAMKH-------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCF  1171
             DE+EH   +  L   +H         +V++++  +     Q+      L ELE+H+YLCF
Sbjct  289   DEVEHLLALLRLCCERHDGGRRRLTQEVVRQIRKNDASFNQQ------LDELEEHLYLCF  342

Query  1172  LNIVRSRRMIVQEIV  1216
             + I ++R ++++E++
Sbjct  343   MTINKARSLVMKEVL  357



>ref|XP_009387360.1| PREDICTED: UPF0496 protein 3-like [Musa acuminata subsp. malaccensis]
Length=396

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 111/414 (27%), Positives = 184/414 (44%), Gaps = 66/414 (16%)
 Frame = +2

Query  47    LHRLNMHLPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEI  226
             L  L +H P F+  +      +   PR+   E    +   S ++  EY  AFRT SY E 
Sbjct  18    LEYLPLHCPPFQASTNT----VASPPRKR--EAVAPISSSSFNLCEEYTNAFRTESYHEF  71

Query  227   YDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES-LPSPGCKLLLCQENMEE  403
             + +V                    LT    ++  P  S   S LPS     LL +  ++ 
Sbjct  72    WAQV------------------LDLTLDHGAALKPRGSSAASRLPS---YRLLAEHLLDP  110

Query  404   --------LPQQASNAHP----LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE  547
                     L   A   HP    LL++Y+  T  A  +C  LLK + + R  Y+ +K  + 
Sbjct  111   DQPTVTKILTHLAKRCHPETHVLLSDYYSETAVASLLCGLLLKDIDRIRRWYRPLKATLR  170

Query  548   KIEELGLSSEEQVNRAYGE-IASLSLFGNTLSAV-----RFDDVRDDHLGLLSRLTSKRG  709
              +  +  S      +A G+ +A +S   N+  +V     +F  V++    LL RL S   
Sbjct  171   SL--VSDSRSRNGLQAIGDFLADVSKTTNSFDSVASSRRKFRAVQEGSADLLKRLESGCK  228

Query  710   RIERRTKRLRVFKVALG-STLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKL  886
             ++  + + +   K  L  S +++  + F+I   +  +H +V  M +P  ++ S  +    
Sbjct  229   KMRAKLRFINRLKRTLAISAIVLAASTFIIGACV-PMHALVTLMTLPPFLSSSSRLASAR  287

Query  887   KEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK--  1060
             +  +        +   LD AAKG ++L  DL T+SRLV RL DE EH  T+  L      
Sbjct  288   RLDR--------VVAQLDAAAKGTYILNRDLDTISRLVARLHDEAEHTLTLLRLCERHGG  339

Query  1061  HCDDVLKEVVS--SKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             H   + +EV    +KN A   +     L ELE+H+YLCF+ I R+RR++++E++
Sbjct  340   HRRRLTQEVARQITKNLASFHQQ----LDELEEHLYLCFMTINRTRRLVLEELL  389



>ref|XP_006601074.1| PREDICTED: UPF0496 protein At3g49070-like [Glycine max]
Length=358

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 88/350 (25%), Positives = 151/350 (43%), Gaps = 26/350 (7%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHESL  355
             V  EY   FRT SY E + +V        S  +     T     S    +  L+   +S 
Sbjct  31    VREEYANTFRTESYTEFWTRVLAYSKDESSTCLSRESTTSARLPSYRLFAEHLLDPDQST  90

Query  356   PSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVK  535
              +       C+  +          H LL++YF  T  A  +C  LLK + + R  Y+S+K
Sbjct  91    VTRALSEAQCRPII----------HSLLSDYFAHTANASLLCSHLLKEIDRVRVKYRSLK  140

Query  536   KAVEKIEELGLSSEEQVNRAYGEIAS-LSLFGNTLS-AVRFDDVRDDHLGLLSRLTSKRG  709
               ++ +    + S   +     E ++ L+ FG + S + R    +     L  RL S R 
Sbjct  141   TILQCVPTNQIPS-PMIMIHLTEFSNFLNPFGASSSPSARIRATQCQCSDLQKRLESSRD  199

Query  710   RIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLK  889
             +   + + +   K       ++   +F++   IL  H     +AV GL +++L   +KL 
Sbjct  200   KARAKLQLVARLKCGSACLFVVITASFVV---ILVTHGFAMIVAVSGLASMNLASERKLA  256

Query  890   EAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD  1069
             +          +   LD A KG +++  DL T SRLV RL+DE+E+ KT    W  +  D
Sbjct  257   K----------VTSQLDAATKGTYIVNKDLETTSRLVARLNDELEYMKTTMRFWLERKKD  306

Query  1070  DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
                 +    +     +    + L ELE+H++LCF+ I R+R +++ +I  
Sbjct  307   KFQADGEVMRLLKKNQCSFSDQLDELEEHLFLCFMTINRARDLVLNQITN  356



>ref|XP_010941446.1| PREDICTED: putative UPF0496 protein 2 [Elaeis guineensis]
Length=390

 Score = 92.0 bits (227),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 138/274 (50%), Gaps = 15/274 (5%)
 Frame = +2

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEI  607
             H LL +YF  T +AC  C +LL  + + R+ ++S+++ + K+    L ++        ++
Sbjct  107   HSLLLDYFDTTSDACTACTTLLASIDRARSYHRSIRRLLLKLSHNRLDNDCTT---LADL  163

Query  608   ASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIG  778
              S     N LS +    F  V      L++RLT+   RI RR       K A G  L+  
Sbjct  164   KSHVELDNPLSPINLAHFHYVHASCRPLVARLTTANRRIARRAHLTGAAKKASGVILIGV  223

Query  779   CTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG--LYMP-----L  937
             C A ++   ++A H VV    V    A +  +  + + A R I  R G   Y+      +
Sbjct  224   CGAAVVAALVVAAHAVVGIGLVAVAAAPAPAVAARQRVASRWIRRRLGGESYLKRAGAQV  283

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQE  1117
             D AAKG +++ +DL TVSR+V R  DE+EH + +A L        +++E  +++     E
Sbjct  284   DAAAKGAYIVGSDLDTVSRMVRRAHDEVEHGRDVAKLVLRIRERQLVRE--AAREVEGGE  341

Query  1118  EWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             E     L ELE+HIYLC + I RSRRM+ QE++G
Sbjct  342   EELAAQLNELEEHIYLCLITINRSRRMVAQEMMG  375



>ref|XP_009149506.1| PREDICTED: UPF0496 protein At1g20180 isoform X2 [Brassica rapa]
Length=360

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 188/389 (48%), Gaps = 65/389 (17%)
 Frame = +2

Query  113   TKSPRRNSNENEG--SLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD  286
             T S R+ ++E E   SL  K S V+ EY  AFRTNSY+EI  K + QL    S ++    
Sbjct  14    TYSARQENSEKECRRSLTCKLS-VNEEYQEAFRTNSYLEIRTKAEDQLGITFSSKLSSPS  72

Query  287   NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLE  466
              T   +SSS  S     + +   P         QE ++ L Q  S  H LL ++F  + +
Sbjct  73    PTTSPSSSSDLSFHSHFTDYLLDPP--------QETLDALMQDTS-FHYLLAKFFDFSSD  123

Query  467   ACAICESLLKIVLQTRADYKSVKKAVE---------KIEELGLSSEEQVNRAYGEIASLS  619
             AC +CESLL+ + Q + ++  +K+ ++         K  E   S E      + E++  +
Sbjct  124   ACDVCESLLQCIQQIKINHMKLKRVIKIGKRVCNGAKTPEC--SRENLCALIFQELSKYA  181

Query  620   LFGNTLSAV----RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
             L  N L  +    +F  V D +  LL+RL SKR RI R+   L V               
Sbjct  182   LLKNPLYCIINETQFPRVNDANPDLLARLKSKRRRIRRKISILGV---------------  226

Query  788   FMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSR-----KGLYMPLDVAAK  952
                             +A P L+ L   + KK  + K    S+     + L   +D+AAK
Sbjct  227   ----------------LAAPALLGLCCLLRKKKTKRKMKNKSKTDTKLEKLGAQMDIAAK  270

Query  953   GLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALE  1132
             G F+++NDL T+SRL GRL DE+EH K +A + A     +VLKE +  + F   EE   E
Sbjct  271   GTFIMMNDLDTLSRLAGRLCDEIEHRKAVAAMCAKSGKVEVLKEAL--RVFNGHEERFSE  328

Query  1133  VLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +L+ELE+H+YLCF  I  SRR+++ +  G
Sbjct  329   LLQELEEHLYLCFHTINISRRLVLAQTTG  357



>tpg|DAA43374.1| TPA: hypothetical protein ZEAMMB73_365203 [Zea mays]
Length=353

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 99/370 (27%), Positives = 161/370 (44%), Gaps = 59/370 (16%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHESL  355
             EY +AFRT SY + + +V   +  A    +V   GGD               + +  + L
Sbjct  12    EYTSAFRTESYNDFWARVL-DITLAHGAGLVPRPGGDGG-------------VTASSKRL  57

Query  356   PSPGCKLLLCQENMEELPQQASNA----------HP----LLNEYFLLTLEACAICESLL  493
             PS      L  E + E  Q+A  A          HP    LL  Y+  T  A  +C  LL
Sbjct  58    PS----YRLFAEQLLEPDQRAVRAALASPRSGQLHPGVRDLLVTYYNETASASFLCSHLL  113

Query  494   KIVLQTRADYKSVKKAVEKIE-ELGLSSEEQVNRAYGE-IASLSLFGNTLSAVRFDDVRD  667
             + + Q R  Y+ +K  + K+  ++   +   V+ A G+  A+L++    L  V+      
Sbjct  114   RDIEQIRLRYRPLKTTLRKLACDVEAPNLSDVSAALGQPFAALAVSQGKLRQVQLSSA--  171

Query  668   DHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVP  847
                 LL  L + R +   R   L   +  L ++ +    A  +    + VH +    A P
Sbjct  172   ---DLLRSLDASRKKARLRISSLARLRQLLSASFVTVVAAVAVVGAFIGVHILAAFAAFP  228

Query  848   GLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEH  1027
              +    LG+         G   R+ L + L+ A KG ++L  D+ T+SRLV RL DE EH
Sbjct  229   MMSPAWLGLFS-------GRSVRRAL-VQLEAATKGTYILNRDMDTISRLVARLRDEGEH  280

Query  1028  NKTIADLWAMKHC------DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRS  1189
                +  L  ++H         ++KEV+  K     EE   + L +LE+H++LCF+ I ++
Sbjct  281   MLALLQL-CVEHLAMAGEKGRLVKEVL--KQLCKNEESFRQQLDDLEEHLFLCFMTINKA  337

Query  1190  RRMIVQEIVG  1219
             R M++  I G
Sbjct  338   RSMVMNFIAG  347



>ref|NP_001136798.1| hypothetical protein [Zea mays]
 gb|ACF82657.1| unknown [Zea mays]
 tpg|DAA43375.1| TPA: hypothetical protein ZEAMMB73_365203 [Zea mays]
Length=382

 Score = 86.7 bits (213),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 99/371 (27%), Positives = 161/371 (43%), Gaps = 59/371 (16%)
 Frame = +2

Query  182   HEYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHES  352
              EY +AFRT SY + + +V   +  A    +V   GGD               + +  + 
Sbjct  40    EEYTSAFRTESYNDFWARVL-DITLAHGAGLVPRPGGDGG-------------VTASSKR  85

Query  353   LPSPGCKLLLCQENMEELPQQASNA----------HP----LLNEYFLLTLEACAICESL  490
             LPS      L  E + E  Q+A  A          HP    LL  Y+  T  A  +C  L
Sbjct  86    LPS----YRLFAEQLLEPDQRAVRAALASPRSGQLHPGVRDLLVTYYNETASASFLCSHL  141

Query  491   LKIVLQTRADYKSVKKAVEKIE-ELGLSSEEQVNRAYGE-IASLSLFGNTLSAVRFDDVR  664
             L+ + Q R  Y+ +K  + K+  ++   +   V+ A G+  A+L++    L  V+     
Sbjct  142   LRDIEQIRLRYRPLKTTLRKLACDVEAPNLSDVSAALGQPFAALAVSQGKLRQVQLSSA-  200

Query  665   DDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAV  844
                  LL  L + R +   R   L   +  L ++ +    A  +    + VH +    A 
Sbjct  201   ----DLLRSLDASRKKARLRISSLARLRQLLSASFVTVVAAVAVVGAFIGVHILAAFAAF  256

Query  845   PGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEME  1024
             P +    LG+         G   R+ L + L+ A KG ++L  D+ T+SRLV RL DE E
Sbjct  257   PMMSPAWLGLFS-------GRSVRRAL-VQLEAATKGTYILNRDMDTISRLVARLRDEGE  308

Query  1025  HNKTIADLWAMKHC------DDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVR  1186
             H   +  L  ++H         ++KEV+  K     EE   + L +LE+H++LCF+ I +
Sbjct  309   HMLALLQL-CVEHLAMAGEKGRLVKEVL--KQLCKNEESFRQQLDDLEEHLFLCFMTINK  365

Query  1187  SRRMIVQEIVG  1219
             +R M++  I G
Sbjct  366   ARSMVMNFIAG  376



>ref|XP_009388342.1| PREDICTED: putative UPF0496 protein 2 [Musa acuminata subsp. 
malaccensis]
Length=366

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 104/380 (27%), Positives = 164/380 (43%), Gaps = 51/380 (13%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAA-RSKEIVGGDNTFPLTssssssssPLIS--G  343
             +V+ EY    RT S+V++  KV  QL     S E   GD          +S  P +S   
Sbjct  6     NVNEEYKKTLRTKSFVDMCSKVHQQLRRTISSSEDDDGDKD-------EASHRPTVSYTK  58

Query  344   HESLPSPGCKLLLCQENMEELPQQASNA-------HPLLNEYFLLTLEACAICESLLKIV  502
             H         L L QE++ E      +        H LL EYF +T  AC  C ++L  +
Sbjct  59    HSEFL-----LELSQESVVEAATATIDGCSAYLYLHSLLLEYFDVTFRACTACTNVLASI  113

Query  503   LQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL---SAVRFDDVRDDH  673
              + R  ++S++  + K+    L   +     +  +ASL    N L   +   F  V+   
Sbjct  114   NRARERHRSIRHLLIKLSSTCLFDGDCTE--FDRLASLLQLDNPLHPQNLANFQSVQSHC  171

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFM-----------ITFTILAVH  820
               L+ +L      I RR + +R+ K A G  ++  C   +           I F ++A  
Sbjct  172   SLLMQQLARAHRGILRRLRFVRLTKKATGIVMISTCNVALVVAVVIAVHTVIGFGVVAAA  231

Query  821   FVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLV  1000
               V     P    +     K+ ++  R       L   +D AAKG +++  DL TVSR+V
Sbjct  232   APVVMATRP-RAGMRWARTKRARDLGR-------LGAQVDAAAKGAYIVGRDLDTVSRMV  283

Query  1001  GRLSDEMEHNKTIADLWAMKHCDDVLKEVVS-SKNFAIQEEWALEVLKELEQHIYLCFLN  1177
              R+ DE+EH + +A +        +++EV    +  A   E  +E LKE   H+ LC + 
Sbjct  284   RRVQDEVEHEQEVARMTLRARERQLVREVARVVEGGAAGMEAQMEELKE---HVCLCLIT  340

Query  1178  IVRSRRMIVQEIV-GRV*PA  1234
             I RSRRM+ QE++ G   PA
Sbjct  341   INRSRRMVAQEMMEGGAEPA  360



>ref|XP_009383392.1| PREDICTED: putative UPF0496 protein 2 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 139/286 (49%), Gaps = 47/286 (16%)
 Frame = +2

Query  428   HPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEI  607
             H LL E+F +TL+AC  C +LL  + +TR  ++S++  + K+      S++    A+  +
Sbjct  140   HSLLLEFFDVTLQACTACTNLLASINRTRVHHRSIRHLLYKLS--FACSDDSDCTAFDRL  197

Query  608   ASLSLFGNTLSA---VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIG  778
             ASL    N L       F   + ++  L+ +LT+   RI RR + +R+ + A G   ++ 
Sbjct  198   ASLVNTENPLQPQNLAHFHSAQSEYTRLMQQLTAAHRRILRRARLIRLTRKATG---ILT  254

Query  779   CTAFMITFTILAVHFVV----------CTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLY  928
              +  +    ++AVH V+            M    L A+S     K +  ++       L 
Sbjct  255   ISIAVAVALVIAVHTVIGVGVVVAIAPAIMTTAPLTAMSWARAGKARYLEK-------LG  307

Query  929   MPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFA  1108
               +D AAKG +++  DL T+SR+V R+ DE+EH +            DV + V+  +   
Sbjct  308   AQVDSAAKGAYIVGRDLDTMSRMVRRVHDEVEHER------------DVARMVLRDRERQ  355

Query  1109  IQEEWALEV----------LKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             +  E A EV          LKELE+H+YLC + I RSRRM+ QE+ 
Sbjct  356   LVREAAREVEGGTAGMAEQLKELEEHVYLCLITINRSRRMVAQEMT  401



>ref|XP_003563532.2| PREDICTED: UPF0496 protein At1g20180-like [Brachypodium distachyon]
Length=369

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 130/271 (48%), Gaps = 32/271 (12%)
 Frame = +2

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF  625
             YF  + EA  IC  LL+ +  T+++Y+S+   +  I  LG ++    +     + +  + 
Sbjct  112   YFDASTEASEICRQLLRNIKNTQSNYQSMDNFLASI--LGCTT--ATSSTPLALETFPVR  167

Query  626   GNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMI  796
              N  S     +F  + D +  +L  + S   ++ ++ K ++V K    + L+I C A  I
Sbjct  168   SNPFSTTTRSKFRQIHDKYSSILQTIKSSHKKVAKKLKIMKVIKRLSRACLIIACGAVAI  227

Query  797   TFTILAVHF-VVCTMAVPGLIALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLI  970
               T   + F ++   AV GL    L   + +LK +K    S + L   LD  AKG +VL 
Sbjct  228   GITAHLLFFSLLVGSAVMGLCPFVLKRRITRLKRSK--TKSLRQLQEQLDTVAKGTYVLG  285

Query  971   NDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLK---  1141
              D  TVS LV RLSD +E   T+A ++ M+  D+          F +Q E  +E+ +   
Sbjct  286   RDFDTVSDLVVRLSDGIERENTMA-MYCMEMVDE---------KFPVQ-EMVMELRRSCS  334

Query  1142  -------ELEQHIYLCFLNIVRSRRMIVQEI  1213
                    ELE+H+ LC   I R+R ++++E+
Sbjct  335   TSKRLAGELEEHVGLCLATIYRARDLVIEEM  365



>ref|XP_008436997.1| PREDICTED: UPF0496 protein At3g49070 isoform X2 [Cucumis melo]
Length=147

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (56%), Gaps = 22/144 (15%)
 Frame = +2

Query  821   FVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLV  1000
             F+ C+ A PG +  ++ +VKK ++  + +         L+VAAKG + L  D  T+ RLV
Sbjct  13    FLSCS-AAPGFLVGAIKLVKKSRKLAKKVAQ-------LNVAAKGTYTLNRDFDTIGRLV  64

Query  1001  GRLSDEMEHNKTIADLWAMKHCD------DVLKEVVSS-KNFAIQEEWALEVLKELEQHI  1159
              RLS E+EH + +   W  +  D      ++L+++  S +NF  Q       L ELE+H+
Sbjct  65    ARLSHELEHMRVMTKFWLDRGEDKRWAIGELLRQLNQSHENFNQQ-------LDELEEHL  117

Query  1160  YLCFLNIVRSRRMIVQEIVGRV*P  1231
             YLCF+ I R+R ++V+EI+    P
Sbjct  118   YLCFMTINRARNLVVKEILDSSAP  141



>gb|EAY88551.1| hypothetical protein OsI_10026 [Oryza sativa Indica Group]
Length=379

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 96/370 (26%), Positives = 158/370 (43%), Gaps = 66/370 (18%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHESL  355
             EY +AFRT SY + + +V   +  A    +V   GG                  +  + L
Sbjct  38    EYTSAFRTESYNDFWARVL-DITLAHGAALVPRHGGGGG--------------CAASKRL  82

Query  356   PSPGCKLLLCQENMEELPQQASNA--------------HPLLNEYFLLTLEACAICESLL  493
             PS      L  E++ E  Q+A  A                LL  Y+  T  A  +C  LL
Sbjct  83    PS----YRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLAAYYAETANASFLCSHLL  138

Query  494   KIVLQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDD  670
             K +   R  Y+ +K  + K+  ++G+S    V+ A G+           S  R  +V+  
Sbjct  139   KDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQ----PFTALAASQGRLREVQAG  194

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                LL  L + R +   R + +   + AL  + +       +    + VH +    A P 
Sbjct  195   SGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACIGVHILAAFAAFPM  254

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             +    LG     +    G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH 
Sbjct  255   MSPAWLG-----ERFFSGRAARRAL-VQLEAAAKGTYILNRDMETISRLVARVRDEGEHM  308

Query  1031  KTIADLWAMKH------------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
               +  L  ++H              +VL+++  SKN    EE   + L ELE+H++LCF+
Sbjct  309   VALLRL-CVEHRPAAGAGGKGRLVQEVLRQL--SKN----EESFRQQLDELEEHLFLCFM  361

Query  1175  NIVRSRRMIV  1204
              I ++R M++
Sbjct  362   TINKARIMVM  371



>sp|A2XCJ1.2|U496C_ORYSI RecName: Full=UPF0496 protein 3 [Oryza sativa Indica Group]
Length=378

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 96/370 (26%), Positives = 158/370 (43%), Gaps = 66/370 (18%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHESL  355
             EY +AFRT SY + + +V   +  A    +V   GG                  +  + L
Sbjct  37    EYTSAFRTESYNDFWARVL-DITLAHGAALVPRHGGGGG--------------CAASKRL  81

Query  356   PSPGCKLLLCQENMEELPQQASNA--------------HPLLNEYFLLTLEACAICESLL  493
             PS      L  E++ E  Q+A  A                LL  Y+  T  A  +C  LL
Sbjct  82    PS----YRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLAAYYAETANASFLCSHLL  137

Query  494   KIVLQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDD  670
             K +   R  Y+ +K  + K+  ++G+S    V+ A G+           S  R  +V+  
Sbjct  138   KDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQ----PFTALAASQGRLREVQAG  193

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                LL  L + R +   R + +   + AL  + +       +    + VH +    A P 
Sbjct  194   SGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACIGVHILAAFAAFPM  253

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             +    LG     +    G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH 
Sbjct  254   MSPAWLG-----ERFFSGRAARRAL-VQLEAAAKGTYILNRDMETISRLVARVRDEGEHM  307

Query  1031  KTIADLWAMKH------------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
               +  L  ++H              +VL+++  SKN    EE   + L ELE+H++LCF+
Sbjct  308   VALLRL-CVEHRPAAGAGGKGRLVQEVLRQL--SKN----EESFRQQLDELEEHLFLCFM  360

Query  1175  NIVRSRRMIV  1204
              I ++R M++
Sbjct  361   TINKARIMVM  370



>ref|XP_011069602.1| PREDICTED: UPF0496 protein At3g49070-like [Sesamum indicum]
Length=133

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 74/132 (56%), Gaps = 17/132 (13%)
 Frame = +2

Query  845   PGLIALSLGMVKK----LKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLS  1012
             P L +L +  +K+     +  K G+  R  +   LDVAAKG ++L  D  T+SRLV RL 
Sbjct  3     PALFSLPMKPLKRKIQTFQFLKYGLLKR--VVGQLDVAAKGAYILNRDFDTISRLVARLH  60

Query  1013  DEMEHNKTIADLWAMKHCD-----DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLN  1177
             DE+EHNK +   +  +  D      VLKE +    F  +++     ++ELE+H+YLC + 
Sbjct  61    DEIEHNKELIHFYLERREDRLSLVQVLKE-IKKYEFGFRKQ-----VEELEEHVYLCLVT  114

Query  1178  IVRSRRMIVQEI  1213
             I R+R ++V EI
Sbjct  115   INRARALVVDEI  126



>gb|KHN41282.1| UPF0496 protein [Glycine soja]
Length=271

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/270 (27%), Positives = 132/270 (49%), Gaps = 24/270 (9%)
 Frame = +2

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF  625
             YF ++ EA  IC  LL+ + Q + +Y+ +++A+  +++    S E+      E+ S    
Sbjct  4     YFDISAEASFICSHLLQSINQVQCNYQFIERALGIMDDD--DSLEKFKLISFELNSFIFS  61

Query  626   GNTLSAVR-----FDDVRDDHLG-LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTA  787
              N LS +      F  + D++   LL RL S R ++ R+ K +   K     T  I C A
Sbjct  62    KNPLSNLNINHDLFKLISDENSSVLLHRLKSMRKKLGRKVKLMTYLK----KTSEI-CVA  116

Query  788   F--MITFTILAVHFVVCTMAVPGLIALSLGMVKK-----LKEAKRGIPSRKGLYMPLDVA  946
                ++  T  A H +   +  P ++      + K     L+ ++R   S   +   LD+A
Sbjct  117   MYDLVAITATAAHTLSTLIMGPTILNFPCKSLNKRELPHLRFSRRMFLS--NVCDQLDIA  174

Query  947   AKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWA  1126
             AKG ++L  D  T++R+V RL DE+EH + +   +  K  D    ++V  K      +  
Sbjct  175   AKGTYILNKDFDTMTRVVARLYDEIEHKRAMVQFFLDKKDDKFSLQMV--KELKKSGDGF  232

Query  1127  LEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              + ++EL++H+YLC + I R+R ++ +E+ 
Sbjct  233   RKQVEELKEHVYLCLVTINRARCLVTEEMT  262



>ref|XP_010314478.1| PREDICTED: UPF0496 protein At3g49070-like isoform X2 [Solanum 
lycopersicum]
Length=169

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 10/97 (10%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD----VLKEVVSSKN  1102
             LDVAAKG ++L  D  T+SRLV RL DE+EHNK +  L   +  D     VLKE+  S N
Sbjct  74    LDVAAKGTYILNRDFDTMSRLVDRLHDEIEHNKAMIKLCLDRREDSISLKVLKELKKS-N  132

Query  1103  FAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                +++     ++ELE+H+YLC L I R+R +++ EI
Sbjct  133   VGFRKQ-----VEELEEHVYLCLLTINRARNLVINEI  164



>ref|XP_009395566.1| PREDICTED: putative UPF0496 protein 2 [Musa acuminata subsp. 
malaccensis]
Length=409

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 76/284 (27%), Positives = 125/284 (44%), Gaps = 37/284 (13%)
 Frame = +2

Query  425   AHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGE  604
             AH LL EYF +T +AC  C  LL  + + R  ++S++  + K+        +        
Sbjct  132   AHSLLLEYFDVTFQACDACAKLLASLSRAREHHRSIRHLLAKVSSACFDDNDCCADV-DH  190

Query  605   IASLSLFGNTLSAV---RFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLI  775
             +ASL    N L +    RF  V+  +  L+ +LT    R  R  + +R+ K A    ++ 
Sbjct  191   LASLLRLENPLCSANLARFYSVQSQYRTLMQQLTKAHRRTLRMVRLIRLTKKAARIVVVS  250

Query  776   GCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLD-----  940
              C+  +     +A H V+      G++A +  MV   +        R      L+     
Sbjct  251   ACSIAVAAALAIAAHTVIGI----GVVAAAAPMVMTTRPRAAMRRGRAARARHLERLGAQ  306

Query  941   --VAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
                AAKG +++  D  T+SR V R  DE+EH + +A +             +  +   + 
Sbjct  307   VGAAAKGAYIVGRDFDTISRTVRRAHDEVEHEREMARM------------ALRGRELQLA  354

Query  1115  EEWALEV----------LKELEQHIYLCFLNIVRSRRMIVQEIV  1216
              E A EV          L+ELE+H+YLC + I RSR M+ QE++
Sbjct  355   REVAREVEGGAARVEEQLEELEEHVYLCLITINRSRSMVAQEVM  398



>gb|AAN87731.1| Unknown protein [Oryza sativa Japonica Group]
Length=379

 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 95/370 (26%), Positives = 157/370 (42%), Gaps = 66/370 (18%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHESL  355
             EY +AFRT SY + + +V   +  A    +V   GG                  +  + L
Sbjct  38    EYTSAFRTESYNDFWARVL-DITLAHGAALVPRHGGGGG--------------CAASKRL  82

Query  356   PSPGCKLLLCQENMEELPQQASNA--------------HPLLNEYFLLTLEACAICESLL  493
             PS      L  E++ E  Q+A  A                LL  Y+  T  A  +C  LL
Sbjct  83    PS----YRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLAAYYAETANASFLCSHLL  138

Query  494   KIVLQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDD  670
             K +   R  Y+ +K  + K+  ++G+S    V+ A G+           S  R  +V+  
Sbjct  139   KDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQ----PFTALAASQGRLREVQAG  194

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                LL  L + R +   R + +   + AL  + +       +    + VH +    A P 
Sbjct  195   SGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACIGVHILAAFAAFPM  254

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             +    LG     +    G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH 
Sbjct  255   MSPAWLG-----ERFFSGRAARRAL-VQLEAAAKGTYILNRDMETISRLVARVRDEGEHM  308

Query  1031  KTIADLWAMKH------------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
               +  L  ++H              +VL+++  SKN    EE   + L ELE+H++LCF+
Sbjct  309   VALRRL-CVEHRPAAGAGGKGRLVQEVLRQL--SKN----EESFRQQLDELEEHLFLCFM  361

Query  1175  NIVRSRRMIV  1204
                ++R M++
Sbjct  362   TTNKARIMVM  371



>gb|AAK98722.1|AC090485_1 Hypothetical protein [Oryza sativa Japonica Group]
Length=364

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 95/370 (26%), Positives = 157/370 (42%), Gaps = 66/370 (18%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHESL  355
             EY +AFRT SY + + +V   +  A    +V   GG                  +  + L
Sbjct  23    EYTSAFRTESYNDFWARVL-DITLAHGAALVPRHGGGGG--------------CAASKRL  67

Query  356   PSPGCKLLLCQENMEELPQQASNA--------------HPLLNEYFLLTLEACAICESLL  493
             PS      L  E++ E  Q+A  A                LL  Y+  T  A  +C  LL
Sbjct  68    PS----YRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLAAYYAETANASFLCSHLL  123

Query  494   KIVLQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDD  670
             K +   R  Y+ +K  + K+  ++G+S    V+ A G+           S  R  +V+  
Sbjct  124   KDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQ----PFTALAASQGRLREVQAG  179

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                LL  L + R +   R + +   + AL  + +       +    + VH +    A P 
Sbjct  180   SGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACIGVHILAAFAAFPM  239

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             +    LG     +    G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH 
Sbjct  240   MSPAWLG-----ERFFSGRAARRAL-VQLEAAAKGTYILNRDMETISRLVARVRDEGEHM  293

Query  1031  KTIADLWAMKH------------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
               +  L  ++H              +VL+++  SKN    EE   + L ELE+H++LCF+
Sbjct  294   VALRRL-CVEHRPAAGAGGKGRLVQEVLRQL--SKN----EESFRQQLDELEEHLFLCFM  346

Query  1175  NIVRSRRMIV  1204
                ++R M++
Sbjct  347   TTNKARIMVM  356



>ref|NP_001048965.1| Os03g0148000 [Oryza sativa Japonica Group]
 sp|Q10RR9.1|U496C_ORYSJ RecName: Full=UPF0496 protein 3 [Oryza sativa Japonica Group]
 gb|ABF93987.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10879.1| Os03g0148000 [Oryza sativa Japonica Group]
Length=378

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 157/370 (42%), Gaps = 66/370 (18%)
 Frame = +2

Query  185   EYMAAFRTNSYVEIYDKVQGQLAAARSKEIV---GGDNTFPLTssssssssPLISGHESL  355
             EY +AFRT SY + + +V   +  A    +V   GG                  +  + L
Sbjct  37    EYTSAFRTESYNDFWARVL-DITLAHGAALVPRHGGGGG--------------CAASKRL  81

Query  356   PSPGCKLLLCQENMEELPQQA--------------SNAHPLLNEYFLLTLEACAICESLL  493
             PS      L  E++ E  Q+A               +   LL  Y+  T  A  +C  LL
Sbjct  82    PS----YRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLAAYYAETANASFLCSHLL  137

Query  494   KIVLQTRADYKSVKKAVEKI-EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDD  670
             K +   R  Y+ +K  + K+  ++G+S    V+ A G+           S  R  +V+  
Sbjct  138   KDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQ----PFTALAASQGRLREVQAG  193

Query  671   HLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPG  850
                LL  L + R +   R + +   + AL  + +       +    + VH +    A P 
Sbjct  194   SGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACIGVHILAAFAAFPM  253

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             +    LG     +    G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH 
Sbjct  254   MSPAWLG-----ERFFSGRAARRAL-VQLEAAAKGTYILNRDMETISRLVARVRDEGEHM  307

Query  1031  KTIADLWAMKH------------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
               +  L  ++H              +VL+++  SKN    EE   + L ELE+H++LCF+
Sbjct  308   VALRRL-CVEHRPAAGAGGKGRLVQEVLRQL--SKN----EESFRQQLDELEEHLFLCFM  360

Query  1175  NIVRSRRMIV  1204
                ++R M++
Sbjct  361   TTNKARIMVM  370



>gb|KHN33256.1| UPF0496 protein [Glycine soja]
Length=204

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 85/180 (47%), Gaps = 13/180 (7%)
 Frame = +2

Query  680   LLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIA  859
             L  RL S R +   + + +   K       ++   +F++   IL  H     +AV GL +
Sbjct  36    LQKRLESSRDKARAKLQLVARLKCGSACLFVVITASFVV---ILVTHGFAMIVAVSGLAS  92

Query  860   LSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTI  1039
             ++L   +KL +              LD A KG +++  DL T SRLV RL+DE+E+ KT 
Sbjct  93    MNLASERKLAKVTS----------QLDAATKGTYIVNKDLETTSRLVARLNDELEYMKTT  142

Query  1040  ADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
                W  +  D    +    +     +    + L ELE+H++LCF+ I R+R +++ +I  
Sbjct  143   MRFWLERKKDKFQADGEVMRLLKKNQCSFSDQLDELEEHLFLCFMTINRARDLVLNQITN  202



>ref|XP_011075012.1| PREDICTED: UPF0496 protein At3g49070-like [Sesamum indicum]
Length=130

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 11/129 (9%)
 Frame = +2

Query  848   GLIALSLGMVKKLKEA-------KRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGR  1006
             G   L+L  VK LK+        K G  S+ G    LD AAKG ++L  D  T+SRLVGR
Sbjct  2     GPALLTLPPVKPLKKKVLDMGFLKYGFLSKIG--SQLDAAAKGTYILNRDFDTMSRLVGR  59

Query  1007  LSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVR  1186
             L DE++HNK +      +  D +   V+  K     E   ++ ++ELE+H+YLC + I R
Sbjct  60    LQDEIDHNKEMIQFCLDRREDRISFRVL--KEMKKCEVGFMKQVEELEEHVYLCLVTINR  117

Query  1187  SRRMIVQEI  1213
             +R ++++EI
Sbjct  118   ARALLMKEI  126



>gb|EMT22072.1| hypothetical protein F775_11781 [Aegilops tauschii]
Length=325

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 127/266 (48%), Gaps = 23/266 (9%)
 Frame = +2

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF  625
             YF  + EA  IC+ LL+ +  T ++Y+S+   +  I     +S   +  A   I   S  
Sbjct  69    YFDASAEASEICKQLLRNIKNTESNYQSMDSFLASIGCTTATSSTSL--ALETIPGRSNP  126

Query  626   GNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRL-------RVFKVALGSTLLIGCT  784
              +T +   F  + D +  +L  + S   ++ ++ K +       R   V  G  + IG  
Sbjct  127   FSTTTRSNFRQIHDRYSSVLQTIKSSHRKVAKKLKIVKIIKKLSRTCLVIAGGAVAIGIA  186

Query  785   AFMITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAKGLF  961
             A ++ F++L         A+ GL  ++L   V +LK +K    S + L   LD AAKG +
Sbjct  187   AHLLVFSLLV------GSALMGLCPIALKRRVTRLKRSK--TKSLQQLQEQLDTAAKGTY  238

Query  962   VLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD--VLKEVVSSKNFAIQEEWALEV  1135
             VL  D  TVS+L  RLSD +E    +A  + M+  D+   ++E+V     +      L +
Sbjct  239   VLGRDFDTVSQLAVRLSDGIERENAMAT-YCMEMVDEKYPVQEMVVELRRSCSSSRRLAM  297

Query  1136  LKELEQHIYLCFLNIVRSRRMIVQEI  1213
               ELE+H+ LC   I R+R ++++EI
Sbjct  298   --ELEEHVGLCLATIHRARLLVIEEI  321



>tpg|DAA37854.1| TPA: hypothetical protein ZEAMMB73_661500 [Zea mays]
Length=369

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 127/280 (45%), Gaps = 35/280 (13%)
 Frame = +2

Query  437   LNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASL  616
             + +YF  + EA  +C  LL+ +  T+++Y+S+   +  +      + +    A   +A +
Sbjct  56    MADYFDASAEASEMCRQLLRNIKSTQSNYRSMDTFLSSM------AADDATTAGEPVARI  109

Query  617   SLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMI  796
             + F  T     F  + D + G+L  + +   R+ R  K LR  +    + L++ C+A   
Sbjct  110   NPFRTTTRGS-FRQIHDRYSGVLQSIRAGHRRVARELKVLRAVRRLSRTCLVVACSAAAA  168

Query  797   TFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG-------------LYMPL  937
                  A H ++  + + G  A + G +  +   +R   +RK              L   L
Sbjct  169   AAIGAAAHLLLFGLLI-GPAAAAAGGLYPMALKRRTAAARKQSSSRSRTMSSLLRLQEQL  227

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIA--------DLWAMKHCDDVLKEVVS  1093
             D AAKG +VL  DL TVS LV RLSD +E    +A        + W      +V+ E+  
Sbjct  228   DTAAKGTYVLGRDLDTVSHLVARLSDGIERENDMAWRCVGRAGETWPPAALQEVVGELRR  287

Query  1094  SKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             S + + +      + +EL+ H+ LC   I ++R +++QEI
Sbjct  288   SCSVSSR------LAEELQDHVCLCLATIQKARVLLIQEI  321



>ref|XP_011069603.1| PREDICTED: UPF0496 protein At3g49070-like [Sesamum indicum]
Length=215

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/233 (26%), Positives = 102/233 (44%), Gaps = 33/233 (14%)
 Frame = +2

Query  86   FSKMKSAFITKSPRRNSNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARS  265
            +++ K++FI K  ++          R+S +V+ EY+ A RT S+ + + KV   +    S
Sbjct  2    WARFKTSFIKKDKQK-----AKLCHRRSINVNEEYLCAVRTKSFADFFLKVHLLVNGQSS  56

Query  266  KEIVGGDNTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQA------SNA  427
                  ++   L+              E L  PG      QE +  L + A      S+ 
Sbjct  57   SSSPAYNSNARLS--------------EILLDPG------QETITALLEAAVVFSDKSSD  96

Query  428  H--PLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYG  601
            H   LL  YF ++ EA   C  LLK + Q R+DY  + K ++ I+     + ++ +    
Sbjct  97   HLKSLLFNYFNISAEASKFCSQLLKSLNQVRSDYILIHKLIDAIDHDHDYTSDEFSCLIS  156

Query  602  EIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALG  760
            E+ S  +  N  S   F  + + H  +L  L SKR R+ R+ K ++ F  A G
Sbjct  157  ELCSCIILNNPFSKQDFKHIHEKHSSVLQHLKSKRKRVARKIKMIKFFNKASG  209



>ref|XP_011075011.1| PREDICTED: uncharacterized protein LOC105159596 [Sesamum indicum]
Length=215

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 98/223 (44%), Gaps = 29/223 (13%)
 Frame = +2

Query  137  NENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssss  316
            ++NE     +S  V++EY+ AFRT SY + + K Q  +   RS                 
Sbjct  13   DKNEKIESDRSLDVNNEYLCAFRTKSYADFFVKAQLLINEPRS-----------------  55

Query  317  ssssPLISGH----ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICE  484
                P    H    E L  P  + +    +   L  ++S+   LL  YF ++ EA   C 
Sbjct  56   ----PPAYAHCRLSEVLLDPAQETIAAVLDSAALSNKSSDLKSLLFNYFDVSAEASKFCS  111

Query  485  SLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAV----RF  652
             LL+ + Q ++DY+ + + ++ I++   S+++Q +  + E+ S  +  +  S++      
Sbjct  112  QLLRSLGQVQSDYRFIHQMLDSIDDYYSSNDQQFDSIFSELRSRVVLKDPFSSIMNKQDL  171

Query  653  DDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGC  781
              + + H  +L  L SK  R+ R+ K ++    A G  +   C
Sbjct  172  SRINEKHSSVLQHLKSKSKRVARKIKLIKYMNKASGVCVAAAC  214



>gb|EMS66051.1| hypothetical protein TRIUR3_17406 [Triticum urartu]
Length=325

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 72/269 (27%), Positives = 129/269 (48%), Gaps = 23/269 (9%)
 Frame = +2

Query  437   LNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASL  616
             ++ YF  + EA  IC+ LL+ +  T ++Y+S+   +  I     ++    + A   I   
Sbjct  66    MSGYFDASAEASEICKQLLRNIKNTESNYQSMDSFLASIG--CTTAPSSTSLALETIPGR  123

Query  617   SLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRL-------RVFKVALGSTLLI  775
             S   ++ +   F  + D +  +L  + S   ++ ++ K +       R   V  G  + I
Sbjct  124   SNPFSSTTRSNFRQIHDRYSSVLKTIKSSHRKVAKKLKIVKIIKKLSRTCLVIAGGAVAI  183

Query  776   GCTAFMITFTILAVHFVVCTMAVPGLIALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAK  952
             G  A ++ F++L         A+ GL  +++   V +LK +K    S + L   LD AAK
Sbjct  184   GIAAHLLVFSLLV------GSALMGLCPIAVKRRVTRLKRSK--TESLQQLQEQLDTAAK  235

Query  953   GLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD--VLKEVVSSKNFAIQEEWA  1126
             G +VL  D  TVS+L  RLSD +E    +A  + M+  D+   ++E+V     +      
Sbjct  236   GTYVLGRDFDTVSQLAVRLSDGIERENAMAT-YCMEMVDEKYPVQEMVLELRRSCSSSRR  294

Query  1127  LEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             L +  ELE+H+ LC   I R+R ++++EI
Sbjct  295   LAI--ELEEHVGLCLATIHRARVLVIEEI  321



>ref|XP_002983928.1| hypothetical protein SELMODRAFT_423232 [Selaginella moellendorffii]
 gb|EFJ14940.1| hypothetical protein SELMODRAFT_423232 [Selaginella moellendorffii]
Length=437

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 169/359 (47%), Gaps = 40/359 (11%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD---NTFPLTssssssssPLISGH  346
             V  EY  A RT+SYVE  ++V    A AR     G     +  P+  S    ++ L+   
Sbjct  105   VEQEYQRAIRTDSYVEFAERV----AVARLNRETGTSVQGSVSPMPRSFERLAAALLEPE  160

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             E       K+L      +EL ++    H L++EY   + ++ A+  SLL          K
Sbjct  161   ED------KILALLTTNKELGKRP-EIHQLVSEYLEESRKSSALWASLL----------K  203

Query  527   SVKKAVEKIEELG--LSSEEQVNRAYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSR  691
             S++ + ++ +E+G  L S+        E+ S+    N  S     +F  + D  LG+  +
Sbjct  204   SIQSSRDRCQEIGGILKSQTSDQEILRELCSIDEGENLFSVAVVQQFQPLHDHCLGMQKK  263

Query  692   LTSKRGRIERRTKRLRVFKVALG-STLL--IGCTAFMITFTILAVHFVVCTMAVPGLIAL  862
             L   R ++    K+LR+ +  L  ST++  IGC   ++  T+     V   +    +   
Sbjct  264   LDKIRKKV---GKKLRLTRACLKVSTVILSIGCFIVLLVTTLALFLAVAALVVGCKVFTF  320

Query  863   SLG-MVKKLKEAKR-GIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEME-HNK  1033
              +G +V++L   KR  + + +  +  ++  ++G FV++ DL T  RLV RL  E++  NK
Sbjct  321   PIGYVVRRLNLRKRKKLNALERQWRQVEAVSQGTFVVVQDLDTTRRLVMRLGSEIDFTNK  380

Query  1034  TIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
              +A  ++++H +D      S +     +    ++L +LE +IYL F++I  +RR + ++
Sbjct  381   AVA--FSIRHREDRSMLSQSLERLRRNQMILSQLLDDLEVNIYLSFMSINNTRREVCRQ  437



>emb|CDY28664.1| BnaCnng05500D [Brassica napus]
Length=363

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 79/297 (27%), Positives = 132/297 (44%), Gaps = 48/297 (16%)
 Frame = +2

Query  386   QENMEELPQQASNAHP-----LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEK  550
             Q N E + +  S+A P     L++ YF  +  A  +C +L + V   R  Y  +      
Sbjct  89    QPNNECVQEALSHAKPTTLTHLVSTYFQHSESATRLCLNLYQSVHTARHLYTPLFDLFHI  148

Query  551   IEELGLSSEEQV-NRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSK-RGRIERR  724
             +     + +E + N A+     L  F N  S+      RD  L   S+L  K   R+ + 
Sbjct  149   LPVDSHAIDESLCNLAFDLFLKLDTFENPFSSPESHSFRDTQLCF-SQLKHKLDTRLRKS  207

Query  725   TKRLRVFKVALGST---LLIGCTAFMITFTILAVHFV--VCTMAVPGLIALSLGMVKKLK  889
               R+R+   A   +   L +GC  F ++ T L + F   +C+  +P          K+L 
Sbjct  208   RSRVRLIHHATAGSALPLYLGCCCFCLSCTTLPLLFAGPLCSPYLPHSFK-----KKELT  262

Query  890   EAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIA--------D  1045
                +           L+ AAKG FVL  DL T+ RLV RL   +E++K           D
Sbjct  263   NISQ-----------LNAAAKGTFVLNKDLDTIDRLVSRLHTGIEYDKLFIRLGLERGRD  311

Query  1046  LWAMKHCDDVLKEVVSSK-NFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             +++++   ++LK++  +  N   Q       LK+LE HI L F N+ ++R +++QEI
Sbjct  312   VYSVQ---EILKQLRKTHLNLTHQ-------LKDLEDHICLWFTNVNKARSLLLQEI  358



>ref|XP_004173545.1| PREDICTED: UPF0496 protein 3-like [Cucumis sativus]
Length=347

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 85/362 (23%), Positives = 156/362 (43%), Gaps = 58/362 (16%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             +KS +V  EY+   RT S+ E +   +   ++A +      D  +  + +       L+ 
Sbjct  31    KKSFNVDDEYLCTLRTQSFAEFFINPESPPSSAST----AVDCCWRFSETI------LLQ  80

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
               +  P+P    +L    +  LP+       L  +YF L+ +A  +C  LL     TR+ 
Sbjct  81    PGQLEPAPS---ILESSFILMLPELKG----LFTDYFNLSAKASNLCTRLLSNFKLTRST  133

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTS  700
              + ++++++ IE+    S E V      + +L    + L    F  + DD+  +  RL  
Sbjct  134   SRCIQESLDSIEKR--FSSETVESIASNVLALRPPFSDLEKRDFALIHDDYTAISHRLNC  191

Query  701   KRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL----  868
              R ++ R+   +R  K+  G    I C    IT   L    V      PG+    L    
Sbjct  192   TRKKVARK---MRWMKIIDG----ITCGLNAITTRTL-TDLVKAADGGPGVFGRKLLRHE  243

Query  869   ----GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKT  1036
                 G ++K++E              L+ AAKG ++L  +L T SRLV RL D +++ K 
Sbjct  244   MLRNGGLEKVEEK-------------LEAAAKGSYILKRELETTSRLVVRLGDAVDNGKA  290

Query  1037  IADLWAMKHCDD-----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMI  1201
             +  L+  +  +D     V  + V   N  I++      ++++E+H+ LC + I RS+  +
Sbjct  291   MVRLFGGRKKEDKFGVGVAMDEVKKNNVKIRKR-----VEDVEEHLCLCIVAINRSKASM  345

Query  1202  VQ  1207
             + 
Sbjct  346   IN  347



>ref|XP_004141011.1| PREDICTED: UPF0496 protein 3-like [Cucumis sativus]
 gb|KGN46135.1| hypothetical protein Csa_6G056530 [Cucumis sativus]
Length=347

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 84/354 (24%), Positives = 156/354 (44%), Gaps = 42/354 (12%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             +KS +V  EY+   RT S+ E +   +   ++A +      D  +  + +       L+ 
Sbjct  31    KKSFNVDDEYLCTLRTQSFAEFFINPESPPSSAST----AVDCCWRFSETI------LLQ  80

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
               +  P+P    +L    +  LP+       L  +YF L+ +A  +C  LL     TR+ 
Sbjct  81    PGQLEPAPS---ILESSFILMLPELKG----LFTDYFNLSAKASNLCTRLLSNFKLTRST  133

Query  521   YKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTS  700
              + ++++++ IE+    S E V      + +L    + L    F  + DD+  +  RL  
Sbjct  134   SRCIQESLDSIEKC--FSSETVESIASNVLALRPPFSDLEKRDFALIHDDYTAISHRLNC  191

Query  701   KRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVK  880
              R ++ R+   +R  K+  G    I C    IT   L    V      PG+    L   +
Sbjct  192   TRKKVARK---MRWMKIIDG----ITCGLNAITTRTL-TDLVKAADGGPGVFGRKLLRHE  243

Query  881   KLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK  1060
              L+    G+   + +   L+ AAKG ++L  +L T SRLV RL D +++ K +  L+  +
Sbjct  244   MLRNG--GL---EKVGEKLEAAAKGSYILKRELETTSRLVVRLGDAVDNGKAMVRLFGGR  298

Query  1061  HCDD-----VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
               +D     V  + V   N  I++      ++++E+H+ LC + I RS+  ++ 
Sbjct  299   KKEDKFGVGVAMDEVKKNNVKIRKR-----VEDVEEHLCLCIVAINRSKASMIN  347



>ref|XP_009408431.1| PREDICTED: UPF0496 protein At3g19330 [Musa acuminata subsp. malaccensis]
Length=434

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/275 (23%), Positives = 124/275 (45%), Gaps = 20/275 (7%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE------KIEELGLS-SEEQVNR  592
             L+++YF  +      C SL++ V + R+ Y  +   ++       +++     +E Q + 
Sbjct  158   LVSDYFDGSEHTSRFCLSLVRAVRRARSLYAPIGDLIDLLPTSTAVDDFPARLTEAQCDL  217

Query  593   AYGEIASLSLFGNTLSA------VRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVA  754
             A+         GN  +A        F  +R     L  +L  +  +  RR + +      
Sbjct  218   AFDRFLEFDRLGNPFTAPSSDGSCSFQGLRGCFAELKQQLELRLLKASRRYRLMCCATRG  277

Query  755   LGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMP  934
              G+ L++      +T  +LA H +V  MA P L +   G   ++ +  R    ++     
Sbjct  278   SGACLIVSTIGLAVTGVVLATHALVTLMAGPALFS---GGCHRMVDVPRLRKRQRDYIAQ  334

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW--AMKHCDDVLKEVVSSKNFA  1108
             L+ A++G++V+ NDL T+ RLV RL   +E ++ +  L   + K     ++EV+   +  
Sbjct  335   LEAASRGVYVINNDLDTIDRLVARLHATVESDRVLVRLGLESGKRQQHPIQEVL--HHLR  392

Query  1109  IQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                   L  L++LE+H+ L F  + R+R ++ ++I
Sbjct  393   KNHPSFLHQLEDLEEHVCLYFAAVNRARFLLFRQI  427



>ref|XP_002512821.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49324.1| conserved hypothetical protein [Ricinus communis]
Length=407

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 75/269 (28%), Positives = 122/269 (45%), Gaps = 23/269 (9%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIE-ELGLSSEEQVNRAYGEIA  610
             L++ YF  +     +C  L + V + R  Y  ++  +E +  E+   ++ Q + AY    
Sbjct  145   LVSNYFDHSESTTDLCLLLHRSVFRARDIYSPIRNLLEVLPVEMDSLTQSQCDYAYEIFM  204

Query  611   SLSLFGNTLSAVRFDDVRDDHLGL--LSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCT  784
                   N        +    H     LS+    R R + R+K   V +  L S L    +
Sbjct  205   QFDRCDNPFPCPFSHEFEGIHRSFSELSQQLDHRLR-KSRSKVHLVRRATLASALCFIGS  263

Query  785   AFMITFTILAV--HFVVCTMAVP--GLIALSLGMVKK-LKEAKRGIPSRKGLYMPLDVAA  949
             A  IT T LA+  H +V  +A P   + +L   + KK L   K+           LD AA
Sbjct  264   AVAITLTALAITGHALVAIVACPFCAVTSLPSNLTKKELAHVKQ-----------LDAAA  312

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD-VLKEVVSSKNFAIQEEWA  1126
             +G +VL N+L TV RLV  L + +E++K +  L      D   + EV+  K+        
Sbjct  313   RGTYVLNNELDTVDRLVALLYNSIENDKHLIRLGLGTGSDKYFISEVL--KHLRKNHPTV  370

Query  1127  LEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             ++ LK LE+HI L F+ + R+R +++QEI
Sbjct  371   IDQLKNLEKHICLYFIAVNRARNLLLQEI  399



>ref|XP_003561583.1| PREDICTED: putative UPF0496 protein 2 [Brachypodium distachyon]
Length=406

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             +D AA+G +++  DL TVSR+V R  DE+EH + +A +    H +  L   V+ +     
Sbjct  298   VDTAARGAYIVGRDLDTVSRMVRRAHDELEHGRDMARIAVRGHAERPLLREVAREEEECG  357

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             E+   + L+ELE+H  LC   I RSRRM+ QE+ 
Sbjct  358   EDLRGQ-LEELEEHACLCLTTINRSRRMVAQEMT  390



>ref|XP_010064984.1| PREDICTED: UPF0496 protein At1g20180-like [Eucalyptus grandis]
Length=176

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 5/126 (4%)
 Frame = +2

Query  848   GLIALSLGMVKKLKEAKRGIPS---RKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             GL+  +LG+ KK  +  +G P    ++   +  DVAAKG F LIN L+T+S + G L DE
Sbjct  47    GLMGCTLGLHKKRTKPVQGNPKMTRQEAFGVQFDVAAKGHFTLINYLATMSIVAGSLYDE  106

Query  1019  MEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRM  1198
             +EH K  A++       D +KEVV  K F  +  + LE L+ELE    LC  +I  SRR 
Sbjct  107   VEHMKERANMCVRSGKSDTIKEVV--KRFDQRNTYFLEKLEELENLACLCLRDINASRRS  164

Query  1199  IVQEIV  1216
             I++EI+
Sbjct  165   IMKEIM  170



>ref|XP_004975612.1| PREDICTED: putative UPF0496 protein 2-like [Setaria italica]
Length=334

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 67/269 (25%), Positives = 120/269 (45%), Gaps = 28/269 (10%)
 Frame = +2

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF  625
             YF  + EA  +C  LL+ +  T+++Y+S++  +  +           + +  E+   + F
Sbjct  75    YFDASAEASEMCRQLLRSIKSTQSNYQSMESFLASMS----------DGSARELVRSNPF  124

Query  626   GNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT  805
               T++   F  + + +  +L  + S   R+ R+ + ++  K    + +L+ C A      
Sbjct  125   C-TMTRSNFRQIHERYSSILQSIRSSHRRVSRKLRMVKAIKKLSRTCVLMVCGAAAAGTI  183

Query  806   ILAVHFV------------VCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAA  949
               A H +            +C  A+      +    ++L+    G+ S   L   LD AA
Sbjct  184   GAAAHLLFFGLLIVPAAAGLCPAALRRRRLSARTAARELRPG--GMTSLVRLREQLDTAA  241

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWA  1126
             KG +VL  DL TVS LV RLSD +E    +A   A +  D   ++E+V           +
Sbjct  242   KGTYVLGRDLDTVSHLVARLSDGIERENAMARRCAERAGDRCPVQEMVG--ELRRSCSSS  299

Query  1127  LEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
               +  ELE+H+ LC   I R R +++QEI
Sbjct  300   RRLADELEEHVCLCLATIHRVRLLVIQEI  328



>ref|XP_002960743.1| hypothetical protein SELMODRAFT_402070 [Selaginella moellendorffii]
 gb|EFJ38282.1| hypothetical protein SELMODRAFT_402070 [Selaginella moellendorffii]
Length=441

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 89/359 (25%), Positives = 169/359 (47%), Gaps = 40/359 (11%)
 Frame = +2

Query  176   VSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD---NTFPLTssssssssPLISGH  346
             V  EY  A RT+SYVE  ++V    A AR     G     +  P+  S    ++ L+   
Sbjct  109   VEQEYQRAIRTDSYVEFAERV----AVARLNRETGTSAQGSVSPMPRSFERLAATLLEPE  164

Query  347   ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYK  526
             E        LL   + + ++P+     H L++EY   + ++ A+  SLL          K
Sbjct  165   E---DKILALLTTNKELGKIPE----IHQLVSEYLEESRKSSALWASLL----------K  207

Query  527   SVKKAVEKIEELG--LSSEEQVNRAYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLSR  691
             S++ + ++ +E+G  L S+        E+ S+    N  S     +F  + D  LG+  +
Sbjct  208   SIQSSRDRCQEIGGILKSQTSDQEILRELCSIDEGENLFSVAVVQQFQPLHDHCLGMQKK  267

Query  692   LTSKRGRIERRTKRLRVFKVALG-STLL--IGCTAFMITFTILAVHFVVCTMAVPGLIAL  862
             L   R ++    K+LR+ +  L  ST++  IGC   ++  T+     V   +    +   
Sbjct  268   LDKIRKKV---GKKLRLTRACLKVSTVILSIGCFIVLLVTTLALFLAVAALVVGCKVFTF  324

Query  863   SLG-MVKKLKEAKR-GIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEME-HNK  1033
              +G +V++L   KR  + + +  +  ++  ++G FV++ DL T  RLV RL  E++  NK
Sbjct  325   PIGYVVRRLNLRKRKKLNALERQWRQVEAVSQGTFVVVQDLDTTRRLVMRLGSEIDFTNK  384

Query  1034  TIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
              +A  +++++ +D      S +     +    ++L +LE +IYL F++I  +RR + ++
Sbjct  385   AVA--FSIRYREDRSMLSQSLERLRRNQMILSQLLDDLEVNIYLSFMSINNTRREVCRQ  441



>emb|CDY29368.1| BnaA06g14280D [Brassica napus]
Length=342

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             +D+AAKG F+++NDL T+SRL GRL DE+EH K +A + A     +VLKE +  + F   
Sbjct  247   MDIAAKGTFIMMNDLDTLSRLAGRLCDEIEHRKAVAAMCAKSGKVEVLKEAL--RVFNGH  304

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             EE   E+L+ELE+H+YLCF  I  SRR+++ +  G
Sbjct  305   EERFSELLQELEEHLYLCFHTINISRRLVLAQTTG  339


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query  113  TKSPRRNSNENEG--SLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGD  286
            T S R+ ++E E   SL  K S V+ EY  AFRTNSY+EI  K + QL    S ++    
Sbjct  14   TYSARQENSEKECRRSLTCKLS-VNEEYQEAFRTNSYLEIRTKAEDQLGITFSSKLSSPS  72

Query  287  NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLE  466
             T   +SSS  S     + +   P         QE ++ L Q  S  H LL ++F  + +
Sbjct  73   PTTSPSSSSDLSFHSHFTDYLLDPP--------QETLDALMQDTS-FHYLLAKFFDFSSD  123

Query  467  ACAICESLLKIVLQTRADYKSVKKAVE  547
            AC +CESLL+ + Q + ++  +K+ ++
Sbjct  124  ACDVCESLLQCIQQIKINHMKLKRVIK  150



>ref|XP_004493091.1| PREDICTED: UPF0496 protein At3g19330-like [Cicer arietinum]
Length=369

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 91/388 (23%), Positives = 153/388 (39%), Gaps = 56/388 (14%)
 Frame = +2

Query  113   TKSPRRN-----SNENEGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIV  277
             T SPR N     +++ + S    S +VS EY  A +  SY EI   +Q            
Sbjct  11    TPSPRNNLPPPSNSQGDNSTPSTSPNVSREYDLAVQAPSYNEILTIIQP-----------  59

Query  278   GGDNTFPLTssssssssPLISGHESLPSPGCKLL--LCQENMEELPQQASNAHP------  433
                   PL   +           E   S    +L  + Q +   + +  +NA P      
Sbjct  60    ------PLQLHNIQIQQQQDEHDEDDDSHHRDILTQVLQPDSNSVRETLANAKPESALTR  113

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIA  610
             L++ YF  +     +C  L   V   R  YK +   +  + +   S S+ Q N AY    
Sbjct  114   LVSSYFDHSETTSHLCLLLFNTVRIARQMYKPISDFISVLPDDSSSLSQPQCNTAYDLFV  173

Query  611   SLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAF  790
               +   N      F  +R+    L  ++   R +   R +  R   +      L   +  
Sbjct  174   QFNRHENPFVFPHFHTLRNSFSDLKHKINIDRRKCRHRIRLFRRATIGCALCALATVSIA  233

Query  791   MITFTILAVHFVVCTMA-VPGLIALSLGM----VKKLKEAKRGIPSRKGLYMPLDVAAKG  955
             ++T  I+A H  +   A VP             + +LK+              LD A  G
Sbjct  234   VVTTVIVATHASIGFAAMVPFCFRFPKKKKRKELARLKQ--------------LDAAENG  279

Query  956   LFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD--VLKEVVSSKNFAIQEEWAL  1129
              FV +ND++T+  LV RL   +E +K     +A++   D   ++EV+  K     +    
Sbjct  280   TFV-VNDINTIDSLVDRLQTAVEGDKAYVK-FALERGRDRHPIQEVI--KQLRKTQPIFE  335

Query  1130  EVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             ++L++LEQHIYLCF  + ++R  +++EI
Sbjct  336   QLLRDLEQHIYLCFYTVNKARYALLKEI  363



>sp|A2YH25.2|U496B_ORYSI RecName: Full=Putative UPF0496 protein 2 [Oryza sativa Indica 
Group]
Length=408

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             LD AA+G +++  DL TVSR+V R  DE+EH + +A +    H +  L + V+ +    +
Sbjct  294   LDAAARGAYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECE  353

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             E+   + L ELE+H+ LC + I R+RR++  E+ 
Sbjct  354   EDLRAQ-LAELEEHVCLCLITINRTRRLVAHEMA  386



>dbj|BAK04981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 140/302 (46%), Gaps = 25/302 (8%)
 Frame = +2

Query  341   GHESLPSPGCKLLLCQ-ENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRA  517
             G E+L  P  +L+L    NM    +++++    +  YF  + EA  IC+ LL  +  T++
Sbjct  35    GMEALLQPQQELILPMLHNMRR--KKSADIELAMAGYFDASAEASEICKQLLMNIKNTQS  92

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLT  697
             +Y+S+   +  I     ++              + F  T  +  F  + D +  +L  + 
Sbjct  93    NYQSMDSFLASIGCSTTATSSTSLALETFPVRSNPFSTTTRS-NFRQIHDRYSSVLQTIK  151

Query  698   SKRGRIERRTKRL-------RVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLI  856
             S   ++ ++ K +       R   V  G  + IG  A ++ F++L         A+ GL 
Sbjct  152   SSHKKVAKKLKIVKIIKKLSRSCLVIAGGAVAIGIAAHLLVFSLLV------GSALMGLC  205

Query  857   ALSLGM-VKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
              ++L   V +LK +K    S + L   LD AAKG +VL  D  TVS L  RLSD +E   
Sbjct  206   PIALKRRVTRLKRSK--TESLQQLQEQLDTAAKGTYVLGRDFDTVSHLAVRLSDGIEREN  263

Query  1034  TIADLWAMKHCDD--VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
              +A  + M+  D+   ++E+V     +      L +  ELE+H+ LC   I R+R ++++
Sbjct  264   AMAT-YCMEMVDEKYPVQEMVMELRRSCSSSRRLAM--ELEEHVGLCLATIHRARVLVIK  320

Query  1208  EI  1213
             EI
Sbjct  321   EI  322



>ref|XP_008441510.1| PREDICTED: UPF0496 protein At3g49070-like [Cucumis melo]
Length=362

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 85/352 (24%), Positives = 157/352 (45%), Gaps = 31/352 (9%)
 Frame = +2

Query  161   RKSSSVSHEYMAAFRTNSYVEIYDKVQGQL---AAARSKEIVGGDNTFPLTssssssssP  331
             ++S +V+ EY+   RT S+ E + K +  +     + +      D  +  + +       
Sbjct  39    KRSFNVNEEYLCTLRTESFAEFFLKPESNVHESPPSTTSSSSAADCCWRFSETILLQPGQ  98

Query  332   LISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQT  511
             L    E++PS     +L    +  LP+       L  +YF L+ +A  +C  LL     T
Sbjct  99    L----EAVPS-----ILESSFLLMLPELKG----LFVDYFNLSAQASDLCTRLLANFKLT  145

Query  512   RADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSR  691
             R+  + ++++++ IE+   SSE   + A   +A  S F + L    F  + DD+  +  R
Sbjct  146   RSTSRCIQESLDSIEKC-FSSETVESIASNLLALRSPFSD-LEKRDFALIHDDYTTISHR  203

Query  692   LTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLG  871
             L   R ++ R+   +R  K+  G    I C    IT   L    V      PG+    L 
Sbjct  204   LNCTRKKVARK---IRSMKIMDG----ITCGLNAITTRTL-TDLVKAADRGPGVFGRKLL  255

Query  872   MVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW  1051
               + L+    G+   + +   L+ AAKG ++L  +L T SRLV RL D +++ K +  L+
Sbjct  256   RHEMLRNG--GL---EKVGEKLEAAAKGSYILKRELETTSRLVVRLGDAVDNGKAMVRLF  310

Query  1052  AMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
               +  +D    VV+            + ++++E+H+ LC + I RS+  ++ 
Sbjct  311   GGRKKEDKFGVVVAMDEVKKNNANIRKRVEDVEEHLCLCIVAINRSKASMIN  362



>sp|Q5Z8N6.1|U496B_ORYSJ RecName: Full=Putative UPF0496 protein 2 [Oryza sativa Japonica 
Group]
 gb|AAL79713.1|AC091774_4 hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD61726.1| hypothetical protein [Oryza sativa Japonica Group]
Length=408

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 1/94 (1%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             LD AA+G +++  DL TVSR+V R  DE+EH + +A +    H +  L + V+ +    +
Sbjct  294   LDAAARGAYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECE  353

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
             E+   + L ELE+H+ LC + I R+RR++  E+ 
Sbjct  354   EDLRAQ-LAELEEHVCLCLITINRTRRLVAHEMA  386



>ref|XP_003624518.1| hypothetical protein MTR_7g084240 [Medicago truncatula]
 gb|AES80736.1| transmembrane protein, putative [Medicago truncatula]
Length=381

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/263 (24%), Positives = 118/263 (45%), Gaps = 16/263 (6%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIE-ELGLSSEEQVNRAYGEIA  610
             L++ YF  +     +C  L + V + R  Y  V   +  +  +    S+ Q + AY    
Sbjct  124   LVSSYFDHSETTSHLCLILFRTVNRAREMYNPVFDLISVLPADCSSLSQPQCDTAYDLFV  183

Query  611   SLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAF  790
               ++  N      F+ +R+    L   +   R + + R +  R   V     +L   +  
Sbjct  184   EFNVHENPFIFPHFNTLRNSFSDLKHEIQLDRRKCQHRIRLFRGANVGCAVCVLATVSIA  243

Query  791   MITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLI  970
             ++T  I+A H    ++    ++   +   K+ K  K+ +   K L    D A  G FV +
Sbjct  244   VVTAVIVATH---ASIGFTSMVPFCIPFQKRRK--KKELARLKQL----DAAESGTFV-V  293

Query  971   NDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD--VLKEVVSSKNFAIQEEWALEVLKE  1144
             N ++T+  LV RL   +E +K     +A++   D   ++EV+  K     +    ++LK+
Sbjct  294   NHVNTIDSLVDRLQTAVEGDKAYVR-FALERGRDRHPIQEVI--KQLRKTQPIFEQLLKD  350

Query  1145  LEQHIYLCFLNIVRSRRMIVQEI  1213
             LEQHIYLCF  + ++R  +++EI
Sbjct  351   LEQHIYLCFYTVNKARGALLKEI  373



>ref|XP_004510071.1| PREDICTED: UPF0496 protein 3-like [Cicer arietinum]
Length=312

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 60/101 (59%), Gaps = 9/101 (9%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKH----CDDVLKEVVSSKN  1102
             +D+AAKG ++L  D  T+S LV R+ DE+EH K +      +     C  +++EV+    
Sbjct  210   IDIAAKGTYILNRDFDTMSGLVTRVHDEVEHKKAMVKFCLERKYDRLCMKIMREVMKKSE  269

Query  1103  FAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVGRV  1225
                +++     ++ELE+H+YLC L I R+R ++++EI+ + 
Sbjct  270   IRFRKQ-----VEELEEHVYLCLLTINRARCLVMKEILTKT  305



>ref|XP_003562085.1| PREDICTED: UPF0496 protein 3 [Brachypodium distachyon]
Length=390

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 168/375 (45%), Gaps = 39/375 (10%)
 Frame = +2

Query  155   LGRKSSSVS----HEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssss  322
             +G  SSS S     EY +AFRT SY + + +V   +  A    +V G  +   T++  S+
Sbjct  32    MGTASSSSSLDFREEYTSAFRTESYNDFWARVL-DITLAHGAALVPGTGSHHNTAAGISA  90

Query  323   ssPLISGH----ESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESL  490
             +S  +S +    E L  P                  +  + LL+ Y+  T  A  +C  L
Sbjct  91    ASKRLSSYRLFAEHLLEPDQAA---VTAALAASGNGTTTNGLLSAYYAETAAASFLCSHL  147

Query  491   LKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLS----LFGNTLSAVRFDD  658
             L+ + Q R  +    K         L S    N+      S+S    L     +  R  D
Sbjct  148   LRDIEQVRLRFHRPLKT-------SLRSNNNNNKLAAVGVSVSGTAALAALAATQGRLGD  200

Query  659   VRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTM  838
              R     LL  L + R +  RR +RL   + AL ++ +       +    + VH +    
Sbjct  201   ARASSADLLGALDAGRKKARRRIRRLARLRHALSASFVTAVATVAVVGACVGVHVLAAFA  260

Query  839   AVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDE  1018
             A P ++A S       K    G  +R+ L + L+ AAKG +++  D+ T+SRLV R+ +E
Sbjct  261   AFPMMMASS--PAPWTKGVFSGRAARRAL-VQLEAAAKGTYIVNRDMDTISRLVERVREE  317

Query  1019  MEHNKTIADLWAMKHCDD------VLKEVVS--SKNFAIQEEWALEVLKELEQHIYLCFL  1174
              EH   +  L  ++H +       +++EV+    KN   Q+ + L+ L ELE+H++LCF+
Sbjct  318   GEHMLALLQL-CVEHQEQEGKGSRLVQEVLRQLGKN---QDSFRLQ-LDELEEHLFLCFM  372

Query  1175  NIVRSRRMIVQEIVG  1219
              I ++R M+++ + G
Sbjct  373   TINKARSMVMKFMAG  387



>ref|XP_006468920.1| PREDICTED: UPF0496 protein At3g19330-like [Citrus sinensis]
Length=391

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 98/393 (25%), Positives = 163/393 (41%), Gaps = 65/393 (17%)
 Frame = +2

Query  122   PRRNSNENEGSLG---RKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNT  292
             P    N  EGS G     + +++ EY    +TNSY E++ K+   L            + 
Sbjct  30    PGSQGNSTEGSPGASIEPAPNLTQEYSNTVQTNSYNEMWSKIHV-LDPNNINHHNHDHDE  88

Query  293   FPLTssssssssPLISGHESLPSPGCKLLLCQ---ENMEELPQQASNAHP-----LLNEY  448
               +           I+G+E       +LL+ Q    N E + +   +A P     L++ Y
Sbjct  89    VQMQIEH-------INGNED----SHQLLVSQVLQPNRECVDEALRHARPNTLTRLVSTY  137

Query  449   FLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIASLSLF  625
             F  +     +C  L + + + R  Y ++ +  +       S S+ Q ++A+         
Sbjct  138   FDHSENTTNLCLLLHQSIYRARELYAALYELFDIFPSDHHSLSQLQCDKAFEVFLQFDSI  197

Query  626   GNTL---SAVRFDDVRDDHLGLLSRLTSKRGRIERRT-KRLRVFKVAL-GSTL-LIGCTA  787
              N     ++  F ++R       S L  +  R  R++  R+R F  A  GSTL +IG   
Sbjct  198   DNPFPCPNSHNFHEMR----RCFSELKQQLDRKLRKSHSRVRFFSRATSGSTLCVIGTAV  253

Query  788   FMITFT----------ILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPL  937
              +              I+A  F     + PGL+   L  V +L                 
Sbjct  254   AVTIAAAAVATHALVAIVAAPFCTAYFS-PGLVKKQLAHVAQL-----------------  295

Query  938   DVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD-VLKEVVSSKNFAIQ  1114
             D A KG++VL NDL T+ RLV RL   +E +K +      +  D   ++EVV  K     
Sbjct  296   DAAKKGIYVLNNDLDTIDRLVARLYTAVEGDKQLVRFGLERGRDKHSIQEVV--KQLRRN  353

Query  1115  EEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             ++   + LK+LE+HI LCF  + R+R +++QEI
Sbjct  354   QQNFTDQLKDLEEHICLCFNTVNRARSLLLQEI  386



>ref|XP_006446909.1| hypothetical protein CICLE_v10015537mg [Citrus clementina]
 gb|ESR60149.1| hypothetical protein CICLE_v10015537mg [Citrus clementina]
Length=391

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDD-VLKEVVSSKNFAI  1111
             LD A KG++VL NDL T+ RLV RL   +E +K +      +  D   ++EVV  K    
Sbjct  295   LDAAKKGIYVLNNDLDTIDRLVARLYTAVEGDKQLVRFGLERGRDKHSIQEVV--KQLQR  352

Query  1112  QEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
              ++   + LK+LE+HI LCF  + R+R +++QEI
Sbjct  353   NQQNFTDQLKDLEEHICLCFNTVNRARSLLLQEI  386



>ref|XP_006851409.1| hypothetical protein AMTR_s00040p00067520 [Amborella trichopoda]
 gb|ERN12990.1| hypothetical protein AMTR_s00040p00067520 [Amborella trichopoda]
Length=306

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 75/152 (49%), Gaps = 29/152 (19%)
 Frame = +2

Query  815   VHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSR  994
             VH  V  +A P L++    + KK   AK       GL   LD A KG ++L  D  TV R
Sbjct  171   VHCFVGVVAGPLLLSGVPLLPKKKSRAKD-----MGLSGQLDTATKGAYILNADFDTVER  225

Query  995   LVGRLSDEMEHNKTI--------ADLWAMKHCDDVLKEVVSSKNFAIQEEWAL-EVLKEL  1147
             LV RL DE+EH K +         + WA+    +V+K++  S       EW   +  +EL
Sbjct  226   LVARLIDEIEHEKGLIAFCLDRREERWALI---EVVKQLRKS-------EWGFRQQAEEL  275

Query  1148  EQHIYLCFLNIVRSRRMIVQEIVGRV*PAHLA  1243
              +H+ LC L I R+R ++ +EI      AHLA
Sbjct  276   MEHLCLCLLTINRARMLVFREI-----SAHLA  302



>ref|XP_002274305.1| PREDICTED: UPF0496 protein At3g19330 isoform X2 [Vitis vinifera]
 emb|CBI40808.3| unnamed protein product [Vitis vinifera]
Length=376

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 90/376 (24%), Positives = 149/376 (40%), Gaps = 38/376 (10%)
 Frame = +2

Query  122   PRRNSNENEG-SLGRKSSSV--SHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNT  292
             P  NS E+   S+ + S +V  + EY  A +TNSY EI+ K+          +    D  
Sbjct  19    PVENSREDTPRSISQTSPTVNLTREYTLAVQTNSYNEIWSKIH----VRHQDDYTNTDPD  74

Query  293   FPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA-HPLLNEYFLLTLEA  469
                          L   H   P   C         + L    SN    L+++YF  +   
Sbjct  75    QDTDGEREEDVQQLRLAHVLRPDRECV-------QDALRHARSNTLTRLVSDYFDHSENT  127

Query  470   CAICESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIASLSLFGNTLSAV  646
               +C  L + V    + Y  +   ++ +     S ++ Q N+A+          N     
Sbjct  128   SQLCLLLHRSVHHAHSLYSPLHDLLDILPLDSDSLTQSQCNQAFDVFLQFDSLDNPFPCP  187

Query  647   RFDDVRDDHLGLLSRLTSKRGRIERRTKRLR-VFKVALGSTLLIGCTAFMITFTILAV--  817
                + RD             G I +   ++R + +   GS      TA  +  + +A+  
Sbjct  188   DSHNFRDMRRCFSQLKEQLDGHIRKSRSKIRLICRATAGSAFCFIGTAVGVAISAVAIAT  247

Query  818   HFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRL  997
             H +V  +A    + L   + KK  E   G          LD AA+G +VL +DL T+  L
Sbjct  248   HTLVALIAPLSTVFLPPRLSKK--ELAHG--------AQLDAAARGTYVLCHDLGTIDSL  297

Query  998   VGRLSDEMEHNKTIADLWAM----KHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYL  1165
             V  L   +E +K +  L       KH    ++EV  +K+      + L  LK+LE+HI L
Sbjct  298   VAWLHTAVEGDKRLIRLGLEGGRDKH---TIQEV--AKHLCKNHLYFLHQLKDLEEHICL  352

Query  1166  CFLNIVRSRRMIVQEI  1213
             CF  + R+R ++++EI
Sbjct  353   CFTTVNRARSLLLREI  368



>ref|XP_006651040.1| PREDICTED: UPF0496 protein 3-like [Oryza brachyantha]
Length=187

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (55%), Gaps = 17/128 (13%)
 Frame = +2

Query  854   IALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEH--  1027
             +A   G+V +      G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH  
Sbjct  61    LAHGAGLVPRPGGGVSGWAARRAL-VQLEAAAKGTYILNRDMDTISRLVARVRDEGEHML  119

Query  1028  --------NKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIV  1183
                     ++  A     +   +VL+++  SKN    EE   + L +LE+H++LCF+ I 
Sbjct  120   ALLQLCVEHRGAAAGGKGRLVQEVLRQL--SKN----EESFRQQLDDLEEHLFLCFMTIN  173

Query  1184  RSRRMIVQ  1207
             ++R M++ 
Sbjct  174   KARIMVMN  181



>gb|KDO45973.1| hypothetical protein CISIN_1g0163131mg, partial [Citrus sinensis]
Length=357

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCD-DVLKEVVSSKNFAI  1111
             LD A KG++VL NDL T+ RLV RL   +E +K +      +  D   ++EVV  K    
Sbjct  261   LDAAKKGIYVLNNDLDTIDRLVARLYTAVEGDKQLVRFGLERGRDKHSIQEVV--KQLRR  318

Query  1112  QEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
              ++   + LK+LE+HI LCF  + R+R +++QEI
Sbjct  319   NQQNFTDQLKDLEEHICLCFNTVNRARSLLLQEI  352



>ref|XP_004966478.1| PREDICTED: putative UPF0496 protein 2-like [Setaria italica]
Length=421

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             +++  DL TVSR+V R  DE+EH + +A +      +  L + V+ +    +E+   + L
Sbjct  324   YIVGRDLDTVSRMVRRAHDELEHGRDVARIAVRGRGERPLMQEVAREEAECEEDLRAQ-L  382

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIVGRV*P  1231
             +ELE+H+ LC + I RSRRM+  ++ G + P
Sbjct  383   EELEEHVCLCLITINRSRRMVAHQMTGGLPP  413



>gb|KFK37660.1| hypothetical protein AALP_AA3G011900 [Arabis alpina]
Length=374

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 94/362 (26%), Positives = 147/362 (41%), Gaps = 55/362 (15%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             ++S E   AF+T SY +I  +V   + A     I                          
Sbjct  44    NLSRELAHAFQTPSYHDIRSRVHVVVPAQHHLHI--------------------------  77

Query  353   LPSPGCKLLLCQ---ENMEELPQQASNAHP-----LLNEYFLLTLEACAICESLLKIVLQ  508
                P  +LLL Q    N E +    S+A P     L++ YF  +  A  +C +L + V  
Sbjct  78    --QPDIELLLSQVLQPNKECVQDALSHAKPTTLTHLISTYFQHSENATRLCLNLYQSVHT  135

Query  509   TRADYKSVKKAVEKIEELGLSSEEQV-NRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLL  685
              R  Y  +      +     + +  + N A+     L  F N  S+      RD  L   
Sbjct  136   ARHLYTPLFDLFHILPGDSHAIDHSLCNLAFDVFLQLDTFDNPFSSPESHGFRDTQL-CF  194

Query  686   SRLTSKRGRIERRTK-RLRVFKVAL-GSTLLIGCTAFMITFT--ILAVHFVVCTMAVPGL  853
             S+L  K  R  R+++ R+R+   A  GS L +      +  +  ++A H +   +    L
Sbjct  195   SQLKHKLDRRLRKSRSRVRLLHHATAGSALCLVAAVVGVAASAALIATHLLPTLVIAGPL  254

Query  854   IALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK  1033
              +  L    K KE              L+ AAKG FVL  DL T+ RLV RL   +E++K
Sbjct  255   CSPYLPHSFKKKELTN--------ISQLNAAAKGTFVLNKDLDTIDRLVSRLHTGIEYDK  306

Query  1034  TIADLWAMKHCDDV--LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
                 L  ++   DV  ++E+V  K            LK+LE HI L F N+ ++R +++Q
Sbjct  307   LFIRL-GLERGRDVYSVQEIV--KQLRKSHLNLNHQLKDLEDHICLWFTNVNKARSLLLQ  363

Query  1208  EI  1213
             EI
Sbjct  364   EI  365



>ref|XP_009603388.1| PREDICTED: UPF0496 protein At3g19330-like [Nicotiana tomentosiformis]
 ref|XP_009603392.1| PREDICTED: UPF0496 protein At3g19330-like [Nicotiana tomentosiformis]
 ref|XP_009603397.1| PREDICTED: UPF0496 protein At3g19330-like [Nicotiana tomentosiformis]
Length=376

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 144/350 (41%), Gaps = 38/350 (11%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             ++S  Y  A +T+SY EI+ KV  ++ +  S E+   +              PL      
Sbjct  40    NLSRAYTLAVQTSSYGEIWSKVHHEVHSDLSVEVAQVE----------FQEEPLQLDDVL  89

Query  353   LPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSV  532
              PS  C     QE +  +   A N   L+ +YF  + +   IC    + V Q R  Y  +
Sbjct  90    KPSHEC----VQEALLHIKPDALNQ--LIAKYFDDSEQTTRICILFSQSVNQARVLYAPI  143

Query  533   KKAVE----KIEELGLS-SEEQVNRAYGEIASLSLFGNTLSAV---RFDDVRDDHLGLLS  688
              K ++     +E  G S S+ Q + A+          N         F+D+R  +  L S
Sbjct  144   HKLLDVLPLDMESAGHSLSQAQCDWAFDIFLQFDSLANPFPGRDTHNFNDMRHCYFQLKS  203

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L     +   + + LR         L+      +I+   +A H  V  +A P   A   
Sbjct  204   ELDLLLRKSRSKVQLLRHATRGSVVCLVAATVGVVISAVAIATHAFVALVAAPICPAFFP  263

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
                   K AK+ +       +  D A KG+F L N L TV+ LVGRL D +E+ K +   
Sbjct  264   S-----KMAKKELVH----LVQFDDATKGIFFLHNHLETVNCLVGRLYDAVEYYKRLVR-  313

Query  1049  WAMKHCDD--VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSR  1192
             +A++   D   ++EVV  K    +    LE L   E+H+ LCF  I ++R
Sbjct  314   FALERGKDRYPIQEVV--KQLHGKHSNFLEELLGFEEHLCLCFAAINKAR  361



>ref|XP_010664051.1| PREDICTED: UPF0496 protein At3g19330 isoform X1 [Vitis vinifera]
Length=377

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 89/373 (24%), Positives = 148/373 (40%), Gaps = 38/373 (10%)
 Frame = +2

Query  131   NSNENEG-SLGRKSSSV--SHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPL  301
             NS E+   S+ + S +V  + EY  A +TNSY EI+ K+          +    D     
Sbjct  23    NSREDTPRSISQTSPTVNLTREYTLAVQTNSYNEIWSKIH----VRHQDDYTNTDPDQDT  78

Query  302   TssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA-HPLLNEYFLLTLEACAI  478
                       L   H   P   C         + L    SN    L+++YF  +     +
Sbjct  79    DGEREEDVQQLRLAHVLRPDRECV-------QDALRHARSNTLTRLVSDYFDHSENTSQL  131

Query  479   CESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIASLSLFGNTLSAVRFD  655
             C  L + V    + Y  +   ++ +     S ++ Q N+A+          N        
Sbjct  132   CLLLHRSVHHAHSLYSPLHDLLDILPLDSDSLTQSQCNQAFDVFLQFDSLDNPFPCPDSH  191

Query  656   DVRDDHLGLLSRLTSKRGRIERRTKRLR-VFKVALGSTLLIGCTAFMITFTILAV--HFV  826
             + RD             G I +   ++R + +   GS      TA  +  + +A+  H +
Sbjct  192   NFRDMRRCFSQLKEQLDGHIRKSRSKIRLICRATAGSAFCFIGTAVGVAISAVAIATHTL  251

Query  827   VCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGR  1006
             V  +A    + L   + KK  E   G          LD AA+G +VL +DL T+  LV  
Sbjct  252   VALIAPLSTVFLPPRLSKK--ELAHG--------AQLDAAARGTYVLCHDLGTIDSLVAW  301

Query  1007  LSDEMEHNKTIADLWAM----KHCDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFL  1174
             L   +E +K +  L       KH    ++EV  +K+      + L  LK+LE+HI LCF 
Sbjct  302   LHTAVEGDKRLIRLGLEGGRDKH---TIQEV--AKHLCKNHLYFLHQLKDLEEHICLCFT  356

Query  1175  NIVRSRRMIVQEI  1213
              + R+R ++++EI
Sbjct  357   TVNRARSLLLREI  369



>gb|EAY94126.1| hypothetical protein OsI_15899 [Oryza sativa Indica Group]
Length=359

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 9/106 (8%)
 Frame = +2

Query  923   LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKN  1102
             L   LD AAKG +VL  DL TVS LV RLSD +E    +A   A +   D    VV+ + 
Sbjct  250   LQEQLDTAAKGTYVLGRDLDTVSHLVARLSDGIERENAMARRCAERVAADDADAVVAGRF  309

Query  1103  FAIQE---------EWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             F +QE           + ++ +ELE+H+ LC   I R+R ++++EI
Sbjct  310   FPVQEMANELRRSCSSSRKLAEELEEHVCLCLATIHRARLLVIKEI  355



>ref|XP_006599418.1| PREDICTED: UPF0496 protein At3g19330-like [Glycine max]
Length=326

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 11/100 (11%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             LD AAK  +VL NDL+T+  L  RL   +E +K +  L   +  +  L E V      I+
Sbjct  230   LDAAAKCAYVLSNDLATIDALASRLRAAVEGDKVLVRLVLERGNERYLVEEV------IK  283

Query  1115  EEWA-----LEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             + W      LE +++LE+HI+LCF NI ++R +++QEI  
Sbjct  284   QLWKSHKGFLEQVEDLEEHIFLCFYNINKARFLVLQEITS  323



>gb|EAY94125.1| hypothetical protein OsI_15898 [Oryza sativa Indica Group]
Length=353

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 124/280 (44%), Gaps = 26/280 (9%)
 Frame = +2

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLF  625
             YF  + EA  IC  LL  +   +++Y S+   +  I    +++ E       ++ S + F
Sbjct  72    YFDASDEASEICRQLLANIKNAQSNYLSMDSFLATIVSDSVAAAE-TTAPLADVRS-NPF  129

Query  626   GNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFT  805
              +  +   F  + D +  +L  +    G++ R+ K  R  + A  + L++ C A      
Sbjct  130   SDAGTRSSFRRIHDRYSSILRAIKRSHGKVARKLKVARAVRKASRACLVVACGAAAAASV  189

Query  806   ILAVHFVVCTMAV-PGLIALS-LGMVKKLKEAKRGIP-------SRKG----LYMPLDVA  946
              +A H ++  + V P  +AL  + + +K+               S  G    L   LD A
Sbjct  190   AVAAHLLLFGLLVGPAAMALCPMALKRKVTNTNAAAVARPARRWSTTGSLLRLQEQLDTA  249

Query  947   AKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK--HCDDVLKEVVSSKNFAIQE-  1117
             AKG +VL  DL TVS LV RLSD +E    +A   A +    +         + F +QE 
Sbjct  250   AKGTYVLGRDLDTVSHLVARLSDGIERENAMARRCAERVAADNVGAAAAAGGRFFPVQEM  309

Query  1118  --------EWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                       + ++ +ELE+H+ LC   I R+R ++++EI
Sbjct  310   ANELRRSCSSSRKLAEELEEHVCLCLATIHRARLLVIKEI  349



>ref|XP_008671312.1| PREDICTED: putative UPF0496 protein 2 [Zea mays]
 tpg|DAA37855.1| TPA: hypothetical protein ZEAMMB73_719984 [Zea mays]
Length=338

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 115/273 (42%), Gaps = 25/273 (9%)
 Frame = +2

Query  437   LNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLSSEEQ-VNRAYGEIAS  613
             + +YF  ++EA  +C  LL+ +   +++Y+ +   V  I   G +     +N  Y     
Sbjct  71    MADYFDASVEALEMCRQLLQNIKDAQSNYQCMDSFVASISAAGCAGAPPALNFPYCRSNP  130

Query  614   LSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFM  793
              S    T +      + D +  +L  + S   R+ R+ K ++  K    + L++   A  
Sbjct  131   FS----TTTRSNLRSIHDRYFCVLQSIRSSHRRVGRKLKMVKAVKKLSRALLVVAGGAAA  186

Query  794   ITFTILAVHFVVCTMAVPGLIALSLGMVKKLKE--AKRGIPSRKG------------LYM  931
                     H +       GLI +       LK   A RG  ++K             L+ 
Sbjct  187   AAALGTGAHLLFF-----GLILIGTATAGALKTWIAPRGRGTKKPSGSKTMSSSLLRLHE  241

Query  932   PLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAI  1111
              LD AAKG +VL  DL TVS LV RLSD +E +  +A  W  +  D+    +  +     
Sbjct  242   QLDAAAKGTYVLGQDLDTVSNLVARLSDAIERDNAMAR-WCAERADEGSSVLEMANELRR  300

Query  1112  QEEWALEVLKELEQHIYLCFLNIVRSRRMIVQE  1210
                 +  +  ELE+H+ +    I R+R ++++E
Sbjct  301   SCSSSRSLTDELEEHVSMFLATIHRARLLVIRE  333



>gb|KDP41869.1| hypothetical protein JCGZ_26887 [Jatropha curcas]
Length=394

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 157/356 (44%), Gaps = 34/356 (10%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPLTssssssssPLISGHES  352
             +V+ EY  + ++NSY E++ KV     ++  +E+       P  + +   +   +     
Sbjct  58    NVTREYFHSVQSNSYNEMWSKVND---SSNHQELDVEQIELPFNNENDEDARQFLLTQ--  112

Query  353   LPSPGCKLLLCQENMEELPQQASNAHP-----LLNEYFLLTLEACAICESLLKIVLQTRA  517
                      + Q N E + +    A P     L+++YF  + ++   C  L + V + R 
Sbjct  113   ---------VLQPNRECVEEALRYARPNTLTRLVSDYFEHSEKSTHNCLLLHQSVYRARV  163

Query  518   DYKSVKKAVEKIEELGLSSEEQVNRAYGEIASLSLFGNTL---SAVRFDDVRDDHLGLLS  688
              Y  + K +E + +L   ++ Q + AY          N     ++ +  D+R     L  
Sbjct  164   LYAPLHKLLE-VLDLDSLTQSQCDNAYEIFLQFDSVDNPFPCRNSHKLQDIRHSFSQLRQ  222

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
             +L  +  + + R + +R    A    ++    A  +    +A H  +  +A P  I    
Sbjct  223   QLDRRLNKSQSRVRLVRRTTAACVLCIIGSVVAVSVAAVCIATHTFIAFVACP--ICSVT  280

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
              + +KL   K+ +   K L    D A++G +VL   L T+  +V +L   +E +K +  L
Sbjct  281   NLPRKL--TKKEVAHAKQL----DAASRGTYVLKEYLLTIESIVAQLYASVEDDKDLIRL  334

Query  1049  WAMKHCDD-VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                + C+  ++ EV+  K+   +    +E+LK+LE+ I LCF  + RSR +++QEI
Sbjct  335   GLGRSCEKHLISEVL--KHLRKKHLNFIELLKDLEERIILCFNAVNRSRSLLLQEI  388



>gb|EPS58966.1| hypothetical protein M569_15847 [Genlisea aurea]
Length=243

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 64/113 (57%), Gaps = 3/113 (3%)
 Frame = +2

Query  881   KLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK  1060
             K ++ K+    R  L   LD AA+ +++L +DL+ + RLV R+++EM+H K I ++    
Sbjct  129   KWRKMKKNKSERNELQRELDAAARWVYILKHDLAMMGRLVKRVNNEMQHMKAIEEIIETI  188

Query  1061  HCDDVLKEVVSSKNFAIQEEWAL-EVLKELEQHIYLCFLNIVRSRRMIVQEIV  1216
                    E +  +    QEE  L + ++ELE+H  LC L+I RSR+ I +EI 
Sbjct  189   PESRASVEAI--RELQRQEECCLMKHMEELEEHGSLCLLDISRSRQQIWKEIT  239



>dbj|BAJ96873.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +2

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             +++  DL TVSR+V R  DE+EH + +A +    H +  L + V+ +     E+   + L
Sbjct  338   YIVGRDLDTVSRMVRRAHDELEHGRDMARIAVSGHGERPLLQEVAREEEECGEDLRSQ-L  396

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEI  1213
             +ELE+H  LC + I RSRRM+ QE+
Sbjct  397   EELEEHACLCLITINRSRRMVAQEM  421



>ref|XP_006827565.1| hypothetical protein AMTR_s00009p00223100 [Amborella trichopoda]
 gb|ERM94981.1| hypothetical protein AMTR_s00009p00223100 [Amborella trichopoda]
Length=340

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +2

Query  926   YMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAM---KHCDDVLKEVVSS  1096
             +  +D AAKG +++  +L T+SRLV ++ DE++H + +A   ++   K   + ++EV  +
Sbjct  236   WARIDAAAKGAYIVSRELDTISRLVAKVRDEVDHLRVLARFVSVRLGKRLIEAVREV--A  293

Query  1097  KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             +     E    E L ELE+H+YL F  I R+R+++ ++I
Sbjct  294   RQVTRSERSFSEQLDELEEHLYLSFFTINRARKLLAKKI  332



>gb|EAZ25586.1| hypothetical protein OsJ_09413 [Oryza sativa Japonica Group]
Length=552

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 112/244 (46%), Gaps = 30/244 (12%)
 Frame = +2

Query  512   RADYKSVKKAVEKI-EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLS  688
             R  Y+ +K  + K+  ++G+S    V+ A G+           S  R  +V+     LL 
Sbjct  311   RLRYRPLKHTLRKLASDVGVSGLADVSAALGQ----PFTALAASQGRLREVQAGSGDLLR  366

Query  689   RLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSL  868
              L + R +   R + +   + AL  + +       +    + VH +    A P +    L
Sbjct  367   GLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACIGVHILAAFAAFPMMSPAWL  426

Query  869   GMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL  1048
             G     +    G  +R+ L + L+ AAKG ++L  D+ T+SRLV R+ DE EH   +  L
Sbjct  427   G-----ERFFSGRAARRAL-VQLEAAAKGTYILNRDMETISRLVARVRDEGEHMVALRRL  480

Query  1049  WAMKH------------CDDVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSR  1192
               ++H              +VL+++  SKN    EE   + L ELE+H++LCF+   ++R
Sbjct  481   -CVEHRPAAGAGGKGRLVQEVLRQL--SKN----EESFRQQLDELEEHLFLCFMTTNKAR  533

Query  1193  RMIV  1204
              M++
Sbjct  534   IMVM  537



>ref|XP_010316380.1| PREDICTED: UPF0496 protein At3g19330-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010316384.1| PREDICTED: UPF0496 protein At3g19330-like isoform X2 [Solanum 
lycopersicum]
Length=368

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 132/331 (40%), Gaps = 46/331 (14%)
 Frame = +2

Query  92    KMKSAFITKSPRRNSNEN-EGSLGRKSSSVSHEYMAAFRTNSYVEIYDKVQGQLAAARSK  268
             K K   IT  P   +++N   S    + ++S  Y  A +T+SY EI+ KV  ++ +  S 
Sbjct  4     KYKKGPITPWPGGVADDNIASSQPSPTVNLSRAYTLAVKTSSYGEIWSKVHHEVPSDLSV  63

Query  269   EIVGGD-NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNAHPLLNE  445
             E+   +    PL          L   HE +          +E +  +  +A N   L+ +
Sbjct  64    EVAQVEFQEEPLQLEDI-----LKPNHECV----------EEALLHIKPEALNQ--LIAK  106

Query  446   YFLLTLEACAICESLLKIVLQTRADYKSVKKAV----EKIEELGLS-SEEQVNRAYGEIA  610
             Y   + +   +C S  + V Q R  Y  + + +    +++E  G S S+ Q N A+    
Sbjct  107   YLDDSEQTARLCISFSQSVNQARRLYAPICRLLDVLPQEMESTGHSLSQAQCNWAFDIFL  166

Query  611   SLSLFGNTL---SAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGC  781
                   N         F+D+R  +L L   L     +   + + LR         L+   
Sbjct  167   QFDSLNNPFPIHDTHNFNDMRHCYLELKRELDLLLQKSRSKVQLLRHSTKGSVVCLVAAT  226

Query  782   TAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG-----LYMPLDVA  946
                +IT  ++A H  V  +A P   A               IPS+           LDVA
Sbjct  227   VGVVITAVVIASHAFVALVAAPACTAC--------------IPSKMAKKELVHLAQLDVA  272

Query  947   AKGLFVLINDLSTVSRLVGRLSDEMEHNKTI  1039
              KG+F L N L TV+ LVGRL D +E  K +
Sbjct  273   TKGIFFLHNHLETVNCLVGRLYDAVEFYKRL  303



>gb|KCW55750.1| hypothetical protein EUGRSUZ_I01580 [Eucalyptus grandis]
Length=235

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 90/172 (52%), Gaps = 14/172 (8%)
 Frame = +2

Query  710   RIERRTKRLRVFKVAL-GSTLLIGCTAFMITFTILAV--HFVVCTMAVPGLIALSLGMVK  880
             R+++   R++  + A+ GS + +  T      +++ V  H ++  ++ P L A     + 
Sbjct  66    RLQKSKSRVKFVRHAITGSAICLCGTVVAAVVSVIGVTAHALIAFVSAPCLTA----YLP  121

Query  881   KLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK  1060
             + K +K+ +     L      AAKG +VL NDL T+ RLV RL   +E +K +  +   +
Sbjct  122   QDKFSKKELAHAAQLDA----AAKGTYVLNNDLDTIDRLVDRLYAAVEDDKLLIRIGLER  177

Query  1061  HCD-DVLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
               D + + EVV  K+        L  LKELE HIYLCF  I R+R+++++EI
Sbjct  178   GTDNNPILEVV--KHLRKNNAKFLVELKELEDHIYLCFNMINRARKLLLEEI  227



>ref|XP_008646698.1| PREDICTED: putative UPF0496 protein 2 [Zea mays]
Length=427

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             +++  DL TVS +V R  DE+EH + +A +      +  L + V+ +    +E+   + L
Sbjct  333   YIVGRDLDTVSCMVRRAHDELEHGRDVARIAVQGRGERPLLQEVTREEAECEEDLRTQ-L  391

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +ELE+H+ LC + I RSRRM+  E+ G
Sbjct  392   EELEEHVCLCLITINRSRRMVAHEMTG  418



>ref|XP_011077825.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
Length=377

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 85/189 (45%), Gaps = 12/189 (6%)
 Frame = +2

Query  650   FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV  829
             F++VR     L  RL     +   RT  +R         L+       ++   +A H +V
Sbjct  193   FNNVRQCFSDLTDRLGHHVRKPRSRTHPVRYCSTGCALCLIAAAVGVAMSAVAIASHALV  252

Query  830   CTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRL  1009
               +  P  IA+   +  + KE  R +P        LD AA   +VL  +L T  RLV  L
Sbjct  253   ALVGSPICIAMFPSIATR-KETAR-LPQ-------LDAAAINAYVLHKELDTTDRLVRHL  303

Query  1010  SDEMEHNKTIADLWAMKHCDDVL-KEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVR  1186
               ++E++K +  L   +  D+ L +E++  K         ++ L  LE+H+ +CF  I R
Sbjct  304   HTDVENDKLLVRLGLERGMDEYLIQEIL--KQLRRNRSGFVQRLVNLEEHLIICFAAINR  361

Query  1187  SRRMIVQEI  1213
             +R  +VQEI
Sbjct  362   TRSQLVQEI  370



>gb|AFW69532.1| hypothetical protein ZEAMMB73_472244 [Zea mays]
Length=392

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +2

Query  959   FVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEWALEVL  1138
             +++  DL TVS +V R  DE+EH + +A +      +  L + V+ +    +E+   + L
Sbjct  298   YIVGRDLDTVSCMVRRAHDELEHGRDVARIAVQGRGERPLLQEVTREEAECEEDLRTQ-L  356

Query  1139  KELEQHIYLCFLNIVRSRRMIVQEIVG  1219
             +ELE+H+ LC + I RSRRM+  E+ G
Sbjct  357   EELEEHVCLCLITINRSRRMVAHEMTG  383



>ref|XP_010550240.1| PREDICTED: UPF0496 protein At3g19330-like isoform X1 [Tarenaya 
hassleriana]
Length=368

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 69/270 (26%), Positives = 119/270 (44%), Gaps = 25/270 (9%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE--KIEELGLSSEEQVNRAYGEI  607
             L++ YF  + +A ++C +L + V   R  Y+ +   ++   I+   ++ E   N A+   
Sbjct  106   LISTYFQHSEDATSLCLNLYQSVHSARELYRPLFDLLDILPIDPHAIN-ESHCNLAFDIF  164

Query  608   ASLSLFGNTLSAVRFDDVRDDH--LGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGC  781
                    N        + R+      LL +    R R  R   RL + +   GS + +  
Sbjct  165   LKFDSLDNPFPCPESHNFRETQQCFSLLKQQLDTRLRKSRTRVRL-LHRATAGSAIFLVA  223

Query  782   TAFMITFTILAVHFVVCTMAVPGLIA----LSLGMVKKLKEAKRGIPSRKGLYMPLDVAA  949
                 +T    A   V+ + A+P L+      S  +    K+ +    S+      L+ AA
Sbjct  224   AVVGVT----ASAAVIASHALPTLVVAGPLCSAYLPHSFKKKELANISQ------LNAAA  273

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV--LKEVVSSKNFAIQEEW  1123
             KG FVL  DL T+ RLV RL   +E++K    L  ++   D+  ++E+V  K        
Sbjct  274   KGTFVLNKDLDTIDRLVSRLHMGIENDKLFVRL-GLERGRDIYPIQEIV--KQLRKSHLN  330

Query  1124  ALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                 LK+LE HI L F N+ ++R +++QEI
Sbjct  331   VTHQLKDLEDHICLWFTNVNKARSLLLQEI  360



>ref|XP_011094271.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
 ref|XP_011094272.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
 ref|XP_011094273.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
 ref|XP_011094274.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
 ref|XP_011094275.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
 ref|XP_011094276.1| PREDICTED: UPF0496 protein At3g19330-like [Sesamum indicum]
Length=381

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/192 (26%), Positives = 87/192 (45%), Gaps = 18/192 (9%)
 Frame = +2

Query  650   FDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTLLIGCTAFMITFTILAVHFVV  829
             FDD+R     L  +L     +   R   +R         L+       I+   +A H +V
Sbjct  197   FDDIRQCFSELRQQLDEHLRKSRSRVHLIRHCSTGSALCLIAAVVGVAISAVAIASHALV  256

Query  830   CTMA---VPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLV  1000
               +A    P ++  ++   + +  A+            LD AAKG +VL NDL T+ RLV
Sbjct  257   ALVAGSICPAILPSNMTKKEIIHLAQ------------LDAAAKGAYVLQNDLDTIDRLV  304

Query  1001  GRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLN  1177
              RL   +E++K +  L   +  +   ++E++  K         +  L +LE+H++LC   
Sbjct  305   ARLHTAVENDKLLIRLGLERGMESYPIQEIL--KQLRRNRPSFMRQLVDLEEHLFLCLAA  362

Query  1178  IVRSRRMIVQEI  1213
             I ++R +++QEI
Sbjct  363   INKARTLLLQEI  374



>gb|EYU18084.1| hypothetical protein MIMGU_mgv1a025599mg, partial [Erythranthe 
guttata]
Length=304

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAI  1111
             L+ AAKG++V+ ND+ T+ RLV RL   +E+++ +  +   +  D   ++E++  K    
Sbjct  209   LEAAAKGVYVIRNDVDTIDRLVARLHAGVENDRLLVRMGVERGVDRYPIEEIL--KQLRR  266

Query  1112  QEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                  L+ L +LE+H++LCF  + RSR +++QEI
Sbjct  267   NRAGFLKQLVDLEEHLFLCFAAVNRSRSILLQEI  300



>ref|XP_010270665.1| PREDICTED: UPF0496 protein At3g19330-like isoform X2 [Nelumbo 
nucifera]
Length=370

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 89/362 (25%), Positives = 149/362 (41%), Gaps = 51/362 (14%)
 Frame = +2

Query  173   SVSHEYMAAFRTNSYVEIYDKVQ----GQLAAARSKEIVGGDNTFPLTssssssssPLIS  340
             +++ EY+ + +TNSY EI+ K+      Q+   + +E V   +          +S   ++
Sbjct  33    NLTSEYILSLQTNSYNEIWSKIHVQDGSQVECVQQEEPVSSSHIVAQLLQPDRASVE-VA  91

Query  341   GHESLPSPGCKLLLCQENMEELPQQASNAHPLLNEYFLLTLEACAICESLLKIVLQTRAD  520
              H + PS                    N   L++ YF  +     +C  L + +   R+ 
Sbjct  92    LHRARPS--------------------NLTKLVSAYFDNSEHTSHLCLLLQRSIDLARSH  131

Query  521   YKSVKKAVEKI----EELGLSSEEQVNRAYGEIASLSLFGNTLSAVRFDDVRD-----DH  673
             Y  +   ++ +     E G  S+ Q + A+G + + +   N       D+ R+       
Sbjct  132   YAPLGDLIDILPLSSSECGSLSQAQCDWAFGILRNFNSLENPFPHPNSDNFRNMRHCFSQ  191

Query  674   LGLLSRLTSKRGRIERRTKRLRVFKVALGSTL-LIGCTAFMITFTILAVHFVVCTMAVPG  850
             L L  +L     +  R+ + +R  +   GS L LIG T  ++   ++        +    
Sbjct  192   LKL--QLDCHLHKSRRKVRLIR--RATTGSALCLIGTTIGVVLAAVVIAAHAFAALVAGA  247

Query  851   LIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHN  1030
             L  L    V K KE K            LD  AKG FVL N L T+ RLV RL   +E +
Sbjct  248   LFVLLPNKVTK-KELKH--------IAQLDATAKGTFVLNNFLDTIDRLVARLHAAIESD  298

Query  1031  KTIADLWAMKHCDDVL-KEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQ  1207
             K +  L   +  D  L +EVV  K     +   L  L +LE+H+ L F  I ++R  ++Q
Sbjct  299   KFLISLGLERGKDSFLIQEVV--KQLRKNQPNFLHQLNDLEEHLCLYFTTINKARYSLLQ  356

Query  1208  EI  1213
             EI
Sbjct  357   EI  358



>gb|EMS63340.1| hypothetical protein TRIUR3_00514 [Triticum urartu]
Length=253

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 18/138 (13%)
 Frame = +2

Query  818   HFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRL  997
             H +    A P +    +G+         G  +R+ L + L+ AAKG ++L  D+ T+SRL
Sbjct  118   HVLAAFAAFPMMSPAWMGLFS-------GRAARRAL-VQLEAAAKGTYILSRDMDTISRL  169

Query  998   VGRLSDEMEHNKTIADLWAMKHC--------DDVLKEVVSSKNFAIQEEWALEVLKELEQ  1153
             V R+ DE E+   +  L   +            +++EV+  +     EE   + L ELE+
Sbjct  170   VERVRDEGEYMLALLQLCVAEEAAAGAGAGKGRLVREVL--RQLCKNEESFRQQLDELEE  227

Query  1154  HIYLCFLNIVRSRRMIVQ  1207
             H++LCF+ I ++R M+++
Sbjct  228   HLFLCFMTINKARSMVIK  245



>ref|XP_008231230.1| PREDICTED: UPF0496 protein At3g19330 [Prunus mume]
Length=426

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 79/296 (27%), Positives = 119/296 (40%), Gaps = 43/296 (15%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVEKI--EELGLS---SEEQVNRAY  598
             L+++YF  +     +C  L + V + R  Y  + + ++ +  EE  LS   S+ Q +RA 
Sbjct  130   LVSDYFDQSENTTQVCLMLHRYVYRARELYAPLHQLLDVVQSEEECLSLNLSQSQCSRAS  189

Query  599   GEIASLSLFGNTLSAVRFDDVR--DDHLGLLSRLTSKRGRIERR-------------TKR  733
                       N   +    D    DD L   S+L  +     R                 
Sbjct  190   EVFLQFDRHDNPFPSPDDSDSHNFDDMLRCFSQLKHQLDARLRSSRSRIRFLRRATLASA  249

Query  734   LRVFKVALG---STLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRG  904
             L     ALG   S + I   A   T  ++A   + CT    G    S             
Sbjct  250   LCFIGTALGVAISAVAITVHALTATLVVVAGPPLCCTPTATGNGTGSSCCSCSSSSMMTA  309

Query  905   IPSRKGLYM-PLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK----------TIADLW  1051
             I  ++  +M  LD AA G  VL NDL+T+ RLV RL   +E +K          ++    
Sbjct  310   IEKKEVAHMKQLDAAAMGTCVLNNDLATIDRLVRRLHTAVEGDKLLIRLGLERGSVTGTA  369

Query  1052  AMKH-CDDVLKEVVSS-KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
               KH   +VLK++  S  NF       L +L ELE+HI LCF  + R+R M++Q +
Sbjct  370   TDKHPIQEVLKQLSKSHPNF-------LHLLNELEEHICLCFNTVNRARSMLLQHM  418



>gb|EPS74092.1| hypothetical protein M569_00664, partial [Genlisea aurea]
Length=290

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADL---WAMKH--CDDVLKEVVSSK  1099
             L+ AAKG FV++N L T+ R+V RL   +E+++ +  +   W +      +VLK+V  +K
Sbjct  199   LEGAAKGAFVIVNYLKTIERVVARLHGAVENDRVLIGMGVGWGLDRYSIQEVLKQVRRNK  258

Query  1100  NFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                +++      L +LE+H++LCF  + ++R +++QE+
Sbjct  259   AGLVEQ------LVDLEEHLFLCFAAVNKARGLLLQEL  290



>ref|XP_007215603.1| hypothetical protein PRUPE_ppa007763mg [Prunus persica]
 gb|EMJ16802.1| hypothetical protein PRUPE_ppa007763mg [Prunus persica]
Length=356

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 19/105 (18%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNK----------TIADLWAMKH-CDDVLK  1081
             LD AA G  VL NDL+T+ RLV RL   +E +K          ++      KH   +VLK
Sbjct  251   LDAAAMGTCVLNNDLATIDRLVRRLHTAVEGDKLLIRLGLERGSVTGTATDKHPIQEVLK  310

Query  1082  EVVSS-KNFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             ++  S  NF       L +L ELE+HI LCF  + R+R M++Q +
Sbjct  311   QLSKSHPNF-------LHLLNELEEHICLCFNTVNRARSMLLQHM  348



>emb|CAN67266.1| hypothetical protein VITISV_028729 [Vitis vinifera]
Length=996

 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 87/370 (24%), Positives = 147/370 (40%), Gaps = 32/370 (9%)
 Frame = +2

Query  131   NSNENEG-SLGRKSSSV--SHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNTFPL  301
             NS E+   S+ + S +V  + EY  A +TNSY EI+ K+          +    D     
Sbjct  642   NSREDTPRSISQTSPTVNLTREYTLAVQTNSYNEIWSKIH----VRHQDDYTNTDPDQDT  697

Query  302   TssssssssPLISGHESLPSPGCKLLLCQENMEELPQQASNA-HPLLNEYFLLTLEACAI  478
                       L   H   P   C         + L    SN    L+++YF  +     +
Sbjct  698   DGEREEDVQQLRLAHVLRPDRECV-------QDALRHARSNTLTRLVSDYFDHSENTSQL  750

Query  479   CESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIASLSLFGNTLSAVRFD  655
             C  L + V    + Y  +   ++ +     S ++ Q ++A+          N        
Sbjct  751   CLLLHRSVHHAHSLYSPLHDLLDILPLDSDSLTQSQCBQAFDVFLQFDSLDNPFPCPDSH  810

Query  656   DVRDDHLGLLSRLTSKRGRIERRTKRLR-VFKVALGSTLLIGCTAFMITFTILAV--HFV  826
             + RD             G I +   ++R + +   GS      TA  +  + +A+  H +
Sbjct  811   NFRDMRRCFSQLKEQLDGHIRKSRSKIRLICRATAGSAFCFIGTAVGVAISAVAIATHTL  870

Query  827   VCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAAKGLFVLINDLSTVSRLVGR  1006
             V  +A    + L   + KK  E   G          LD AA+G +VL +DL T+  LV  
Sbjct  871   VALIAPLSTVFLPPRLSKK--ELAHG--------AQLDAAARGTYVLCHDLGTIDSLVAW  920

Query  1007  LSDEMEHNKTIADLWAMKHCDD-VLKEVVSSKNFAIQEEWALEVLKELEQHIYLCFLNIV  1183
             L   +E +K +  L      D   ++EV  +K+      + L  LK+LE+HI LCF  + 
Sbjct  921   LHTAVEGDKRLIRLGLEGGRDKHTIQEV--AKHLCKNHLYFLHQLKDLEEHICLCFTTVN  978

Query  1184  RSRRMIVQEI  1213
             R+R ++++EI
Sbjct  979   RARSLLLREI  988



>ref|XP_010927490.1| PREDICTED: LOW QUALITY PROTEIN: UPF0496 protein At3g19330-like 
[Elaeis guineensis]
Length=417

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 20/141 (14%)
 Frame = +2

Query  821   FVVCTMAVPGLIA---LSLGMVKKLKEAKRGIPSRKGLYMP-LDVAAKGLFVLINDLSTV  988
              V+ T A+  L+A   + L  V  L   +R    R   +M  LD AA+G +VL NDL T+
Sbjct  276   LVIXTHALAALVAGPAMCLAPVDLLAGPRR----RAREHMAQLDAAARGTYVLNNDLDTI  331

Query  989   SRLVGRLSDEMEHNKTIADLW-----AMKH-CDDVLKEVVSSKNFAIQEEWALEVLKELE  1150
              RLV RL + +E +K +  L       M+H  ++VL+++   KN        L  L++L+
Sbjct  332   ERLVARLHETVESDKKLVRLGLERGRGMRHPIEEVLRQL--RKNHPS----ILHQLEDLD  385

Query  1151  QHIYLCFLNIVRSRRMIVQEI  1213
             +HI L F  I R+R ++ Q+I
Sbjct  386   EHICLFFAAINRARSLLFQQI  406



>ref|XP_007151712.1| hypothetical protein PHAVU_004G069400g [Phaseolus vulgaris]
 gb|ESW23706.1| hypothetical protein PHAVU_004G069400g [Phaseolus vulgaris]
Length=331

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 11/98 (11%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDVLKEVVSSKNFAIQ  1114
             LD AAK  +VL NDL T+  LV RL   +E +K +  L   +  +  L E V      I+
Sbjct  234   LDAAAKCAYVLSNDLGTIDALVSRLRAAVEGDKVLVGLGLERGNERYLVEEV------IK  287

Query  1115  EEWA-----LEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             + W      L  +++LE+HI+LCF NI ++R ++ Q I
Sbjct  288   QLWKSHQGFLRQVEDLEEHIFLCFYNINKARLLVHQVI  325



>ref|XP_010670227.1| PREDICTED: UPF0496 protein At3g19330 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 94/382 (25%), Positives = 152/382 (40%), Gaps = 77/382 (20%)
 Frame = +2

Query  131   NSNENEGSLGRKSS------SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNT  292
             NS+++  +  R S+      ++S EY  A +T+SY EI+ K+           +   +NT
Sbjct  29    NSSQDTPTTPRASTIPSPTVNLSREYALAVQTSSYNEIWSKIHV---------VEQRENT  79

Query  293   FPLTssssssssPLISGHESLPSPGCKLLLCQ------ENMEELPQQA--SNAHPLLNEY  448
              P               H+       +LLL Q      E+ EE+ + A  +    L++ Y
Sbjct  80    EP--------------DHQE------QLLLSQVLQPDRESAEEVLRHAPPNTFTQLVSVY  119

Query  449   FLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIASLSLF  625
                + + C +   L   +  +R+ Y  +   V+ +     S +E   N A+         
Sbjct  120   CEHSEKTCHLLLLLHHSIHHSRSLYAHLHDLVDALPADTESMTESHCNHAFDIFFQFDQK  179

Query  626   GNTL---SAVRFDDVR---------DDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
             GN      ++ F D+R          DH     RL   RGR+    +++R         L
Sbjct  180   GNPFLCPDSLNFHDMRLCFSQLKQQVDH-----RLEKSRGRV----RQIRCGTTTSALCL  230

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAA  949
             +       ++   +  H +V  +A           +KK KE              LD AA
Sbjct  231   IGAVVGVTVSAIAIGAHALVALVATSSCPVFLPSKIKK-KEVVN--------MTQLDAAA  281

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWA  1126
             K  +VL NDL T+ RLV RL  E+E ++ +  L   +  D   + EVV  K         
Sbjct  282   KSAYVLHNDLDTIDRLVSRLHTEIEGDRLLIRLGLDRGRDKYPIYEVV--KRLRKNRASL  339

Query  1127  LEVLKELEQHIYLCFLNIVRSR  1192
             L+ L +LE+HI LCF  I R+R
Sbjct  340   LDQLTDLEEHICLCFAAINRAR  361



>ref|XP_010932700.1| PREDICTED: UPF0496 protein At3g19330-like [Elaeis guineensis]
Length=366

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLW-----AMKHCDDVLKEVVSSK  1099
             LD AA+G +VL NDL T+ RLV RL + +E +K +  L        +H    ++EVV  +
Sbjct  260   LDAAARGTYVLNNDLDTIERLVARLHETVESDKKLVRLGLERGRGQRH---PIEEVV--R  314

Query  1100  NFAIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
                      L  L++L++HI L F  + R+R +++Q+I
Sbjct  315   QLRKNHPTFLHQLRDLDEHICLFFAAVNRARSLLLQQI  352



>ref|XP_004228688.1| PREDICTED: UPF0496 protein At3g19330-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_004228689.1| PREDICTED: UPF0496 protein At3g19330-like isoform X1 [Solanum 
lycopersicum]
Length=376

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 134/342 (39%), Gaps = 50/342 (15%)
 Frame = +2

Query  68    LPLFKKFSKMKSAFITKSPRRNSNENEGSLGRKSSS----VSHEYMAAFRTNSYVEIYDK  235
             LP  ++ S   +A  + SP       + ++     S    +S  Y  A +T+SY EI+ K
Sbjct  2     LPCLRQLSLTATANCS-SPSLEGGVADDNIASSQPSPTVNLSRAYTLAVKTSSYGEIWSK  60

Query  236   VQGQLAAARSKEIVGGD-NTFPLTssssssssPLISGHESLPSPGCKLLLCQENMEELPQ  412
             V  ++ +  S E+   +    PL          L   HE +          +E +  +  
Sbjct  61    VHHEVPSDLSVEVAQVEFQEEPLQLEDI-----LKPNHECV----------EEALLHIKP  105

Query  413   QASNAHPLLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAV----EKIEELGLS-SE  577
             +A N   L+ +Y   + +   +C S  + V Q R  Y  + + +    +++E  G S S+
Sbjct  106   EALNQ--LIAKYLDDSEQTARLCISFSQSVNQARRLYAPICRLLDVLPQEMESTGHSLSQ  163

Query  578   EQVNRAYGEIASLSLFGNTL---SAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFK  748
              Q N A+          N         F+D+R  +L L   L     +   + + LR   
Sbjct  164   AQCNWAFDIFLQFDSLNNPFPIHDTHNFNDMRHCYLELKRELDLLLQKSRSKVQLLRHST  223

Query  749   VALGSTLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKG--  922
                   L+      +IT  ++A H  V  +A P   A               IPS+    
Sbjct  224   KGSVVCLVAATVGVVITAVVIASHAFVALVAAPACTAC--------------IPSKMAKK  269

Query  923   ---LYMPLDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTI  1039
                    LDVA KG+F L N L TV+ LVGRL D +E  K +
Sbjct  270   ELVHLAQLDVATKGIFFLHNHLETVNCLVGRLYDAVEFYKRL  311



>ref|XP_010670226.1| PREDICTED: UPF0496 protein At3g19330 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 94/382 (25%), Positives = 152/382 (40%), Gaps = 77/382 (20%)
 Frame = +2

Query  131   NSNENEGSLGRKSS------SVSHEYMAAFRTNSYVEIYDKVQGQLAAARSKEIVGGDNT  292
             NS+++  +  R S+      ++S EY  A +T+SY EI+ K+           +   +NT
Sbjct  30    NSSQDTPTTPRASTIPSPTVNLSREYALAVQTSSYNEIWSKIHV---------VEQRENT  80

Query  293   FPLTssssssssPLISGHESLPSPGCKLLLCQ------ENMEELPQQA--SNAHPLLNEY  448
              P               H+       +LLL Q      E+ EE+ + A  +    L++ Y
Sbjct  81    EP--------------DHQE------QLLLSQVLQPDRESAEEVLRHAPPNTFTQLVSVY  120

Query  449   FLLTLEACAICESLLKIVLQTRADYKSVKKAVEKIEELGLS-SEEQVNRAYGEIASLSLF  625
                + + C +   L   +  +R+ Y  +   V+ +     S +E   N A+         
Sbjct  121   CEHSEKTCHLLLLLHHSIHHSRSLYAHLHDLVDALPADTESMTESHCNHAFDIFFQFDQK  180

Query  626   GNTL---SAVRFDDVR---------DDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
             GN      ++ F D+R          DH     RL   RGR+    +++R         L
Sbjct  181   GNPFLCPDSLNFHDMRLCFSQLKQQVDH-----RLEKSRGRV----RQIRCGTTTSALCL  231

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLDVAA  949
             +       ++   +  H +V  +A           +KK KE              LD AA
Sbjct  232   IGAVVGVTVSAIAIGAHALVALVATSSCPVFLPSKIKK-KEVVN--------MTQLDAAA  282

Query  950   KGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMKHCDDV-LKEVVSSKNFAIQEEWA  1126
             K  +VL NDL T+ RLV RL  E+E ++ +  L   +  D   + EVV  K         
Sbjct  283   KSAYVLHNDLDTIDRLVSRLHTEIEGDRLLIRLGLDRGRDKYPIYEVV--KRLRKNRASL  340

Query  1127  LEVLKELEQHIYLCFLNIVRSR  1192
             L+ L +LE+HI LCF  I R+R
Sbjct  341   LDQLTDLEEHICLCFAAINRAR  362



>ref|XP_009798011.1| PREDICTED: UPF0496 protein At3g19330-like [Nicotiana sylvestris]
 ref|XP_009798012.1| PREDICTED: UPF0496 protein At3g19330-like [Nicotiana sylvestris]
Length=375

 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 109/263 (41%), Gaps = 23/263 (9%)
 Frame = +2

Query  434   LLNEYFLLTLEACAICESLLKIVLQTRADYKSVKKAVE----KIEELGLS-SEEQVNRAY  598
             L+  Y   T +   +C  + + V + R  Y  + K ++     +E +G S S+ Q + A+
Sbjct  111   LITNYLDSTEQTARLCILISQSVNKARLLYAPIHKLLDVLALDLESVGHSLSQAQYDLAF  170

Query  599   GEIASLSLFGNTL---SAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALGSTL  769
                       N         F+D+ D    L  +L  +  +     + LR         L
Sbjct  171   DIFLQFDSLANHFPGRDTYNFNDMFDSSFQLKKQLELRLYKSHSMVQLLRRTIRGSAVCL  230

Query  770   LIGCTAFMITFTILAVHFVVCTMAVPGLIA-LSLGMVKKLKEAKRGIPSRKGLYMPLDVA  946
             L      +I+  I+A H     +A+P   A L L M KK  +            M LD A
Sbjct  231   LAATVGVVISAVIIATHGFAALVAIPICPACLPLSMEKKELD-----------LMQLDEA  279

Query  947   AKGLFVLINDLSTVSRLVGRLSDEME-HNKTIADLWAMKHCDDVLKEVVSSKNFAIQEEW  1123
              +G+F L N L+TV  LVGRL D +E +N TI   + ++   D      + K    +   
Sbjct  280   TRGIFFLHNHLNTVKSLVGRLHDAVESYNGTIR--FGLESGRDRYHIQEALKQLQRRHST  337

Query  1124  ALEVLKELEQHIYLCFLNIVRSR  1192
              L+ L  LEQH+ +CF  I  +R
Sbjct  338   FLDELLGLEQHLCVCFAAISTAR  360



>ref|XP_003548490.2| PREDICTED: UPF0496 protein At3g19330-like [Glycine max]
Length=367

 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 71/278 (26%), Positives = 114/278 (41%), Gaps = 31/278 (11%)
 Frame = +2

Query  419   SNAHPLLNEYFLLTLEACAICESLLKIVLQTR------ADYKSVKKAVEKIEELGLSSEE  580
             SN   L++ YF  +  A   C  L + V + R      +D  SV  A   +  L   S+ 
Sbjct  106   SNLTRLVSTYFDHSETASDFCLRLSRSVHRARYLYAPLSDLLSVLPADAPLPSL---SQP  162

Query  581   QVNRAYGEIASLSLFGNTLSAVRFDDVRDDHLGLLSRLTSKRGRIERRTKRLRVFKVALG  760
             Q N AY          N  +  R   +RD    L   +     +   R +  R       
Sbjct  163   QCNHAYDLFLQFDREENPFALFRLHRLRDSFSDLKRDIQRDLRKCHSRIRLFRHGAAGCA  222

Query  761   STLLIGCTAFMITFTILAVHFVVCTMAVPGLIALSLGMVKKLKEAKRGIPSRKGLYMPLD  940
                +      ++  +I+AVH VV      G  ALS       ++ KR +   K L    +
Sbjct  223   LCFVAAAAGTVLVASIVAVHAVV------GFSALSAAPFCVPRQKKRELARLKQL----E  272

Query  941   VAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIA----DLWAMKH-CDDVLKEVVSSKNF  1105
             V   G  V +ND++T+  LV RL   +E +K       +    +H   +VLK++   KN 
Sbjct  273   VVENGTHV-VNDINTIDSLVDRLQTAVEGDKAFVRFALERGRERHPIQEVLKQL--RKNQ  329

Query  1106  AIQEEWALEVLKELEQHIYLCFLNIVRSRRMIVQEIVG  1219
              + E     +L +LEQHI  CF ++ ++R  +++EI  
Sbjct  330   PVLEH----LLGDLEQHICFCFYSVNKARYALLKEICS  363



>gb|EAZ30748.1| hypothetical protein OsJ_14812 [Oryza sativa Japonica Group]
Length=254

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 11/104 (11%)
 Frame = +2

Query  935   LDVAAKGLFVLINDLSTVSRLVGRLSDEMEHNKTIADLWAMK--HCDDVLKEVVSSKNFA  1108
             LD AAKG +VL  DL TVS LV RLSD +E    +A   A +    +         + F 
Sbjct  147   LDTAAKGTYVLGRDLDTVSHLVARLSDGIERENAMARRCAERVAADNVGAAAAAGGRFFP  206

Query  1109  IQE---------EWALEVLKELEQHIYLCFLNIVRSRRMIVQEI  1213
             +QE           + ++ +ELE+H+ LC   I R+R ++++EI
Sbjct  207   VQEMANELRRSCSSSRKLAEELEEHVCLCLATIHRARLLVIKEI  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4306464265376