BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23032_g1_i1 len=3741 path=[1:0-1738 1740:1739-2988 2990:2989-2991
2993:2992-3022 6210:3023-3043 6231:3044-3740]

Length=3741
                                                                      Score     E

emb|CAN61322.1|  hypothetical protein VITISV_012106                     357   3e-139   Vitis vinifera
gb|AAT85031.1|  putative polyprotein                                    344   5e-128   Oryza sativa Japonica Group [Japonica rice]
emb|CAN81099.1|  hypothetical protein VITISV_017741                     334   1e-125   Vitis vinifera
emb|CAN59952.1|  hypothetical protein VITISV_006720                     355   1e-124   Vitis vinifera
emb|CAN81355.1|  hypothetical protein VITISV_039158                     317   8e-124   Vitis vinifera
emb|CAN65942.1|  hypothetical protein VITISV_001716                     340   2e-123   Vitis vinifera
gb|AAN04167.1|  Putative copia-like retrotransposon polyprotein         339   2e-123   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71553.1|  hypothetical protein VITISV_034738                     374   3e-122   Vitis vinifera
emb|CAN63649.1|  hypothetical protein VITISV_037657                     325   2e-121   Vitis vinifera
emb|CAN65591.1|  hypothetical protein VITISV_042091                     323   1e-117   Vitis vinifera
emb|CCH50966.1|  T4.5                                                   304   7e-114   
gb|KFL89552.1|  hypothetical protein AmDm5_1575                         308   4e-113   
gb|KHN36156.1|  Retrovirus-related Pol polyprotein from transposo...    331   5e-113   
gb|KHN22040.1|  Retrovirus-related Pol polyprotein from transposo...    329   2e-112   
emb|CAN68489.1|  hypothetical protein VITISV_037543                     297   4e-112   Vitis vinifera
emb|CAB40035.1|  retrotransposon like protein                           285   6e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CAB43904.1|  putative protein                                       281   4e-110   Arabidopsis thaliana [mouse-ear cress]
gb|ACP30598.1|  disease resistance protein                              268   1e-109   Brassica rapa subsp. pekinensis [bai cai]
emb|CAN78022.1|  hypothetical protein VITISV_015518                     311   1e-109   Vitis vinifera
gb|KHN21230.1|  Retrovirus-related Pol polyprotein from transposo...    305   2e-109   
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins           290   9e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AAD21687.1|  Strong similarity to gi|3600044 T12H20.12 proteas...    292   9e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AAK51235.1|AF287471_1  polyprotein                                   285   4e-108   Arabidopsis thaliana [mouse-ear cress]
gb|ABA98728.2|  retrotransposon protein, putative, Ty1-copia subc...    365   4e-107   Oryza sativa Japonica Group [Japonica rice]
emb|CAN77529.1|  hypothetical protein VITISV_041425                     312   5e-107   Vitis vinifera
emb|CAN78447.1|  hypothetical protein VITISV_026810                     288   6e-107   Vitis vinifera
emb|CAN71996.1|  hypothetical protein VITISV_023485                     290   7e-106   Vitis vinifera
ref|XP_009145096.1|  PREDICTED: uncharacterized protein LOC103868780    280   8e-104   
emb|CAN79884.1|  hypothetical protein VITISV_002539                     280   6e-103   Vitis vinifera
emb|CAC37623.1|  copia-like polyprotein                                 272   9e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67247.1|  hypothetical protein VITISV_008682                     294   4e-101   Vitis vinifera
ref|XP_008351324.1|  PREDICTED: uncharacterized protein LOC103414737    256   7e-99    
gb|AAC61290.1|  putative retroelement pol polyprotein                   236   1e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CAN62863.1|  hypothetical protein VITISV_030334                     289   1e-95    Vitis vinifera
emb|CAN68496.1|  hypothetical protein VITISV_010947                     324   1e-95    Vitis vinifera
emb|CAN66863.1|  hypothetical protein VITISV_013500                     341   6e-95    Vitis vinifera
dbj|BAB10503.1|  retroelement pol polyprotein-like                      270   9e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CAN83392.1|  hypothetical protein VITISV_041406                     341   2e-94    Vitis vinifera
emb|CAN64509.1|  hypothetical protein VITISV_041217                     300   6e-94    Vitis vinifera
emb|CAN76078.1|  hypothetical protein VITISV_008973                     279   6e-94    Vitis vinifera
gb|AAT93988.1|  putative polyprotein                                    263   1e-93    Oryza sativa Japonica Group [Japonica rice]
emb|CAN60844.1|  hypothetical protein VITISV_005976                     276   1e-93    Vitis vinifera
gb|KHN05629.1|  Retrovirus-related Pol polyprotein from transposo...    264   2e-93    
gb|KHN30958.1|  Retrovirus-related Pol polyprotein from transposo...    265   4e-93    
gb|KHN45997.1|  Retrovirus-related Pol polyprotein from transposo...    265   4e-93    
emb|CAN69753.1|  hypothetical protein VITISV_024937                     306   5e-93    Vitis vinifera
emb|CAN62182.1|  hypothetical protein VITISV_044400                     249   2e-91    Vitis vinifera
emb|CAN71108.1|  hypothetical protein VITISV_001478                     332   7e-91    Vitis vinifera
ref|XP_006465491.1|  PREDICTED: uncharacterized protein LOC102624640    333   7e-91    
emb|CAN67403.1|  hypothetical protein VITISV_025614                     329   2e-90    Vitis vinifera
gb|AAD43604.1|AC005698_3  T3P18.3                                       266   4e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CAN67819.1|  hypothetical protein VITISV_041315                     319   4e-90    Vitis vinifera
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...    210   7e-90    Oryza sativa Japonica Group [Japonica rice]
gb|AAT07563.1|  putative polyprotein                                    214   6e-89    Oryza sativa Japonica Group [Japonica rice]
pir||T02087  gag/pol polyprotein - maize retrotransposon Hopscotch      204   7e-88 
emb|CAN75478.1|  hypothetical protein VITISV_020209                     319   9e-88    Vitis vinifera
gb|AAU10682.1|  putative polyprotein                                    206   8e-87    Oryza sativa Japonica Group [Japonica rice]
emb|CAN77295.1|  hypothetical protein VITISV_005638                     191   1e-86    Vitis vinifera
emb|CAN64288.1|  hypothetical protein VITISV_022326                     319   1e-86    Vitis vinifera
gb|AAK09230.1|AC084320_17  putative copia-like retrotransposon Ho...    207   3e-86    Oryza sativa Japonica Group [Japonica rice]
gb|ACY72569.1|  unknown                                                 206   4e-86    Oryza sativa Japonica Group [Japonica rice]
emb|CAN71595.1|  hypothetical protein VITISV_010143                     254   1e-85    Vitis vinifera
emb|CAC95126.1|  gag-pol polyprotein                                    259   2e-85    Populus deltoides
emb|CAN79148.1|  hypothetical protein VITISV_004343                     186   3e-85    Vitis vinifera
gb|AAD26943.1|  putative retroelement pol polyprotein                   251   6e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CAN73924.1|  hypothetical protein VITISV_041509                     186   2e-84    Vitis vinifera
emb|CAN69851.1|  hypothetical protein VITISV_009554                     250   2e-84    Vitis vinifera
gb|ABA95367.1|  retrotransposon protein, putative, Ty1-copia subc...    206   3e-84    Oryza sativa Japonica Group [Japonica rice]
gb|AAF79879.1|AC000348_32  T7N9.5                                       248   2e-83    Arabidopsis thaliana [mouse-ear cress]
emb|CAN77085.1|  hypothetical protein VITISV_044282                     280   4e-83    Vitis vinifera
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...    263   4e-83    
gb|AAU43956.1|  unknown protein                                         205   5e-83    Oryza sativa Japonica Group [Japonica rice]
gb|AAR88589.1|  putative copia-like retrotransposon protein             196   6e-83    Oryza sativa Japonica Group [Japonica rice]
emb|CAA72989.1|  unnamed protein product                                244   8e-83    Brassica oleracea
emb|CAN82380.1|  hypothetical protein VITISV_021579                     187   1e-82    Vitis vinifera
emb|CAN72498.1|  hypothetical protein VITISV_010513                     183   1e-82    Vitis vinifera
emb|CAN81016.1|  hypothetical protein VITISV_025518                     246   2e-82    Vitis vinifera
gb|KFK44388.1|  hypothetical protein AALP_AA1G251100                    189   5e-82    
emb|CAN74695.1|  hypothetical protein VITISV_024648                     196   8e-82    Vitis vinifera
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...    195   1e-81    Oryza sativa Japonica Group [Japonica rice]
gb|ACV42639.1|  gag/pol                                                 195   1e-81    
emb|CAN64418.1|  hypothetical protein VITISV_030041                     196   1e-81    Vitis vinifera
gb|AAD25646.1|  putative retroelement pol polyprotein                   242   2e-81    Arabidopsis thaliana [mouse-ear cress]
emb|CAN73272.1|  hypothetical protein VITISV_013115                     245   3e-81    Vitis vinifera
gb|AAB61111.1|  Strong similarity to Zea mays retrotransposon Hop...    247   1e-80    Arabidopsis thaliana [mouse-ear cress]
gb|KFK45117.1|  hypothetical protein AALP_AA1G346500                    189   1e-80    
emb|CAB10526.1|  retrotransposon like protein                           282   4e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAF69172.1|AC007915_24  F27F5.11                                     298   5e-80    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK41512.1|  C-end truncated polyprotein                            185   5e-80    
emb|CAN61640.1|  hypothetical protein VITISV_021909                     298   5e-80    Vitis vinifera
dbj|BAM42649.1|  Polyprotein                                            180   6e-80    
dbj|BAA78426.1|  polyprotein                                            180   6e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532348.1|  PREDICTED: uncharacterized protein LOC104808371    292   6e-80    
dbj|BAM44532.1|  polyprotein                                            179   7e-80    
gb|AFN88207.1|  integrase core domain containing protein                238   8e-80    
emb|CAN75041.1|  hypothetical protein VITISV_027174                     241   8e-80    Vitis vinifera
dbj|BAM42646.1|  polyprotein                                            180   8e-80    
dbj|BAM42647.1|  polyprotein                                            180   9e-80    
dbj|BAA78424.1|  polyprotein                                            179   1e-79    Arabidopsis thaliana [mouse-ear cress]
gb|EPS62921.1|  hypothetical protein M569_11867                         234   1e-79    
gb|AAC79110.1|  putative polyprotein of LTR transposon                  179   1e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44530.1|  polyprotein                                            180   1e-79    
dbj|BAK41511.1|  polyprotein                                            183   2e-79    
gb|AAK62793.1|AC027036_14  polyprotein, putative                        183   2e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAK62788.1|AC027036_9  polyprotein, putative                         183   2e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAM42650.1|  Polyprotein                                            179   2e-79    
dbj|BAM44531.1|  polyprotein                                            179   2e-79    
dbj|BAA87949.1|  retrotransposon homolog                                183   2e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA78427.1|  polyprotein                                            179   2e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA78423.1|  polyprotein                                            182   2e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAM44534.1|  polyprotein                                            178   4e-79    
dbj|BAM44535.1|  polyprotein                                            178   4e-79    
dbj|BAM44529.1|  polyprotein                                            178   5e-79    
emb|CAN67925.1|  hypothetical protein VITISV_021168                     244   7e-79    Vitis vinifera
emb|CAN82859.1|  hypothetical protein VITISV_025377                     167   8e-79    Vitis vinifera
emb|CAN76679.1|  hypothetical protein VITISV_034325                     241   1e-78    Vitis vinifera
emb|CAN83015.1|  hypothetical protein VITISV_041694                     234   1e-78    Vitis vinifera
emb|CAN67546.1|  hypothetical protein VITISV_027734                     295   1e-78    Vitis vinifera
emb|CAN76546.1|  hypothetical protein VITISV_010420                     234   2e-78    Vitis vinifera
emb|CAN60609.1|  hypothetical protein VITISV_036599                     238   3e-78    Vitis vinifera
emb|CAN71748.1|  hypothetical protein VITISV_019194                     221   5e-78    Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                     239   5e-78    Vitis vinifera
ref|XP_007014689.1|  Uncharacterized protein TCM_040047                 175   8e-78    
gb|AAF99727.1|AC004557_6  F17L21.7                                      192   1e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CAN66496.1|  hypothetical protein VITISV_036886                     170   2e-77    Vitis vinifera
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...    248   2e-77    
dbj|BAK41507.1|  polyprotein                                            183   2e-77    
gb|AAC02672.1|  polyprotein                                             187   3e-77    Arabidopsis arenosa
dbj|BAA78425.1|  polyprotein                                            183   3e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CAN62535.1|  hypothetical protein VITISV_041880                     239   3e-77    Vitis vinifera
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890    290   3e-77    
gb|AAC67200.1|  putative retroelement pol polyprotein                   168   4e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAB82754.1|  retrofit                                                180   4e-77    Oryza longistaminata [long-staminate rice]
emb|CAN81139.1|  hypothetical protein VITISV_018760                     236   5e-77    Vitis vinifera
emb|CAN80320.1|  hypothetical protein VITISV_034560                     238   5e-77    Vitis vinifera
ref|XP_010038745.1|  PREDICTED: uncharacterized protein LOC104427339    284   5e-77    
emb|CAN67588.1|  hypothetical protein VITISV_036280                     289   7e-77    Vitis vinifera
dbj|BAK64102.1|  gag-pol polyprotein                                    224   7e-77    
dbj|BAB10876.1|  polyprotein                                            181   9e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CAB10225.1|  retrovirus-related like polyprotein                    246   9e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CAN71185.1|  hypothetical protein VITISV_014270                     233   9e-77    Vitis vinifera
gb|AAD14478.1|  Strong similarity to gb|AF039376 Evelknievel retr...    178   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...    238   3e-76    
gb|AAK43485.1|AC084807_10  polyprotein, putative                        178   3e-76    Arabidopsis thaliana [mouse-ear cress]
emb|CAN75900.1|  hypothetical protein VITISV_033582                     230   5e-76    Vitis vinifera
emb|CAN74286.1|  hypothetical protein VITISV_036410                     234   9e-76    Vitis vinifera
emb|CAN71132.1|  hypothetical protein VITISV_007235                     219   1e-75    Vitis vinifera
emb|CAN80753.1|  hypothetical protein VITISV_003323                     230   2e-75    Vitis vinifera
gb|AAC02666.1|  polyprotein                                             181   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AAC02669.1|  polyprotein                                             181   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AAC02664.1|  polyprotein                                             181   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AGJ83729.1|  gag-pol polyprotein                                     248   2e-75    
emb|CAN80547.1|  hypothetical protein VITISV_010898                     243   4e-75    Vitis vinifera
emb|CAN68235.1|  hypothetical protein VITISV_037104                     238   4e-75    Vitis vinifera
emb|CAN76493.1|  hypothetical protein VITISV_007584                     224   5e-75    Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                     229   6e-75    Vitis vinifera
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein             256   7e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CAB46043.1|  retrotransposon like protein                           180   7e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ACB45089.1|  putative polyprotein                                    218   1e-74    Solanum habrochaites
emb|CAN74241.1|  hypothetical protein VITISV_006638                     214   1e-74    Vitis vinifera
emb|CAN67539.1|  hypothetical protein VITISV_021584                     213   1e-74    Vitis vinifera
gb|AAC35532.1|  contains similarity to proteases                        164   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...    233   5e-74    
emb|CAN72168.1|  hypothetical protein VITISV_004170                     236   5e-74    Vitis vinifera
emb|CAN77638.1|  hypothetical protein VITISV_007620                     238   1e-73    Vitis vinifera
emb|CAN83125.1|  hypothetical protein VITISV_015109                     201   3e-73    Vitis vinifera
gb|AAT38747.2|  Polyprotein, putative                                   213   3e-73    Solanum demissum
emb|CAN66243.1|  hypothetical protein VITISV_015916                     232   3e-73    Vitis vinifera
ref|XP_004149623.1|  PREDICTED: uncharacterized protein LOC101211618    248   3e-73    
emb|CAN64963.1|  hypothetical protein VITISV_002891                     232   4e-73    Vitis vinifera
emb|CAN74984.1|  hypothetical protein VITISV_035210                     223   6e-73    Vitis vinifera
emb|CAN74430.1|  hypothetical protein VITISV_010987                     233   7e-73    Vitis vinifera
gb|AAG50751.1|AC079733_19  polyprotein, putative                        231   7e-73    Arabidopsis thaliana [mouse-ear cress]
emb|CAN65144.1|  hypothetical protein VITISV_026080                     212   9e-73    Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                     224   1e-72    Vitis vinifera
gb|AAT38758.1|  Putative gag-pol polyprotein, identical                 223   1e-72    Solanum demissum
ref|XP_008379771.1|  PREDICTED: uncharacterized protein LOC103442736    272   2e-72    
ref|XP_010507647.1|  PREDICTED: uncharacterized protein LOC104784298    177   7e-72    
emb|CAN82526.1|  hypothetical protein VITISV_028058                     214   7e-72    Vitis vinifera
emb|CAN71037.1|  hypothetical protein VITISV_011061                     227   8e-72    Vitis vinifera
emb|CAN77210.1|  hypothetical protein VITISV_000141                     226   8e-72    Vitis vinifera
emb|CDY58610.1|  BnaCnng33390D                                          167   9e-72    
gb|AGV40508.1|  hypothetical protein                                    171   1e-71    
gb|AAG51247.1|AC055769_6  copia-type polyprotein, putative; 28768...    226   1e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CAN80930.1|  hypothetical protein VITISV_005279                     221   1e-71    Vitis vinifera
ref|XP_004137882.1|  PREDICTED: ABC transporter C family member 1...    240   2e-71    
dbj|BAB11200.1|  copia-type polyprotein                                 226   2e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAF25964.2|AC017118_1  F6N18.1                                       226   2e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008383301.1|  PREDICTED: uncharacterized protein LOC103446021    169   2e-71    
ref|XP_010051209.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    179   2e-71    
emb|CAN76645.1|  hypothetical protein VITISV_004685                     233   3e-71    Vitis vinifera
dbj|BAB01972.1|  copia-like retrotransposable element                   206   4e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CAN67317.1|  hypothetical protein VITISV_019719                     215   6e-71    Vitis vinifera
emb|CAN74964.1|  hypothetical protein VITISV_006810                     195   8e-71    Vitis vinifera
emb|CAN67240.1|  hypothetical protein VITISV_037460                     236   1e-70    Vitis vinifera
emb|CAN74951.1|  hypothetical protein VITISV_030567                     157   1e-70    Vitis vinifera
emb|CAN84135.1|  hypothetical protein VITISV_000113                     237   1e-70    Vitis vinifera
emb|CAN83877.1|  hypothetical protein VITISV_014760                     259   7e-70    Vitis vinifera
ref|XP_008374275.1|  PREDICTED: retrovirus-related Pol polyprotei...    175   1e-69    
emb|CAN76133.1|  hypothetical protein VITISV_036298                     220   2e-69    Vitis vinifera
gb|ABI34329.1|  Integrase core domain containing protein                203   3e-69    Solanum demissum
emb|CAN64002.1|  hypothetical protein VITISV_023116                     247   3e-69    Vitis vinifera
emb|CAN67076.1|  hypothetical protein VITISV_042382                     209   4e-69    Vitis vinifera
gb|ABW74566.1|  integrase                                               222   6e-69    Boechera divaricarpa
emb|CAN60452.1|  hypothetical protein VITISV_011348                     223   1e-68    Vitis vinifera
emb|CAN69647.1|  hypothetical protein VITISV_022133                     220   2e-68    Vitis vinifera
emb|CAN59949.1|  hypothetical protein VITISV_043423                     205   2e-68    Vitis vinifera
emb|CAN70029.1|  hypothetical protein VITISV_010388                     221   4e-68    Vitis vinifera
ref|XP_004228785.1|  PREDICTED: uncharacterized protein LOC101255821    228   7e-68    
gb|AIC77183.1|  polyprotein                                             224   9e-68    
emb|CAN69607.1|  hypothetical protein VITISV_009561                     196   1e-67    Vitis vinifera
emb|CAN73234.1|  hypothetical protein VITISV_033857                     204   2e-67    Vitis vinifera
emb|CAN69307.1|  hypothetical protein VITISV_001120                     205   2e-67    Vitis vinifera
emb|CAN66596.1|  hypothetical protein VITISV_019893                     222   2e-67    Vitis vinifera
emb|CAN81712.1|  hypothetical protein VITISV_038973                     206   2e-67    Vitis vinifera
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...    217   2e-67    
emb|CAN60829.1|  hypothetical protein VITISV_012059                     258   3e-67    Vitis vinifera
emb|CAN80771.1|  hypothetical protein VITISV_027574                     201   4e-67    Vitis vinifera
emb|CAN80566.1|  hypothetical protein VITISV_029672                     210   6e-67    Vitis vinifera
emb|CAN81385.1|  hypothetical protein VITISV_012324                     215   6e-67    Vitis vinifera
emb|CAN78451.1|  hypothetical protein VITISV_005945                     252   6e-67    Vitis vinifera
ref|XP_007024187.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    257   1e-66    
emb|CAN60274.1|  hypothetical protein VITISV_024841                     199   1e-66    Vitis vinifera
ref|XP_008237766.1|  PREDICTED: uncharacterized protein LOC103336496    211   2e-66    
emb|CAN79061.1|  hypothetical protein VITISV_024577                     211   9e-66    Vitis vinifera
emb|CAN60238.1|  hypothetical protein VITISV_032906                     219   1e-65    Vitis vinifera
emb|CAN64452.1|  hypothetical protein VITISV_009528                     210   1e-65    Vitis vinifera
ref|XP_008367623.1|  PREDICTED: uncharacterized protein LOC103431265    152   3e-65    
gb|ACS74199.1|  putative gag-pol polyprotein                            204   3e-65    Fragaria x ananassa
emb|CAN63081.1|  hypothetical protein VITISV_016842                     212   4e-65    Vitis vinifera
emb|CAN70669.1|  hypothetical protein VITISV_037506                     209   6e-65    Vitis vinifera
emb|CAN77046.1|  hypothetical protein VITISV_035257                     219   6e-65    Vitis vinifera
sp|P10978.1|POLX_TOBAC  RecName: Full=Retrovirus-related Pol poly...    205   7e-65    Nicotiana tabacum [American tobacco]
emb|CAN62533.1|  hypothetical protein VITISV_030700                     188   7e-65    Vitis vinifera
emb|CAN70357.1|  hypothetical protein VITISV_013713                     228   8e-65    Vitis vinifera
emb|CAN67119.1|  hypothetical protein VITISV_017483                     194   8e-65    Vitis vinifera
ref|XP_010325686.1|  PREDICTED: uncharacterized protein LOC104649000    220   9e-65    
emb|CAN82171.1|  hypothetical protein VITISV_040546                     193   2e-64    Vitis vinifera
gb|ACL97384.1|  Gag-Pol polyprotein                                     195   3e-64    Medicago truncatula
ref|XP_003376336.1|  retrovirus-related Pol polyprotein from tran...    192   3e-64    
ref|XP_003376808.1|  retrovirus-related Pol polyprotein from tran...    189   3e-64    
emb|CAA19715.1|  putative protein                                       159   3e-64    Arabidopsis thaliana [mouse-ear cress]
emb|CAN82064.1|  hypothetical protein VITISV_022772                     203   4e-64    Vitis vinifera
gb|AAP46257.1|  putative polyprotein                                    218   4e-64    Oryza sativa Japonica Group [Japonica rice]
gb|ABI34342.1|  Polyprotein, putative                                   203   4e-64    Solanum demissum
gb|AAX92861.1|  retrotransposon protein, putative, Ty1-copia sub-...    199   5e-64    Oryza sativa Japonica Group [Japonica rice]
emb|CAH66122.1|  OSIGBa0146N20.7                                        197   5e-64    Oryza sativa [red rice]
gb|ABA98804.1|  retrotransposon protein, putative, Ty1-copia subc...    199   7e-64    Oryza sativa Japonica Group [Japonica rice]
gb|ACL97385.1|  Gag-Pol polyprotein                                     193   9e-64    Medicago truncatula
emb|CAN74064.1|  hypothetical protein VITISV_028146                     231   1e-63    Vitis vinifera
gb|AAL75752.1|AC037197_10  Putative copia-type polyprotein              221   2e-63    Oryza sativa Japonica Group [Japonica rice]
gb|ACL97386.1|  Gag-Pol polyprotein                                     191   2e-63    Medicago truncatula
gb|AAX92941.1|  retrotransposon protein, putative, Ty1-copia sub-...    207   2e-63    Oryza sativa Japonica Group [Japonica rice]
gb|AFB73912.1|  polyprotein                                             206   2e-63    
emb|CAN75922.1|  hypothetical protein VITISV_030752                     191   2e-63    Vitis vinifera
emb|CAN82452.1|  hypothetical protein VITISV_003326                     246   2e-63    Vitis vinifera
gb|AAK29467.1|  polyprotein-like                                        205   2e-63    Solanum chilense
gb|ACL97383.1|  Gag-Pol polyprotein                                     192   3e-63    Medicago truncatula
emb|CAN61630.1|  hypothetical protein VITISV_003191                     188   3e-63    Vitis vinifera
emb|CAN75051.1|  hypothetical protein VITISV_020117                     199   3e-63    Vitis vinifera
gb|ABA98656.1|  retrotransposon protein, putative, Ty1-copia subc...    197   4e-63    Oryza sativa Japonica Group [Japonica rice]
emb|CAN81715.1|  hypothetical protein VITISV_032902                     237   4e-63    Vitis vinifera
emb|CAN63683.1|  hypothetical protein VITISV_030301                     163   4e-63    Vitis vinifera
gb|AFB73911.1|  polyprotein                                             204   4e-63    
emb|CAN78715.1|  hypothetical protein VITISV_030863                     211   7e-63    Vitis vinifera
gb|ABA97637.1|  retrotransposon protein, putative, Ty1-copia subc...    201   9e-63    Oryza sativa Japonica Group [Japonica rice]
emb|CAN79281.1|  hypothetical protein VITISV_034553                     213   1e-62    Vitis vinifera
emb|CAN74303.1|  hypothetical protein VITISV_032980                     211   1e-62    Vitis vinifera
emb|CAH66391.1|  OSIGBa0134J07.9                                        214   1e-62    Oryza sativa [red rice]
ref|XP_008372142.1|  PREDICTED: uncharacterized protein LOC103435525    226   2e-62    
gb|ABA95820.1|  retrotransposon protein, putative, unclassified         222   3e-62    Oryza sativa Japonica Group [Japonica rice]
emb|CAE04792.1|  OSJNBb0018J12.5                                        191   3e-62    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA22288.1|  polyprotein                                            194   3e-62    Oryza australiensis
emb|CAN62423.1|  hypothetical protein VITISV_020608                     226   4e-62    Vitis vinifera
gb|AAT44162.1|  putative polyprotein                                    191   4e-62    Oryza sativa Japonica Group [Japonica rice]
gb|AAL31076.1|AC091749_5  putaive copia-like retrotransposon poly...    231   5e-62    Oryza sativa [red rice]
ref|NP_001174286.1|  Os05g0235100                                       238   6e-62    
ref|XP_009611318.1|  PREDICTED: uncharacterized protein LOC104104835    238   8e-62    
emb|CAN74381.1|  hypothetical protein VITISV_007944                     173   1e-61    Vitis vinifera
emb|CAN68623.1|  hypothetical protein VITISV_010681                     238   1e-61    
emb|CAN70689.1|  hypothetical protein VITISV_012155                     241   1e-61    
gb|ABA91445.2|  retrotransposon protein, putative, Ty1-copia subc...    191   1e-61    
gb|AAV24814.1|  putative polyprotein                                    189   1e-61    
emb|CAN71445.1|  hypothetical protein VITISV_042489                     212   2e-61    
emb|CAN74794.1|  hypothetical protein VITISV_041689                     153   2e-61    
emb|CAN82285.1|  hypothetical protein VITISV_039753                     197   2e-61    
emb|CAN62623.1|  hypothetical protein VITISV_001656                     191   2e-61    
emb|CAN78864.1|  hypothetical protein VITISV_007439                     238   2e-61    
emb|CAN71161.1|  hypothetical protein VITISV_009113                     174   2e-61    
gb|ACN78973.1|  copia-type polyprotein                                  199   3e-61    
gb|ABA99473.2|  retrotransposon protein, putative, Ty1-copia subc...    188   3e-61    
gb|AAU44026.2|  putative polyprotein                                    191   3e-61    
emb|CAD40744.2|  OSJNBa0072D21.4                                        191   3e-61    
gb|AAP54573.2|  retrotransposon protein, putative, Ty1-copia subc...    190   3e-61    
gb|AAT77367.1|  putative polyprotein                                    190   4e-61    
gb|AAR87163.1|  putative polyprotein                                    195   4e-61    
emb|CAN62447.1|  hypothetical protein VITISV_024007                     163   4e-61    
gb|AAP53927.1|  retrotransposon protein, putative, Ty1-copia subc...    192   4e-61    
gb|AAK84454.1|AC087192_15  putative polyprotein                         190   4e-61    
gb|AAR01716.1|  putative Gag and Pol polyprotein                        190   4e-61    
emb|CAN83506.1|  hypothetical protein VITISV_027576                     136   4e-61    
gb|ABA97938.1|  retrotransposon protein, putative, Ty1-copia subc...    190   4e-61    
gb|AAR01682.1|  putative gag and pol protein                            190   5e-61    
gb|AAT58810.1|  putative polyprotein                                    191   5e-61    
emb|CAB75481.1|  copia-like polyprotein                                 185   5e-61    
gb|AAX96832.1|  retrotransposon protein, putative, Ty1-copia sub-...    189   5e-61    
gb|AAK71544.1|AC087852_4  putative polyprotein                          190   5e-61    
gb|ABF98943.1|  retrotransposon protein, putative, unclassified, ...    190   5e-61    
gb|AAT69606.1|  putative polyprotein                                    189   5e-61    
gb|AAN61480.1|  Putative polyprotein from transposon TNT                190   5e-61    
gb|ABA95768.1|  retrotransposon protein, putative, Ty1-copia subc...    188   6e-61    
gb|AAT38001.1|  Putative polyprotein                                    191   6e-61    
gb|ABA96779.1|  retrotransposon protein, putative, Ty1-copia subc...    189   6e-61    
gb|ABF98853.1|  retrotransposon protein, putative, Ty1-copia subc...    189   6e-61    
gb|ABA91250.1|  retrotransposon protein, putative, Ty1-copia subc...    189   6e-61    
emb|CAN64827.1|  hypothetical protein VITISV_030308                     238   7e-61    
gb|ABF96702.1|  retrotransposon protein, putative, Ty1-copia subc...    190   7e-61    
gb|AAP20858.1|  retrotransposon protein, putative, Ty1-copia sub-...    190   7e-61    
emb|CAD40198.2|  OSJNBb0043H09.7                                        189   8e-61    
gb|ABA91402.1|  retrotransposon protein, putative, Ty1-copia subc...    190   9e-61    
emb|CAE03086.1|  OSJNBa0017B10.1                                        189   1e-60    
emb|CAN60203.1|  hypothetical protein VITISV_036059                     239   1e-60    
gb|AAU90089.1|  putative polyprotein                                    196   1e-60    
ref|XP_004967136.1|  PREDICTED: uncharacterized protein LOC101762311    216   1e-60    
emb|CAN82928.1|  hypothetical protein VITISV_025045                     193   1e-60    
gb|ABA99751.1|  retrotransposon protein, putative, Ty1-copia subc...    188   1e-60    
ref|XP_008344799.1|  PREDICTED: uncharacterized protein LOC103407689    140   1e-60    
dbj|BAG94704.1|  unnamed protein product                                196   1e-60    
ref|XP_006580845.1|  PREDICTED: uncharacterized protein LOC102660325    188   1e-60    
emb|CAN71109.1|  hypothetical protein VITISV_001479                     173   2e-60    
emb|CAN74767.1|  hypothetical protein VITISV_041860                     239   2e-60    
emb|CAE04541.2|  OSJNBa0040D17.9                                        188   2e-60    
ref|NP_001059837.1|  Os07g0528100                                       195   2e-60    
gb|EFA06256.1|  hypothetical protein TcasGA2_TC009115                   185   2e-60    
gb|ACZ04926.1|  polyprotein                                             186   2e-60    
gb|AAV31347.1|  putative polyprotein                                    191   2e-60    
gb|EEE51974.1|  hypothetical protein OsJ_33644                          188   2e-60    
emb|CBI36090.3|  unnamed protein product                                132   5e-60    
emb|CAN76151.1|  hypothetical protein VITISV_012673                     234   5e-60    
emb|CAJ09951.2|  putative gag-pol polyprotein                           184   5e-60    
gb|AAT93940.1|  putative polyprotein                                    186   6e-60    
gb|AAD23690.1|  putative retroelement pol polyprotein                   195   6e-60    
gb|AAO60021.1|  putative polyprotein                                    191   6e-60    
gb|ABA96419.1|  retrotransposon protein, putative, Ty1-copia subc...    189   7e-60    
emb|CAN69340.1|  hypothetical protein VITISV_032634                     171   8e-60    
emb|CAN74198.1|  hypothetical protein VITISV_005765                     173   8e-60    
ref|XP_008646585.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    152   9e-60    
emb|CAN83839.1|  hypothetical protein VITISV_023230                     230   9e-60    
gb|AAT39267.1|  putative polyprotein                                    184   9e-60    
gb|ABF97537.1|  retrotransposon protein, putative, Ty1-copia subc...    185   1e-59    
gb|ABA99836.1|  retrotransposon protein, putative, Ty1-copia subc...    186   1e-59    
gb|AAR87214.1|  retrotransposon protein, putative, Ty1-copia sub-...    185   1e-59    
gb|ABA93952.1|  retrotransposon protein, putative, Ty1-copia subc...    186   1e-59    
gb|AAT44282.1|  putative polyprotein                                    193   1e-59    
ref|XP_008664109.1|  PREDICTED: uncharacterized protein LOC103642667    145   2e-59    
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...    147   2e-59    
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...    142   2e-59    
gb|AAT39281.2|  Integrase core domain containing protein                140   2e-59    
ref|XP_010451516.1|  PREDICTED: uncharacterized protein LOC104733649    202   2e-59    
gb|AAO72413.1|  gag-pol polyprotein                                     196   2e-59    
gb|ABA98555.1|  retrotransposon protein, putative, Ty1-copia subc...    186   3e-59    
gb|ABF99203.1|  retrotransposon protein, putative, Ty1-copia subc...    207   3e-59    
ref|XP_008372204.1|  PREDICTED: uncharacterized protein LOC103435597    170   3e-59    
gb|AAO37957.1|  putative gag-pol polyprotein                            209   3e-59    
emb|CAN65367.1|  hypothetical protein VITISV_032069                     219   3e-59    
emb|CAN67009.1|  hypothetical protein VITISV_004754                     214   3e-59    
emb|CAE05795.1|  OSJNBb0046K02.5                                        188   4e-59    
emb|CAE01299.2|  OSJNBa0020P07.16                                       184   4e-59    
gb|AAD32759.1|  putative retroelement pol polyprotein                   188   4e-59    
gb|ABF94836.1|  retrotransposon protein, putative, unclassified         208   4e-59    
gb|AAT85194.1|  putative polyprotein                                    196   4e-59    
gb|ABF93543.1|  retrotransposon protein, putative, unclassified         208   4e-59    
gb|AAN60494.1|  Putative Zea mays retrotransposon Opie-2                208   4e-59    
gb|AAP54315.2|  retrotransposon protein, putative, Ty1-copia subc...    192   4e-59    
emb|CAE02325.2|  OSJNBb0112E13.7                                        188   5e-59    
gb|AAM91886.1|  putative polyprotein                                    192   5e-59    
emb|CAH67713.1|  H0512B01.8                                             203   5e-59    
gb|AAU90262.1|  integrase core domain containing protein                207   5e-59    
emb|CAE03600.2|  OSJNBb0004A17.2                                        207   5e-59    
gb|AAV88069.1|  hypothetical retrotransposon                            181   6e-59    
ref|XP_008675247.1|  PREDICTED: uncharacterized protein LOC103651...    152   7e-59    
emb|CAN61815.1|  hypothetical protein VITISV_009920                     231   8e-59    
emb|CAN73437.1|  hypothetical protein VITISV_031733                     232   1e-58    
emb|CAN77602.1|  hypothetical protein VITISV_024474                     183   1e-58    
pir||S00954  pol polyprotein - fruit fly (Drosophila melanogaster...    185   2e-58 
emb|CAD41731.1|  OSJNBb0034I13.10                                       203   2e-58    
gb|ABA98797.2|  retrotransposon protein, putative, Ty1-copia subc...    189   2e-58    
emb|CAN64816.1|  hypothetical protein VITISV_010668                     231   3e-58    
gb|KFD61291.1|  hypothetical protein M514_26539                         177   3e-58    
gb|EEC67008.1|  hypothetical protein OsI_33720                          187   6e-58    
ref|XP_008666385.1|  PREDICTED: uncharacterized protein LOC103645032    145   6e-58    
emb|CAH66177.1|  OSIGBa0130O15.1                                        187   7e-58    
emb|CAN73101.1|  hypothetical protein VITISV_042890                     225   7e-58    
emb|CAN78616.1|  hypothetical protein VITISV_003658                     230   8e-58    
gb|ABB47537.2|  retrotransposon protein, putative, unclassified         187   9e-58    
emb|CAE03978.3|  OSJNBa0033H08.2                                        186   9e-58    
ref|XP_009373186.1|  PREDICTED: uncharacterized protein LOC103962231    227   9e-58    
emb|CAN76948.1|  hypothetical protein VITISV_017167                     185   1e-57    
dbj|BAD34493.1|  Gag-Pol                                                187   1e-57    
ref|XP_008357951.1|  PREDICTED: uncharacterized protein LOC103421687    130   3e-57    
emb|CAN68682.1|  hypothetical protein VITISV_024814                     181   3e-57    
emb|CAN82075.1|  hypothetical protein VITISV_016661                     170   6e-57    
ref|XP_010059512.1|  PREDICTED: uncharacterized protein LOC104447480    224   6e-57    
gb|KFD72989.1|  hypothetical protein M514_12352                         180   7e-57    
emb|CAD40924.3|  OSJNBa0033G16.12                                       183   7e-57    
gb|AAT69582.1|  putative polyprotein                                    208   8e-57    
gb|AAX96223.1|  retrotransposon protein, putative, Ty1-copia sub-...    182   9e-57    
emb|CAN74341.1|  hypothetical protein VITISV_043997                     165   1e-56    
gb|AAK73108.1|AF391808_10  Fourf gag/pol protein                        188   2e-56    
emb|CAA31653.1|  polyprotein                                            181   2e-56    
gb|ABA97652.1|  retrotransposon protein, putative, Ty1-copia subc...    206   2e-56    
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    194   4e-56    
emb|CAN63276.1|  hypothetical protein VITISV_000400                     179   6e-56    
gb|AAR01736.1|  putative Gag and Pol polyprotein                        181   1e-55    
ref|XP_004966848.1|  PREDICTED: uncharacterized protein LOC101777861    147   1e-55    
gb|ABA96626.1|  retrotransposon protein, putative, unclassified         180   1e-55    
gb|KFD64618.1|  hypothetical protein M514_23220                         177   1e-55    
ref|NP_001059496.1|  Os07g0434200                                       184   1e-55    
gb|ABF97694.1|  retrotransposon protein, putative, unclassified         197   2e-55    
emb|CAN76680.1|  hypothetical protein VITISV_034326                     217   2e-55    
ref|XP_008671960.1|  PREDICTED: uncharacterized protein LOC103649473    149   2e-55    
emb|CCI55376.1|  PH01B035L11.21                                         200   3e-55    
ref|XP_010501944.1|  PREDICTED: uncharacterized protein LOC104779282    182   3e-55    
emb|CAN69956.1|  hypothetical protein VITISV_032883                     150   3e-55    
ref|XP_010656794.1|  PREDICTED: uncharacterized protein LOC104880778    218   6e-55    
gb|ABA93525.1|  retrotransposon protein, putative, Ty1-copia subc...    186   7e-55    
gb|EEC82022.1|  hypothetical protein OsI_25984                          135   8e-55    
gb|ABA95205.1|  retrotransposon protein, putative, Ty1-copia subc...    174   1e-54    
gb|AAC26250.1|  contains similarity to reverse transcriptase (Pfa...    179   1e-54    
ref|XP_010545858.1|  PREDICTED: uncharacterized protein LOC104818098    171   1e-54    
gb|ABA97707.2|  retrotransposon protein, putative, Ty1-copia subc...    201   2e-54    
gb|AAK12626.1|  unknown protein                                         161   2e-54    
emb|CDY09583.1|  BnaC05g23360D                                          176   6e-54    
ref|XP_008350396.1|  PREDICTED: uncharacterized protein LOC103413729    139   1e-53    
emb|CAN80088.1|  hypothetical protein VITISV_021656                     158   1e-53    
gb|EEC81933.1|  hypothetical protein OsI_25798                          177   1e-53    
emb|CAN64073.1|  hypothetical protein VITISV_038270                     175   2e-53    
emb|CAN79529.1|  hypothetical protein VITISV_026262                     168   2e-53    
emb|CAN74310.1|  hypothetical protein VITISV_037517                     161   3e-53    
gb|ABG22485.1|  retrotransposon protein, putative, Ty1-copia subc...    184   3e-53    
gb|AEJ72555.1|  putative retroelement polyprotein                       129   4e-53    
emb|CAN71138.1|  hypothetical protein VITISV_008660                     155   5e-53    
emb|CAH66624.1|  OSIGBa0115A19.5                                        182   5e-53    
emb|CAN70024.1|  hypothetical protein VITISV_030172                     213   5e-53    
emb|CAN60366.1|  hypothetical protein VITISV_031870                     167   8e-53    
ref|XP_010544446.1|  PREDICTED: uncharacterized protein LOC104817067    192   9e-53    
pir||S23319  hypothetical protein 2 - Arabidopsis thaliana retrot...    170   1e-52 
ref|XP_008384570.1|  PREDICTED: uncharacterized protein LOC103447138    142   1e-52    
ref|XP_004513130.1|  PREDICTED: uncharacterized protein LOC101488260    139   2e-52    
gb|ABF94883.1|  transposon protein, putative, unclassified              174   2e-52    
emb|CAN65233.1|  hypothetical protein VITISV_022975                     212   2e-52    
gb|AAD12997.1|  gag-pol polyprotein                                     163   2e-52    
gb|ABA94191.1|  retrotransposon protein, putative, Ty1-copia subc...    188   2e-52    
gb|ABA96226.1|  retrotransposon protein, putative, Ty1-copia subc...    197   3e-52    
ref|NP_001064098.1|  Os10g0130700                                       182   3e-52    
emb|CAN67821.1|  hypothetical protein VITISV_025855                     178   4e-52    
emb|CAN82754.1|  hypothetical protein VITISV_034296                     169   4e-52    
emb|CAN82769.1|  hypothetical protein VITISV_037882                     130   4e-52    
emb|CAE04422.2|  OSJNBb0040D15.12                                       168   4e-52    
emb|CAN81793.1|  hypothetical protein VITISV_020571                     170   5e-52    
gb|ABF96953.1|  retrotransposon protein, putative, Ty1-copia subc...    191   6e-52    
gb|AAS01934.1|  putative Integrase core domain containing protein       191   6e-52    
emb|CAN69688.1|  hypothetical protein VITISV_026774                     184   6e-52    
gb|AAF69161.1|AC007915_13  F27F5.19                                     211   6e-52    
emb|CAN83352.1|  hypothetical protein VITISV_022160                     154   6e-52    
emb|CAN69566.1|  hypothetical protein VITISV_033535                     159   7e-52    
emb|CAN66083.1|  hypothetical protein VITISV_028833                     179   7e-52    
gb|AAT38797.2|  Polyprotein, putative                                   145   2e-51    
emb|CCA17998.1|  putative polyprotein                                   176   4e-51    
gb|ABA98286.2|  retrotransposon protein, putative, Ty1-copia subc...    208   4e-51    
dbj|BAD99220.1|  polypeptide with an integrase domain                   167   5e-51    
emb|CAN80247.1|  hypothetical protein VITISV_027801                     187   6e-51    
gb|AAU10819.1|  putative polyprotein                                    136   6e-51    
emb|CAN60498.1|  hypothetical protein VITISV_027869                     151   7e-51    
emb|CAN71436.1|  hypothetical protein VITISV_039529                     162   1e-50    
emb|CAN72710.1|  hypothetical protein VITISV_018096                     148   1e-50    
ref|XP_008374284.1|  PREDICTED: uncharacterized protein LOC103437576    153   2e-50    
gb|AAB87099.1|  putative retroelement pol polyprotein                   149   2e-50    
emb|CAN70473.1|  hypothetical protein VITISV_037490                     169   3e-50    
emb|CAN66416.1|  hypothetical protein VITISV_044133                     167   5e-50    
ref|XP_010661279.1|  PREDICTED: uncharacterized protein LOC104881770    202   5e-50    
gb|AAP94600.1|  putative copia-like retrotransposon Hopscotch pol...    203   5e-50    
gb|KFK32108.1|  hypothetical protein AALP_AA6G199700                    168   7e-50    
emb|CAN82221.1|  hypothetical protein VITISV_015226                     136   7e-50    
emb|CAN62633.1|  hypothetical protein VITISV_031441                     203   1e-49    
gb|AAL66754.1|AF464738_5  putative copia-like retrotransposon Hop...    203   1e-49    
gb|AAX95066.1|  retrotransposon protein, putative, unclassified         159   1e-49    
gb|AAD12998.1|  pol polyprotein                                         167   2e-49    
ref|XP_010662546.1|  PREDICTED: uncharacterized protein LOC104882159    202   2e-49    
emb|CAN73613.1|  hypothetical protein VITISV_023299                     170   2e-49    
gb|ABA93966.1|  retrotransposon protein, putative, Ty1-copia subc...    180   2e-49    
ref|XP_008385533.1|  PREDICTED: uncharacterized protein LOC103448069    131   2e-49    
emb|CAN76550.1|  hypothetical protein VITISV_031906                     142   2e-49    
emb|CAN74229.1|  hypothetical protein VITISV_000584                     136   3e-49    
emb|CAN74536.1|  hypothetical protein VITISV_023111                     202   3e-49    
ref|XP_008356829.1|  PREDICTED: cation/H(+) antiporter 15-like          117   4e-49    
emb|CAN70756.1|  hypothetical protein VITISV_014702                     201   5e-49    
ref|XP_010412990.1|  PREDICTED: uncharacterized protein LOC104699374    141   5e-49    
ref|XP_009348351.1|  PREDICTED: uncharacterized protein LOC103939989    132   6e-49    
emb|CAN68148.1|  hypothetical protein VITISV_035665                     128   8e-49    



>emb|CAN61322.1| hypothetical protein VITISV_012106 [Vitis vinifera]
Length=1432

 Score =   357 bits (917),  Expect(2) = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 266/466 (57%), Gaps = 34/466 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F++++E QF   IK +Q D GGE+R     L  +GI HR SC Y   Q
Sbjct  585   QTKDQALPIFKXFKLQMENQFDTKIKCLQSDNGGEFRSFTSFLQAVGIAHRFSCPYNSXQ  644

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NGRVERK+RH+VETGLALL+  S+  +YW +AF+  T LIN +P+ VL+++SPY  L + 
Sbjct  645   NGRVERKHRHVVETGLALLSHASLPMKYWHYAFQTXTFLINRMPSKVLEYDSPYFTLFRR  704

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y   RVFGC CYP++RPYN HK++YRS  C+FL Y  + +G+ C++  +G++YI  H
Sbjct  705   HPDYKSFRVFGCLCYPFIRPYNTHKLQYRSVQCLFLGYSLNHKGFLCLDYATGRVYITPH  764

Query  1711  VHFYESIFLFS--------DSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLT  1556
             V F ES F  +        + T      P  I   S P +      +HA+    +  +  
Sbjct  765   VVFDESTFPLAQSKSSSSSNDTSAEGSTPALITPPSFPCLLPDSKISHASIDSHSLSTSE  824

Query  1555  SPVPL-------------ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMT-R  1418
             SP+P              A  L P ++  P  TA             R     +R +T +
Sbjct  825   SPIPTTSSSPLDTSSSSPAIDLSPKSVPEPQITALA----------PRMTTRSMRGITKK  874

Query  1417  DTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKW  1238
              T     A+ V ++P+   QA     W  AM+ E  AL  N TW LV   P++NV+GCKW
Sbjct  875   KTILDLSAIKV-SEPSTLKQAFKDPNWTKAMEMEIAALHRNHTWDLVEQPPNVNVIGCKW  933

Query  1237  VFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLR  1058
             V++ K   DGSIE+YKARLVAKG+NQ  G D+F+TFS VVK  T+R++ ++ +S  W +R
Sbjct  934   VYKLKHKPDGSIERYKARLVAKGYNQTHGLDYFETFSPVVKAATIRIILTVALSFKWEIR  993

Query  1057  QLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             QLDVHNAFLNG L E VYM QPPGY DP  P+ V      ALYGL+
Sbjct  994   QLDVHNAFLNGELEEQVYMSQPPGYFDPQFPNRV-CRLKKALYGLK  1038


 Score =   169 bits (427),  Expect(2) = 3e-139, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 129/222 (58%), Gaps = 15/222 (7%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ +  YTG+D + +GNG  L IS +G   + S +    L  V +VP +S  L SV +  
Sbjct  362   LTSTSPYTGTDKVTIGNGKHLSISNIGSKQLHSHTHSFRLKKVFHVPFISANLISVAKFC  421

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV--------SRSHFAYLTSRAT  2545
             +ENN   EFH + F VKD  T+ VL +G    GLY+ PV        S ++ +   S+ +
Sbjct  422   SENNALIEFHSNAFFVKDLHTKMVLAQGKLENGLYKFPVFSNLKPYSSINNASAFHSQFS  481

Query  2544  STV------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSY  2383
             STV      WH RLGH +  + ++V+ +C VA  K KS    + C L+K+ R P    ++
Sbjct  482   STVENKAELWHNRLGHASFDIVSKVMNTCNVASGKYKSFVC-SDCQLAKSHRLPTQLSNF  540

Query  2382  SSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +   L+L+YTDIWGPA + STSG RYF+LFVDDYSR+ WFY
Sbjct  541   HASKPLELVYTDIWGPASIKSTSGARYFILFVDDYSRYTWFY  582


 Score = 64.3 bits (155),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 82/162 (51%), Gaps = 15/162 (9%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + +KL   N+I WR+Q+   +       ++D  + CP   ++P              
Sbjct  33    NHTLPVKLDRTNYILWRSQIDNVIFANGFEDFIDGTSICPEKDLSP--------------  78

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                 NPA+ AW +QD++ILS + SSL+  +M   +G  TS   W ++ +   SSSRAR +
Sbjct  79    -GVMNPAFVAWRRQDRTILSWIYSSLTPGIMAQIIGHNTSHSAWNALESIFSSSSRARIM  137

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                 +    ++G+ S ++Y+ + +   ++LA  G P+S  +Q
Sbjct  138   QLRLELQSTKKGSMSMIDYIMKIKGAADNLAAIGEPVSEQDQ  179



>gb|AAT85031.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF96679.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1437

 Score =   344 bits (882),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 202/525 (38%), Positives = 276/525 (53%), Gaps = 83/525 (16%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS+++  F  F+  VER F+R I ++Q D GGEY+K+H    K+GITH  SC +TH+Q
Sbjct  551   KYKSEVFDKFHEFQSLVERLFNRKIVAMQTDWGGEYQKLHSFFNKVGITHHVSCPHTHQQ  610

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GLALLA  S+  ++W  AF  A  LIN  P+ VL   SP  RL   
Sbjct  611   NGSAERKHRHIVEVGLALLAYSSMPLKFWGEAFLSAVYLINRTPSRVLHDVSPLERLLGH  670

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC C+P LRPYN+HK+++RS  C FL Y    +G++C++ ++G++YI R 
Sbjct  671   KPDYNALRVFGCACWPNLRPYNKHKLQFRSTTCTFLGYSTLHKGFKCLDPSTGRVYISRD  730

Query  1711  VHFYESIFLFS-------------------------------------------------  1679
             V F E+ F F+                                                 
Sbjct  731   VVFDETQFPFTKLHPNVGAKLRAEIALVPELAASLPRGLQQISSVINTPENANVSNENMQ  790

Query  1678  -DSTLCSQPVPPTIPWASEPVVTRAPCNTHAAP-----------TDSAHMS-LTSPVPLA  1538
              DST  ++P   T   A + V   AP  +  +P           +DSA  S  ++PV  A
Sbjct  791   QDSTYDNEPETET-DGAPDTVSANAPAESSGSPPINEPASPFGESDSATASPASAPVNSA  849

Query  1537  -------------------RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
                                 G P +AI+ P        +            +R   +  D
Sbjct  850   PHPDAAASGSSAPRGSTSQGGTPSVAIDDPHPATTVTGQEAQRPRTRLQSGIRKEKVYTD  909

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              + ++  L  T +P     A+ +  W+ AMD E+ AL+ N+TW LV  +   NV+ CKWV
Sbjct  910   GTVKWGMLTSTGEPENLQDALQNNNWKCAMDAEYMALIKNNTWHLVPPQQGRNVIDCKWV  969

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             ++ KR  DGS+++YKARLVAKGF Q  G D+ DTFS VVK  T+R++ S+ VS  W LRQ
Sbjct  970   YKIKRKQDGSLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWCLRQ  1029

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             LDV NAFL+G L E VYMKQPPGYE+P+ PD+V      ALYGL+
Sbjct  1030  LDVQNAFLHGVLEEEVYMKQPPGYENPSTPDYV-CKLDKALYGLK  1073


 Score =   145 bits (365),  Expect(2) = 5e-128, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 122/210 (58%), Gaps = 7/210 (3%)
 Frame = -1

Query  2868  DEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENN  2689
             D+Y G+D +   +GAG+ IS +G++ + + S+ LHL +VLYVPK +  L S Y+LT++N 
Sbjct  340   DKYHGNDQVHTASGAGMEISHIGNSVVKTPSRNLHLKDVLYVPKANKNLVSAYKLTSDNL  399

Query  2688  VFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHF-----AYLTSRATSTVWHRR  2524
              F E ++  F +KD   R  LLRG    GLY LP   SH       Y  ++ +   WH R
Sbjct  400   AFIELYRKFFFIKDLAMRRTLLRGRCHKGLYALPSPSSHHHQVKQVYGVTKPSFERWHSR  459

Query  2523  LGHPNAHVQNRVLQSCPVAPNKV-KSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTD  2347
             LGHP+  V  +V++S  +    V + +    +C  +K+ +    + +  SK  L+L+++D
Sbjct  460   LGHPSYTVVEKVIKSQNLPCLDVSEQVSVCDACQKAKSHQLSFPKSTSESKYPLELVFSD  519

Query  2346  IWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +WGPAP  S    +Y++ F+DDYS+F W Y
Sbjct  520   VWGPAPQ-SVGNNKYYVSFIDDYSKFTWIY  548


 Score = 58.9 bits (141),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (45%), Gaps = 10/159 (6%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             VS KL   N   W+ Q++  +RG  L G++  +   P P +       + V         
Sbjct  18    VSEKLGKSNHAVWKAQILATIRGARLEGHLTGDDQPPAPILRRKEGEKEVVVSNPE----  73

Query  3416  pnpAYRAWIKQDQsilsll-isslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSP  3240
                 Y  W+  DQ +L+ L  S   D ++ +A  RT +   W  I    GS +RAR ++ 
Sbjct  74    ----YEEWVATDQQVLAYLLSSMTKDLLVQVATCRTAASA-WSMIQGMFGSMTRARTINT  128

Query  3239  LGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDE  3123
                   L++G+ +   Y+G+ + L +DL   G P+  DE
Sbjct  129   RLSLSTLQKGDMNITTYVGKMRALADDLMAVGKPVDDDE  167



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score =   334 bits (856),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 272/482 (56%), Gaps = 36/482 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS+  KTF +F+ +VE QF   IKS+Q D GGE+R     L + GI HR SC +T +Q
Sbjct  619   RNKSEAIKTFVNFKTQVELQFDLKIKSLQTDWGGEFRAFQSYLAENGIVHRVSCPHTQQQ  678

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+R IVE GL LL   S+  ++WD +F     L N LPT++L  + P   L K+
Sbjct  679   NGVAERKHRTIVEHGLTLLHTASLPLKFWDESFRTVVYLSNRLPTAILHHKCPIEVLFKS  738

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+FL+VFGC C+P LRPYN HK++YRS  C FL Y    +GY+CM+ ++G++YI   
Sbjct  739   IPDYSFLKVFGCSCFPNLRPYNTHKLQYRSEECTFLGYSLKHKGYKCMS-SNGRVYISHD  797

Query  1711  VHFYESIFLFSDSTLCSQPVPPTI--------PWASEPVVTRAPCNTHAAPTDSAH----  1568
             V F E+ F +S +   S  +  T+        P AS PV++     T  +P  SA     
Sbjct  798   VIFNETSFPYSKTIQVSSCLLSTVSPSTSHLSPSASPPVLSPTMLPTPTSPISSARPISE  857

Query  1567  -MSLTSPVPLARG------LPPLAIEGPVQT---------APTRARAV*TQHQERGHVMR  1436
               ++ S  P A         P   +  PV T         A         +  +  H M 
Sbjct  858   MDNIVSTHPHAPNSADTTLTPAQVVSNPVATPVQHVVSSIADASVTRTIAKDADNTHPMI  917

Query  1435  LRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMN  1256
              R  +     +   +    +P+  S A+    W+ AM  E++AL  N+TW LV       
Sbjct  918   TRAKSGIVKPKIF-IAAIREPSSVSAALQQDEWKKAMVAEYDALQRNNTWSLVPLPAGRQ  976

Query  1255  VVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVS  1076
              +GCKWV++TK N DG++++YKARLVAKGF+Q AG DF +TFS VVKP+TVR++F++ +S
Sbjct  977   AIGCKWVYKTKENPDGTVQKYKARLVAKGFHQQAGFDFTETFSPVVKPSTVRVVFTIALS  1036

Query  1075  HNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SP  896
              NW ++QLDV+NAFLNG L E V+M+QP G+ D  +P+ V      ALYGL+      +P
Sbjct  1037  RNWAIKQLDVNNAFLNGDLQEEVFMQQPQGFIDEQNPNLV-CRLHKALYGLKQ-----AP  1090

Query  895   RA  890
             RA
Sbjct  1091  RA  1092


 Score =   147 bits (371),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 124/234 (53%), Gaps = 29/234 (12%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASI--PSESKLLHLSNVLYVPKLSVPLFSVYR  2707
             + +S E+ G + + VGNG GL I  +G +    P  SK L L+++L+VP ++  L SV +
Sbjct  386   LMKSAEFAGQNQVHVGNGTGLSIKHIGQSEFLSPFSSKPLLLNHLLHVPSITKNLLSVSK  445

Query  2706  LTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATST----  2539
                +N VFFEFH D   VKD +T+AVL+ G    GLY      SH A   +++ S     
Sbjct  446   FAKDNKVFFEFHSDSCFVKDQVTQAVLMVGKVRDGLYAF--DSSHLALRPTQSLSKSPSV  503

Query  2538  -------------------VWHRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLS  2419
                                +WH+RLGHP+A     VL  C VA  NK+ S    +SC L 
Sbjct  504   VASSFSSKVCTTSLSSTFDLWHKRLGHPSAATIKNVLSKCNVAHINKMDS-NFCSSCCLG  562

Query  2418  KASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K  RFP      +    L+L++ D+WGP  V+S SG+RY++ FVD +SRF W +
Sbjct  563   KIHRFPFSLSHTTYTKPLELIHLDLWGPTLVLSNSGYRYYIHFVDAFSRFSWIF  616



>emb|CAN59952.1| hypothetical protein VITISV_006720 [Vitis vinifera]
Length=1365

 Score =   355 bits (911),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 202/468 (43%), Positives = 270/468 (58%), Gaps = 43/468 (9%)
 Frame = -3

Query  2224  FESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVERKYR  2045
             F+ F+++VE QF   IK +Q D GGE+R     L + GI HR SC Y   QNGRVERK+R
Sbjct  539   FKQFKLQVENQFDAKIKCLQSDNGGEFRSFMSFLQESGILHRFSCPYNSSQNGRVERKHR  598

Query  2044  HIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRV  1865
             H+VETGLALLA   +  ++W +AF+ AT LIN +P+ VLQ  SPY  L K  P Y FLRV
Sbjct  599   HVVETGLALLAHAGLPLKFWSYAFQTATFLINRMPSKVLQNASPYFALFKRNPDYKFLRV  658

Query  1864  FGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFL  1685
             FGC CYP++RPYN HK++YRS  CVFL Y    +GY C++  +G++Y+  HV F E+ F 
Sbjct  659   FGCLCYPFIRPYNNHKLQYRSLKCVFLGYSLHHKGYLCLDNLTGRVYVSPHVVFDETQFP  718

Query  1684  FSDSTLCS-------QPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPV-------  1547
             F+ +   S       + V P I  +S P    +  + H +    A  +LTS +       
Sbjct  719   FAQNISSSPSKDASDESVIPAIIVSSNP----STLSFHGSNHSMASPNLTSALTHPTPPT  774

Query  1546  --PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTS---EQFHALNVT  1382
               P  R L    +E  V T P + + V         V   R  TR  S   ++ H  N+ 
Sbjct  775   DTPTTRSLREXVLEAEV-TLPAQQQVV---------VPPPRVTTRSMSGITKRKHIFNLA  824

Query  1381  ----TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNA  1214
                 ++PT   QA+    W +AM  E  AL  N TW LV     +N++GCKWV++ K   
Sbjct  825   AFKISEPTTLKQAIKDPNWAEAMQTEIAALHKNQTWDLVDPPKDVNIIGCKWVYKLKYKP  884

Query  1213  DGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAF  1034
             DGS+++YKARLVA+GFNQ  G D+F+TFS VVK  T+R++ ++ +S+ W LRQLDV N F
Sbjct  885   DGSVDRYKARLVARGFNQTFGLDYFETFSPVVKAATIRIVLTIALSYRWELRQLDVQNXF  944

Query  1033  LNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             LNG L E VYM  PPG+  P HP+ V      ALYGL+      SPRA
Sbjct  945   LNGDLVEQVYMAXPPGFLHPNHPNKV-CKLKKALYGLKQ-----SPRA  986


 Score =   122 bits (306),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 102/208 (49%), Gaps = 39/208 (19%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ +  YTG+D + +GNG  L IS  G   + S      L  V +VP +S  L SV +  
Sbjct  359   LTNATPYTGADKVTIGNGKHLTISNTGFTRLFSNPHSFQLKKVFHVPFISANLISVAKFC  418

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRL  2521
             ++NN   EFH + F VKD  T+ VL +G    GLY+ PV       +++R T+ V     
Sbjct  419   SDNNALIEFHSNGFFVKDLHTKRVLAQGKLENGLYKFPV-------ISNRKTAYV-----  466

Query  2520  GHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
                   + N     C    NK      R   H S                +L+L+YTDIW
Sbjct  467   -----GITNDSTFQCSTIGNK------RELWHHS----------------LLELVYTDIW  499

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             GPA V STSG +YF+LFVDDYSR+ W Y
Sbjct  500   GPASVTSTSGAKYFILFVDDYSRYTWLY  527


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 76/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  3590  IKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptpn  3411
             +KL   N+I WR+Q+   +       ++D  + CP   + P   +               
Sbjct  35    VKLDRTNYILWRSQIDNVIFANGFEDFIDGTSXCPEKELRPXEIN---------------  79

Query  3410  pAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLGQ  3231
             PA+ AW +QD++ILS + SSL+  +M   +G  +S   W ++     S SRAR +    +
Sbjct  80    PAFVAWRRQDRTILSWIYSSLTPGIMAQIIGHNSSHSAWNALEKIFSSCSRARIMQLRLE  139

Query  3230  FHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
             F   ++G+ S ++Y+ + +   + LA  G P+S  +Q
Sbjct  140   FQSTKKGSMSMIDYIMKVKGAADSLAAIGEPVSEQDQ  176



>emb|CAN81355.1| hypothetical protein VITISV_039158 [Vitis vinifera]
Length=1402

 Score =   317 bits (811),  Expect(2) = 8e-124, Method: Compositional matrix adjust.
 Identities = 181/458 (40%), Positives = 251/458 (55%), Gaps = 36/458 (8%)
 Frame = -3

Query  2224  FESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVERKYR  2045
             F+ F+++VE QF   IK +Q D GGE+R     L + GI HR SC Y   QNGRVERK+R
Sbjct  589   FKXFKLQVENQFEAKIKCLQXDNGGEFRSFMSFLQESGILHRFSCPYNSSQNGRVERKHR  648

Query  2044  HIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRV  1865
             H+VETGLALLA   +  ++W +AF+ AT LIN +P+ VL   SPY  L K  P Y FLRV
Sbjct  649   HVVETGLALLAHAGLPLKFWSYAFQTATFLINRMPSKVLXNASPYFALFKRNPDYKFLRV  708

Query  1864  FGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFL  1685
             FGC CYP++RPYN HK++YRS  CVFL Y    +GY C++  +G++Y+  HV F E+ F 
Sbjct  709   FGCLCYPFIRPYNNHKLQYRSLKCVFLGYSLHHKGYLCLDNLTGRVYVSPHVVFDETQFP  768

Query  1684  FSDSTLCSQPVPPTIPWASEPVVTR-------APCNTHAAPTDSAHMSLTSPVPLARGLP  1526
             F+ +   S    P+   + E ++         +  + H +    A  +LTS +       
Sbjct  769   FAQNISSS----PSKDASDESIIPXIIVSSNPSTLSFHGSNHSMASPNLTSTLTHPTSPT  824

Query  1525  PLAIEGPVQTAPTRARAV*TQHQE------RGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
                     +     A       Q+      R     +  +T+       A +  ++PT  
Sbjct  825   DTPTTRXSREPVLEAEVXLPAQQQVVVPPPRVTTRSMSGITKRKPIFNLAASKISEPTTL  884

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
              QA+    W +AM  E  AL  N TW LV     +N++GCKWV++ K   DGS+++YKAR
Sbjct  885   KQAIKDPNWAEAMHTEIAALHKNQTWDLVDPPKDVNIIGCKWVYKLKYKXDGSVDRYKAR  944

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVY  1004
             LVA+GFNQ  G D+F+TFS VVK  T+R++ ++ +S+ W LRQLD             VY
Sbjct  945   LVARGFNQTFGLDYFETFSPVVKAATIRIVLTIXLSYRWELRQLD-------------VY  991

Query  1003  MKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             M QPPG+  P HP+ V      ALYGL+      SPRA
Sbjct  992   MAQPPGFLHPNHPNKV-CKLKKALYGLKQ-----SPRA  1023


 Score =   158 bits (400),  Expect(2) = 8e-124, Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 121/220 (55%), Gaps = 13/220 (6%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ +  YTG+D + +GNG  L IS      + S      L  V +VP +S  L SV +  
Sbjct  359   LTNATPYTGADKVTIGNGKHLTISNTXFTRLFSNPHSFQLKKVFHVPFISANLISVAKFC  418

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV-SRSHFAYLTSRATST-----  2539
             ++NN   EFH + F +KD  T+ VL +G    GLY+ PV S    AY+     ST     
Sbjct  419   SDNNALIEFHSNGFFLKDLHTKRVLAQGKLENGLYKFPVISNKKTAYVGITNDSTFQCSN  478

Query  2538  ------VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSS  2377
                   +WH RLGH    +  R++ +C V+  K K+    +SC L+K+ R P    S+ +
Sbjct  479   IENKRELWHHRLGHAATDIVTRIMHNCNVSCGKYKATVC-SSCQLAKSHRLPTHLSSFHA  537

Query  2376  KNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                L+L+YTDIWGPA V STSG +YF+LFVDDYSR+ W Y
Sbjct  538   SKPLELVYTDIWGPASVTSTSGAKYFILFVDDYSRYTWLY  577


 Score = 54.3 bits (129),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 75/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  3590  IKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptpn  3411
             +KL   N+I WR+Q+   +       ++D  + CP   + P                  N
Sbjct  35    VKLDRTNYILWRSQIDNVIFANGFEDFIDGTSVCPEKELRP---------------GEIN  79

Query  3410  pAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLGQ  3231
             PA+ A  +QD++ILS + SSL+  +M   +G  +S   W ++     S SRAR +    +
Sbjct  80    PAFVAXRRQDRTILSWIYSSLTPGIMAQIIGHNSSHSAWNALEKIFSSCSRARIMQLXLE  139

Query  3230  FHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
             F   ++G+ S ++Y+ + +   + LA  G P+S  +Q
Sbjct  140   FQSTKKGSMSMIDYIMKVKGAADSLAAIGEPVSEQDQ  176



>emb|CAN65942.1| hypothetical protein VITISV_001716 [Vitis vinifera]
Length=1319

 Score =   340 bits (873),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/471 (41%), Positives = 265/471 (56%), Gaps = 35/471 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F+++VE QF   IK +Q D GGE+R     L + GI HR SC Y   Q
Sbjct  523   QTKDQALPAFKKFKLQVENQFDAKIKCLQSDNGGEFRSFKTFLQQTGIFHRFSCPYNSAQ  582

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NGRVERK+RH+VETGLALLA  S+  ++W +AF+ AT LIN +P+ VLQ  SPY  L + 
Sbjct  583   NGRVERKHRHVVETGLALLAHASLPMEFWQYAFQTATFLINRMPSKVLQNNSPYFTLFQK  642

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP++RP N HK++YRS   +FL Y    +G+ C++  +G++YI  H
Sbjct  643   VPNYKSLRVFGCLCYPFIRPCNSHKLQYRSVQSLFLGYSLHNKGFLCLDFLTGRVYITPH  702

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASE----PVVTRAPCNTHAAPTDSAHM-------  1565
             V F E  F  +     + P+ PT   +++     ++T  P  T  +              
Sbjct  703   VVFDEGQFPLAK----THPLSPTKDTSTDTLTPAIITSFPFLTFCSNGSHTSSLSSSPST  758

Query  1564  -----SLTSP-VPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ  1403
                  S++SP V  A    P AI      +P+ A         R     +R +T+  +  
Sbjct  759   SEASDSVSSPTVTPASSTLPEAIYEDQPPSPSPA--------PRMTTRLMRGITKKKTIL  810

Query  1402  FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTK  1223
               ++   ++P    QA+    W  AMD E  AL  N TW LV     +N++GCKWV++ K
Sbjct  811   NLSVVKISEPYTLKQALKDPNWIQAMDLEIAALHRNQTWDLVEQPSEVNLIGCKWVYKLK  870

Query  1222  RNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVH  1043
                DGSIE+YKA+LVAKG+NQ  G D+F+TFS VVK  T+R++ ++ +S  W +RQLDVH
Sbjct  871   HKPDGSIERYKAQLVAKGYNQTHGLDYFETFSPVVKAATIRIILTMALSFQWEIRQLDVH  930

Query  1042  NAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             NAFLNG L E VYM QPPGY D T P  V      ALYGL+      +PRA
Sbjct  931   NAFLNGELEEQVYMSQPPGYLDTTFPTKV-CRLKKALYGLKQ-----APRA  975


 Score =   133 bits (334),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 109/212 (51%), Gaps = 32/212 (15%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ S  YTG+D + +GNG  L IS  G   +  +S+  HL  V +VP +S  L SV +  
Sbjct  339   LTSSSPYTGTDKVTIGNGKHLSISNTGSHRLLXDSRSFHLKKVFHVPFISANLISVAKFC  398

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRL  2521
             ++NN   EF  + F VKD  T+ VL +G    GLYR PV  S                  
Sbjct  399   SDNNALIEFXSNSFFVKDLHTKKVLAQGKLENGLYRFPVLNSK-----------------  441

Query  2520  GHPNAHVQNRVLQSCPVAPNKVKSLGSRT---SCHLSKASRFPLDRVSYSSKNVLDLLYT  2350
                         +SC V+  K ++    T   SC L+K+ R P       +   L+L++T
Sbjct  442   ------------KSCNVSFEKNQNTVCSTVCSSCQLAKSHRLPTHLSLSCASKPLELVHT  489

Query  2349  DIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             D+WGPA V STSG RYF+LF++DYS++ WFYP
Sbjct  490   DLWGPASVKSTSGARYFILFLNDYSQYTWFYP  521


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 82/164 (50%), Gaps = 19/164 (12%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQL--VPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdat  3432
             +H + +KL   N+I W++Q+  V F  G E   ++D+ + CP   +     SG       
Sbjct  33    NHTLPVKLDRTNYIMWKSQIDNVDFANGFE--DFIDESSICPDKELN----SG-------  79

Query  3431  taaptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRAR  3252
                   NPA+ AW +QD++ILS L SSL+  +M   +G  +S   W ++     SSSRAR
Sbjct  80    ----LINPAFVAWRRQDRTILSWLYSSLTPAIMAQIIGHNSSHSAWNALEKTFSSSSRAR  135

Query  3251  CLSPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
              +    +    ++G+ S ++Y+ + +   + LA  G P    +Q
Sbjct  136   IMQLRLELQSTKKGSLSMIDYIMKVKGAADSLAAIGEPXXEQDQ  179



>gb|AAN04167.1| Putative copia-like retrotransposon polyprotein [Oryza sativa 
Japonica Group]
 gb|AAP53032.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1042

 Score =   339 bits (870),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 193/475 (41%), Positives = 268/475 (56%), Gaps = 37/475 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+++ F  F+  VER F R I ++Q D GGEY+K++    K+GI+H  SC +TH+QNG
Sbjct  448   KSDVFEKFHDFQQLVERLFDRKIIAMQTDWGGEYQKLNSFFEKIGISHHVSCPHTHQQNG  507

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+R IVE GLALLA  S+  +YWD AF  AT +IN +P+ +LQ+++P   L     
Sbjct  508   SAERKHRLIVEVGLALLAYASMPLKYWDEAFLAATHIINRIPSRILQYDTPLECLFNHKL  567

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+  R+FGC C+P LRPYN HK+++RS  CVFL    +  GY+C+++ +G+IYICR V 
Sbjct  568   DYSSFRIFGCACWPNLRPYNAHKLQFRSMQCVFLGPSHTHNGYKCLDIATGRIYICRDVV  627

Query  1705  FYESIFLFSD-STLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGL  1529
             F E++F  S   +     +   I      +++     +H     + HM     V   +  
Sbjct  628   FDENVFPLSKFHSNAGSRLRSEIALLPSHLLSHT---SHQGGEHNNHMLDFYNVSSDQTD  684

Query  1528  PPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHM-----TRDTSEQ-------------  1403
                 I+G   T  T        H+ R  VM+  H      T  T +Q             
Sbjct  685   ENADIDGGNTTDTTNDDLGNQLHELRSSVMQDMHFGGEAATHATEDQSMVAAKPRTRLQS  744

Query  1402  -FHALNVTTDPT----CYS---------QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP  1265
                   V TD T    C++         +A+    W+ AMD E+ AL+ N TW LV  + 
Sbjct  745   GIRKEKVYTDGTVKYSCFTSSGEPQNLHEALNDKNWKHAMDSEYTALMKNKTWHLVPAKS  804

Query  1264  HMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSL  1085
               NV+ CKWV++ KR ADGS+++YKARLVAKGF Q  G D+ DTFS VVK  T+R++ S+
Sbjct  805   DRNVIDCKWVYKIKRKADGSLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRVILSI  864

Query  1084  VVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              VS  W+LRQLDV NAFL+G L E VYM+QP GYE  + P+HV      ALYGL+
Sbjct  865   AVSRGWSLRQLDVSNAFLHGILEEEVYMRQPLGYEVSSLPNHV-CKLDKALYGLK  918


 Score =   134 bits (337),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 112/206 (54%), Gaps = 8/206 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G D +   +GAG+ I  +GHA + + ++ LHL+NVL+VP+ +  L S  +L ++N+VF
Sbjct  242   YKGHDQIHTASGAGMKIKHIGHAIVHTPTRPLHLNNVLHVPQAAKNLISATKLASDNSVF  301

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAH  2503
              E H   F++KD  TR+ +L+G    GLY LP + S         +   WH RLGHP+  
Sbjct  302   VEIHSKYFLIKDRTTRSTVLKGPRRHGLYPLPSTSSTKQAFAVAPSLERWHSRLGHPSIP  361

Query  2502  VQNRVLQS----CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGP  2335
             +  +V+ S    C    NK        +C  +K+ + P       S   L+L+Y+D+WGP
Sbjct  362   IVMKVISSNKLPCLRESNKESVC---DACQKAKSHQLPYSNSMSVSNKPLELIYSDVWGP  418

Query  2334  APVISTSGFRYFLLFVDDYSRFCWFY  2257
             A   S  G ++++ F+D Y +F W Y
Sbjct  419   AST-SFGGKKFYVSFIDSYRKFSWIY  443



>emb|CAN71553.1| hypothetical protein VITISV_034738 [Vitis vinifera]
Length=1312

 Score =   374 bits (961),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 198/450 (44%), Positives = 270/450 (60%), Gaps = 12/450 (3%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K  ++ TF  F+  VE QF  +IK +Q + GGE+  +   L+  GI HR SC YT EQNG
Sbjct  504   KDQVHSTFVQFKTLVENQFQTTIKCLQTBHGGEFIALXKFLSLHGILHRFSCPYTPEQNG  563

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK RH+VETGL LL   ++  ++W +AF  A  LIN +P+ +L + SP++ L+K PP
Sbjct  564   RVERKMRHVVETGLTLLYTATLPSKFWXYAFTTAVTLINCMPSPLLNYSSPFSLLYKHPP  623

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y   +VFGC CYP+L+  N +K + RS PC+FL Y PS +GY C+N T+ ++YI RHV 
Sbjct  624   DYFHFKVFGCLCYPHLKHLNSNKFQPRSTPCIFLGYAPSHKGYLCLNPTTNRVYISRHVV  683

Query  1705  FYESIFLFSDSTLCSQ-----PVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             F E+ F F   +  SQ     PV P  P    P++   P  T +     +  + TSP   
Sbjct  684   FAETTFPFQALSXPSQQSXHIPVTPXFPLPPSPIL--FPPTTSSXLATPSEXAPTSPPAS  741

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQER---GHVMRLRHMTRDTSEQFHALNVTTDPT  1370
             +  LPPL I+ P             Q       GH M  R  +    ++ +  ++T +P 
Sbjct  742   SLSLPPL-IQVPFVDEAAETPTTSLQDSTAPIPGHPMITRSKSGICKKKTYLTSLTIEPR  800

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
                QA+    W+ AM+QE+ ALL N TW LV    +  ++GCKWVF+ K   +GSI++YK
Sbjct  801   TVKQALQDPNWKVAMEQEYQALLKNQTWSLVPPPSNAKIIGCKWVFKLKHKPNGSIDRYK  860

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVA+GF+Q  G DFF+TFS VVKP T+RL+ S+ VS NW ++QLDVHNAFLNG L E 
Sbjct  861   ARLVAQGFHQTYGIDFFETFSPVVKPCTIRLVLSIAVSSNWPIKQLDVHNAFLNGDLQEQ  920

Query  1009  VYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V+M QPPG+ED + P HV      ALYGL+
Sbjct  921   VFMMQPPGFEDNSCPTHV-CRLQKALYGLK  949


 Score = 95.5 bits (236),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 72/162 (44%), Gaps = 52/162 (32%)
 Frame = -1

Query  2715  VYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR--------SHFAYL  2560
             V +   +NN   EFH   F VKD  T+  LL+G    GLY+ P S          H  +L
Sbjct  381   VSKFCTDNNTILEFHPSSFFVKDKDTKVTLLQGQLERGLYKFPTSSISSPTASPKHQVFL  440

Query  2559  T-SRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSY  2383
             T ++ T+ +WH+R GHP+  +  ++                                   
Sbjct  441   TKTQPTTMLWHQRFGHPSGVILQKI-----------------------------------  465

Query  2382  SSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                      +T +WGPAPV S++G RYFLL +DDYSRF WFY
Sbjct  466   --------FHTYLWGPAPVPSSTGARYFLLLMDDYSRFVWFY  499


 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 77/162 (48%), Gaps = 15/162 (9%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N I W TQ+   +       +++   PCPP TI+    + D        
Sbjct  26    NHPLPIKLDRDNHILWHTQMENVIYANGFEDHIEGLRPCPPKTISTGEVNPD--------  77

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                    +  W + D+ ILS + SSL+ EVM   VG  TS   W ++  +  +S++AR +
Sbjct  78    -------FLVWRRYDRMILSWIYSSLTPEVMGQIVGLQTSHEAWTALQRSFSASTKARTM  130

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                  F   ++G+ + +EY+ + + + + LA  G P+   +Q
Sbjct  131   QLRLAFQTTKKGSLTMMEYIQKLKHISDSLAAIGEPVPEKDQ  172



>emb|CAN63649.1| hypothetical protein VITISV_037657 [Vitis vinifera]
Length=1131

 Score =   325 bits (833),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/411 (42%), Positives = 232/411 (56%), Gaps = 64/411 (16%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K      F  F+V +E QF   ++ +Q + GGE++   +TL K GI HR SC  T +QNG
Sbjct  532   KDQAISGFLQFKVMIETQFDTKVRMLQTNWGGEFQAFTNTLCKFGILHRVSCPSTSQQNG  591

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK+RH+VE GL+LLA  S+  +YW FAF+ A  LIN LP+SVL F SPY  L+   P
Sbjct  592   RVERKHRHVVEVGLSLLAHASIPLKYWPFAFQSALYLINRLPSSVLNFSSPYKTLYHCLP  651

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+FLRV+GC CYP+LRP+NRHK  YRS  C F+ Y    +GY C+N+++GKI+I RHV 
Sbjct  652   NYSFLRVYGCTCYPFLRPFNRHKFAYRSVKCTFIGYSSKHKGYLCLNMSNGKIHISRHV-  710

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLP  1526
                                        P+ T  P ++H                      
Sbjct  711   --------------------------APIPTAQPSSSH----------------------  722

Query  1525  PLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGH  1346
                +  P     TRA         +  + + +     T   FH L    +P  + +AV  
Sbjct  723   ---VPSPCHPMTTRA---------KNGIFKPKIFLSPTKTIFHPL---CEPNSFKEAVKV  767

Query  1345  L*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGF  1166
               W+ AM  EF AL+ N TW LV   P+ N++GC WV++ K   DG++E+YKARLVAKGF
Sbjct  768   PEWQQAMHLEFEALMSNKTWVLVPPPPNQNIIGCHWVYKLKYKPDGTVERYKARLVAKGF  827

Query  1165  NQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             +Q    D+F+TFS VVKPTT+R++ SL +S NW++RQLDVHNAFLNG L+E
Sbjct  828   HQTPSFDYFETFSPVVKPTTIRVVLSLALSKNWSIRQLDVHNAFLNGDLSE  878


 Score =   142 bits (357),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 119/226 (53%), Gaps = 45/226 (20%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             + GSD + VGNG  L IS +GH++I S S+ L+L N+L+VP+L+  L SV RL  +NNV 
Sbjct  323   FAGSDKVMVGNGNRLNISNIGHSTISSVSRSLNLKNILHVPQLTTNLISVNRLCTDNNVT  382

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAY-------LTSRATST-----  2539
              EF  + F+VKD  ++  LL+G+ + GLY+L  S     Y       L  R + T     
Sbjct  383   VEFFTNGFVVKDQASKKALLQGNLNYGLYKLSSSTPSRRYQDPDDNKLAGRTSLTTEVPC  442

Query  2538  ------------VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLD  2395
                         +WH RLGHP      RV + C +A                K+ R P  
Sbjct  443   MSSTLQLSNKADLWHFRLGHP-----ARVCEPCQMA----------------KSHRLPFT  481

Query  2394  RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                  +     L+++D+WGPAPV+ T+G RYF+LFVDD++RF W Y
Sbjct  482   LSESRASQPFALVHSDLWGPAPVVGTNGARYFVLFVDDHTRFSWLY  527



>emb|CAN65591.1| hypothetical protein VITISV_042091 [Vitis vinifera]
Length=1427

 Score =   323 bits (829),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/499 (39%), Positives = 273/499 (55%), Gaps = 58/499 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+Y  F  ++  VE+ F+ S+ ++  D G EY+ +       GI H+ S  YT E  G
Sbjct  550   KSDVYTIFPKYKSMVEKYFNASLVTLYTDGGTEYKSLKSYFISQGIQHQVSPPYTPEHVG  609

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RH+VETGLA+L + S+  +YW +AF  A  LIN LPT +L+ +SP+  L +  P
Sbjct  610   SAERKHRHVVETGLAMLHKASLPLKYWSYAFLAAAYLINRLPTPILKHQSPFESLFQHMP  669

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LR FGC C+P++RPY+ HK++ RS PCVFL Y  +   Y+C++L+S ++YI RHV 
Sbjct  670   NYDKLRAFGCLCFPWMRPYSDHKLDKRSKPCVFLGYSNTHNAYKCLDLSSNRVYISRHVQ  729

Query  1705  FYESIFLFSDSTL-------------CS------QPVPPTIPWASEPVVTRAPCNTHAAP  1583
             F E  F F+ +T              CS      QP    +P +S+    +AP  T+  P
Sbjct  730   FIEHKFPFASNTTPTDLBQAISTWSSCSPALAAIQPSFFVVPTSSKSFPHQAPSCTNTGP  789

Query  1582  TDS-----------------AHMSLTSPVP---LARGLPPLAIEGPVQTAPTRARAV*TQ  1463
                                 A +S     P   L+    P++ +    ++P+ + +  TQ
Sbjct  790   NQELISSLSPTSSSPPTTASAPLSACDAPPRYDLSLSSLPVSFDSSNISSPSLSLSPPTQ  849

Query  1462  HQERGHVMRLRH--MTRDTS-----EQF-----------HALNVTTDPTCYSQAVGHL*W  1337
              Q    +    H  +TR  +     +QF           H L  + +PT  SQA+    W
Sbjct  850   PQGSNPLPEPSHRIVTRSQNNIHCPKQFPDFKTSFHVTKHPLPXSLEPTTASQALKDPKW  909

Query  1336  RDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQV  1157
                MD E  AL  N TW LV    + N+VGCKWVFR KRN DGSI +YKARLVAKGF+Q 
Sbjct  910   CAXMDDELAALARNCTWVLVPPPSNHNIVGCKWVFRIKRNPDGSISRYKARLVAKGFHQR  969

Query  1156  AGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYED  977
              G D+ DTFS VVKPTT+R++ S+ +S+ W + QLDV+N FL+G L E VYM QPPGY D
Sbjct  970   PGVDYHDTFSPVVKPTTIRVVLSIALSNXWXISQLDVNNXFLHGTLTEDVYMAQPPGYVD  1029

Query  976   PTHPDHVRVSSSTALYGLR  920
               +P HV      ALYGL+
Sbjct  1030  QANPTHV-CRLQKALYGLK  1047


 Score =   130 bits (328),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 114/219 (52%), Gaps = 10/219 (5%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    Y G D + +G+G+GL I+  G + +P+ SK   LSNVL  P +   L SV +  
Sbjct  328   LSHQQPYEGPDDILLGDGSGLEITHTGSSKLPATSKSFCLSNVLCXPSIKQNLISVSKFC  387

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTV-----  2536
               NN   EF    F++KD  T A L +G +   +Y  P         TS   + V     
Sbjct  388   KTNNTSIEFFPSSFVIKDLKTGARLTQGRSKDDVYEWPWPNKGNTLGTSPKQACVSVKTS  447

Query  2535  ---WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASRFPLDRVSYSSKN  2371
                WH RLGHP++ +   +++   +     +S  +    SC  +K+ + P    S  S+ 
Sbjct  448   LANWHHRLGHPSSRIFQFLIRKHNLQIYPTESFHNFFCESCLCNKSHKLPFGVSSLRSRG  507

Query  2370  VLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              LDL+Y+D+WGP+P+ S  GFRY+L+F+D ++++ W +P
Sbjct  508   XLDLVYSDVWGPSPIESIDGFRYYLIFIDYFTKYVWLFP  546



>emb|CCH50966.1| T4.5 [Malus x robusta]
Length=1670

 Score =   304 bits (778),  Expect(2) = 7e-114, Method: Compositional matrix adjust.
 Identities = 189/495 (38%), Positives = 266/495 (54%), Gaps = 78/495 (16%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KSD++ T ++F ++++      ++SI+ D GGE+  + +     + GITH+ SC +T EQ
Sbjct  830   KSDVFSTLKTFILKLQTLLDLQVQSIRSDSGGEFLNKSLQSFFNEQGITHQLSCLHTSEQ  889

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLP--TSVLQFESPYTRLH  1898
             NG  ERK+RH+VE G  LL++  +  Q+W  AF+    LIN LP  +SV+   SP+  L 
Sbjct  890   NGCAERKHRHVVEMGRTLLSQSDLPTQFWVEAFQTVVYLINRLPPQSSVI---SPWELLF  946

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y  L+ FGC CYP+L+PY+R K++++S  CVFL Y  +  GYRC +  S ++YI 
Sbjct  947   HASPKYHTLKAFGCACYPWLQPYSRDKLDFKSKQCVFLGYSLNHSGYRCWDPISNRLYIS  1006

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAH----MSLTSP  1550
             RHV F ES+F +   +L SQ                    +H +P  S+     MSL  P
Sbjct  1007  RHVVFDESLFPYK--SLSSQA-------------------SHHSPCVSSPLHPPMSLHLP  1045

Query  1549  VPLA----RGLPPLAIEGPVQTAPT-----RARAV*TQHQE-------------------  1454
             +P++    +  P  A+EG   + P+         + +  QE                   
Sbjct  1046  LPVSHLEQQSSPAAALEGRNASPPSIFSTAAHTTIPSSAQESLHTPPVSSSPAEPPPLPP  1105

Query  1453  ----RGHVMRLR-----HMTRDTSEQFHALNVTTD--------PTCYSQAVGHL*WRDAM  1325
                   H M  R     H  +  +   H L  T D        P+ + QA     W +AM
Sbjct  1106  PIPVNTHTMITRAKAGIHKPKVFTATKHQLPSTVDSLTALPPTPSTFLQASKSSHWMEAM  1165

Query  1324  DQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDD  1145
               EF AL    TW+LV +    N+VGCKWVF+ K   DG+IE+YKARLVAKGF+Q  G D
Sbjct  1166  QFEFQALQSTGTWELVPNHSTYNIVGCKWVFKVKHKPDGTIERYKARLVAKGFHQQEGLD  1225

Query  1144  FFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHP  965
             F +TFS V KPTT+R+L S+ VS+ W + QLDV NAFL+GHL E VYM QPPG+ DP+ P
Sbjct  1226  FSETFSPVAKPTTIRILLSIAVSYYWFIHQLDVSNAFLHGHLKEDVYMVQPPGFVDPSKP  1285

Query  964   DHVRVSSSTALYGLR  920
              HV      +LYGL+
Sbjct  1286  HHV-CKLRKSLYGLK  1299


 Score =   137 bits (346),  Expect(2) = 7e-114, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 121/222 (55%), Gaps = 12/222 (5%)
 Frame = -1

Query  2886  SMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYR  2707
             S ++ +  Y+G+D L VG+G GL IS  G A I ++     L++VL VP+ S  L SVY+
Sbjct  606   SALNSAIPYSGNDQLFVGDGKGLCISHTGSALIRTKHATFRLNDVLLVPQASHNLLSVYK  665

Query  2706  LTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL---------PVSRSHFAYLTS  2554
                +N  +  F    F VKD  T  +L +G + GGLY            ++ S  A + +
Sbjct  666   FVYDNWCYLTFDPFGFYVKDLSTGKMLFQGPSEGGLYPFYWNASNGVSGIAISPTALMIA  725

Query  2553  RATSTVWHRRLGHPNAHVQNRVLQS--CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYS  2380
             +A    WHRRLGHP+    + V+     PV    V ++   T+C L K+ R     +  +
Sbjct  726   KADIHTWHRRLGHPSGGTLHSVVHKNHLPVI-GYVNNMSVCTACQLGKSYRLSFSTLPCT  784

Query  2379  SKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             S   L LL+TD+WGP+P  S +G+R++L+ VDD++++ W YP
Sbjct  785   SSRPLQLLHTDVWGPSPTSSCTGYRFYLIIVDDFTKYSWLYP  826


 Score = 72.8 bits (177),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 82/156 (53%), Gaps = 11/156 (7%)
 Frame = -2

Query  3599  FVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaap  3420
              V  KL  +N+I WR+  +P L+  +L+G V+ E  CPPP +     SG  VP+A+    
Sbjct  273   MVPTKLNRQNYITWRSLFIPVLKRFKLIGLVNGEDLCPPPFVR--DPSGTCVPNAS----  326

Query  3419  tpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSP  3240
                  +  W ++DQ ++  + S+LS +++ L +G   SR +W+S+      +SR    S 
Sbjct  327   -----FETWCERDQILMIWINSTLSKDLLPLTIGMEDSRSLWQSLERRFSGASRTHVHSL  381

Query  3239  LGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPIS  3132
               +   + +G+SS  ++L   + +   LA AG P+S
Sbjct  382   RSKIQTIHKGDSSMTDFLNSIKEISNKLAAAGEPLS  417



>gb|KFL89552.1| hypothetical protein AmDm5_1575 [Acetobacter malorum]
Length=1375

 Score =   308 bits (788),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 195/507 (38%), Positives = 263/507 (52%), Gaps = 65/507 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R KS++++ F  F   +  QFS S+K+ Q D GGEY   +    L   GI H KSC +T 
Sbjct  656   RNKSEVFQVFVHFHAFISTQFSTSVKTFQSDGGGEYCSTRFQQFLLDKGIIHHKSCPHTP  715

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNG  ERK+ HIVET L LL+   +  Q+W  A  ++  LIN +P S L  +SPYT L 
Sbjct  716   EQNGLAERKHMHIVETALTLLSTAQLPPQFWFHACAISVYLINRMPCSTLSMKSPYTCLF  775

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
               P   T L+VFG  CYP L+PYN +K++ ++  C+FL Y   ++GY C N  SG+ Y+ 
Sbjct  776   AQPSALTHLKVFGYSCYPLLKPYNTNKLQPKTVQCIFLGYAGQYKGYICFNPLSGRFYVS  835

Query  1717  RHVHFYESIF----LFSDSTLCSQPV---PPTI-PWASEPVVTRAP--CNTHAA------  1586
             RHV FYE+ F    L    + CS PV   PP+I P  +   V  +P    +HA+      
Sbjct  836   RHVVFYETNFPYKHLLVKPSQCS-PVFVTPPSITPLVTGQNVVVSPHTSASHASLPLSQP  894

Query  1585  ---------PTDS--------------------------AHMSLTSPVPLARGLPPLAIE  1511
                      PT +                          A  SLTS  P      P + +
Sbjct  895   TRASEFLHEPTSASEFLASPIRVPEFSSSSPPLPDPIYHASESLTSLSPTVPASSP-STQ  953

Query  1510  GPVQTAPT----RARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT------DPTCYS  1361
              PV   P         V   H    H M+ R  +    ++    ++++      +P+ + 
Sbjct  954   SPVPADPDFQPENLTIVLPVHSVSLHPMQTRSKSGIIKKKAFVASISSVGQSDVEPSTFK  1013

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
              A   + W+ AM  E +AL    TW LV      N+VGCKWV+R K+N DGSI +YKARL
Sbjct  1014  AASKIVEWQSAMQDEIDALHAQHTWDLVPLPSGKNLVGCKWVYRVKKNPDGSIARYKARL  1073

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VAKG+NQ  G D+ +TFS VVKPTTVRL+ +L     W+LRQLDV NAFL+G L E +YM
Sbjct  1074  VAKGYNQEEGIDYGETFSPVVKPTTVRLILALAAQFRWSLRQLDVKNAFLHGDLHEEMYM  1133

Query  1000  KQPPGYEDPTHPDHVRVSSSTALYGLR  920
              QPPG+  P HP H       +LYGL+
Sbjct  1134  SQPPGFGSPHHPSHFVYKLHKSLYGLK  1160


 Score =   131 bits (330),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 121/226 (54%), Gaps = 17/226 (8%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++Q+  + G+D +   +G+GL IS  G + +        L ++L+VP++S  L S+Y+L 
Sbjct  429   LTQATPFLGADTITTASGSGLPISHTGSSFLHVPQYAFQLKDILHVPQISQHLLSMYKLC  488

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLP-----------------VSRSH  2572
              +NN  F   + CF ++D IT  +LL+G    GLY +P                 ++ + 
Sbjct  489   KDNNCRFICDEFCFWIQDKITGTILLQGLCRDGLYPIPFHIPQHILPKASHTSHSLTNNQ  548

Query  2571  FAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDR  2392
               +L     +++WH RLGHP+  V + +L    ++ +   S     SC   K ++ P   
Sbjct  549   TCFLGHHINTSLWHNRLGHPSNAVVSTMLNQSQISFSVDPSKHVCISCLEGKCTKLPFSF  608

Query  2391  VSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              ++ S    ++L++D+WGP+P +S  G+++++LF+D+ +RF W +P
Sbjct  609   PAHKSVKPFEVLHSDVWGPSPTMSVEGYKFYVLFIDECTRFTWIFP  654



>gb|KHN36156.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1417

 Score =   331 bits (848),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 191/483 (40%), Positives = 268/483 (55%), Gaps = 39/483 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KSD  K F  F+  ++ QF  SIK+IQ D GGE+R     L +LGI HR +C +T  Q
Sbjct  594   KAKSDALKAFTQFKALIQNQFQASIKAIQSDWGGEFRAFTALLNELGIQHRLTCPHTSHQ  653

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQ-FESPYTRLHK  1895
             NG VERK+RHIVE GL LL+  ++  ++WD +F  A  LIN LP+S +  F+SPY  LH+
Sbjct  654   NGTVERKHRHIVEMGLTLLSHAALPLKFWDHSFTQAVYLINRLPSSAIPLFQSPYHALHQ  713

Query  1894  TPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
             + P Y+ ++VFGC C+P+LRPYN HK++YRS+PCV+L   P  +G++C++ T G+IYI +
Sbjct  714   SQPDYSQIKVFGCLCFPHLRPYNNHKLQYRSSPCVYLGVSPQHKGHKCLDAT-GRIYISK  772

Query  1714  HVHFYESIF----LFSDS--------TLCSQPVPPTIPWASE--PVVTRAPCNTHAAPTD  1577
              V F+ES F    LF+ S        T  +Q + P++   +   P  + AP      P  
Sbjct  773   DVIFHESQFPYLSLFASSSSNSHMSHTYPAQILFPSVNTNTNLHPETSSAPDTDPPDPVS  832

Query  1576  S--AHMSLTSPVPLARGLPPLAIEGPVQT------------APTRARAV*TQHQERGHVM  1439
                  +S +S  PL        I  P+ T             P    A         H M
Sbjct  833   PLPGSVSPSSSTPLTISQINSLISQPISTTSPSVPTPPADPVPAIRPASQNISHHNAHPM  892

Query  1438  RLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHM  1259
               R  T +   +        +P     A+    W  AM  E+ AL+ N TW LV    H 
Sbjct  893   ITRAKTGNLKPKVFV--AALEPKSVKSALNDPAWLQAMQAEYKALMDNQTWTLVPLPQHR  950

Query  1258  NVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
               +GCKW+FR K N DG++ ++KARLVAKGF Q AG DF +TFS V+KP T+R++ +L V
Sbjct  951   KAIGCKWIFRVKENPDGTVNKFKARLVAKGFLQTAGFDFTETFSPVIKPITIRIILTLAV  1010

Query  1078  SHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*S  899
             +  W+++Q+DV+NAFLNG L E VYM QP G+E        ++  S  LYGL+      +
Sbjct  1011  TFKWSVQQIDVNNAFLNGILQEEVYMTQPAGFEASDKSLVCKLHKS--LYGLKQ-----A  1063

Query  898   PRA  890
             PRA
Sbjct  1064  PRA  1066


 Score =   108 bits (269),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 117/251 (47%), Gaps = 50/251 (20%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASI--PSESKL-LHLSNVLYVPKLSVPLFSVY  2710
             +S S  YTG D + +GNG G+ I  +G +    P+E  + L L ++L+VP +S  L SV 
Sbjct  348   LSYSSPYTGQDQVVMGNGQGVSIHSLGQSQFHSPNEPNVKLTLKDLLHVPNISKNLLSVS  407

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGST-SGGLYRLPVSRSHFAYLTSRATS---  2542
             +   +NNV FEFH     VK   ++ VLL G+  + GLY+       F +LT+   +   
Sbjct  408   KFAQDNNVIFEFHPYHCFVKYQDSKQVLLEGTVGADGLYQF----KPFKFLTNSGAASNS  463

Query  2541  ---------------------------------TVWHRRLGHPNAHVQNRVLQSCPVA-P  2464
                                               +WH RLGH +      +L  C +   
Sbjct  464   DSSSMSSSSQFSVFNNPVNCNNTVSVMQNGNVFQMWHLRLGHAHTSAVKNILNLCNIPFS  523

Query  2463  NKVKSLGSRTSCHLSKASRF--PLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLF  2290
             NK  +L   T C + K+ R   PL    Y+     ++++ D+WGPAP +S  G+ Y++ F
Sbjct  524   NKTATLPC-TFCCMGKSHRLHSPLSNTVYTKP--FEVIHCDLWGPAPFVSYYGYSYYITF  580

Query  2289  VDDYSRFCWFY  2257
             VD Y++F W Y
Sbjct  581   VDTYTKFTWIY  591



>gb|KHN22040.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1417

 Score =   329 bits (843),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/483 (39%), Positives = 267/483 (55%), Gaps = 39/483 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KSD  K F  F+  ++ QF  SIK+IQ D GGE+R     L +LGI HR +C +T  Q
Sbjct  594   KAKSDALKAFTQFKALIQNQFQASIKAIQSDWGGEFRAFTALLNELGIQHRLTCPHTSHQ  653

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQ-FESPYTRLHK  1895
             NG VERK+RHIVE GL LL+   +  ++WD +F  A  LIN LP+S +  F+SPY  LH+
Sbjct  654   NGTVERKHRHIVEMGLTLLSHADLPLKFWDHSFTQAVYLINRLPSSAIPLFQSPYHALHQ  713

Query  1894  TPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
             + P Y+ ++VFGC C+P+LRPYN HK++Y+S+PCV+L   P  +G++C++ T G+IYI +
Sbjct  714   SQPDYSQIKVFGCLCFPHLRPYNNHKLQYKSSPCVYLGVSPQHKGHKCLDAT-GRIYISK  772

Query  1714  HVHFYESIF----LFSDS--------TLCSQPVPPTIPWASE--PVVTRAPCNTHAAPTD  1577
              V F+ES F    LF+ S        T  +Q + P++   +   P  + AP      P  
Sbjct  773   DVIFHESQFPYLSLFASSSSNSHMSHTYPAQILFPSVNTNTNLHPETSSAPDTDPPDPVS  832

Query  1576  S--AHMSLTSPVPLARGLPPLAIEGPVQT------------APTRARAV*TQHQERGHVM  1439
                  +S +S  PL        I  P+ T             P    A         H M
Sbjct  833   PLPGSVSPSSSTPLTISQINSLISQPISTTSPSVPTPPADPVPAIRPASQNISHHNAHPM  892

Query  1438  RLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHM  1259
               R  T +   +        +P     A+    W  AM  E+ AL+ N TW LV    H 
Sbjct  893   ITRAKTGNLKPKVFV--AALEPKSVKSALNDPAWLQAMQAEYKALMDNQTWTLVPLPQHR  950

Query  1258  NVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
               +GCKW+FR K N DG++ ++KARLVAKGF Q AG DF +TFS V+KP T+R++ +L V
Sbjct  951   KAIGCKWIFRVKENPDGTVNKFKARLVAKGFLQTAGFDFTETFSPVIKPITIRIILTLAV  1010

Query  1078  SHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*S  899
             +  W+++Q+DV+NAFLNG L E VYM QP G+E        ++  S  LYGL+      +
Sbjct  1011  TFKWSVQQIDVNNAFLNGILQEEVYMTQPAGFEASDKSLVCKLHKS--LYGLKQ-----A  1063

Query  898   PRA  890
             PRA
Sbjct  1064  PRA  1066


 Score =   108 bits (269),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 117/251 (47%), Gaps = 50/251 (20%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASI--PSESKL-LHLSNVLYVPKLSVPLFSVY  2710
             +S S  YTG D + +GNG G+ I  +G +    P+E  + L L ++L+VP +S  L SV 
Sbjct  348   LSYSSPYTGQDQVVMGNGQGVSIHSLGQSQFHSPNEPNVKLTLKDLLHVPNISKNLLSVS  407

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGST-SGGLYRLPVSRSHFAYLTSRATS---  2542
             +   +NNV FEFH     VK   ++ VLL G+  + GLY+       F +LT+   +   
Sbjct  408   KFAQDNNVIFEFHPYHCFVKYQDSKQVLLEGTVGADGLYQF----KPFKFLTNSGAASNS  463

Query  2541  ---------------------------------TVWHRRLGHPNAHVQNRVLQSCPVA-P  2464
                                               +WH RLGH +      +L  C +   
Sbjct  464   DSSSMSSSSQFSVFNNPVNCNNTVSVMQNGNVFQMWHLRLGHAHTSAVKNILNLCNIPFS  523

Query  2463  NKVKSLGSRTSCHLSKASRF--PLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLF  2290
             NK  +L   T C + K+ R   PL    Y+     ++++ D+WGPAP +S  G+ Y++ F
Sbjct  524   NKTATLPC-TFCCMGKSHRLHSPLSNTVYTKP--FEVIHCDLWGPAPFVSYYGYSYYITF  580

Query  2289  VDDYSRFCWFY  2257
             VD Y++F W Y
Sbjct  581   VDTYTKFTWIY  591



>emb|CAN68489.1| hypothetical protein VITISV_037543 [Vitis vinifera]
Length=1449

 Score =   297 bits (761),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 233/399 (58%), Gaps = 17/399 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K      F  F+  VE QF+  I+ ++ D GGE++     L   GI  + SC YT EQNG
Sbjct  618   KDQALSVFIKFKSLVENQFNSRIQCLRSDNGGEFKAFSSYLATHGIKSQFSCPYTPEQNG  677

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK RHI+ETGLALLA  S+  ++W +AF  A  LIN LPT VL ++SP+  L    P
Sbjct  678   RAERKLRHIIETGLALLATASLPFKFWLYAFHTAIFLINRLPTKVLNYQSPFQILFGKSP  737

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y   ++FGC CYPY+RPYN++K+ YRS+ CVFL Y  + +GY C+N  +G++Y+ RHV 
Sbjct  738   NYHIFKIFGCLCYPYIRPYNKNKLSYRSSQCVFLGYSSNHKGYMCLNPLTGRLYVTRHVV  797

Query  1705  FYESIFLF-----SDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             F+E++F F       S++ + P P  +P +S PV +             +H + ++  P 
Sbjct  798   FHETVFPFQSTPDQSSSVVTIPTPAFLPCSSPPVSSL-----------RSHTTXSTSSPP  846

Query  1540  ARGLPPLAIEGP-VQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
                +P   I  P +   P    +    H    H M  R     + ++ +  +  ++PT +
Sbjct  847   LTNMPSSTISLPDLIQVPFADISTSEPHPTNQHPMVTRAKNGISKKKVYFSSHISEPTTF  906

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
             +QAV    W  AM++EF+AL  N+TW LV    + N++GCKWV++ K   DG++++YKAR
Sbjct  907   TQAVKDSNWVLAMEKEFSALQRNNTWHLVPPPSNGNIIGCKWVYKLKYKPDGTVDRYKAR  966

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNW  1067
             LVA+GF Q  G D+F+TFS VVK + +R++ ++ +S NW
Sbjct  967   LVAQGFTQTLGLDYFETFSPVVKASXIRIILAVALSFNW  1005


 Score =   139 bits (349),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 123/221 (56%), Gaps = 13/221 (6%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    Y G+D + VGNG  L I   G    PS SK   L  VL+VP ++  L SV +  
Sbjct  395   LSDVQPYMGNDKVIVGNGKHLRILHTGTTFFPSSSKTFQLRQVLHVPDIATNLISVSQFC  454

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS--RSHFAYLTS---------  2554
              +NN FFEFH   F VKD +T+ +LL+GS   GLYR P     S  A+++S         
Sbjct  455   ADNNTFFEFHPRFFFVKDQVTKKILLQGSLEHGLYRFPARFVPSPAAFVSSSYDRSSNLS  514

Query  2553  -RATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSS  2377
                T+T+WH RLGHP  ++   +L SC ++ ++        +C  +K+ + P +     +
Sbjct  515   LTTTTTLWHSRLGHPADNILKHILTSCNIS-HQCHKNNVCCACQFAKSHKLPFNVXVSRA  573

Query  2376  KNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              + L LL+ D+WGP  + ST+G RYF+LFVDD+SRF W YP
Sbjct  574   SHPLALLHADLWGPXSIPSTTGARYFILFVDDFSRFSWIYP  614


 Score = 60.8 bits (146),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 78/162 (48%), Gaps = 15/162 (9%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I WRTQ+   +       +++    CPP   +    + D V      
Sbjct  94    NHALPIKLDRNNYILWRTQMENVVFANGFEDHIEGLKICPPQKTSSGETNPDFVM-----  148

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ ILS + SSL+ E+M   VG  +S   W ++     +SSRAR +
Sbjct  149   ----------WRRFDRMILSWIYSSLTPEIMGQIVGYQSSHAXWFALEXXFXASSRARVM  198

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                 +F   R+G+ + +EY+ + + L ++LA  G P++  +Q
Sbjct  199   QLRLEFQTTRKGSLTMMEYILKLKSLADNLAAIGEPVTDRDQ  240



>emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1515

 Score =   285 bits (730),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/525 (35%), Positives = 264/525 (50%), Gaps = 87/525 (17%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGE---YRKIHHTLTKLGITHRKSCAYT  2081
             ++KSD +  F  F+  VE Q+   I   Q D GGE   Y+ + H L   GI    SC +T
Sbjct  552   KLKSDFFSVFVLFQQLVENQYQHKIAMFQCDGGGEFVSYKFVAH-LASCGIKQLISCPHT  610

Query  2080  HEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVL-QFESPYTR  1904
              +QNG  ER++R++ E GL+L+    V  + W  AF  +  L N LP+S L   +SPY  
Sbjct  611   PQQNGIAERRHRYLTELGLSLMFHSKVPHKLWVEAFFTSNFLSNLLPSSTLSDNKSPYEM  670

Query  1903  LHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIY  1724
             LH TPP YT LRVFG  CYPYLRPY ++K + +S  CVFL Y   ++GYRC++  +GK+Y
Sbjct  671   LHGTPPVYTALRVFGSACYPYLRPYAKNKFDPKSLLCVFLGYNNKYKGYRCLHPPTGKVY  730

Query  1723  ICRHVHFYESIFLFSD----------------------STLCSQPVPPT-----------  1643
             ICRHV F E  F +SD                      ST  S+  P T           
Sbjct  731   ICRHVLFDERKFPYSDIYSQFQTISGSPLFTAWQKGFSSTALSRETPSTNVEDIIFPSAT  790

Query  1642  -----------------------IPWASEPVVTRAPCNTHAAPT-------DSAHMSLTS  1553
                                    +  A + VV  +P  + + PT       D  H S  S
Sbjct  791   VSSSVPTGCAPNIAETATAPDVDVAAAHDMVVPPSPITSTSLPTQPEESTSDQNHYSTDS  850

Query  1552  PVPLARGLPPLAIE---------GPVQTAPTRARAV*TQHQERGHVMRLRHMTRDT--SE  1406
                ++  + P +I           P+Q+  +   A      E  H M  R  +  T  + 
Sbjct  851   ETAISSAMTPQSINVSLFEDSDFPPLQSVISSTTAA----PETSHPMITRAKSGITKPNP  906

Query  1405  QFHALNVTTD---PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
             ++   +V ++   P    +A+    W +AM +E   +   DTW LV  E    ++GCKWV
Sbjct  907   KYALFSVKSNYPEPKSVKEALKDEGWTNAMGEEMGTMHETDTWDLVPPEMVDRLLGCKWV  966

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             F+TK N+DGS+++ KARLVA+G+ Q  G D+ +T+S VV+  TVR +  +   + W+L+Q
Sbjct  967   FKTKLNSDGSLDRLKARLVARGYEQEEGVDYVETYSPVVRSATVRSILHVATINKWSLKQ  1026

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             LDV NAFL+  L ETV+M QPPG+EDP+ PD+V      A+Y L+
Sbjct  1027  LDVKNAFLHDELKETVFMTQPPGFEDPSRPDYV-CKLKKAIYDLK  1070


 Score =   146 bits (369),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 116/215 (54%), Gaps = 3/215 (1%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             T   +  S  Y+G D + VGNG  L I+ +G   +      L L +VL  P ++  L SV
Sbjct  337   TTDGLQNSQTYSGDDSVIVGNGDFLPITHIGTIPLNISQGTLPLEDVLVCPGITKSLLSV  396

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS--T  2539
              +LT++    F F  D  ++KD  T+ +L +G+   GLY L        Y T + +S   
Sbjct  397   SKLTDDYPCSFTFDSDSVVIKDKRTQQLLTQGNKHKGLYVLKDVPFQTYYSTRQQSSDDE  456

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             VWH+RLGHPN  V   ++++  +  NK  S     +C + K  R P     + S   L+ 
Sbjct  457   VWHQRLGHPNKEVLQHLIKTKAIVVNKTSS-NMCEACQMGKVCRLPFVASEFVSSRPLER  515

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGPAPV S  GF+Y+++F+D+YSRF WFYP
Sbjct  516   IHCDLWGPAPVTSAQGFQYYVIFIDNYSRFTWFYP  550



>emb|CAB43904.1| putative protein [Arabidopsis thaliana]
 emb|CAB81478.1| putative protein [Arabidopsis thaliana]
Length=1415

 Score =   281 bits (719),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 183/512 (36%), Positives = 258/512 (50%), Gaps = 72/512 (14%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R+KSD +  F +F+  VE Q  + I S Q D GGE+   +    L + GI    SC YT 
Sbjct  521   RLKSDFFSVFLTFQKMVENQCQQKIASFQCDGGGEFISNQFVSHLAECGIRQLISCPYTP  580

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFE-SPYTRL  1901
             +QNG  ERK+RHI E G +++ +G V Q  W  AF  +  L N LP+SVL+ + SPY  L
Sbjct  581   QQNGIAERKHRHITELGSSMMFQGKVPQFLWVEAFYTSNFLCNLLPSSVLKDQKSPYEVL  640

Query  1900  HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
                 P YT LRVFGC CYP LRPY  +K + +S  CVF  Y   ++GY+C +  +GKIYI
Sbjct  641   MGKAPVYTSLRVFGCACYPNLRPYASNKFDPKSLLCVFTGYNEKYKGYKCFHPPTGKIYI  700

Query  1720  CRHVHFYESIFLFSD----------STLC----SQPVPPTIPWASEPVVTRAPCNTHAAP  1583
              RHV F ES FLFSD          STL     S  +P +IP   E +      NT A+ 
Sbjct  701   NRHVLFDESKFLFSDIYSDKVSGTNSTLVSAWQSNFLPKSIPATPEVLDIS---NTAASF  757

Query  1582  TDS-------------AHMSLTSPVPLARGLPPLAI--------EGPVQTAPT-------  1487
             +D                 +    VP+   LP   +        E P+ +A +       
Sbjct  758   SDEQGEFSGAVGGGGCGCTADLDSVPIGNSLPSSPVTQQNSPQPETPISSAGSGNDAEDS  817

Query  1486  --------------------RARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTD---  1376
                                    A  T  Q    + R +      + ++    V ++   
Sbjct  818   ELSENSENSESSVFSEATTETEAADNTNDQSHPMITRSKSGIFKPNPKYAMFTVKSNYPV  877

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             P     A+    W DAM +E+++     TW LV  +  +  +GC+WVF+TK  ADG++++
Sbjct  878   PKTVKTALKDPGWTDAMGEEYDSFEETHTWDLVPPDSFITPLGCRWVFKTKLKADGTLDR  937

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
              KARLVAKG+ Q  G D+ +T+S VV+  TVR +  +   + W ++QLDV NAFL+G L 
Sbjct  938   LKARLVAKGYEQEEGVDYMETYSPVVRTATVRTILHVATINKWEIKQLDVKNAFLHGDLK  997

Query  1015  ETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             ETVYM QPPG+E+   PD+V    + A+YGL+
Sbjct  998   ETVYMYQPPGFENQDRPDYV-CKLNKAIYGLK  1028


 Score =   148 bits (373),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 123/216 (57%), Gaps = 5/216 (2%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             + S +  +  Y+G D + VGN   L I+ +G A + S    L L +VL  P ++  L SV
Sbjct  306   STSQLQSAQPYSGEDSVIVGNSDFLPITHIGSAVLTSNQGNLPLRDVLVCPNITKSLLSV  365

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATST--  2539
              +LT++     EF  D  IVKD +T+ +L +G+    LY L   +    Y +SR  +T  
Sbjct  366   SKLTSDYPCVIEFDSDGVIVKDKLTKQLLTKGTRHNDLYLLENPKFMACY-SSRQQATSD  424

Query  2538  -VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
              VWH RLGHPN  V  ++L++  +  +K  S     +C + K  + P     + S  +L+
Sbjct  425   EVWHMRLGHPNQDVLQQLLRNKAIVISKT-SHSLCDACQMGKICKLPFASSDFVSSRLLE  483

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              ++ D+WGPAPV+S+ GFRY+++F+D+YSRF WFYP
Sbjct  484   RVHCDLWGPAPVVSSQGFRYYVIFIDNYSRFTWFYP  519


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             H+V++KL+  N++ W+ Q   +L  Q LLG+V    PCP  T +    +GD V       
Sbjct  15    HYVTLKLSTANYLLWKIQFETWLNNQRLLGFVTGANPCPNATRS--IRNGDQV------T  66

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
                NP +  W++ DQ I+  L+ SLS++ +    G  TSR VW S+       S +R   
Sbjct  67    EATNPDFLTWVQNDQKIMGWLLGSLSEDALRSVYGLHTSREVWFSLAKKYNRVSASRKSD  126

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                + + + +   S +EYL   + + + L   G P+  +E+
Sbjct  127   LQRRLNPVSKNEKSMLEYLNCVKQICDQLDSIGCPVPENEK  167



>gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis]
Length=2301

 Score =   268 bits (685),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/499 (35%), Positives = 253/499 (51%), Gaps = 54/499 (11%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KSD +  F +F+  V+ QF  +I + Q D GGE+   +    L K GI    SC +T 
Sbjct  559   KKKSDFHSIFIAFQSLVQNQFHTTIGTFQCDGGGEFISNQFLLHLQKNGIQQLLSCPHTP  618

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSV-LQFESPYTRL  1901
             +QNG  ER++RHIVE GL+LL +    Q+YW  AF  A  L N LP S      SPY +L
Sbjct  619   QQNGLAERRHRHIVELGLSLLFQSRAPQKYWVEAFMTANFLSNLLPHSANTNTASPYEKL  678

Query  1900  HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
             H   P Y  LR+FGC C+P LRPY ++K++ RS  CVFL Y   ++GYRC+   +G++YI
Sbjct  679   HNKSPSYDALRIFGCACFPMLRPYTQNKLDPRSLQCVFLGYSEKYKGYRCLLPATGRVYI  738

Query  1720  CRHVHFYES---------------------IFLFSDSTLCSQPV----------PPTIPW  1634
              RHV F ES                      +L S+ +  SQ            P     
Sbjct  739   SRHVIFDESKFPFADVYGHLHPPALTPLMEAWLQSNRSAVSQSQSTQGRQETMQPRLCVI  798

Query  1633  ASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLPPLAIEGPV--------QTAPTRAR  1478
               +  V     +T +    S+  ++++ +P+  G     I+           +TA  RA 
Sbjct  799   KPQHFVAPNSSSTGSCSVISSSETMSTSLPITDGTSQRLIDRESNSPQVEHNETALPRAN  858

Query  1477  AV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT---DPTCYSQAVGHL*WRDAMDQEFNA  1307
                  HQ      RL+      + ++  L        P   ++A+ H  W ++M +E   
Sbjct  859   MPVNNHQ---MTTRLKAGITKPNPRYALLTQKVLCPRPRTVAEALKHPGWNNSMKEEIGN  915

Query  1306  LLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFS  1127
                  TW LV   P M+V+G  WVFR K NADG+++  ++RLVA+G +Q  G D+ +T+S
Sbjct  916   CELTKTWSLVPYTPDMHVIGNGWVFREKLNADGTVKSLRSRLVAQGCSQEEGIDYLETYS  975

Query  1126  LVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVS  947
              VV+  TVR++  +     W ++Q+DV NAFL+G L ETVYM QP G+ D + PDHV + 
Sbjct  976   PVVRTATVRIVLHIATVLQWDIKQMDVANAFLHGDLHETVYMSQPKGFVDESKPDHVCLL  1035

Query  946   SSTALYGLRGVKMG*SPRA  890
               + LYGL+      SPRA
Sbjct  1036  HKS-LYGLKQ-----SPRA  1048


 Score =   159 bits (402),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 123/215 (57%), Gaps = 3/215 (1%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             T   +  +  Y GSD + VGNG  L I+  G ASI S S  L L++VL  P+++ PL SV
Sbjct  344   TPHHLQNAQPYMGSDSVMVGNGEYLPITHTGAASIASSSGNLILNDVLVCPQIAKPLLSV  403

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL--PVSRSHFAYLTSRATST  2539
              + T +    F+F  D   + D  T+ VLL+G  + GLY +  P   + F+     A+  
Sbjct  404   SKFTTDYPCGFDFDADNVCIYDKATKKVLLQGRNTKGLYSIKEPAFHAFFSTRQVAASDE  463

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             VWH+RLGHPN H+  R+     V  NK +S     SC ++K+SR P     + +   L+ 
Sbjct  464   VWHQRLGHPNPHILQRLASIKSVFINK-RSKSLCVSCQMAKSSRLPFSASQFVATRPLER  522

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGP+PV+S   F+Y+++ +D+YSR+CW YP
Sbjct  523   IHCDVWGPSPVVSVQEFKYYVVLIDNYSRYCWMYP  557


 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 75/154 (49%), Gaps = 7/154 (5%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             V++KLT +N+I W+ Q   FL GQ LLG+V   TP P  TI   + +G +        P 
Sbjct  20    VTVKLTEKNYILWKRQFEAFLNGQRLLGFVTGSTPQPAATIPAPTINGTTT-------PA  72

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
             PNP Y  W + DQ+I S L+ S S++V    +  T S  +W ++ +     + AR     
Sbjct  73    PNPDYALWFQTDQAIQSWLLGSFSEDVQSSVIHCTNSYEIWMTLASHFNRPTSARLFELQ  132

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
              +     + + S  +YL   + + + L   G P+
Sbjct  133   RKLQTTAKQDKSMDDYLRDIKTICDQLTSIGQPV  166



>emb|CAN78022.1| hypothetical protein VITISV_015518 [Vitis vinifera]
Length=1501

 Score =   311 bits (797),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 255/480 (53%), Gaps = 45/480 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYR----KIHHTLTKLGITHRKSCAY  2084
             + KSD +  F  F+  VE Q S  IK  Q D G E+     K H  L   GI H+ SC Y
Sbjct  504   KFKSDFFDIFLQFQKFVENQHSARIKVFQSDGGAEFTNTCFKAH--LRTSGIHHQLSCPY  561

Query  2083  THEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTR  1904
             T  QNGR ERK+RH+ ETGLALL    +S ++W  AF  AT +IN LPT +L  +SP+  
Sbjct  562   TPAQNGRAERKHRHVTETGLALLFHSHLSPRFWVDAFSTATYIINRLPTPLLGGKSPFEL  621

Query  1903  LHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIY  1724
             L+   P Y     FGCR YP LR Y  +K+  RS PC+FL Y PS +G+RC++ T+ ++Y
Sbjct  622   LYGXSPHYENFHPFGCRVYPCLRDYMPNKLSPRSIPCIFLGYSPSHKGFRCLDPTTSRLY  681

Query  1723  ICRHVHFYESIFLFSDSTLCSQPVPPTIPWASE-----------------------PVVT  1613
             I RH  F E+ F    +   SQ  P +    S                        P   
Sbjct  682   ITRHAQFDETHF---PTVPSSQAQPLSSLHISNFLEPRLHHIDPSPPSPPSPSSHIPRSN  738

Query  1612  RAPCNTHAAPTDSAHMSLTSPVPLARGLPPLA-----IEGPVQTAPTRARAV*TQHQERG  1448
              +PCN  +   D +    TS       LPPLA     IE    ++ +          + G
Sbjct  739   SSPCNICSDLVDESVQVDTSLA--GSSLPPLASSPHSIEHAADSSSSLGSHPMITRAKAG  796

Query  1447  HVMRLRHMTR----DTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKL  1280
              + + RH        +S    AL  +T+P  +  A  +  W  AMD+E  AL  N TW L
Sbjct  797   -IFKTRHPANLGVLGSSGLLXALLASTEPKGFKSAAKNPAWLAAMDEEVQALQQNGTWIL  855

Query  1279  VLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVR  1100
             V    + N+VG KWVFRTK   DGS+E+ KARLVAKG+  V G D+ DTFS VVK TTVR
Sbjct  856   VPRPVNTNIVGSKWVFRTKYLPDGSVERLKARLVAKGYTXVPGLDYTDTFSPVVKATTVR  915

Query  1099  LLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             ++ SL V++ W LRQLDV NAFLNG L E VYM+QPPGY DP  P HV +    ALYGL+
Sbjct  916   VVLSLAVTNKWPLRQLDVKNAFLNGTLTEHVYMEQPPGYIDPRFPTHVCLLKK-ALYGLK  974


 Score =   116 bits (290),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 117/216 (54%), Gaps = 22/216 (10%)
 Frame = -1

Query  2886  SMMSQSDEYTGSDVLRVGNGAGLIISRVGHAS-IPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             S + QS  Y G D + VGNGA L I+  G  S +P+    +HL +VL V  L+  L S+ 
Sbjct  304   SXLDQSKNYMGKDSVIVGNGASLPITHTGTLSPVPN----IHLLDVLVVXHLTKNLLSIS  359

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTS----RATS  2542
             +LT++  +   F  + F V++  T   +  G   GGLY L    S F  +      RA+ 
Sbjct  360   KLTSDFPLSVTFTNNLFTVQNRQTGRXVATGKRDGGLYVLERGNSAFISVLKNKSLRASY  419

Query  2541  TVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
              +WH RLGH +       L S   +P+        ++C L+K  R P  R  + S +VLD
Sbjct  420   DLWHARLGHLS-------LTSLLPSPSLC------STCQLAKNHRLPYSRNEHRSSHVLD  466

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             L++ D+WGP+P+ S SGF Y+++F+DDYSRF W YP
Sbjct  467   LIHCDLWGPSPIKSNSGFLYYVIFIDDYSRFTWLYP  502


 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 13/156 (8%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             H ++IKL+  N++ W++QL+P L  Q+LL YVD  T  PPP   P +++  S        
Sbjct  16    HMITIKLSSSNYLLWKSQLLPLLESQDLLAYVDG-TLVPPPRFEPETSTTLST-------  67

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
                   Y AW   DQ +L LL+SSL++E + + VG +T+R VW ++       S+AR L 
Sbjct  68    -----KYLAWKAADQRLLCLLLSSLTEEAIAVVVGLSTAREVWLALENTFSHHSKARELR  122

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                    ++ G     EY    + L + L   G P+
Sbjct  123   LKDDLQLMKCGTKPVAEYARTFKTLCDQLHAIGRPV  158



>gb|KHN21230.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1429

 Score =   305 bits (780),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 187/446 (42%), Positives = 239/446 (54%), Gaps = 35/446 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+    F+ F+   E Q +  IK+IQ D GGE+R     L++LGI HR  C +TH QNG
Sbjct  611   KSETLTIFKQFKALAELQLNTKIKAIQSDWGGEFRSFTSYLSQLGIIHRIICPHTHHQNG  670

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RHIVE GL+LL+  S+   YWD AF  A  +IN LP S      P   L    P
Sbjct  671   VVERKHRHIVEMGLSLLSHSSLPYHYWDHAFHTAVYIINRLPAS-HNHCIPLKVLFNNVP  729

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y FLR FGC CYP L PYN  K +YRS  C+FL Y  S RGY+C++  SG+IYI + V 
Sbjct  730   DYNFLRAFGCACYPLLTPYNNPKFQYRSKECIFLGY--STRGYKCLDNKSGRIYISKDVL  787

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCN-------------THAAPTDSAHM  1565
             F E  F +       Q  PPT    ++ V + AP                +  P +    
Sbjct  788   FNEKHFPY-------QITPPTTCSPNQTVTSAAPLGVVNHIPQQTPHTPNNLTPNNQPTP  840

Query  1564  SLTSPVPLARGLPPL-AIEGPVQTAPTRARAV*---------TQHQERGHVMRLRHMTRD  1415
                +  P     P + A   P  T P+ A +                  H M  R  T  
Sbjct  841   HTPTTFPSHTSSPYISASASPTPTLPSTASSTIDPNSTPTSSPSPTTNTHHMLTRSKTGH  900

Query  1414  TSEQ-FHALNVTT-DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCK  1241
                  F  +N+TT +PT   QA+  + W +AM QE+ AL  N TW LV   PH   +GCK
Sbjct  901   LKPPLFPTINLTTTEPTTVQQALSSIHWTEAMQQEYQALQANKTWSLVPLPPHKRAIGCK  960

Query  1240  WVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTL  1061
             W+FR K N DG+I +YKARLVAKGFNQ  G D+ DT+S VVKP TVR + ++ ++  W L
Sbjct  961   WIFRIKENPDGTINKYKARLVAKGFNQKYGQDYSDTYSPVVKPITVRTVLTIALTSKWPL  1020

Query  1060  RQLDVHNAFLNGHLAETVYMKQPPGY  983
              QLDV+NAFLNG L E VYM+QP G+
Sbjct  1021  IQLDVNNAFLNGQLHEDVYMQQPQGF  1046


 Score =   122 bits (306),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 114/212 (54%), Gaps = 20/212 (9%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHASIPSESK---LLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             +GNG GL ++ +   + PS S     LHL+NVL+VP ++  L SV +  ++NN + +FH 
Sbjct  397   LGNGQGLRVTGISSYAFPSPSHPHHTLHLNNVLHVPSINKNLISVSKFASDNNAYIQFHP  456

Query  2667  DCFIVKDSITRAVLLRGS-TSGGLYRLPVSRSHFAYLTSRATST------------VWHR  2527
               F++K      +LL+G     GLY +    S  + L+SR  S              WH 
Sbjct  457   SHFVMKSQDNDQILLQGKLDKAGLYPIHSQSSTTSSLSSRHHSVHSIVTSHNDLYFQWHH  516

Query  2526  RLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFP--LDRVSYSSKNVLDLLY  2353
             RLGH N    N VL+SC +            SC L K+ R P  L + +Y+S   L+L+Y
Sbjct  517   RLGHTNLDTMNNVLKSCNMPTFNKNKTDFCISCCLGKSHRLPSQLSQSTYNSP--LELIY  574

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              D+WGPAP+ S+ G++Y++ F+D +S++ W Y
Sbjct  575   CDLWGPAPMQSSMGYKYYISFIDAFSKYIWVY  606



>gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Arabidopsis thaliana]
Length=1522

 Score =   290 bits (741),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 190/525 (36%), Positives = 263/525 (50%), Gaps = 79/525 (15%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             ++KSD + TF  F+  VE Q    IK  Q D GGE+   +    L   GI    SC YT 
Sbjct  555   KLKSDFFSTFVMFQKLVENQLGHKIKIFQCDGGGEFISSQFLKHLQDHGIQQNMSCPYTP  614

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQF-ESPYTRL  1901
             +QNG  ERK+RHIVE GL+++ +  +  +YW  +F  A  +IN LPTS L   ESPY +L
Sbjct  615   QQNGMAERKHRHIVELGLSMIFQSKLPLKYWLESFFTANFVINLLPTSSLDNNESPYQKL  674

Query  1900  HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
             +   P Y+ LRVFGC CYP LR Y   K + RS  CVFL Y   ++GYRC+   +G+IYI
Sbjct  675   YGKAPEYSALRVFGCACYPTLRDYASTKFDPRSLKCVFLGYNEKYKGYRCLYPPTGRIYI  734

Query  1720  CRHVHFYESIFLFS---------DST------------------------LCSQPVPPTI  1640
              RHV F E+   F          D T                        + S P P T 
Sbjct  735   SRHVVFDENTHPFESIYSHLHPQDKTPLLEAWFKSFHHVTPTQPDQSRYPVSSIPQPETT  794

Query  1639  PWASEPVV----TRAPCNTHAAPTDSAHMSLTSPVP-LARGLPPLAI-------------  1514
               ++ P      T  P  +     D+  +S+ S  P    GL   +I             
Sbjct  795   DLSAAPASVAAETAGPNASDDTSQDNETISVVSGSPERTTGLDSASIGDSYHSPTADSSH  854

Query  1513  -------------EGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQF----HALNV  1385
                            P+Q AP +       + E   V R +      ++++    H +++
Sbjct  855   PSPARSSPASSPQGSPIQMAPAQQVQAPVTN-EHAMVTRGKEGISKPNKRYVLLTHKVSI  913

Query  1384  TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGS  1205
               +P   ++A+ H  W +AM +E       +TW LV   P+MNV+G  WVFRTK +ADGS
Sbjct  914   -PEPKTVTEALKHPGWNNAMQEEMGNCKETETWTLVPYSPNMNVLGSMWVFRTKLHADGS  972

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             +++ KARLVAKGF Q  G D+ +T+S VV+  TVRL+  +     W L+Q+DV NAFL+G
Sbjct  973   LDKLKARLVAKGFKQEEGIDYLETYSPVVRTPTVRLILHVATVLKWELKQMDVKNAFLHG  1032

Query  1024  HLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              L ETVYM+QP G+ D + PDHV +    +LYGL+      SPRA
Sbjct  1033  DLTETVYMRQPAGFVDKSKPDHVCLLHK-SLYGLKQ-----SPRA  1071


 Score =   135 bits (339),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 118/213 (55%), Gaps = 4/213 (2%)
 Frame = -1

Query  2883  MMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRL  2704
             ++ QS  Y GSD + V +G  L I+  G  SI S S  + L  VL  P +   L SV +L
Sbjct  342   VLQQSQPYHGSDSIMVADGNFLPITHTGSGSIASSSGKIPLKEVLVCPDIVKSLLSVSKL  401

Query  2703  TNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR--ATSTVWH  2530
             T++     EF  D   + D  T+ +L+ G    GLY L   +    Y T +  A+S VWH
Sbjct  402   TSDYPCSVEFDADSVRINDKATKKLLVMGRNRDGLYSLEEPKLQVLYSTRQNSASSEVWH  461

Query  2529  RRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLY  2353
             RRLGH NA V +++  S  +   NKV       +CHL K++R P    ++++   L+ ++
Sbjct  462   RRLGHANAEVLHQLASSKSIIIINKVVKTVCE-ACHLGKSTRLPFMLSTFNASRPLERIH  520

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              D+WGP+P  S  GFRY+++F+D YSRF WFYP
Sbjct  521   CDLWGPSPTSSVQGFRYYVVFIDHYSRFTWFYP  553



>gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from 
Arabidopsis thaliana BAC gb|AF080119 and is a member of the 
reverse transcriptase family PF|00078 [Arabidopsis thaliana]
Length=1415

 Score =   292 bits (747),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 183/468 (39%), Positives = 249/468 (53%), Gaps = 36/468 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS+    F SF+  VE Q +  IK  Q D GGE+   K+   L++ GI HR SC YT +Q
Sbjct  553   KSEFLSVFISFQKLVENQLNTKIKVFQSDGGGEFVSNKLKTHLSEHGIHHRISCPYTPQQ  612

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RH+VE GL++L      Q++W  +F  A  +IN LP+SVL+  SPY  L   
Sbjct  613   NGLAERKHRHLVELGLSMLFHSHTPQKFWVESFFTANYIINRLPSSVLKNLSPYEALFGE  672

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ LRVFG  CYP LRP  ++K + RS  CVFL Y   ++GYRC    +GK+YI R+
Sbjct  673   KPDYSSLRVFGSACYPCLRPLAQNKFDPRSLQCVFLGYNSQYKGYRCFYPPTGKVYISRN  732

Query  1711  VHFYESIFLFSDS--TLCSQPVPPTI-PWA----SEPVVTRAPCNTHAAPTD-------S  1574
             V F ES   F +   +L  Q   P +  W     SE  V  AP    + P D        
Sbjct  733   VIFNESELPFKEKYQSLVPQYSTPLLQAWQHNKISEISVPAAPVQLFSKPIDLNTYAGSQ  792

Query  1573  AHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHA  1394
                 LT P P +        EG  +     A  +   +QE+  V+    MT  +      
Sbjct  793   VTEQLTDPEPTSNN------EGSDEEVNPVAEEI-AANQEQ--VINSHAMTTRSKAGIQK  843

Query  1393  LNV----------TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGC  1244
              N           T +P   + A+ H  W +A+ +E N +    TW LV     MN++  
Sbjct  844   PNTRYALITSRMNTAEPKTLASAMKHPGWNEAVHEEINRVHMLHTWSLVPPTDDMNILSS  903

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWT  1064
             KWVF+TK + DGSI++ KARLVAKGF+Q  G D+ +TFS VV+  T+RL+  +  S  W 
Sbjct  904   KWVFKTKLHPDGSIDKLKARLVAKGFDQEEGVDYLETFSPVVRTATIRLVLDVSTSKGWP  963

Query  1063  LRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             ++QLDV NAFL+G L E V+M QP G+ DP  P HV    + A+YGL+
Sbjct  964   IKQLDVSNAFLHGELQEPVFMYQPSGFIDPQKPTHV-CRLTKAIYGLK  1010


 Score =   132 bits (333),  Expect(2) = 9e-109, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 112/215 (52%), Gaps = 10/215 (5%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +  + EY G D + VG+G  L I+  G  +I S +  + L+ VL VP +   L SV +L 
Sbjct  339   LQSATEYEGDDAVLVGDGTYLPITHTGSTTIKSSNGKIPLNEVLVVPNIQKSLLSVSKLC  398

Query  2700  NE--NNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR----ATST  2539
             ++    V+F+ +K C I  D  T+ V+  G    GLY L      F  L S     AT  
Sbjct  399   DDYPCGVYFDANKVCII--DLQTQKVVTTGPRRNGLYVL--ENQEFVALYSNRQCAATEE  454

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             VWH RLGH N+     +  S  +  NK ++      C + K+SR P         + LD 
Sbjct  455   VWHHRLGHANSKALQHLQNSKAIQINKSRTSPVCEPCQMGKSSRLPFLISDSRVLHPLDR  514

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGP+PV+S  G +Y+ +FVDDYSR+ WFYP
Sbjct  515   IHCDLWGPSPVVSNQGLKYYAIFVDDYSRYSWFYP  549



>gb|AAK51235.1|AF287471_1 polyprotein [Arabidopsis thaliana]
Length=1453

 Score =   285 bits (730),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 178/486 (37%), Positives = 243/486 (50%), Gaps = 45/486 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + KSD +  F +F+  VE QF+  IK  Q D GGE+    +   LT  GI HR SC YT 
Sbjct  554   KAKSDFFAVFVAFQNLVENQFNTKIKVFQSDGGGEFTSNLMKKHLTDCGIQHRISCPYTP  613

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK+RH VE GL+++       Q+W  AF  A+ L N LP+  L   SP   L 
Sbjct  614   QQNGIAERKHRHFVELGLSMMFHSHTPLQFWVEAFFTASFLSNMLPSPSLGNVSPLEALL  673

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
             K  P Y  LRVFG  CYP LRP   HK E RS  CVFL Y   ++GYRC+   +G++YI 
Sbjct  674   KQKPNYAMLRVFGTACYPCLRPLGEHKFEPRSLQCVFLGYNSQYKGYRCLYPPTGRVYIS  733

Query  1717  RHVHFYESIFLFS----------DSTLCSQPVPPTIPWASEPVVTRA---PCNTHAAP--  1583
             RHV F E  F F           +S+L S     +IP A + ++ +A      + A P  
Sbjct  734   RHVIFDEETFPFKQKYQFLVPQYESSLLS-AWQSSIPQADQSLIPQAEEGKIESLAKPPS  792

Query  1582  --TDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH------  1427
                ++   + T P  L  G+     E                H +               
Sbjct  793   IQKNTIQDTTTQPAILTEGVLNEEEEEDSFEETETESLNEETHTQNDEAEVTVEEEVQQE  852

Query  1426  ------MTRDTSEQFHALNV----------TTDPTCYSQAVGHL*WRDAMDQEFNALLHN  1295
                   MT  +    H  N             +P    +A+ H  W +A++ E   +   
Sbjct  853   PENTHPMTTRSKAGIHKSNTRYALLTSKFSVEEPKSIDEALNHPGWNNAVNDEMRTIHML  912

Query  1294  DTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVK  1115
              TW LV     MN++GC+WVF+TK   DGS+++ KARLVAKGF+Q  G D+ +TFS VV+
Sbjct  913   HTWSLVQPTEDMNILGCRWVFKTKLKPDGSVDKLKARLVAKGFHQEEGLDYLETFSPVVR  972

Query  1114  PTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSST  938
               T+RL+  +  +  W ++QLDV NAFL+G L E VYM QPPG+ D   P +V R++   
Sbjct  973   TATIRLVLDVATAKGWNIKQLDVSNAFLHGELKEPVYMLQPPGFVDQEKPSYVCRLTK--  1030

Query  937   ALYGLR  920
             ALYGL+
Sbjct  1031  ALYGLK  1036


 Score =   137 bits (345),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 122/208 (59%), Gaps = 8/208 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNE--NN  2689
             Y GSD + VG+GA L I+ VG  +I S+S  L L+ VL  P +   L SV +L ++    
Sbjct  348   YNGSDTVLVGDGAYLPITHVGSTTISSDSGTLPLNEVLVCPDIQKSLLSVSKLCDDYPCG  407

Query  2688  VFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR---ATSTVWHRRLG  2518
             V+F+ +K C I  D  T+ V+ +G  S GLY L  ++   A+ ++R   A+  +WH RLG
Sbjct  408   VYFDANKVCII--DINTQKVVSKGPRSNGLYVLE-NQEFVAFYSNRQCAASEEIWHHRLG  464

Query  2517  HPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWG  2338
             H N+ +  ++  S  ++ NK +       C + K+S+      +    ++L  ++ D+WG
Sbjct  465   HSNSRILQQLKSSKEISFNKSRMSPVCEPCQMGKSSKLQFFSSNSRELDLLGRIHCDLWG  524

Query  2337  PAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             P+PV+S  GF+Y+++FVDDYSR+ WFYP
Sbjct  525   PSPVVSKQGFKYYVVFVDDYSRYSWFYP  552



>gb|ABA98728.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1016

 Score =   365 bits (936),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 208/514 (40%), Positives = 285/514 (55%), Gaps = 74/514 (14%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+++  F  F+ RVER F+R I S+Q D GGEY K+H   TK+GI+H  SC Y H+QNG
Sbjct  166   KSEVFSKFHEFQQRVERLFNRKIISMQTDWGGEYEKLHSFFTKIGISHHVSCPYAHQQNG  225

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVE GLALLA  SV  ++WD AF  AT LIN LP+ V+Q+ +P  RL    P
Sbjct  226   SAERKHRHIVEVGLALLAHASVPLKFWDEAFLAATYLINRLPSKVIQYSAPLERLLDQKP  285

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LR FGC C+P LRPYN+ K+E+RS  CVFL Y    +G++C+++++G++YI R V 
Sbjct  286   NYSALRTFGCACWPNLRPYNKRKLEFRSKQCVFLGYSNIHKGFKCLDVSTGRVYISRDVV  345

Query  1705  FYESIFLFSD-------------STLCSQPVPPTIPWASEPVVTR-----------APCN  1598
             F E++F FS                L S  +P  + ++++ ++             A  N
Sbjct  346   FDENVFPFSKLHSNAGARLRSEILLLPSSLIPNGVGYSNDHMLNTPERSNGNMENIASGN  405

Query  1597  THA---------APTDSAHMSLTSP----------VPLARGLPPLAIEGPVQTAPTRARA  1475
             T              D  H S+  P          + LA  L     EGP  TA + A+ 
Sbjct  406   TEVFEENAEDPDGTEDPDHASVIQPNDMRTVLLHMMVLALQLRHREQEGP-PTATSSAQH  464

Query  1474  V*TQHQERGH-----------------------VMRLRHMTR------DTSEQFHALNVT  1382
                QH +  H                       + RL+  TR      D + ++  L +T
Sbjct  465   SAQQHSQAQHSVQQHGNDGNDGAEQQQQMVQRPMTRLQRGTRKEKVYTDGTVRYSFLAMT  524

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
              +P   ++A+    W+ AMD EF ALL N TW LV      N++ CKWV++ KR +DGS+
Sbjct  525   GEPNNLAEALADNNWKHAMDAEFTALLDNKTWHLVPPSSDKNIIDCKWVYKIKRKSDGSL  584

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             ++YKARLVAKGF Q  G D+ D FS VVK  T+R + S+VVS  W LRQLDV NAFL+G+
Sbjct  585   DRYKARLVAKGFKQRYGIDYEDMFSPVVKAATIRTILSIVVSRGWCLRQLDVQNAFLHGY  644

Query  1021  LAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             L E VYM+QP GYED + P +V      A+YGL+
Sbjct  645   LEEEVYMRQPSGYEDKSKPSYV-CKLDKAIYGLK  677


 Score = 54.7 bits (130),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -1

Query  2421  SKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +K  + P  + S  S + L+L+++D+WGPAPV S    +Y++ F+DD+S+F W Y
Sbjct  108   AKGHQLPYPKSSSVSSHPLELVFSDVWGPAPV-SVESRKYYVSFIDDFSKFTWIY  161


 Score = 61.2 bits (147),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  ++Y G + +   +GAG+ I  VGH+ I +  + +HL N+L+V K+   L S +RL 
Sbjct  29    LTTHEKYNGKEQIHTASGAGMDIKHVGHSIIHTPVRNIHLKNILHVRKVKKNLISAHRLA  88

Query  2700  NENNVFFEFHKDCFIVKDS  2644
              +NN F E H   F +KD 
Sbjct  89    VDNNAFVEVHSRFFAIKDQ  107



>emb|CAN77529.1| hypothetical protein VITISV_041425 [Vitis vinifera]
Length=1047

 Score =   312 bits (799),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 259/450 (58%), Gaps = 19/450 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K  +  TF +FR  +E Q + +IK IQ D GGE+      L   GI H+ SC +T +QNG
Sbjct  464   KDQVLSTFITFRKMIENQLNSTIKCIQSDNGGEFIAFKPYLEAHGIVHQFSCPHTPQQNG  523

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R +RK  H+VETG+ LLA+  +  +YW F+F+ +  LIN L   +L F+SP   L    P
Sbjct  524   RAKRKIHHLVETGMTLLAQSFLPSKYWSFSFQTSVYLINLLLAKLLNFQSPLQVLFHKIP  583

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRPYN HK+ YRS  CVFL Y  + +GY C+++++ ++YI R V 
Sbjct  584   NYHHLRVFGCLCFPSLRPYNHHKLSYRSIACVFLGYASAHKGYICLDVSTSRLYISRDVL  643

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP------  1544
             F+ES F F  S     P+P   P  S  ++     +T + PT      ++ PVP      
Sbjct  644   FHESSFPF-QSIPAPSPLPQHTPLTSA-LINPPLLSTSSPPT------VSFPVPTSSTDY  695

Query  1543  --LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPT  1370
                +  LPPL ++ P    P+   +  +      H M  R  +    ++   +  T++P 
Sbjct  696   TSTSDSLPPL-LQVPFAPTPSPTPSS-SPSPLNTHPMVTRAKSGIHKKKSFLMQTTSEPH  753

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
              YSQA     W  AM  ++ AL HN TW LV   P  ++VGC+W+++ K  ++GS+E++K
Sbjct  754   TYSQAFKSEPWVQAMQHQYQALRHNHTWSLVPPPPSAHIVGCRWIYKLKYLSNGSVERHK  813

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVA+GF Q  G D+FDTF+ VVKP T+RL+ +L VS  W +RQLDV NAFLN  L + 
Sbjct  814   ARLVAQGFTQTPGVDYFDTFNPVVKPCTIRLILALAVSFQWPIRQLDVENAFLNEDLQDE  873

Query  1009  VYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V+M QP G+  P +P +V      ALYGL+
Sbjct  874   VFMAQPQGFVHPQYPHYV-CKLHKALYGLK  902


 Score =   107 bits (266),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = -1

Query  2736  LSVPLFSVYRLTNENNVFF-EFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYL  2560
             L +P F   +L   + V   + H    +  D +T+  LL+G    GLY  P S S  A++
Sbjct  293   LHLPTFPQCQLCGADQVTIGDGHSLPILNTDQVTKQTLLKGWLRDGLYEFPSSSSTHAFV  352

Query  2559  TSRAT-----STVWHRRLGHPNAHVQNRVLQSC-PVAPNKVKSLGSRTSCHLSKASRFPL  2398
             ++ +        +WH RLGHP A + ++ L SC P    ++  +     C L+K+   P 
Sbjct  353   STSSVPALTPGAIWHSRLGHPAAPILSKALASCNPSISFQINKIAPCKICPLAKSHSLPY  412

Query  2397  DRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                S  +   L L++TD+WG AP  STSG RYFLLF+DDYSR+ W Y
Sbjct  413   SLSSSHASQPLALIHTDLWGLAPSPSTSGARYFLLFIDDYSRYTWIY  459


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I W+TQ+   +       Y+D   PCPP  +     + D V      
Sbjct  26    NHALPIKLDRNNYILWKTQMENVVYANGFEEYIDGTKPCPPQELHTGELNPDFVQ-----  80

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ +LS L S+L+ ++M   VG  TS   W ++     +SS+AR L
Sbjct  81    ----------WRRFDRMVLSWLYSTLTPDIMGQIVGFQTSHDAWMALHKIFSASSKARIL  130

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                 +F   ++G    +EY+ + + +  +LA  G P+
Sbjct  131   QLRLEFQTAKKGADPMLEYILKIKTISNNLAAIGEPV  167



>emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera]
Length=1171

 Score =   288 bits (737),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 180/451 (40%), Positives = 242/451 (54%), Gaps = 55/451 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KSD++ TF  F+   E+ FS SIK IQ D GGE+   +    LT  GI HR +C +T +Q
Sbjct  557   KSDVFATFVKFKTIAEKLFSTSIKQIQTDNGGEFTSNQFKQFLTAQGIFHRLTCPHTSQQ  616

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VERK+RHI E GL LLA+ S+S QYW  AF  +  LIN LPT VL   +PY  LHKT
Sbjct  617   NGIVERKHRHIQEMGLTLLAQSSLSPQYWVDAFLTSVFLINRLPTKVLDNLTPYFLLHKT  676

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP LRPYN HK+ +RS  C+FL Y    +GYRC++L + ++YI RH
Sbjct  677   EPTYMDLRVFGCACYPLLRPYNDHKLTFRSKKCIFLGYSNCQKGYRCLDLATKRVYISRH  736

Query  1711  VHFYESIF---LFSDSTLCSQPVPPTI----PWASEPVVTRAPCNTHAAPTDSAHMSLTS  1553
             V F E  F     ++ T   +  PP      P +  P V     N    P          
Sbjct  737   VIFDEHSFPAKELAEYTTSRRTNPPADIVIPPISHSPQVLPEXDNISNNPI---------  787

Query  1552  PVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDP  1373
                         ++       TR +   +Q +         H TR   + F A+  T +P
Sbjct  788   ------------VQPTFTQIQTRXKTGHSQPKSFPDYTLYYH-TRHPLQAFSAVLDTPEP  834

Query  1372  TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQY  1193
             T Y+QA                        L       ++V  KWV++ K   DGSIE++
Sbjct  835   TSYTQA-----------------------SLCPRPLDKHIVRNKWVYKIKXRPDGSIERF  871

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             KARLVAKG++Q +G D+ +TFS V+KPTT+RL+ ++ V  +W ++QLDV NAFL+G L E
Sbjct  872   KARLVAKGYDQKSGVDYHETFSPVIKPTTIRLVLAIAVHFHWPIQQLDVSNAFLHGFLDE  931

Query  1012  TVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              V+M+QP G+ D T P +V      +LYGL+
Sbjct  932   EVFMEQPRGFVDETKPHYV-CKLHKSLYGLK  961


 Score =   130 bits (327),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 118/225 (52%), Gaps = 19/225 (8%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+ ++    +  S+ + VGNG+GL +   G  +        HL+ +L+ P+ +  L S+ 
Sbjct  335   ATNLTHQQPFCESETVTVGNGSGLQVLNTGSTTFNFGQSNFHLNKILHCPQAATNLISIN  394

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTS-------R  2551
             +   +NN +F    + F+VK+++T  +LL+G    GLY L   ++    LT        R
Sbjct  395   QFCLDNNCYFILTANGFVVKENLTGRILLQGVVENGLYPLAGCKTFHKSLTCLSTTIGVR  454

Query  2550  ATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT------SCHLSKASRFPLDRV  2389
             A +  WH RLGHP++ + N +  S     NK+   GS T      +C L KA + P    
Sbjct  455   ANADTWHSRLGHPSSVIFNSLFHS-----NKLSVKGSSTKLEFCSACQLGKAKQLPFPES  509

Query  2388  SYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             S  S   L L+++D+W  +PV ST G  Y++LF+DDYSR+ W YP
Sbjct  510   SRQSSVPLALIHSDVWV-SPVQSTGGCSYYVLFIDDYSRYSWLYP  553


 Score = 72.0 bits (175),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 83/160 (52%), Gaps = 18/160 (11%)
 Frame = -2

Query  3596  VSIKLT-YRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaap  3420
             +S+KL    N++ W+ Q +  LRG +L+G++D    CPP      +ASG           
Sbjct  21    ISVKLDGSHNYLAWKMQFLNLLRGHDLMGFIDGTEACPPKH----TASGS----------  66

Query  3419  tpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSP  3240
               NPAY  W K+D  +L  +++SLS++++    G  TS+ VW ++     S SR+R    
Sbjct  67    -LNPAYVVWQKKDVCLLGWILASLSEKLVSTIYGLETSKQVWTALQTRFSSQSRSRISHL  125

Query  3239  LGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
               Q   L QG  S  EYL  A+ L + LA AG P+  D+Q
Sbjct  126   KRQLQTLTQGTKSCSEYLESAKTLADQLAAAGKPV--DDQ  163



>emb|CAN71996.1| hypothetical protein VITISV_023485 [Vitis vinifera]
Length=1087

 Score =   290 bits (742),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 168/432 (39%), Positives = 223/432 (52%), Gaps = 59/432 (14%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F++++E QF   IK +Q D GGE+      L  +GI HR S  Y   Q
Sbjct  391   QTKDQXLPIFKRFKLQMENQFDTKIKCLQXDNGGEFXSFMSFLQAVGIAHRFSYPYNSTQ  450

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NGRVERK+RH+VET LALL+  S+  +YW   F+MAT LIN +P+ VL+++SPY  L + 
Sbjct  451   NGRVERKHRHVVETXLALLSYASLPMKYWYCTFQMATFLINLMPSKVLEYDSPYFPLFRR  510

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP++RPYN HK++YRS               +  N++   +     
Sbjct  511   HPDYKSLRVFGCLCYPFIRPYNTHKLQYRSV--------------QYSNISHASM-----  551

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARG  1532
                        DS   S    P                    PTDS     TS       
Sbjct  552   -----------DSHXLSTSESPI-------------------PTDSXSPLDTSSFSPTID  581

Query  1531  LPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAV  1352
             LPP ++  P  TAPT           R     +  +T+  +    +    ++P+   Q  
Sbjct  582   LPPESVLEPQVTAPT----------PRMTTRSMGGITKKKTILDQSAIKVSEPSTLKQTF  631

Query  1351  GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAK  1172
                 W  AM+ E  A   N TW LV   P +NV+GCKW  + K   DGSIE+YKARLVAK
Sbjct  632   KDPNWTKAMEMEIAAFHRNHTWDLVEQPPDVNVIGCKWANKLKHKPDGSIERYKARLVAK  691

Query  1171  GFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQP  992
             G+NQ  G D+F+TFS VVK  T+R++ ++ +S  W +RQLDVHNAFLNG L E VY  QP
Sbjct  692   GYNQTHGLDYFETFSPVVKXATIRIILTVALSFKWEIRQLDVHNAFLNGELEEQVYXSQP  751

Query  991   PGYEDPTHPDHV  956
             PGY D   P+ V
Sbjct  752   PGYFDTQFPNRV  763


 Score =   125 bits (313),  Expect(2) = 7e-106, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 99/187 (53%), Gaps = 19/187 (10%)
 Frame = -1

Query  2766  HLSNVLYVPKLSVPLFSVYRLT--NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYR  2593
             HL+  L     + P     R+T  N+NN   EFH + F VKD  T+ VL +G    GLY+
Sbjct  204   HLTQNLGNXTSTSPYTGTDRVTIGNDNNALIEFHSNVFFVKDRHTKMVLAQGKLENGLYK  263

Query  2592  LPVS---------------RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNK  2458
              P+                 SHF   T    + +WH RLGH  + + ++V+ +C VA  K
Sbjct  264   FPMFSNKKPYSSINNASAFHSHFXS-TVENKAELWHNRLGHAASDIVSKVMNTCNVASRK  322

Query  2457  VKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDY  2278
              KS      C L+K+ R P    ++ +   L+L+YTDIWGPA V ST   +YF+LFVDDY
Sbjct  323   YKSTVC-FDCQLAKSHRLPTQLSNFHAFKSLELVYTDIWGPASVKSTFEAKYFILFVDDY  381

Query  2277  SRFCWFY  2257
             SR+ WFY
Sbjct  382   SRYTWFY  388



>ref|XP_009145096.1| PREDICTED: uncharacterized protein LOC103868780 [Brassica rapa]
Length=2690

 Score =   280 bits (716),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/507 (36%), Positives = 255/507 (50%), Gaps = 64/507 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  VE +F   I ++  D GGEY  +   L   GI+H  S  +T E 
Sbjct  1246  KQKSQVRETFIAFKALVENRFKTRIVTLYSDNGGEYIGLRSFLATHGISHLTSPPHTPEH  1305

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL + +V + YW FAF  A  LIN +P+ V Q  SPY +L   
Sbjct  1306  NGISERKHRHIVETGLTLLGKSAVPRCYWPFAFAAAVYLINRMPSPVTQNVSPYAKLFGQ  1365

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFG  C+P+LRPY ++K++ RS PCVFL Y  +   Y C++  + ++Y  RH
Sbjct  1366  QPNYQKLRVFGSLCFPWLRPYAQNKLDVRSIPCVFLGYSLTQSSYICLDPKTQRLYSSRH  1425

Query  1711  VHFYESIFLFSDSTL---------------CSQP-------------VPPTIPWASEPVV  1616
             V F E  F F   T                 S P             VPP          
Sbjct  1426  VQFLEDTFPFRTQTSPSAPSHPSPEPEHPASSNPELIVVPLGQTRSTVPPCSVQHQNLQQ  1485

Query  1615  TRAPCNTHAAPTDSAHMSLTS-----------------PVPLARGLPPLAIEGPVQTAPT  1487
             + +P N+  +P +++    +S                 P PL+    P  +  P +  PT
Sbjct  1486  SLSPMNSPVSPENASPSIPSSDSTRGDQMGSERSTGMFPHPLSTNTEPTNVNLPSEPVPT  1545

Query  1486  RARAV*TQHQERG--------------HVMRLRHMTRDTS-EQFHALNVTTD---PTCYS  1361
                       + G              H M+ R        +   +LN+ T    PT  +
Sbjct  1546  NVPQPPNSPSQSGTQSQNPAPPAPPNQHSMKTRSKNNIIKPKSKFSLNIQTRPIIPTTVN  1605

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             QA+    WR++M  EF+A+  N T+ LV   P+ NV+  KW+F  K   +G I+++K+R+
Sbjct  1606  QALRDRKWRNSMSLEFDAITRNHTYDLVPPAPYQNVIDTKWIFTLKYLPNGEIDRHKSRI  1665

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VA+GFNQ  G D+ +TFS V+K TTVRL+    V  +WT+RQ+DV+NAFL G L + VY+
Sbjct  1666  VARGFNQRYGIDYAETFSPVIKSTTVRLVLEHAVRKDWTIRQIDVNNAFLQGTLQDEVYV  1725

Query  1000  KQPPGYEDPTHPDHVRVSSSTALYGLR  920
              QPPG+ D   P HV      ALYGL+
Sbjct  1726  SQPPGFVDKDRPHHV-CRLRKALYGLK  1751


 Score =   128 bits (322),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 114/209 (55%), Gaps = 9/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G GL IS +G A +P+ S    L +VLYVP L   L SVYRL N N V 
Sbjct  1039  YNGGEEVTIADGTGLSISHIGSAILPTPSHSFPLRDVLYVPNLHKNLVSVYRLCNANQVS  1098

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHF-AYLTSRATST---VWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  P+  +    YL S +  T    WH RLGH
Sbjct  1099  VEFFPAHFQVKDLSTGARLLQGKTKNELYEWPLPPTKITTYLASPSPKTSLASWHSRLGH  1158

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  +   ++   S P++ + +K   S   C  +K+ + P    +  S   L  LY+D+W
Sbjct  1159  PSLPILKTLVSQFSLPIS-DSIKQF-SCVDCLTNKSHKLPFHTNTIKSDKPLQYLYSDVW  1216

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S+  ++Y+L+FVD ++R+ W YP
Sbjct  1217  T-SPIVSSDHYKYYLIFVDHFTRYTWLYP  1244



>emb|CAN79884.1| hypothetical protein VITISV_002539 [Vitis vinifera]
Length=1453

 Score =   280 bits (716),  Expect(2) = 6e-103, Method: Compositional matrix adjust.
 Identities = 193/484 (40%), Positives = 245/484 (51%), Gaps = 56/484 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             ++KSD +  F  F+  VE Q+S  IK  Q D G E+   +    L + GI H+ SC YT 
Sbjct  508   KLKSDFFDIFLQFQKLVENQYSTKIKIFQSDGGAEFTSNRFQSHLQQFGIHHQMSCPYTP  567

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
              QNGR ERK+RH+ ETGLALL    V  +YW  AF  AT +IN LP  VL   SP+  L 
Sbjct  568   SQNGRAERKHRHVTETGLALLFHSHVPPRYWVDAFSTATYIINRLPLPVLGGLSPFEVLF  627

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y     FGCR YP LR Y  HK   RS PC+FL Y  S +G+RC + T+ + YI 
Sbjct  628   GKSPNYENFHPFGCRVYPCLRDYAPHKFSPRSLPCIFLGYSSSHKGFRCFDTTTSRTYIT  687

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTR------APCNTHAAPTDSAHM---  1565
             RH  F E  F FS+++  +      +    EP          +P  T   P+ S H    
Sbjct  688   RHARFDEHFFPFSNTSSATSIADIGLSNFFEPCALEPSPSTSSPTTTRVPPSPSCHFCAD  747

Query  1564  --------------------SLTSPVPLAR-GLPPLAIEGPVQTAPTRARAV*TQH----  1460
                                 +  SPVP +   L P A   P+    T   A    H    
Sbjct  748   DFAVEPLQVSSSAPESTSSSAAVSPVPASMTTLVPFA--APMDPIHTTTSATPASHPMIT  805

Query  1459  QERGHVMRLRHMTR----DTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHND  1292
             + +  + + RH +      +S   HAL  T++P  +  A  +  W  AMD E   L  N 
Sbjct  806   RAKSGIFKPRHPSHLSFVQSSPLIHALLATSEPKGFKSAAKNPAWLAAMDDEIKVLQTNH  865

Query  1291  TWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
             TW LV    + N+VG KWVFRTK  +DGSIE++KARLVAKG+ Q+               
Sbjct  866   TWDLVPRPSNTNIVGSKWVFRTKFLSDGSIERFKARLVAKGYTQLPA-------------  912

Query  1111  TTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTAL  932
             +TVR++ SLVVSH W L QLDV NAFLNG L ETVYM+QPPGY DP HP HV      AL
Sbjct  913   STVRVVLSLVVSHKWPLCQLDVKNAFLNGILHETVYMEQPPGYVDPRHPLHV-CKLKKAL  971

Query  931   YGLR  920
             Y L+
Sbjct  972   YDLK  975


 Score =   125 bits (313),  Expect(2) = 6e-103, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 118/218 (54%), Gaps = 12/218 (6%)
 Frame = -1

Query  2886  SMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYR  2707
             S + + + Y G D + VGNGA L I+   H    S S  L L +VL VP+L+  L S+ +
Sbjct  294   SQLDKVEPYHGKDCVIVGNGASLPIT---HTGTLSSSSNLQLLDVLVVPRLTKNLLSISK  350

Query  2706  LTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR----ATST  2539
             LT++  +   F  D F+V++ IT   + +G  +GGLY L    S FA +       A+  
Sbjct  351   LTSDFPLSVTFSHDNFVVQNRITGMAVAKGKRAGGLYVLERGHSAFASVLRNKNLHASFE  410

Query  2538  VWHRRLGHPNAHVQ---NRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNV  2368
             +WH RLGH N  +    N+  Q    +     SL S  +C L+K+ R P    +  S  V
Sbjct  411   LWHARLGHVNHSILSLLNKKGQLFLTSLLPTPSLCS--TCQLAKSHRLPFSSNTTRSNVV  468

Query  2367  LDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             L L++ DIWG APV S  GF Y++LF+DDYSRF W YP
Sbjct  469   LGLVHCDIWGLAPVKSNLGFNYYVLFIDDYSRFTWLYP  506


 Score = 72.0 bits (175),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 79/156 (51%), Gaps = 11/156 (7%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             H ++IKL+  N++ WR QL+P L+ Q LL +VD     PP TIA  S+S           
Sbjct  13    HMITIKLSSTNYLLWRNQLLPLLQCQNLLSHVDGSVAPPPITIAVDSSSSQP--------  64

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
                NP Y AW  QDQ +LSLL SSL++E M   +G TT+R VW ++  +    S+   L 
Sbjct  65    ---NPQYVAWQLQDQRLLSLLFSSLTEEAMTEVLGLTTARDVWLALENSFSHISKTCELR  121

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                    +++G  S  EY    + L + L   G  +
Sbjct  122   IKDDLQLIKRGTRSVTEYSRSFKALCDQLTAMGRSV  157



>emb|CAC37623.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   272 bits (695),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 176/480 (37%), Positives = 250/480 (52%), Gaps = 40/480 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R+KS     F +++  VE Q    IK  Q D GGE+   K+     + GI HR SC YT 
Sbjct  553   RMKSKFISVFIAYQKLVENQLGTKIKEFQSDGGGEFTSNKLKEHFREHGIHHRISCPYTP  612

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK+RH+VE GL++L       ++W  AF  A  L N LP+SVL+  SPY  L 
Sbjct  613   QQNGVAERKHRHLVELGLSMLYHSHTPLKFWVEAFFTANYLSNLLPSSVLKEISPYETLF  672

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
             +    YT LRVFG  CYP LRP  ++K + RS  CVFL Y   ++GYRC+   +GK+YI 
Sbjct  673   QQKVDYTPLRVFGTACYPCLRPLAKNKFDPRSLQCVFLGYHNQYKGYRCLYPPTGKVYIS  732

Query  1717  RHVHFYESIFLFSD----------STLC-----SQPVPPTIPWASEPVVTRAPCNTHAAP  1583
             RHV F E+ F F +          +TL      +   PP++P +    + R      A  
Sbjct  733   RHVIFDEAQFPFKEKYHSLVPKYQTTLLQAWQHTDLTPPSVPSSQLQPLARQ-MTPMATS  791

Query  1582  TDSAHMSLTSPVPLARGLPPLAIE------------GPVQTAPTRARAV*TQHQERGHVM  1439
              +   M+  +   +   +   + E             PV        A+     E  H M
Sbjct  792   ENQPMMNYETEEAVNVNMETSSDEETESNDEFDHEVAPVLNDQNEDNALGQGSLENLHPM  851

Query  1438  RLRHMTRDTSEQ---FHALNVT----TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKL  1280
               R  ++D  ++    +AL V+     +P   + A+ H  W  A+  E + +   +TW L
Sbjct  852   ITR--SKDGIQKPNPRYALIVSKSSFDEPKTITTAMKHPSWNAAVMDEIDRIHMLNTWSL  909

Query  1279  VLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVR  1100
             V     MN++  KWVF+TK   DG+I++ KARLVAKGF+Q  G D+ +TFS VV+  T+R
Sbjct  910   VPATEDMNILTSKWVFKTKLKPDGTIDKLKARLVAKGFDQEEGVDYLETFSPVVRTATIR  969

Query  1099  LLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             L+     ++ W L+QLDV NAFL+G L E V+M QP G+ DP  P+HV    + ALYGL+
Sbjct  970   LVLDTATANEWPLKQLDVSNAFLHGELQEPVFMFQPSGFVDPNKPNHV-CRLTKALYGLK  1028


 Score =   132 bits (333),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 118/220 (54%), Gaps = 10/220 (5%)
 Frame = -1

Query  2895  VTASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFS  2716
              + S +  +  Y G+D + VG+G  L I+ VG  +I S    + L+ VL  P +   L S
Sbjct  336   ASTSGLQNATTYEGNDAVLVGDGTYLPITHVGSTTISSSKGTIPLNEVLVCPAIQKSLLS  395

Query  2715  VYRLTNE--NNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR---  2551
             V +L ++    V+F+ +K C I  D  T+ V+ +G  + GLY L    S F  L S    
Sbjct  396   VSKLCDDYPCGVYFDANKVCII--DLTTQKVVSKGPRNNGLYML--ENSEFVALYSNRQC  451

Query  2550  -ATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSK  2374
              A+   WH RLGH N+ +  ++L    +  NK ++      C + K++R       + + 
Sbjct  452   AASMETWHHRLGHSNSKILQQLLTRKEIQVNKSRTSPVCEPCQMGKSTRLQFFSSDFRAL  511

Query  2373  NVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               LD ++ D+WGP+PV+S  GF+Y+ +FVDD+SRF WF+P
Sbjct  512   KPLDRVHCDLWGPSPVVSNQGFKYYAVFVDDFSRFSWFFP  551


 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             V++KL   N++ W+TQ    L  Q+L+G+V+      PP    L  + D        +  
Sbjct  17    VTLKLNDSNYLLWKTQFESLLSSQKLIGFVNGVVT--PPAQTRLVVNDD------VTSEV  68

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
             PNP Y  W   DQ + S L  +LS+EV+      TTSR +W S+      SS AR  S  
Sbjct  69    PNPQYEDWFCTDQLVRSWLFGTLSEEVLGHVHNLTTSRQIWISLAENFNKSSIAREFSLR  128

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                  L + + S   Y    +++ + L+  G P+
Sbjct  129   RNLQLLTKKDKSLSVYCRDFKIICDSLSSIGKPV  162



>emb|CAN67247.1| hypothetical protein VITISV_008682 [Vitis vinifera]
Length=1270

 Score =   294 bits (753),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 173/450 (38%), Positives = 245/450 (54%), Gaps = 37/450 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K     TF +FR  +E Q + +IK IQ D GGE+      L   GI H+ SC +T +QNG
Sbjct  470   KDQALSTFITFRKMIENQLNSTIKCIQSDNGGEFIAFKPYLEAHGIVHQFSCPHTPQQNG  529

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R +RK RH+VETG+ALLA+  +  +YW FAF+ +  LIN LPT +L F+SP   L    P
Sbjct  530   RAKRKIRHLVETGMALLAQSFLPSKYWSFAFQTSVYLINLLPTKLLNFQSPLQVLFHKIP  589

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRPYN HK+ YRS  CVFL Y  + +GY C+++++ ++YI R V 
Sbjct  590   NYHHLRVFGCLCFPSLRPYNHHKLSYRSTACVFLGYASAHKGYICLDVSTSRLYISRDVL  649

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP------  1544
             F+ES F F       Q +P  +P      +T A  N     T S   +++ P+P      
Sbjct  650   FHESSFPF-------QSIPAPLPLPQHTPLTSALINPPFLSTSSP-PTVSFPIPTSSTDC  701

Query  1543  --LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPT  1370
                +  LPPL ++ P    P+   +  +      H M  R  +    ++   +  T++P 
Sbjct  702   TSTSDSLPPL-LQVPFSPTPSPTPSS-SPSPLNTHPMVTRAKSGIHKKKSFLMQTTSEPH  759

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
              YSQA     W  AM  E+ ALL N TW LV   P  ++VGC+W+++ K   +GS+E++K
Sbjct  760   TYSQAFKSEPWVQAMQHEYQALLRNHTWSLVPPPPSAHIVGCRWIYKLKYLPNGSVEKHK  819

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARL +                   +  T+RL+ +L VS  W +RQLDV NAFLNG L E 
Sbjct  820   ARLSS------------------CEACTIRLILALAVSFQWPIRQLDVENAFLNGDLQEE  861

Query  1009  VYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V++ QP G+  P +P +V      ALYGL+
Sbjct  862   VFIAQPQGFVHPKYPHYV-CKLHKALYGLK  890


 Score =   105 bits (261),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -1

Query  2649  DSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT-----STVWHRRLGHPNAHVQNRVL  2485
             D +T+  LL+G    GLY  P S S  A++++ +        +WH RLGHP A + ++ L
Sbjct  329   DQVTKQTLLKGWLKDGLYEFPSSSSTHAFVSTSSIPALTPGAIWHSRLGHPAAPILSKAL  388

Query  2484  QSC-PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGF  2308
               C P    ++  +     C L+K+   P    S  +   L L++TD+WGPAP  STS  
Sbjct  389   AFCNPSVSFQINKIAPCKICPLAKSHSLPYSLSSSHASQPLALIHTDLWGPAPSPSTSSA  448

Query  2307  RYFLLFVDDYSRFCWFY  2257
             RYFLLF+DDYSR+ W Y
Sbjct  449   RYFLLFIDDYSRYTWIY  465



>ref|XP_008351324.1| PREDICTED: uncharacterized protein LOC103414737 [Malus domestica]
Length=1269

 Score =   256 bits (655),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 166/439 (38%), Positives = 231/439 (53%), Gaps = 40/439 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIH--HTLTKLGITHRKSCAYTHEQ  2072
             K+ ++  F  F+  V+  F+  I+ +Q D GGEY  IH  + L   GI H KSC YT +Q
Sbjct  765   KAAVFGLFVQFQAFVQNFFNVHIRILQSDGGGEYIGIHFQNFLKDKGILHHKSCPYTPQQ  824

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VERK RHI ET + LL +  +  Q+W  A   A  LIN +PT VL  +SP+  L+ +
Sbjct  825   NGLVERKNRHITETAITLLQQACLPPQFWYHACATAVYLINRMPTPVLSMKSPFEVLYHS  884

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    L++FG  CYP L+PY  HK+  +++ C+FL Y   ++G+ C N T  K+ + +H
Sbjct  885   SPKLDHLKIFGYACYPSLKPYRSHKLAPKTSECIFLGYVAQYKGFICFNPTDNKLIVSQH  944

Query  1711  VHFYES----------IFLFSDSTLCSQPVPPTI----PWASEP---VVTRAPCNTHAAP  1583
             V F ES              S     S  VP       P AS P   V  R   + H  P
Sbjct  945   VIFDESHXPATNMASHFDSGSKVASISSTVPSNTFHHPPLASVPFPQVFFRDSSSQHNPP  1004

Query  1582  TDSAHMS---LTSPVPLARG------LPPLAIEGPVQTA--PTRARAV*TQHQERGHVMR  1436
               S+  S    +  +P   G      +   AI G V +   P    +  ++ Q+      
Sbjct  1005  VCSSAPSEFVSSGTIPSLPGDISMDHMSSAAISGQVMSELHPDTHLSQVSELQQVSVAAV  1064

Query  1435  LRH--MTRDTSEQF---HALNV-----TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTW  1286
               H   TR  S  F    A +V       +P  YS A     WR AM++E +ALL  +TW
Sbjct  1065  NSHPIQTRSKSGIFKKKQAFSVEVQSGAQEPQSYSAACKLSEWRGAMEEEMDALLQQNTW  1124

Query  1285  KLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTT  1106
              LV   P  N+VGCKW+++ K++ DG++ +YKARLVAKGF+Q AG D+++TFS VVKPTT
Sbjct  1125  TLVPLPPDKNLVGCKWIYKIKKHPDGTVARYKARLVAKGFSQEAGLDYYETFSPVVKPTT  1184

Query  1105  VRLLFSLVVSHNWTLRQLD  1049
             +RLL SL  S+ W L+QLD
Sbjct  1185  MRLLLSLAASNGWKLKQLD  1203


 Score =   135 bits (339),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 117/207 (57%), Gaps = 4/207 (2%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y+ SD +   NG GL I+ + H+++P +S  + L +VL+VP+LS  L S+++L  +NN  
Sbjct  555   YSSSDTVTGANGEGLHIAHIRHSTLPLQSHNICLKSVLHVPQLSQHLLSMHQLCKDNNCR  614

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHF----AYLTSRATSTVWHRRLGH  2515
                 +    ++D +T+ VL RG ++  +Y LPV +S      AY+  R  S +WH RLGH
Sbjct  615   CIVBESSVCIQDKVTQEVLYRGLSNNAVYPLPVMKSSHVSPAAYIGRRINSALWHCRLGH  674

Query  2514  PNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGP  2335
             P + V    L    +    + S  +  +C   K +  P   ++  S    ++++TD+WGP
Sbjct  675   PASSVVKAALSKADIPFKCLDSFYTCKACLQGKFANLPFPYLASKSVIPFEVIHTDVWGP  734

Query  2334  APVISTSGFRYFLLFVDDYSRFCWFYP  2254
             +P +S  G+RY++ F+D+ +R+ W +P
Sbjct  735   SPSLSIEGYRYYVSFIDECTRYTWIFP  761



>gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1149

 Score =   236 bits (601),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/470 (36%), Positives = 235/470 (50%), Gaps = 38/470 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY---RKIHHTLTKLGITHRKSCAYTHE  2075
             KSD    F  F+  VE      I + Q D GGE+   R + H L + GI H  SC +T +
Sbjct  545   KSDFCSLFMKFQSFVENLLQTKIGTFQSDGGGEFTSNRFLQH-LQESGIQHYISCPHTPQ  603

Query  2074  QNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFES-PYTRLH  1898
             QNG  ERK+R + E GL L+ +    Q++W  AF  A  L N LPTS L   + PY  L 
Sbjct  604   QNGLAERKHRQLTERGLTLMFQSKAPQRFWVEAFFTANFLSNLLPTSALDSSTTPYQVLF  663

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y+ LR FGC C+P LR Y R+K + RS  C+FL Y   ++GYRC    + ++Y+ 
Sbjct  664   GKAPDYSALRTFGCACFPTLRAYARNKFDPRSLKCIFLGYTEKYKGYRCFFPPTNRVYLS  723

Query  1717  RHVHFYESIFLFSDSTLCSQ---PVPPTIPWASEPVVTRAPC-NTHAAPTDSAHMSLTSP  1550
             RHV F ES F F D+    Q   P P    W      + +P  N   A  +S     + P
Sbjct  724   RHVLFDESSFPFIDTYTSLQHPSPTPMFDAWLKSFPSSSSPLENDQTAGFNSGA---SVP  780

Query  1549  VPLARGLPPLAI--EGPVQTAPTRARAV*TQHQERGH----VMRLRHM-TRDTSEQFHAL  1391
             V  A+   P+    +GP    P     V + +Q+       V  L+ + + D ++    L
Sbjct  781   VITAQQTQPILSLKDGPNILLPEGEITVSSNNQDIEDEPICVTPLQTLSSEDNAKSSETL  840

Query  1390  NVTTDPTCYSQAVGHL*WRDAMDQEFNAL--------LHNDTWKLVLDEPH-MNVVGCKW  1238
             ++ ++      A   L   D +    NAL        L +   +   +  H M     K 
Sbjct  841   SMGSEECSECTASFDL---DPIGN--NALSSSPRHDQLTSSIPRAATESTHPMTTRLKKG  895

Query  1237  VF----RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHN  1070
             +     R K N DGS+++YKARLVA+GF Q  G D+ +T+S VV+  TVR +  L    N
Sbjct  896   IIKLNQRVKLNVDGSLDKYKARLVAQGFKQEEGIDYLETYSPVVRSATVRAVLHLSTIMN  955

Query  1069  WTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             W L+Q+DV N FL+G L ETVYMKQP G+ D  HPDHV +    ALYGL+
Sbjct  956   WELKQMDVKNGFLHGDLTETVYMKQPAGFIDKAHPDHVCLLHK-ALYGLK  1004


 Score =   155 bits (391),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 120/215 (56%), Gaps = 4/215 (2%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             +S + Q   Y G+D +   +G  L I+ +G A++PS S  L L +VL  P ++  L SV 
Sbjct  328   SSRLQQMQPYLGNDTVMASDGNFLPITHIGSANLPSTSGNLPLKDVLVCPNIAKSLLSVS  387

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGS-TSGGLYRLPVSRSHFAYLTS--RATST  2539
             +LT +    F F  D  +VKD  T  VL +GS TS GLY+L   +    Y T   +AT  
Sbjct  388   KLTKDYPCSFTFDADGVLVKDKATCKVLTKGSSTSEGLYKLENPKFQMFYSTRQVKATDE  447

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             VWH RLGHPN  V   +     +  NK  S     SC L K+SR P     + +   L+ 
Sbjct  448   VWHMRLGHPNPQVLQLLANKKAIQINKSTSKMCE-SCRLGKSSRLPFIASDFIASRPLER  506

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGPAPV S  GF+Y+++F+D+ SRFCWFYP
Sbjct  507   VHCDLWGPAPVSSIQGFQYYVIFIDNRSRFCWFYP  541


 Score = 70.1 bits (170),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 75/155 (48%), Gaps = 14/155 (9%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             V++KLT RN+I W++Q   FL GQ LLG+V+     P  T++    +G            
Sbjct  19    VTVKLTDRNYILWKSQFESFLSGQGLLGFVNGAYAAPTGTVSGPQDAG-------VTEAI  71

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
             PNP Y+AW + DQ         +S++++ + VG  TS  VW ++       S +R     
Sbjct  72    PNPDYQAWFRSDQ-------VVMSEDILSVVVGSKTSHEVWMNLAKHFNRISSSRIFELQ  124

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPIS  3132
              + H L +   +  EYL   + + + LA  G P++
Sbjct  125   RRLHSLSKEGKTMEEYLRYLKTICDQLASVGSPVA  159



>emb|CAN62863.1| hypothetical protein VITISV_030334 [Vitis vinifera]
Length=1442

 Score =   289 bits (739),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/453 (38%), Positives = 242/453 (53%), Gaps = 48/453 (11%)
 Frame = -3

Query  2248  VKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQN  2069
              KS +   F  F++ VE +F   IK++  D GGE+  +   L   GI+H  +  YT +QN
Sbjct  617   TKSSVSTIFPQFKIFVETRFQAKIKTLYSDNGGEFISLKPFLNLHGISHYTTAPYTPQQN  676

Query  2068  GRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTP  1889
             G  ER++RH+VETGL LL++ S+   YW  AF  AT LIN  PT +L  +SP+  L    
Sbjct  677   GVSERRHRHLVETGLTLLSDASLPLSYWPHAFRTATYLINRQPTPLLTNKSPFEALFGQK  736

Query  1888  PPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHV  1709
             P Y  L+ FG  CYP  RPYN  K++ +S PC   +  P+F              + R+ 
Sbjct  737   PNYLKLKKFGSLCYPLTRPYNNXKMQPKSIPCKPPLSSPNFPLXD----------VLRNS  786

Query  1708  HFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGL  1529
               + ++ +  D  L S               +  P +TH      A ++L+     +  +
Sbjct  787   GSHSNVLISHDXVLXS---------------SLHPTHTHTV----ADLTLSQ----SHSI  823

Query  1528  PPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVG  1349
             PP      VQT   R   + T+        +  H+        H + +  +PTC +QAV 
Sbjct  824   PPSC----VQTGNPRLHKMTTRSMNNIFKPKQLHLVSK-----HPIPLAIEPTCATQAVN  874

Query  1348  HL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKG  1169
             H  WRDAM  E  AL+ + TW LV   P+   VGCKWVFR KR ADGS++++K RLVAK 
Sbjct  875   HPQWRDAMSTELTALMKHGTWDLVPPLPNCTPVGCKWVFRVKRKADGSVDKFKTRLVAKD  934

Query  1168  FNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPP  989
             + Q  G D+ +TFS VV+P T+R + ++ V + W LRQ+D++NAFL+G L ETVYM QPP
Sbjct  935   YTQRPGLDYKETFSPVVRPATIRCVLTIAVMNGWPLRQMDINNAFLHGTLTETVYMMQPP  994

Query  988   GYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             G++D + PDHV      A+YGLR      +PRA
Sbjct  995   GFKDTSKPDHV-CRLRKAIYGLRQ-----APRA  1021


 Score = 92.4 bits (228),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 74/142 (52%), Gaps = 9/142 (6%)
 Frame = -1

Query  2658  IVKDSITRAVLLRGSTSGGLYRLPVS-----RSHFAYLTSRATSTVWHRRLGHPNAHVQN  2494
             +  + IT A+LLRGS   G+Y    S         A +  R     WH+RLGHP+  +  
Sbjct  475   VSHEPITGAILLRGSCENGIYIFSESLVGNFSQKVANVHERMLLDGWHKRLGHPSYPIVK  534

Query  2493  RVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVIS  2320
              ++   S P   NK+  L    SC ++K+ + P    S SS   L ++YTD+WGPA    
Sbjct  535   NLVSIFSLPTTTNKITMLCR--SCSINKSHQQPFRTTSLSSTGPLKIIYTDVWGPAHSTG  592

Query  2319  TSGFRYFLLFVDDYSRFCWFYP  2254
               G RY+LLFVD Y+ + WFYP
Sbjct  593   LDGSRYYLLFVDHYTIYMWFYP  614


 Score = 59.3 bits (142),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 72/158 (46%), Gaps = 16/158 (10%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             ++ KLT   F  WR Q    L G +LL YV   + CP P+   +SA   +          
Sbjct  156   INEKLTPSTFPQWRAQFEALLIGYDLLDYVTGISQCPSPSDLSISALHKT----------  205

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
                    W++QD+ ILS L++S S  +  L     TS   W+ +     S SR R +   
Sbjct  206   ------HWVRQDKLILSALLASTSPTITPLIATAKTSHEAWQKLNTLYASKSRTRAMQLK  259

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDE  3123
              +   +++GN    +YL   + L +++A   HPIS D+
Sbjct  260   EELTLIQRGNRLISDYLHAVKSLADEIAIIDHPISDDD  297



>emb|CAN68496.1| hypothetical protein VITISV_010947 [Vitis vinifera]
Length=1539

 Score =   324 bits (830),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 257/450 (57%), Gaps = 19/450 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K     TF + R  +E Q + +IK IQ D GGE+      L   GI H+  C +T +QNG
Sbjct  746   KDQALSTFITIRKMIENQLNSTIKCIQSDNGGEFIAFKPYLEAHGIVHQFLCPHTAQQNG  805

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK  H+VETG+ALLA+  +  +YW FAF+ +  LIN LP  +L F+SP   L    P
Sbjct  806   RAERKICHLVETGMALLAQSFLPSKYWSFAFQTSVYLINLLPAKLLNFQSPLQVLFHKIP  865

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVF C C+P LRPYN HK+ YRS  CVFL Y  + +GY C+++++ ++YI R V 
Sbjct  866   NYHHLRVFACLCFPSLRPYNHHKLSYRSTACVFLGYASAHKGYICLDVSTSRLYISRDVL  925

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP------  1544
             F+ES F F  S     P+P   P  S   +   P  + ++P+     +++ PVP      
Sbjct  926   FHESSFPF-QSIPAPSPLPQHTPLTS--ALINPPLLSTSSPS-----TMSFPVPTSSTDC  977

Query  1543  --LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPT  1370
                +  LPPL ++ P    P+   +  +      H M  R  +    ++   +  T++P 
Sbjct  978   TSTSDSLPPL-LQVPFAPTPSPTPSS-SSSPLNTHPMVTRVKSGIHKKKSFLMQTTSEPH  1035

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
              Y+QA     W  AM  E+ ALL N TW LV   P  ++VGC+W+++ K   +GS+E++K
Sbjct  1036  TYNQASKSEPWDQAMQHEYQALLRNHTWSLVPPPPSAHIVGCRWIYKLKYLPNGSVERHK  1095

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVA+GF +  G D+FDTFS +VKP T+RL+ +L VS  W +RQLDV N FLNG L E 
Sbjct  1096  ARLVAQGFTKTPGVDYFDTFSPIVKPCTIRLILTLAVSFQWPIRQLDVENXFLNGDLQEE  1155

Query  1009  VYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V+M QP G+  P +P +V      ALYGL+
Sbjct  1156  VFMAQPQGFVHPQYPHYV-CKLYKALYGLK  1184


 Score = 57.0 bits (136),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (43%), Gaps = 46/136 (34%)
 Frame = -1

Query  2649  DSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT-----STVWHRRLGHPNAHVQNRVL  2485
             D +T+  LL+G    GLY  P S S  A++++ +        +WH RLGHP   + ++ L
Sbjct  647   DQVTKQTLLKGWLRDGLYEFPSSSSTHAFVSTSSVPALTPGAIWHSRLGHPXXPILSKAL  706

Query  2484  QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFR  2305
              SC                  + +  F ++++                  AP       +
Sbjct  707   ASC------------------NPSVSFQINKI------------------APCA-----Q  725

Query  2304  YFLLFVDDYSRFCWFY  2257
             YFL+F+DDYSR+ W Y
Sbjct  726   YFLIFIDDYSRYTWIY  741


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I W+T +   +       Y+D   PCPP  +     + D V      
Sbjct  279   NHALPIKLDRNNYIJWKTXMENVVYANGFEEYIDGTKPCPPQELHTGELNPDFVQ-----  333

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ +LS L S+L+ ++M   VG  TS   W ++     SSS+AR L
Sbjct  334   ----------WRRFDRMVLSWLYSTLTPDIMGQIVGFQTSHDAWMALHKIFSSSSKARIL  383

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                 +F   ++G    +EY+ + + + ++LA  G P+
Sbjct  384   QLRLEFQTAKKGADPMLEYILKIKTIYDNLAAIGEPV  420



>emb|CAN66863.1| hypothetical protein VITISV_013500 [Vitis vinifera]
Length=1112

 Score =   341 bits (874),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 198/457 (43%), Positives = 258/457 (56%), Gaps = 24/457 (5%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD +  F  F+  VE+ F+R I ++  D GGEY+ +   LT  G++H  S  +T E NG
Sbjct  321   KSDTHDVFVHFKALVEKFFNRPIITLYSDNGGEYQALSSFLTINGVSHLTSPPHTPEHNG  380

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER++RHIVETGL+LL   S+   YW FAF     LIN LPT  L   S Y +L  T P
Sbjct  381   YSERRHRHIVETGLSLLTHASMPLSYWPFAFSTTVYLINRLPTPTLNHLSSYFKLFGTFP  440

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LR FGC CYP+LRPY   K+E RS+PC+F+ Y P+   Y C++ ++ ++Y  RHVH
Sbjct  441   NYSKLRSFGCLCYPWLRPYTSPKLESRSSPCIFVGYSPTQSAYLCLDTSTARLYTSRHVH  500

Query  1705  FYESIFLFSDS-TLCSQPVPPTIP-WASE--PVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
             F ESIF F  S T   +    TI  W S   PVV     N  +AP        ++PVP  
Sbjct  501   FVESIFPFVTSHTSLPRATSSTISEWCSMTLPVVATPSVNVGSAPXSKPDSHSSAPVPET  560

Query  1537  R----GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT---  1379
             +      PPL    P Q  P +   +        HV+  R    +  +     N+T    
Sbjct  561   KCDCANNPPLP---PTQNDPNQPPDL----SPSPHVIVTRS-KHNIHKPIQKXNLTAXLQ  612

Query  1378  ----DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNAD  1211
                 +PT  +QA+    WR AM  EF+ALL N TW LV   P  N+ GCKW+FRTK   +
Sbjct  613   QPTLEPTTVTQALKDPKWRQAMSAEFDALLRNGTWDLVPSHPXQNLXGCKWIFRTKYLPN  672

Query  1210  GSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFL  1031
             GSI++YKARLVAKGF+Q  G  + +TFS V+KPTTVRL+ SL V   W+LRQLD +N FL
Sbjct  673   GSIDRYKARLVAKGFHQXPGXXYSETFSPVIKPTTVRLVLSLAVXQGWSLRQLDXNNXFL  732

Query  1030  NGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              G L E  +M QPPG+ D  HP HV      A+YGL+
Sbjct  733   QGTLTEDXFMSQPPGFIDRDHPHHV-CKLRKAIYGLK  768


 Score = 86.7 bits (213),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 4/132 (3%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             + G+D + +G+G GL IS  G  S+ + S    LSNVL VP +   L S+ +    NN  
Sbjct  179   FDGTDEIMIGDGFGLPISHTGSTSLTTPSHSFTLSNVLCVPTMKRNLISISQFCKSNNTS  238

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A+LL+G T  G+Y  P+S +      A+ + + T + WH RLGH
Sbjct  239   IEFLPSSFHVKDLHTGAILLQGRTKDGVYEWPLSTTQSXPLIAFSSVKTTLSEWHHRLGH  298

Query  2514  PNAHVQNRVLQS  2479
             P+  +   ++ S
Sbjct  299   PSLSIFKNIMSS  310



>dbj|BAB10503.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1475

 Score =   270 bits (689),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/451 (36%), Positives = 236/451 (52%), Gaps = 24/451 (5%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K+D+ + F  F   VE Q+   +K+++ D   E R         GI    SC  T +Q
Sbjct  681   KAKNDVLQIFPDFLKMVETQYGTLVKAVRSDNAPELR-FEALYQAKGIISYHSCPETPQQ  739

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    AL+ E ++  ++W      A  LIN LPT +L  +SP+  LH  
Sbjct  740   NSVVERKHQHILNVARALMFEANMPLEFWGDCILSAVFLINRLPTPLLSNKSPFELLHLK  799

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P YT L+VFGC CY    P  RHK   R+  CVFL YP  ++GY+ ++L +  I+I RH
Sbjct  800   VPDYTSLKVFGCLCYESTSPQQRHKFAPRARACVFLGYPSGYKGYKLLDLETNTIHISRH  859

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPV---VTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             V FYE++F F+D T+    +P  +    +PV   +   P  + +AP  S+          
Sbjct  860   VVFYETVFPFTDKTI----IPRDVFDLVDPVHENIENPPSTSESAPKVSSKR--------  907

Query  1540  ARGLPPLAIEGPVQTA-PTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
                 PP  ++     A P   + V          +    ++ + +    A+N   +P  Y
Sbjct  908   -ESRPPGYLQDYFCNAVPDVTKDV---RYPLNAYINYTQLSEEFTAYICAVNKYPEPCTY  963

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
             +QA     W DAM+ E +AL   +TW +         +GCKWVF+ K NADGS+E++KAR
Sbjct  964   AQAKKIKEWLDAMEIEIDALESTNTWSVCSLPQGKKPIGCKWVFKVKLNADGSLERFKAR  1023

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVY  1004
             LVAKG+ Q  G D++DTFS V K TTV+ L S+     W+L QLD+ NAFLNG L E +Y
Sbjct  1024  LVAKGYTQREGLDYYDTFSPVAKMTTVKTLLSVAAIKEWSLHQLDISNAFLNGDLKEEIY  1083

Query  1003  MKQPPGY---EDPTHPDHVRVSSSTALYGLR  920
             M  PPGY   +    P +  +    +LYGL+
Sbjct  1084  MTLPPGYSMKQGGVLPQNPVLKLQKSLYGLK  1114


 Score =   108 bits (270),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 102/212 (48%), Gaps = 17/212 (8%)
 Frame = -1

Query  2853  SDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEF  2674
             S+ + +  G+ + I+ +G   + S    L L NVLY+P+  + L SV + T +      F
Sbjct  471   SNEVTLPTGSNVKIAGIGVIKLNSN---LTLKNVLYIPEFRLNLLSVSQQTKDMKCKIYF  527

Query  2673  HKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR------------SHFAYLTSRATSTVWH  2530
              +DC +++D I    + RG+  GGLY L  S             +   Y  +   S +WH
Sbjct  528   DEDCCVIQDPIKEQKIGRGNQIGGLYVLDTSSVECTSVDINSSVTEKQYCNAVVDSALWH  587

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKS-LGSRTSCHLSKASRFPLDRVSYSSKNVLDLLY  2353
              RLGHP ++ +N VL      P + K  L   + C  +K         +  S+N  DL++
Sbjct  588   SRLGHP-SYEKNDVLHDVLGLPKRNKEDLVHCSICQKAKQKHLSFPSKNNMSENKFDLIH  646

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              D WGP    +T G++YFL  VDDYSR  W Y
Sbjct  647   IDTWGPFATPTTEGYKYFLTIVDDYSRATWVY  678



>emb|CAN83392.1| hypothetical protein VITISV_041406 [Vitis vinifera]
Length=1262

 Score =   341 bits (875),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/490 (40%), Positives = 270/490 (55%), Gaps = 50/490 (10%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS   + F  F+ + E QF   +K+ Q D GGE+R +     + GI HR SC +T +Q
Sbjct  414   KTKSQTREAFLMFKAQAELQFGCKLKTFQTDWGGEFRSLKTYFEQNGIIHRLSCPHTSKQ  473

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG +ERK+RHIVE GL LLA+ S+  +YW  AF  A  LIN LPT VL+ + PY  L  +
Sbjct  474   NGIIERKHRHIVELGLTLLAQASLPLKYWPDAFSTAVFLINRLPTEVLKQKCPYEFLFNS  533

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ L+VFGC C+P+LRPYN+HK+++RS+PC FL Y    +GY+C+N   G+++I R 
Sbjct  534   KPNYSQLKVFGCLCFPHLRPYNKHKLDFRSSPCTFLGYSSKHKGYKCLN-QQGRMFISRS  592

Query  1711  VHFYESIFLFSDSTLCSQPVP---------PTIPWAS--EPVVTRAPCNTHAAPTDSAHM  1565
             V F E+ F F+D     +PV          P IP     EP       +   +   S+H 
Sbjct  593   VVFDETRFPFADR--LQKPVQIVSHSTVGLPCIPLVKNLEPJSVSPSLSLPTSSAQSSHQ  650

Query  1564  -------------------SLTSPVPLAR---------------GLPPLAIEGPVQTAPT  1487
                                  +S VP+                 G  PL+          
Sbjct  651   LDENLGSDIRSIQXDFSNTDSSSTVPILXESASIXSSSNLYALPGTIPLSTNSDEPNESI  710

Query  1486  RARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNA  1307
               R V    Q    V R ++           LNV  +P  + +A+ H  W++AMD+EF A
Sbjct  711   NTRPVTXPQQPHHMVTRSKNGIFKPXVYTVDLNV-EEPNTFQEAISHPKWKEAMDEEFRA  769

Query  1306  LLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFS  1127
             L+ N TW LV    +   VGC+WVF+ KRN DGS+ +YKARLVAKG++QV G DF++TFS
Sbjct  770   LMKNKTWSLVSLPTNRTSVGCRWVFKLKRNPDGSVSRYKARLVAKGYSQVPGFDFYETFS  829

Query  1126  LVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVS  947
              VVKPTT+R++ ++ VS +W +RQLDV+NAFLNG L E VYM QPPG++  T+ +   V 
Sbjct  830   PVVKPTTIRVVLAIAVSQSWCIRQLDVNNAFLNGELQEEVYMDQPPGFDGKTNQEQKLVC  889

Query  946   S-STALYGLR  920
                 ALYGL+
Sbjct  890   KLHKALYGLK  899


 Score = 60.8 bits (146),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 52/103 (50%), Gaps = 18/103 (17%)
 Frame = -1

Query  2865  EYTGSDVLRVGNGAGLIISRVGHASIPSES---KLLHLSNVLYVPKLSVPLFSVYRLTNE  2695
             EY G+  + +GNG GL IS +G +  PS S   K+L L N+L VP +     SV +   +
Sbjct  289   EYNGNSKIHMGNGTGLKISHIGLSVFPSSSSPNKVLFLKNILRVPAIKKNXLSVSQFXRD  348

Query  2694  NNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFA  2566
             NNV+FEFH                +G+   GLY+  +S+  F 
Sbjct  349   NNVYFEFHP---------------KGNLHKGLYQFNLSKKLFG  376



>emb|CAN64509.1| hypothetical protein VITISV_041217 [Vitis vinifera]
Length=1269

 Score =   300 bits (768),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 177/424 (42%), Positives = 236/424 (56%), Gaps = 34/424 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+ +  F  F+  VE+ F+R I ++  D GGEY+ +   LT  G++H  S  +T E NG
Sbjct  535   KSNTHDVFVRFKALVEKFFNRPIITLYSDNGGEYQALSSFLTINGVSHLTSPPHTPEHNG  594

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER++RHIVETGL+LL   S+   YW FAF  A  LIN LPT  L   SPY +L  T P
Sbjct  595   YSERRHRHIVETGLSLLTHASMPLSYWPFAFSTAVYLINRLPTPTLNHLSPYFKLFGTFP  654

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LR FGC  YP+LRPY  HK+E RS+PCVF+ Y P+   Y C++ ++ ++Y   HV 
Sbjct  655   NYSKLRSFGCLXYPWLRPYTSHKLESRSSPCVFVGYSPTQSAYLCLDTSTARLYTSXHVR  714

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR---  1535
             F + +      T  SQ        + +P      C   A PT       ++PVP  +   
Sbjct  715   FVDLL----TXTAPSQ--------SQDPSQNNTTC---ATPTXEPDSHSSAPVPETKCDC  759

Query  1534  -GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT-------  1379
                PPL    P Q  P +   +        HV+ +     +  +    LN+T        
Sbjct  760   ANNPPLP---PTQNDPNQPPDL----SPSPHVI-VTXSKHNIHKPIQKLNLTAQLQQPTL  811

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +PT  +QA+    WR A   EF+ LL N TW LV   P  N+VGCKW+FRTK   +GSI+
Sbjct  812   EPTTVTQALKDPKWRQAXSAEFDXLLRNGTWDLVPSHPTQNLVGCKWIFRTKYLPNGSID  871

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
             +YKARLVAKGF+Q  G D+ +TFS  +KPTTVRL  SL VS  W+LRQLDV+NAFL G L
Sbjct  872   RYKARLVAKGFHQRPGVDYSETFSPXIKPTTVRLXLSLAVSQGWSLRQLDVNNAFLQGTL  931

Query  1018  AETV  1007
              E +
Sbjct  932   TEDL  935


 Score = 75.5 bits (184),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 93/208 (45%), Gaps = 28/208 (13%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             + G+D + +G+G+GL IS  G  S+ + S    LSNVL VP +   L S+ +    NN  
Sbjct  347   FDGTDEIMIGDGSGLPISHXGSTSLTTPSHSFTLSNVLCVPTMKRNLISISQFCKSNNTS  406

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVWHRRLGH  2515
              EF    F             G T  G+Y  P+    SR   A+ + + T + WH RLGH
Sbjct  407   IEFLPSSF------------HGRTKDGVYEWPLSTTQSRPLIAFSSVKTTLSEWHHRLGH  454

Query  2514  PNAHVQNRVLQSCPVAPNKVKSLG-SRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWG  2338
             P+  +   ++ S  +  ++  +   +  SC  +K+ + P    + S+ + L         
Sbjct  455   PSLSIFKNIMSSFHLDVSRPSNFNFNCNSCQCNKSHKLPFSTSTLSTSSSLK--------  506

Query  2337  PAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
                         +++FVD ++++ W YP
Sbjct  507   ---STLLITLNIYVIFVDHFTKYIWLYP  531


 Score = 55.8 bits (133),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 71/157 (45%), Gaps = 12/157 (8%)
 Frame = -2

Query  3593  SIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptp  3414
             SIKLT  N+  W+TQ+   L G +L  ++D   P PP TI             T    + 
Sbjct  15    SIKLTPTNYFSWKTQMEAILIGYDLQKFIDGSHPAPPTTIT------------TNNVVST  62

Query  3413  npAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLG  3234
             NPAY+ W++QD+ +   L+ +LS  ++ L     TS   W+ +       SR        
Sbjct  63    NPAYQTWLRQDKLLFGALVDTLSPTLVPLITQSKTSYEAWQILANTYARPSRGHIKQLKD  122

Query  3233  QFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDE  3123
                 + +G+ S  +Y+   +   ++LA  G P+  ++
Sbjct  123   HLKNITKGSQSIXDYMXSIKTRADELAALGKPLDQED  159



>emb|CAN76078.1| hypothetical protein VITISV_008973 [Vitis vinifera]
Length=1146

 Score =   279 bits (714),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/415 (41%), Positives = 239/415 (58%), Gaps = 26/415 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K     +F +FR  VE Q   +IK IQ D GGE+      L   GI H+ S  +T +QNG
Sbjct  438   KDQALHSFITFRKMVENQLHTTIKCIQSDNGGEFLVFKPYLEAHGILHQFSYPHTPQQNG  497

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK RH+VETGLAL+A+  +  +YW +AF+ A  LIN LP  +L F+SP        P
Sbjct  498   RAERKIRHLVETGLALMAQSFLPSKYWTYAFQTAVYLINLLPAKLLHFQSPIQAFFHKLP  557

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRPY +HK+ YRS  CVFL Y P+ +GY C+++++ +IYI ++V 
Sbjct  558   NYHHLRVFGCLCFPSLRPYTQHKLCYRSTACVFLGYAPAHKGYLCLDVSTSRIYISKNVI  617

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLP  1526
             F+ES F F  S+    P          P  T A  N+ +  +  + ++++SP+  +  +P
Sbjct  618   FHESSFPFQSSSPPPSPP------PHLPSSTPALINSPSL-SAPSSLTVSSPIITSDSIP  670

Query  1525  PLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGH  1346
             PL I  P  T+   A +                       + H ++ T +P  YSQA   
Sbjct  671   PL-IPVPFTTSSPAAPS-----------------PPPLPLKTHPIHTT-EPRTYSQASKT  711

Query  1345  L*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGF  1166
               W  AM++E+ ALL N+TW LV      ++VGC+W+++ K   DGSI+++KARLVA+GF
Sbjct  712   DSWVQAMNREYQALLRNNTWSLVPPPSSAHIVGCRWIYKLKYRPDGSIDRHKARLVAQGF  771

Query  1165  NQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
              Q  G D+FDTF+ VVKP T+RL+ +L VS    +RQLDV NAFLNG L E   +
Sbjct  772   TQTPGIDYFDTFNPVVKPYTIRLILALAVSFQCPVRQLDVENAFLNGDLEEETLL  826


 Score = 96.3 bits (238),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = -1

Query  2646  SITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS--TVWHRRLGHPNAHVQNRVLQSC-  2476
              +T+ +LL+G    GLY    S    A++T  + S   +WH RLGHP + + ++ L SC 
Sbjct  301   QVTKKILLKGWLRDGLYEFSSSSPPRAFVTPSSFSDGAIWHSRLGHPASLILSKALASCN  360

Query  2475  PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFL  2296
             P    ++  +     C L+K+   P    S    + L L++TD+WGPAP IS +  RYFL
Sbjct  361   PSVTLQINKIAPCIICQLAKSHSLPYSLSSSHVSHPLALIHTDLWGPAPSISITRARYFL  420

Query  2295  LFVDDYSRFCWFY  2257
             +F+DDYSR  W Y
Sbjct  421   IFIDDYSRHTWIY  433



>gb|AAT93988.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1480

 Score =   263 bits (673),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 184/538 (34%), Positives = 263/538 (49%), Gaps = 98/538 (18%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKL----GITHRKSCAY  2084
             R KSD+++    F   V+ QFS  I+  Q D G ++  ++H  T      GI  R SC Y
Sbjct  583   RHKSDVHQHLLEFVAYVKTQFSLPIRCFQADNGTKF--VNHATTSFFASRGIVLRLSCPY  640

Query  2083  THEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTR  1904
             T  QNG+ ER  R I ++   LL + S+   YW  A   AT L+N  P++ ++   PY  
Sbjct  641   TSPQNGKAERVLRTINKSIRTLLIQASMPPSYWAEALATATYLLNRRPSTSVRNSIPYQL  700

Query  1903  LHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIY  1724
             LH   P Y+ L+VFGC CYP L     HK+  RSAP VFL Y  S +G+RC+++++ ++Y
Sbjct  701   LHNKLPDYSNLQVFGCLCYPNLSAMTSHKLSPRSAPYVFLGYSASHKGFRCLDISTRRLY  760

Query  1723  ICRHVHFYESIFLFSD-----------------------------------STLCSQPVP  1649
             I RHV F E  F F+                                    S    QP+P
Sbjct  761   ISRHVVFDEKTFPFAAIPQDASSFDFLLQGFSIAVAPSSEVERPRFSSMTPSPEVEQPIP  820

Query  1648  -------------PTI-------PWASEPVVTRAP---CNTHAAPTDSAHMSLTSPVPLA  1538
                          P +       P A  PV  R P    N  A  + S+++S     P A
Sbjct  821   DDDTSGTELFQLLPGLRSSAAGRPLAGSPVDARLPGGCANDAANGSSSSNLSPVMDPPAA  880

Query  1537  RGLPPLAIEGPV---------------QTAPTR-------ARAV*T---QHQERGHVM--  1439
               + P   EGP                Q APT        +RA  +   Q Q+ GH M  
Sbjct  881   SVVRPAPSEGPTTSLISPYRHTYLRRSQPAPTAIHRPIRASRAFHSATDQQQQTGHTMVT  940

Query  1438  -----RLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVL  1274
                   LR + R T    H + V+  P+ Y  A+    WR A   E+ AL+ N+TW+LV 
Sbjct  941   RSQTGHLRPIQRFTYTATHDV-VSPVPSNYRSALADPNWRAATANEYKALVDNNTWRLVP  999

Query  1273  DEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLL  1094
               P  NVV  KW+F+ K ++DG++ ++KAR V +G++Q  G D+ +TFS VVKP T+ ++
Sbjct  1000  RPPGANVVTGKWIFKHKFHSDGTLARHKARWVVRGYSQQHGIDYDETFSPVVKPATIHVV  1059

Query  1093  FSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              S+  S +W + QLDV NAFL+G+L ETVY +QP G+ DP+ P+ V +   + LYGL+
Sbjct  1060  LSIAASRSWPIHQLDVKNAFLHGNLEETVYYQQPSGFVDPSAPNAVCLLQKS-LYGLK  1116


 Score =   111 bits (277),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 112/202 (55%), Gaps = 11/202 (5%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             + VGNG  + +   G + +P  +    L N+L  P L   L  V + T +N   FEF + 
Sbjct  386   ITVGNGHTIPVICRGTSFLPIGTTRFALKNILVAPSLVRNLLFVRQFTRDNKCSFEFDEF  445

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHF-AYLTSRATSTVWHRRLGHPN-AHVQ--  2497
              F VKD  TR V+LR ++ G LY LP +     A+     +ST+WH RLGHP+ A VQ  
Sbjct  446   GFSVKDLPTRRVILRCNSRGDLYTLPTTVPAITAHSFLAKSSTLWHHRLGHPSPAAVQTL  505

Query  2496  -NRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVIS  2320
                 + SC  + NK+       +CHL K +R    + S S+ +  +L++ D+W  +PV+S
Sbjct  506   HKLAILSCTRSNNKLCH-----ACHLGKHTRLSFSKSSSSTSSPFELVHCDVWT-SPVLS  559

Query  2319  TSGFRYFLLFVDDYSRFCWFYP  2254
              SGF+Y+L+ +DD++ FCW +P
Sbjct  560   LSGFKYYLVVLDDFTHFCWTFP  581



>emb|CAN60844.1| hypothetical protein VITISV_005976 [Vitis vinifera]
Length=1380

 Score =   276 bits (707),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 222/399 (56%), Gaps = 35/399 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F++++E QF   IK +QFD GGE+R     L  +GI HR SC Y   Q
Sbjct  375   QTKDQALPIFKRFKLQMENQFDTKIKCLQFDNGGEFRSFMSFLQAVGIAHRFSCPYNLAQ  434

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NGRVERK+RH+VETGLALL+  S+  +YW +AF+ +T LIN +P+ VL+++SPY  L + 
Sbjct  435   NGRVERKHRHVVETGLALLSHASLPMKYWHYAFQTSTFLINGMPSKVLKYDSPYFTLFRK  494

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
                Y  LRVFGC CYP++RPYN HK++YRS  C+FL Y  + +G+ C++  +G++YI  H
Sbjct  495   HLDYKSLRVFGCLCYPFIRPYNTHKLQYRSVQCLFLGYSLNHKGFLCLDYATGRVYITPH  554

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDS--AHMSLT------  1556
             V F ES F  + S   +     ++  ++  ++T     T     DS  +H S+       
Sbjct  555   VVFDESTFPLAQSKSSNSSNDTSVEGSTPALITPHSFPTLCLLLDSKISHASIDSHSLST  614

Query  1555  --SPVPL-------------ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMT  1421
               SP+P                 LPP +I  P  TA             R     +R +T
Sbjct  615   SESPIPTTSSSPLDTSSSSPVTDLPPKSIPEPQVTALA----------PRMTTRSMRGIT  664

Query  1420  RD-TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGC  1244
             +  T     A+ V ++P+   QA     W  AM+ E +AL  N TW L    P++NV+GC
Sbjct  665   KKRTILDLSAIKV-SEPSTLKQAFKDPNWTKAMEMEIDALHRNHTWDLAEKPPNVNVIGC  723

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFS  1127
             KWV++ K   +GSIE+YK RLV KG+NQ  G D+F+TFS
Sbjct  724   KWVYKLKYKPNGSIERYKVRLVEKGYNQTHGLDYFETFS  762


 Score = 97.8 bits (242),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             +WH RL H  + + ++V+ +C VA  K KS+   + C L+K+ R P    ++ +   L+L
Sbjct  280   LWHNRLSHAGSDIVSKVMNTCNVASGKYKSIVC-SDCQLAKSHRLPTQLSNFRASKPLEL  338

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +Y DIWGPA + STSG +YF+LFVDDYSR+ WFY
Sbjct  339   VYIDIWGPASIKSTSGAKYFILFVDDYSRYIWFY  372



>gb|KHN05629.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1248

 Score =   264 bits (675),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 172/456 (38%), Positives = 232/456 (51%), Gaps = 42/456 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F  F+  VE  +   IK +  D GGEY  +   L   GI+H  +  +T E NG
Sbjct  464   KSDVQTIFPKFKSLVENFYHHKIKILYTDNGGEYIGLRPFLLNHGISHHTTPPHTPEHNG  523

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER+ RHI ETGL+LL    +   YW  A   A  LIN LPT +L ++SPY++L    P
Sbjct  524   ISERRNRHIAETGLSLLHHSGLPLTYWPHAMTTAAYLINRLPTPILGYQSPYSKLLNISP  583

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  L+ FGC C+P+++PY  HK+  +SA CVF+ Y      Y C++ T+G+IY  RHV 
Sbjct  584   DYHKLKCFGCLCFPWIKPYANHKLAPKSAMCVFVGYSADQHAYLCLDPTTGRIYTSRHVK  643

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAP---------TDSAHM--SL  1559
             F ES F F+     + P P       +  + + P N              T+S +M  S 
Sbjct  644   FVESEFPFNSLVTHASPSPEQQTGPLQLSILQ-PMNPPEDSSPAPSSPSITNSPYMAQSS  702

Query  1558  TSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT  1379
             T P    +  PP +   P  +AP     V       G + R ++      ++ +     +
Sbjct  703   TEPTNPTQSPPPTSQSSPQLSAPPPQTIV--NPNGGGIITRSKNNIIKPIQKLNLHVQAS  760

Query  1378  DP---TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
              P      +QA+    WR AM  EF+AL HN+TW LV      N+VGCKWVFR KRN DG
Sbjct  761   SPIEPNTITQALRDPDWRSAMQAEFDALHHNNTWDLVSRSSDQNLVGCKWVFRIKRNPDG  820

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             SI++YKARLVAKGF+Q              +P          V   W +RQLDV+NAFL 
Sbjct  821   SIDRYKARLVAKGFHQ--------------RP----------VRQGWPIRQLDVNNAFLQ  856

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             G L E V+M QPPG+ +   PDHV      ALYGL+
Sbjct  857   GTLKEEVFMIQPPGFVNKNFPDHV-CRLKKALYGLK  891


 Score =   109 bits (273),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 105/203 (52%), Gaps = 7/203 (3%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D L +GNG+GL I+  G          L LSN L VP +   + SV +LT + N  
Sbjct  265   YTGPDSLFMGNGSGLNITHSG----TLLLNDLSLSNALCVPSMKQKIISVSKLTQQTNSA  320

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAH  2503
               F  + F VKD  T     +GS   GLY  P + S   +     +S  WH RLGHP++ 
Sbjct  321   VVFLPNSFYVKDLQTGHTTHKGSCVDGLYLWPAT-SPSVHTVRTESSASWHHRLGHPSSS  379

Query  2502  VQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVI  2323
             +   V +   +  NK    G   SC +SK+ + P    +  S   L+++++D+W  +P++
Sbjct  380   IFKFVQKHFSLGSNKFLQSGC-NSCQISKSHKLPFHESTLKSCYPLEIIFSDVWT-SPIL  437

Query  2322  STSGFRYFLLFVDDYSRFCWFYP  2254
             S  G RY+ +FVD ++R+ W YP
Sbjct  438   SIDGLRYYCMFVDHFTRYIWLYP  460



>gb|KHN30958.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1237

 Score =   265 bits (676),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 171/456 (38%), Positives = 231/456 (51%), Gaps = 42/456 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F  F+  VE  +   IK +  D GGEY  +   L   GI+H  +  +T E NG
Sbjct  464   KSDVQTIFPKFKSLVENFYHHKIKILYTDNGGEYIGLRPFLLNHGISHHTTPPHTPEHNG  523

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER+ RHI ETGL+LL    +   YW  A   A  LIN LPT +L ++SPY++L    P
Sbjct  524   ISERRNRHIAETGLSLLHHSGLPLTYWPHAMTTAAYLINRLPTPILGYQSPYSKLLNISP  583

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  L+ FGC C+P+++PY  HK+  +SA CVF+ Y      Y C++ T+G+IY  RHV 
Sbjct  584   DYHKLKCFGCLCFPWIKPYANHKLAPKSAMCVFVGYSADQHAYLCLDPTTGRIYTSRHVK  643

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAP---------TDSAHM--SL  1559
             F ES F F+     + P P       +  + + P N              T+S +M  S 
Sbjct  644   FVESEFPFNSLVTHASPSPEQQTGPLQLSILQ-PMNPPEDSSPAPSSPSITNSPYMAQSS  702

Query  1558  TSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT  1379
             T P    +  PP +   P  +AP     V       G + R ++      ++ +     +
Sbjct  703   TEPTNPTQSPPPTSQSSPQLSAPPPQTIV--NPNGGGIITRSKNNIIKPIQKLNLHVQAS  760

Query  1378  DP---TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
              P      +QA+    WR AM  EF+AL HN+TW LV      N+VGCKWVFR KRN DG
Sbjct  761   SPIEPNTITQALRDPDWRSAMQAEFDALHHNNTWDLVSRSSDQNLVGCKWVFRIKRNPDG  820

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             SI++YKARLVAKGF+Q +                        V   W +RQLDV+NAFL 
Sbjct  821   SIDRYKARLVAKGFHQRS------------------------VRQGWPIRQLDVNNAFLQ  856

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             G L E V+M QPPG+ +   PDHV      ALYGL+
Sbjct  857   GTLKEEVFMIQPPGFVNKNFPDHV-CRLKKALYGLK  891


 Score =   108 bits (269),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 104/203 (51%), Gaps = 7/203 (3%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D L +GNG+GL I+  G          L LSN L VP +   + SV +LT + N  
Sbjct  265   YTGPDSLFMGNGSGLNITHSG----TLLLNDLSLSNALCVPSMKQKIISVSKLTQQTNSA  320

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAH  2503
               F  + F VKD  T     +GS   GLY  P + S   +     +S  WH RLGHP++ 
Sbjct  321   VVFLPNSFYVKDLQTGHTTHKGSCVDGLYLWPAT-SPSVHTVRTESSASWHHRLGHPSSS  379

Query  2502  VQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVI  2323
             +   V +   +  NK        SC +SK+ + P    +  S   L+++++D+W  +P++
Sbjct  380   IFKFVQKHFSLGSNKFPQ-SDCNSCQISKSHKLPFHESTLKSCYPLEIIFSDVWT-SPIL  437

Query  2322  STSGFRYFLLFVDDYSRFCWFYP  2254
             S  G RY+ +FVD ++R+ W YP
Sbjct  438   SIDGLRYYCMFVDHFTRYIWLYP  460



>gb|KHN45997.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1235

 Score =   265 bits (676),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 171/456 (38%), Positives = 231/456 (51%), Gaps = 42/456 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F  F+  VE  +   IK +  D GGEY  +   L   GI+H  +  +T E NG
Sbjct  462   KSDVQTIFPKFKSLVENFYHHKIKILYTDNGGEYIGLRPFLLNHGISHHTTPPHTPEHNG  521

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER+ RHI ETGL+LL    +   YW  A   A  LIN LPT +L ++SPY++L    P
Sbjct  522   ISERRNRHIAETGLSLLHHSGLPLTYWPHAMTTAAYLINRLPTPILGYQSPYSKLLNISP  581

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  L+ FGC C+P+++PY  HK+  +SA CVF+ Y      Y C++ T+G+IY  RHV 
Sbjct  582   DYHKLKCFGCLCFPWIKPYANHKLAPKSAMCVFVGYSADQHAYLCLDPTTGRIYTSRHVK  641

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAP---------TDSAHM--SL  1559
             F ES F F+     + P P       +  + + P N              T+S +M  S 
Sbjct  642   FVESEFPFNSLVTHASPSPEQQTGPLQLSILQ-PMNPPEDSSPAPSSPSITNSPYMAQSS  700

Query  1558  TSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT  1379
             T P    +  PP +   P  +AP     V       G + R ++      ++ +     +
Sbjct  701   TEPTNPTQSPPPTSQSSPQLSAPPPQTIV--NPNGGGIITRSKNNIIKPIQKLNLHVQAS  758

Query  1378  DP---TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
              P      +QA+    WR AM  EF+AL HN+TW LV      N+VGCKWVFR KRN DG
Sbjct  759   SPIEPNTITQALRDPDWRSAMQAEFDALHHNNTWDLVSRSSDQNLVGCKWVFRIKRNPDG  818

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             SI++YKARLVAKGF+Q +                        V   W +RQLDV+NAFL 
Sbjct  819   SIDRYKARLVAKGFHQRS------------------------VRQGWPIRQLDVNNAFLQ  854

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             G L E V+M QPPG+ +   PDHV      ALYGL+
Sbjct  855   GTLKEEVFMIQPPGFVNKNFPDHV-CRLKKALYGLK  889


 Score =   107 bits (268),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 104/203 (51%), Gaps = 7/203 (3%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D L +GNG+GL I+  G          L LSN L VP +   + SV +LT + N  
Sbjct  263   YTGPDSLFMGNGSGLNITHSG----TLLLNDLSLSNALCVPSMKQKIISVSKLTQQTNSA  318

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAH  2503
               F  + F VKD  T     +GS   GLY  P + S   +     +S  WH RLGHP++ 
Sbjct  319   VVFLPNSFYVKDLQTGHTTHKGSCVDGLYLWPAT-SPSVHTVRTESSASWHHRLGHPSSS  377

Query  2502  VQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVI  2323
             +   V +   +  NK        SC +SK+ + P    +  S   L+++++D+W  +P++
Sbjct  378   IFKFVQKHFSLGSNKFPQ-SDCNSCQISKSHKLPFHESTLKSCYPLEIIFSDVWT-SPIL  435

Query  2322  STSGFRYFLLFVDDYSRFCWFYP  2254
             S  G RY+ +FVD ++R+ W YP
Sbjct  436   SIDGLRYYCMFVDHFTRYIWLYP  458



>emb|CAN69753.1| hypothetical protein VITISV_024937 [Vitis vinifera]
Length=793

 Score =   306 bits (783),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 185/469 (39%), Positives = 245/469 (52%), Gaps = 60/469 (13%)
 Frame = -3

Query  2224  FESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVERKYR  2045
             F+ F++++E QF   IK +Q D GGE+R     L  +GI HR S  Y   QNGRVE K+R
Sbjct  188   FKRFKLQMENQFDTKIKCLQSDNGGEFRSFMSFLQAVGIAHRFSYPYNSAQNGRVEWKHR  247

Query  2044  HIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRV  1865
             H+VETGL LL+  S+  +YW +AF+  T LIN +P+ VL+++SPY  L +  P Y  LRV
Sbjct  248   HVVETGLTLLSHASLPMKYWHYAFQTTTFLINRMPSKVLEYDSPYFTLFRRHPDYKSLRV  307

Query  1864  FGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFL  1685
             F   CYP++ PYN H+++YRS  C FL Y  + +G+ C++  +G++YI  H  F ES F 
Sbjct  308   FDYLCYPFIWPYNTHRLQYRSVQCFFLGYSLNHKGFLCLDYATGRVYITPHAVFDESTFP  367

Query  1684  FSDST----LCSQPVPPTIPWASEPVVTRAPC-----NTHAAPTDSAHMSLT-SPVP---  1544
             F+ S             + P    P     PC     N   A  DS  +S + SP+P   
Sbjct  368   FAQSKSSILFNDTSAEGSTPAIRAPTSFPTPCLLPDSNISHASIDSHSLSTSESPIPTDS  427

Query  1543  ----------LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMT-RDTSEQFH  1397
                            PP  +  P  TAP            R  +  +R +T ++T     
Sbjct  428   SSPLDTSSSSPTTDFPPEYVPEPQVTAPA----------PRMTIRSMRGITKKNTILDLS  477

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRN  1217
             A+ V + P    QA     W  AM+ E  AL  N TW LV   P +NV+GCKWV++ K  
Sbjct  478   AIKV-SKPFTLKQAFKDPNWTKAMEMEIAALHQNHTWDLVEQPPDVNVIGCKWVYKLKHK  536

Query  1216  ADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNA  1037
              DGSIE+YKARLVAKG+NQ  G + F+TFS                     +RQLDVHNA
Sbjct  537   PDGSIERYKARLVAKGYNQTHGLNSFETFSP-------------------EIRQLDVHNA  577

Query  1036  FLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             FLNG L + VYM QPPGY D   P+ V      ALYGL+      SPRA
Sbjct  578   FLNGELEKQVYMSQPPGYFDTQFPNRV-CRLKKALYGLKQ-----SPRA  620


 Score = 66.6 bits (161),  Expect(2) = 5e-93, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -1

Query  2466  PNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFV  2287
             P +V++L    S  L+K+ R P    ++ +   L+L+YT+IWG A V S SG +YF+LFV
Sbjct  109   PVQVRNLN--VSYVLAKSHRLPTQLSNFRASKPLELVYTNIWGHASVKSISGAKYFILFV  166

Query  2286  DDYSRFCWFYPYG*NLTYIKLLSR  2215
             DDYSR+ WFY    N   + +  R
Sbjct  167   DDYSRYTWFYSLQTNDQTLPIFKR  190



>emb|CAN62182.1| hypothetical protein VITISV_044400 [Vitis vinifera]
Length=920

 Score =   249 bits (636),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/422 (35%), Positives = 214/422 (51%), Gaps = 73/422 (17%)
 Frame = -3

Query  2224  FESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVERKYR  2045
             F+ F++++E QF   IK +Q D GGE+R     L  +             QNGRVERK+ 
Sbjct  409   FKRFKLQMENQFDMKIKCLQSDNGGEFRSFMSFLQSVA------------QNGRVERKHX  456

Query  2044  HIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRV  1865
             H+VE GLALL+   +  +YW +AF+  T LIN + + VL+++SPY  L +  P Y  LRV
Sbjct  457   HVVEXGLALLSHAXLPXKYWHYAFQTTTFLINRMXSKVLEYDSPYFTLFRRHPDYKSLRV  516

Query  1864  FGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIF-  1688
             FGC CYP+++PYN HK++YRS  C FL Y  + +G+ C++  +G++YI  HV F ES F 
Sbjct  517   FGCLCYPFIQPYNTHKLQYRSVQCFFLGYSLNHKGFLCLDYATGRVYITPHVVFDESTFP  576

Query  1687  -------LFSDSTLCSQPVPPTIPWASEPVVTRAPCN--THAAPTDSAHMSLTSPVP---  1544
                    + S+ T      P  I   S P +   P +  +HA+    +  +  SP+P   
Sbjct  577   LAQLKSSISSNDTSAEGSTPAXIIPTSFPTLCLLPYSNISHASIXSHSLXTSESPIPTDS  636

Query  1543  ----------LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHA  1394
                       LA  LPP +  G                          H +  T++    
Sbjct  637   SSPLDTSSSSLATDLPPESXLGTSS-----------------------HYSCSTND----  669

Query  1393  LNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNA  1214
              N  + P+   QA     W  AM+ E  AL  N  W LV    ++NV+GCKWV++ K   
Sbjct  670   -NKVSKPSTLKQAFKDPNWTKAMEMEIXALHRNHXWDLVEQPXNVNVIGCKWVYKLKHKP  728

Query  1213  DGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAF  1034
             DGS E+YK            G D+F+TFS VVK  T+R++ ++ +S  W +R +DVHNAF
Sbjct  729   DGSXERYKTH----------GLDYFETFSPVVKAATIRIILTVALSFKWEIRHVDVHNAF  778

Query  1033  LN  1028
             LN
Sbjct  779   LN  780


 Score =   117 bits (294),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 108/237 (46%), Gaps = 52/237 (22%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ +  YTG+D + +GN   L IS +G     S +    L                    
Sbjct  212   LTSTSPYTGTDRVTIGNXKHLSISNIGSKXFHSHTHXFQLK-------------------  252

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS---------------RSHFA  2566
                             KD  T+ VL +G    GLY+ PV                 SHF+
Sbjct  253   ----------------KDRHTKMVLAQGKLENGLYKFPVFSNKKPYSSVNNASAFHSHFS  296

Query  2565  YLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVS  2386
               T    + +WH RLGH  + + ++V+ +C VA  K KS    + C L+K+ R P    +
Sbjct  297   S-TIENKAELWHNRLGHVASDIVSKVMNTCNVASGKYKSTVC-SDCQLAKSHRLPTQLSN  354

Query  2385  YSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYPYG*NLTYIKLLSR  2215
             + +   L+L+YTDIWGPA V STSG +YF+LFVDDYSR+ WFY    N   + +  R
Sbjct  355   FRASKPLELVYTDIWGPASVKSTSGAKYFILFVDDYSRYTWFYSLQTNDQTLPIFKR  411



>emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera]
Length=1354

 Score =   332 bits (850),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 190/458 (41%), Positives = 262/458 (57%), Gaps = 23/458 (5%)
 Frame = -3

Query  2233  YKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVER  2054
             ++ F+ ++  VE  FS+ I ++  D GGEY  +   L+   I+H  +  +T E NG  ER
Sbjct  542   HEVFKRYKTIVENYFSKKIITLYSDNGGEYMVLKDYLSLXXISHFTTPPHTPEHNGYSER  601

Query  2053  KYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTF  1874
             ++RHIVETGL LL+  S+   +   AF  A  LIN LPT+ L   SP+  +    P Y+ 
Sbjct  602   RHRHIVETGLTLLSHASLPNTFXPHAFATAVYLINRLPTTTLNLSSPFELIFHKSPNYSR  661

Query  1873  LRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYES  1694
             L+VFGC CYP+LRPY  HK+   S PCVFL Y  S   Y C++ ++ K+Y+ RHV F ES
Sbjct  662   LKVFGCLCYPWLRPYXTHKLTPXSKPCVFLGYSLSQSAYLCLDXSTSKLYVSRHVQFVES  721

Query  1693  IFLFS---------DSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             +F ++         +ST  S  +P  I   S P  ++    T +A +        +  P 
Sbjct  722   VFPYTSLHTTLPRPNSTTISTWIP-XILSVSTPTSSQQEAITPSAASSQGLPLFETTSPP  780

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTR---DTSEQFHALNV-----  1385
             A   P  A   P Q +P  +              + R  TR   + ++    LN+     
Sbjct  781   AAPFPHQASSAP-QPSPQPSLTTTEPPIPVPPPTQHRMTTRAKNNITKPIQKLNLHTHKP  839

Query  1384  ---TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNA  1214
                TT PT  SQA+    WR AM  E++AL+ N TW+LV  E   N+VGCKW+FR KRN+
Sbjct  840   TFQTTTPTSISQALKDQNWRQAMSDEYDALVRNGTWELVPPEDITNLVGCKWIFRIKRNS  899

Query  1213  DGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAF  1034
             DGSI++YKARLVAKGF+Q  G D+ +TFS VVKPTTVRL+ S+ VS+ W+LRQLDV+NAF
Sbjct  900   DGSIDRYKARLVAKGFHQRPGVDYHETFSPVVKPTTVRLVLSIAVSNGWSLRQLDVNNAF  959

Query  1033  LNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             L G L+E V+M QPPG+ D  HP +V      A+YGL+
Sbjct  960   LQGRLSENVFMAQPPGFVDSDHPSYV-CKLHKAIYGLK  996


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 72/156 (46%), Gaps = 12/156 (8%)
 Frame = -2

Query  3590  IKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptpn  3411
             +KLT  N++  + Q      G +LLGY+D   PCPP T+   + + D++          N
Sbjct  152   LKLTSSNYLSCKIQFETLFIGYDLLGYIDGSKPCPPKTLT--TNNVDTL----------N  199

Query  3410  pAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLGQ  3231
             PAY  WI+QDQ IL+ LI SLS  ++       TSR  W  +       SR R       
Sbjct  200   PAYTLWIRQDQLILNALIGSLSPTIISFIARANTSREAWTILANTYAKPSRGRIKQVKNL  259

Query  3230  FHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDE  3123
                  +G  +  ++L   +   ++LA  G P+  ++
Sbjct  260   LKNPSKGTMTVTDFLHSVRARTDELAILGAPMEEED  295



>ref|XP_006465491.1| PREDICTED: uncharacterized protein LOC102624640 [Citrus sinensis]
Length=1682

 Score =   333 bits (855),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 197/473 (42%), Positives = 269/473 (57%), Gaps = 35/473 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD  + F  F+  +E+   + IK++Q D GGE+R     LT+ GI  R  C + H QNG
Sbjct  21    KSDALQVFTEFKSFIEKHLQQHIKTVQTDWGGEFRTFASYLTQFGIQFRHPCPHIHHQNG  80

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R+ERK+RHIV+ GL LLA+ ++  ++W  AF  A  LIN LPT  L   SPY +L +  P
Sbjct  81    RIERKHRHIVDIGLTLLAQANLPLKFWWNAFHTAVFLINRLPTPTLNNISPYQKLFQQVP  140

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+PYLRPYNRHK+ +RS  CVF+ Y  S +GY+C++ +SG++Y+  HV 
Sbjct  141   DYVSLRVFGCACFPYLRPYNRHKLSFRSNRCVFIGYSSSHKGYQCLH-SSGRVYVSNHVI  199

Query  1705  FYESIFLF---SDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR  1535
             F E  F +   SD +  +Q   P +  +SE  VT  P     +P   +  S   P    +
Sbjct  200   FDEQSFPYVSGSDFSSIAQSCSP-LDISSESKVTLVPIPQVQSPLQESPASDYLPADTPQ  258

Query  1534  GLPPLAIEGPVQTAPTRARAV*TQHQER-----------GHVMRLRHMTRDTSEQFH---  1397
                P +      T+ +    +   H +            GH M    +TR  +  F    
Sbjct  259   VFSPSSTSSSSSTSTSHTHPI--HHTQSPPHILPAAPPIGHPM----ITRSKAGIFKPKS  312

Query  1396  ----ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFR  1229
                  L + ++PT  S A+    W  AM +EF AL +N TW LVL    + VVG KW+F+
Sbjct  313   FLAALLAIPSEPTSVSAALSDPKWFKAMQEEFQALQNNHTWDLVLPSEPIKVVGNKWIFK  372

Query  1228  TKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
              K +ADG+I +YKARLVAKGF+Q  G D+ +TFS VVK +TVR++ SL V + W LRQ+D
Sbjct  373   IKYHADGTISRYKARLVAKGFHQTQGVDYTETFSPVVKASTVRVILSLAVMNKWELRQVD  432

Query  1048  VHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             V+NAFLNG L E VYM QP G+ DP+ P HV      ALYGL+      +PRA
Sbjct  433   VNNAFLNGILVEDVYMGQPEGFIDPSRPLHV-CKLKKALYGLKQ-----APRA  479



>emb|CAN67403.1| hypothetical protein VITISV_025614 [Vitis vinifera]
Length=1271

 Score =   329 bits (844),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/404 (42%), Positives = 249/404 (62%), Gaps = 18/404 (4%)
 Frame = -3

Query  2113  GITHRKSCAYTHEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTS  1934
             GI  + SC YT EQNGR ERK RHI+ETGLALLA  S+  ++W +AF     LIN LPT 
Sbjct  471   GIKSQFSCPYTPEQNGRAERKLRHIIETGLALLATASLPFKFWLYAFHTTIFLINRLPTK  530

Query  1933  VLQFESPYTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYR  1754
             VL ++SP+  L    P Y   ++FGC CYPY+RPYN++K+ YRS+ CVFL Y  + +GY 
Sbjct  531   VLNYQSPFQILFGKSPNYHIFKIFGCLCYPYIRPYNKNKLSYRSSQCVFLGYSSNHKGYM  590

Query  1753  CMNLTSGKIYICRHVHFYESIFLF-----SDSTLCSQPVPPTIPWASEPVVTRAPCNTHA  1589
             C+N  +G++Y+ RHV F+E++F F       S++ + P P  +P +S PV   +   +H 
Sbjct  591   CLNPLTGRLYVTRHVVFHETVFPFQSTPDQSSSVVTIPTPAFLPCSSPPV---SSLRSHT  647

Query  1588  APTDSAHMSLTSPVPLARGLPPLAIEGP-VQTAPTRARAV*TQHQERGHVMRLRHMTRDT  1412
              P+ S+        P    +P   I  P +   P    +    H    H M  R     +
Sbjct  648   TPSTSS--------PPLTNMPSSTISLPDLIQVPFADISTSEPHPTNQHPMVTRAKNGIS  699

Query  1411  SEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
              ++ +  +  ++PT ++QAV    W  AM++EF+AL  N+TW LV    + N++GCKWV+
Sbjct  700   KKKVYFSSHISEPTTFTQAVKDSNWVLAMEKEFSALQRNNTWHLVPPPSNGNIIGCKWVY  759

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             + K   DG++++YKARLVA+GF Q  G ++F+TFS VVK +T+R++ ++ +S NW++ QL
Sbjct  760   KLKYKPDGTVDRYKARLVAQGFTQTLGLBYFETFSPVVKASTIRIILAVALSFNWSVHQL  819

Query  1051  DVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             DV NAFL+G L E V+M+QPPG+ +  +P HV    + ALYGL+
Sbjct  820   DVQNAFLHGDLEEHVFMQQPPGFINSQYPSHV-CKLNKALYGLK  862


 Score = 60.8 bits (146),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 78/162 (48%), Gaps = 15/162 (9%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I WRTQ+   +       +++    CPP   +    + D V      
Sbjct  136   NHALPIKLDRNNYILWRTQMENVVFANGFEDHIEGLKICPPQKTSSGETNPDFVM-----  190

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ ILS + SSL+ E+M   VG  +S   W ++     +SSRAR +
Sbjct  191   ----------WRRFDRMILSWIYSSLTPEIMGQIVGYQSSHAAWFALERIFSASSRARVM  240

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                 +F   R+G+ + +EY+ + + L ++LA  G P++  +Q
Sbjct  241   QLRLEFQTTRKGSLTMMEYILKLKSLADNLAAIGEPVTDRDQ  282



>gb|AAD43604.1|AC005698_3 T3P18.3 [Arabidopsis thaliana]
Length=1309

 Score =   266 bits (679),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 175/474 (37%), Positives = 246/474 (52%), Gaps = 45/474 (9%)
 Frame = -3

Query  2203  VERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRHIVET  2030
             VE Q    IK  Q D GGE+   K+     + GI HR SC YT +QNG  ERK+RH+VE 
Sbjct  412   VENQLGTKIKEFQSDGGGEFTSNKLKEHFREHGIHHRISCPYTPQQNGVAERKHRHLVEL  471

Query  2029  GLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGCRC  1850
             GL++L       ++W  AF  A  L N LP+SVL+  SPY  L +    YT LRVFG  C
Sbjct  472   GLSMLYHSHTPLKFWVEAFFTANYLSNLLPSSVLKEISPYETLFQQKVDYTPLRVFGTAC  531

Query  1849  YPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSD--  1676
             YP LRP  ++K + RS  CVFL Y   ++GYRC+   +GK+YI RHV F E+ F F +  
Sbjct  532   YPCLRPLAKNKFDPRSLQCVFLGYHNQYKGYRCLYPPTGKVYISRHVIFDEAQFPFKEKY  591

Query  1675  --------STLC-----SQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR  1535
                     +TL      +   PP++P +    + R      A   +   M+  +   +  
Sbjct  592   HSLVPKYQTTLLQAWQHTDLTPPSVPSSQLQPLARQ-VTPMATSENQPMMNYETEEAVNV  650

Query  1534  GLPPLAIE------------GPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ---F  1400
              +   + E             PV        A+     E  H M  R  ++D  ++    
Sbjct  651   NMETSSDEETESNDEFDHEVAPVLNDQNEDNALGQGSLENLHPMITR--SKDGIQKPNPR  708

Query  1399  HALNVT----TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
             +AL V+     +P   + A+ H  W  A+  E + +   +TW LV     MN++  KWVF
Sbjct  709   YALIVSKSSFDEPKTITTAMKHPGWNAAVMDEIDRIHMLNTWSLVPATEDMNILTSKWVF  768

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             +TK   DG+I++ KARLVAKGF+Q  G D+ +TFS VV+  T+RL+     ++ W L+QL
Sbjct  769   KTKLKPDGTIDKLKARLVAKGFDQEEGVDYLETFSPVVRTATIRLVLDTATANEWPLKQL  828

Query  1051  DVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             DV NAFL+G L E V+M QP G+ DP  P+HV    + ALYGL+      +PRA
Sbjct  829   DVSNAFLHGELQEPVFMFQPSGFVDPNKPNHV-CRLTKALYGLKQ-----APRA  876


 Score = 96.7 bits (239),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 102/200 (51%), Gaps = 12/200 (6%)
 Frame = -1

Query  2895  VTASM--MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPL  2722
             +TAS   +  +  Y G+D + VG+G  L I+ VG  +I S    + L+ VL  P +   L
Sbjct  212   ITASTSGLQNATTYEGNDAVLVGDGTYLPITHVGSTTISSSKGTIPLNEVLVCPAIQKSL  271

Query  2721  FSVYRLTNEN--NVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR-  2551
              SV +L ++    V+F+ +K C I  D  T+ V+ +G  + GLY L    S F  L S  
Sbjct  272   LSVSKLCDDYPCGVYFDANKVCII--DLTTQKVVSKGPRNNGLYML--ENSEFVALYSNR  327

Query  2550  ---ATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYS  2380
                A+   WH RLGH N+ +  ++L    +  NK ++      C + K++R       + 
Sbjct  328   QCAASMETWHHRLGHSNSKILQQLLTRKEIQVNKSRTSPVCEPCQMGKSTRLQFFSSDFR  387

Query  2379  SKNVLDLLYTDIWGPAPVIS  2320
             +   LD ++ D+WGP+PV+S
Sbjct  388   ALKPLDRVHCDLWGPSPVVS  407


 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             V++KL   N++ W+TQ    L  Q+L+G+V+      PP    L  + D        +  
Sbjct  17    VTLKLNDSNYLLWKTQFESLLSSQKLIGFVNGVVT--PPAQTRLVVNDD------VTSEV  68

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
             PNP Y  W   DQ + S L  +LS+EV+      TTSR +W S+      SS AR  S  
Sbjct  69    PNPQYEDWFCTDQLVRSWLFGTLSEEVLGHVHNLTTSRQIWISLAENFNKSSIAREFSLR  128

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                  L + + S   Y    +++ + L+  G P+
Sbjct  129   RNLQLLTKKDKSLSLYCRDFKIICDSLSSIGKPV  162



>emb|CAN67819.1| hypothetical protein VITISV_041315 [Vitis vinifera]
Length=1242

 Score =   319 bits (818),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 186/488 (38%), Positives = 262/488 (54%), Gaps = 46/488 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS   + F  F+ + E QF   + + Q D GGE+R +     + GI HR SC +T +Q
Sbjct  660   KTKSQTREAFLMFKAQAELQFGCKLXTFQXDWGGEFRSLKTYFEQNGIIHRLSCPHTSKQ  719

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG +ERK+RHIVE GL LLA+ S+  +YW  AF     LIN LPT VL+ + PY  L  +
Sbjct  720   NGIIERKHRHIVELGLTLLAQASLPLKYWPDAFSTXVFLINRLPTEVLKQKCPYEFLFNS  779

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ L+VFGC C+P+LRPYN+HK+++RS+PC FL Y    +GY+C+N   G+++I R 
Sbjct  780   KPNYSQLKVFGCLCFPHLRPYNKHKLDFRSSPCTFLGYSSKHKGYKCLN-QQGRMFISRS  838

Query  1711  VHFYESIFLFSD-----------STL---CSQPVPPTIPW--------------ASEPVV  1616
             V F E+ F F D           ST+   C   V    P               +S  + 
Sbjct  839   VXFDETKFPFXDXLQKPVQXVSHSTVGLPCIXLVKNLXPJSXSXSLSLPTSSAQSSHQLD  898

Query  1615  TRAPCNTHAAPTDSAHMSLTSPVPLAR---------------GLPPLAIEGPVQTAPTRA  1481
                  +  +   D ++   +S VP+                 G  PL+            
Sbjct  899   ENLGSDIRSVQQDLSNTDSSSTVPILNXSASISSSSNLYVLPGTIPLSTNSDEPNESINT  958

Query  1480  RAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALL  1301
             R V    Q    V R ++           LNV  +P  + +A+ H  W++AMD+EF AL+
Sbjct  959   RPVTLPQQPHHMVTRSKNGIFKPKVYTFDLNV-EEPNTFQEAISHPKWKEAMDEEFRALM  1017

Query  1300  HNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLV  1121
              N TW  V    +   VGC+WVF+ K   DGS+ ++KARLVAK ++QV G DF +TFS V
Sbjct  1018  KNKTWSFVSLLTNRTYVGCRWVFKLKMYPDGSVSRHKARLVAKDYSQVPGFDFSETFSPV  1077

Query  1120  VKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSS-  944
             VKPTT+R++ ++VVS +W++RQLDV+N FLNG L E VYM QPP +E  T+     V   
Sbjct  1078  VKPTTIRVVLAIVVSQSWSIRQLDVNNVFLNGELQEEVYMDQPPSFEGRTNQKQKLVCKL  1137

Query  943   STALYGLR  920
               ALYGL+
Sbjct  1138  HKALYGLK  1145


 Score = 43.1 bits (100),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = -1

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             L  D+WGPAP+ S+ GF Y++ F D YSR+   Y
Sbjct  624   LSNDLWGPAPINSSYGFTYYVSFXDAYSRYTXVY  657



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score =   210 bits (534),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS ++  F+ F+V VERQF R I ++Q D GGEY+ ++   +K+GI H  SC +TH+QNG
Sbjct  549   KSQVFDKFQEFQVMVERQFDRKILAMQTDWGGEYQSLNSFFSKIGIVHHVSCPHTHQQNG  608

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVE GL+LL+  S+  ++WD AF++AT LIN +P+ V+   SP  +L K  P
Sbjct  609   SAERKHRHIVEIGLSLLSHASMPLKFWDEAFQVATYLINRVPSRVIHNISPLEKLFKQKP  668

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LR+FGC C+P LRPYN HK+++RS  CVFL +    +G++C+ +++G+IYI R V 
Sbjct  669   DYSSLRIFGCACWPNLRPYNNHKLQFRSKRCVFLGFSTMHKGFKCLEVSTGRIYISRDVV  728

Query  1705  FYESIFLFSD  1676
             F E+IF F++
Sbjct  729   FDENIFPFTE  738


 Score =   152 bits (383),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 123/209 (59%), Gaps = 2/209 (1%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPS-ESKLLHLSNVLYVPKLSVPLFSVYRL  2704
             ++  ++Y G + +   +GAG+ IS +GHA + +  S+ +HL NVLYVP+    L SV+RL
Sbjct  337   LTMKEKYNGGEQIHTASGAGMDISHIGHAIVHNPNSRNIHLRNVLYVPQAKKNLVSVHRL  396

Query  2703  TNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRR  2524
              N+N+ F E H+D F +KD ITR  LL+G +   LY LP S    AY   + +   WH R
Sbjct  397   VNDNSAFLELHRDYFFLKDQITRKTLLKGRSWRRLYPLPHSSLKQAYSAIKLSLDRWHHR  456

Query  2523  LGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDI  2344
             LGHP+     +V+    +  + + S     +C  +K+ + P    S  SK+ L+L+++D+
Sbjct  457   LGHPSITTVKQVVNKFSLPCSDLSSESVCNACQQAKSHQLPFPISSSVSKHPLELVFSDV  516

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             WGPAP  S    +Y++ F+DD+S+F W Y
Sbjct  517   WGPAPE-SVGRKKYYVSFIDDFSKFTWIY  544


 Score =   178 bits (451),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 1/156 (1%)
 Frame = -3

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
              + +PT   +A+    W+ AMD E++AL+ N TW LV  +   N++GCKWV++ KR ADG
Sbjct  941   ASGEPTNDLEALKDKNWKLAMDSEYDALVKNKTWHLVPPQRGRNIIGCKWVYKIKRKADG  1000

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             ++++YKARLVAKGF Q  G D+ DTFS VVK  T+R++ SL VS  W+LRQLDV NAFL+
Sbjct  1001  TLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSLAVSKGWSLRQLDVQNAFLH  1060

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             G+L E VYM QPPG+EDPT P HV      ALYGL+
Sbjct  1061  GYLEEEVYMLQPPGFEDPTKPHHV-CKLDKALYGLK  1095



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score =   214 bits (545),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS++++ F  F+  VERQF R I S+Q D GGEY K+H    ++GI+H  SC +TH+QNG
Sbjct  542   KSEVFQKFHEFQKLVERQFDRKILSMQTDWGGEYLKLHTFFNEIGISHHVSCPHTHQQNG  601

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RHIVE GL+LLA  S+  ++WD AF  AT LIN LP+ V++F++P  RL K  P
Sbjct  602   AVERKHRHIVEVGLSLLAHASMPLKFWDEAFLAATYLINRLPSKVIKFDTPLERLFKQTP  661

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LR FGC C+P LRPYN HK+++RS  CVFL +    +G++C+++++G++Y+ R V 
Sbjct  662   DYKSLRTFGCACWPNLRPYNTHKLQFRSKQCVFLGFSNIHKGFKCLDVSTGRVYVSRDVT  721

Query  1705  FYESIFLFSD  1676
             F E +F F++
Sbjct  722   FDEQVFPFAN  731


 Score =   144 bits (364),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 112/210 (53%), Gaps = 4/210 (2%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  + Y G+D +   +G G  I  VGHA +P+ S  LHL NVL+VP+ +  L SV++L 
Sbjct  330   LTTKERYKGTDQIHTASGEGTSIKHVGHAIVPTPSHPLHLKNVLHVPEAAKNLVSVHKLV  389

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRL  2521
              +N  F E H   F++KD  TR  +L G    GLY LP   S      +  +   WH RL
Sbjct  390   ADNYAFLEIHGKYFLIKDKATRRTILEGPCRRGLYPLPARSSLRQAFVATPSFVRWHGRL  449

Query  2520  GHPNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTD  2347
             GHP+  +  R+L     P   N V       +C  +K  + P  R +  S N L+L+++D
Sbjct  450   GHPSKPIVLRILSQNKLPCLSNSVNE-SVCDACQQAKCHQLPFPRSTSVSNNPLELIHSD  508

Query  2346  IWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +WGPA   S    +Y++ F+DDYS+F W Y
Sbjct  509   VWGPASE-SVGAKKYYVSFIDDYSKFVWIY  537


 Score =   167 bits (422),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 111/174 (64%), Gaps = 3/174 (2%)
 Frame = -3

Query  1441  MRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPH  1262
             +R   +  D + ++     + +P    +A+G   W++AMD E+ AL+ N TW LV  +  
Sbjct  902   IRKEKIYTDGTVRYSCFTSSGEPQTLHEALGDKNWKEAMDSEYQALMKNKTWHLVPSKKG  961

Query  1261  MNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLV  1082
              N++ CKWV++ KR ADGS+++YKAR+VAKGF Q  G D+ DTF+ VVK  T+R + S+ 
Sbjct  962   QNIIDCKWVYKVKRKADGSLDRYKARVVAKGFKQRYGIDYEDTFNPVVKAATIRTILSIA  1021

Query  1081  VSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             +S  WTLRQLDV NAFL+G L E V+M+QPPGYE     D        ALYGL+
Sbjct  1022  ISRGWTLRQLDVQNAFLHGVLEEDVFMRQPPGYE---QKDGYVCKLDKALYGLK  1072



>pir||T02087 gag/pol polyprotein - maize retrotransposon Hopscotch
 gb|AAA57005.1| copia-like retrotransposon Hopscotch polyprotein [Zea mays]
Length=1439

 Score =   204 bits (518),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 130/191 (68%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KSD+YK+F  F+  VER F R I + Q D GGEY K++     +GI H+ SC +TH+Q
Sbjct  553   RHKSDVYKSFCEFQHLVERMFGRKIIAFQSDWGGEYEKLNAHFKTIGIHHQVSCPHTHQQ  612

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GLALLA+ S+  +YWD AF  A  LIN  P+  +  ++P  +L   
Sbjct  613   NGAAERKHRHIVEVGLALLAQSSMPLKYWDHAFLAAVYLINRTPSKTIAHDTPLHKLTGA  672

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ LR+FGC C+P LRPYN+HK+++RS  CVFL Y    +G++C+++++G+IYI R 
Sbjct  673   TPDYSSLRIFGCACWPNLRPYNQHKLQFRSTRCVFLGYSNMHKGFKCLDISTGRIYISRD  732

Query  1711  VHFYESIFLFS  1679
             V F E +F F+
Sbjct  733   VVFDEHVFPFA  743


 Score =   151 bits (381),  Expect(2) = 7e-88, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 128/217 (59%), Gaps = 15/217 (7%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  D+YTG+D +   NG G+ IS +G+A +P+ S+ LHL +VL+VP     L SV+RLT
Sbjct  340   LTMHDKYTGTDQIIAANGTGMTISNIGNAIVPTSSRSLHLRSVLHVPSTHKNLISVHRLT  399

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS---RSHFAYLTSRATSTVWH  2530
             N+N+VF EFH   F++KD  T+AVLL G    GLY LP     R    + ++R     WH
Sbjct  400   NDNDVFIEFHSSHFLIKDRQTKAVLLHGKCRDGLYPLPPHPDLRLKHNFSSTRVPLEHWH  459

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTS------CHLSKASRFPLDRVSYSSKNV  2368
             +RLGHP+  + +RV+ +     N +  L + ++      C  +KA + P       S   
Sbjct  460   KRLGHPSRDIVHRVISN-----NNLPCLSNNSTTSVCDACLQAKAHQLPYTISMSQSSAP  514

Query  2367  LDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             L L+++D++GPA + S   ++Y++ F+DDYS+F W Y
Sbjct  515   LMLIFSDVFGPA-IDSFGRYKYYVSFIDDYSKFTWIY  550


 Score =   181 bits (458),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 152/261 (58%), Gaps = 24/261 (9%)
 Frame = -3

Query  1654  VPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR----GLP---PLAIEGPV--  1502
             VP ++  A+ P  T    N   AP      SL+S  P+A     G+P   PL ++ P   
Sbjct  823   VPSSLVPAASPAPTGVSANAEPAPEAD---SLSSGPPVATESVTGVPDADPL-LQAPGSS  878

Query  1501  ------QTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*  1340
                    +AP  A A  T+ Q    + + +  T  T    +A    T+P+  S+A+    
Sbjct  879   VAHQTPDSAPLSAAAPRTRLQHG--ISKPKQFTDGTVRYGNAAARITEPSSVSEALADPQ  936

Query  1339  WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQ  1160
             WR AM+ EF AL  N+TW LV  +   N++ CKWVF+ K NADGSI++ KARLVAKGF Q
Sbjct  937   WRAAMEAEFQALQKNNTWTLVPPDRTRNLIDCKWVFKVKYNADGSIDRLKARLVAKGFKQ  996

Query  1159  VAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYE  980
               G D+ DTFS VVK +T+RL+ SL VS  W+LRQLDV NAFL+G L ETVYMKQPPG+ 
Sbjct  997   QYGIDYDDTFSPVVKHSTIRLVLSLAVSQKWSLRQLDVQNAFLHGILEETVYMKQPPGFA  1056

Query  979   DPTHPD-HVRVSSSTALYGLR  920
             D THP+ H  +  S  LYGL+
Sbjct  1057  DTTHPNYHCHLQKS--LYGLK  1075


 Score = 70.1 bits (170),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 80/158 (51%), Gaps = 9/158 (6%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             VS KLT  N++ W+ Q++P +R  +L   +     CPP TI+  S    +V +       
Sbjct  20    VSEKLTKGNYLLWKAQVLPAIRAAQLDDILTGVEICPPKTISDASDRTVTVANPA-----  74

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
                 Y  WI +DQ++L  L+SSLS EV+   V  +TS  VW ++     S SRAR ++  
Sbjct  75    ----YGRWIARDQAVLGYLLSSLSREVLSSVVNCSTSASVWTTLSEMYSSHSRARKVNTR  130

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDE  3123
                   ++G SS  EY  + +   ++L  AG P+  +E
Sbjct  131   IALATTKKGASSVAEYFAKMRGFADELGAAGKPLDDEE  168



>emb|CAN75478.1| hypothetical protein VITISV_020209 [Vitis vinifera]
Length=1074

 Score =   319 bits (818),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 173/403 (43%), Positives = 236/403 (59%), Gaps = 30/403 (7%)
 Frame = -3

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNGRVE K RH+VETGL LL   ++  ++W +AF     LIN +P+ +L + SP++ L+
Sbjct  306   EQNGRVECKMRHVVETGLTLLYTATLPSKFWPYAFTTTVTLINCMPSPLLNYSSPFSLLY  365

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
             K PP Y   +VFGC CYP+L+  N +K + RS PC+FL Y PS +GY C+N T+ ++YI 
Sbjct  366   KHPPDYFHFKVFGCLCYPHLKHLNSNKFQPRSTPCIFLGYAPSHKGYLCLNPTTNRVYIS  425

Query  1717  RHVHFYESIFLFSDSTLCSQ-----PVPPTIPWASEPVV----TRAPCNTHAAPTDSAHM  1565
             RHV F E+ F F   +  SQ     PV P  P    P++    T +P  T + P      
Sbjct  426   RHVVFAETTFPFQALSPPSQQSYHIPVTPAFPLPPSPILFPPTTSSPLATPSEPAP----  481

Query  1564  SLTSPVPLARGLPPL--------AIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTS  1409
               TSP   +  LPPL        A E P  +       +       GH M  R  +    
Sbjct  482   --TSPPANSLSLPPLIHVPFVDEAAETPTTSLQDSTAPI------PGHPMITRSKSGICK  533

Query  1408  EQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFR  1229
             ++ +  ++T +P    Q +    W+ AM+QE+ ALL N TW LV    +  ++ CKWVF+
Sbjct  534   KKTYLTSLTIEPRTVKQTLQDPNWKLAMEQEYQALLKNQTWSLVPPPSNAKIIRCKWVFK  593

Query  1228  TKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
              K   +GSI++YKARLVA+GF+Q  G DFF+TFS VVKP T+RL+ S+ VS NW ++QLD
Sbjct  594   LKHKPNGSIDRYKARLVAQGFHQTYGIDFFETFSPVVKPCTIRLVLSIAVSSNWPIKQLD  653

Query  1048  VHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             VHNAFLNG L E V+M QPPG+ED + P HV      ALYGL+
Sbjct  654   VHNAFLNGDLQEQVFMMQPPGFEDSSCPTHV-CRLQKALYGLK  695



>gb|AAU10682.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1210

 Score =   206 bits (525),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 131/191 (69%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS+++  F  F+  VER F R I ++Q D GGEY K+H   TK+GI+H  SC +TH+Q
Sbjct  544   KQKSEVFHKFHEFQQLVERIFYRKIIAMQTDWGGEYEKLHDFFTKIGISHHVSCPHTHQQ  603

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL+LLA  S+  ++WD AF  AT LIN  P+ V+Q+E+P   L   
Sbjct  604   NGSAERKHRHIVEVGLSLLAHASMPLKFWDEAFIAATYLINRTPSKVIQYETPLEHLFHQ  663

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P YT LRVFGC C+P LRPYN  K+++RS  CVFL Y    +G++C+++ +G++YI R 
Sbjct  664   KPSYTSLRVFGCACWPNLRPYNARKLQFRSKQCVFLGYSNLHKGFKCLDVAAGRVYISRD  723

Query  1711  VHFYESIFLFS  1679
             V F E++F F+
Sbjct  724   VVFDENVFPFA  734


 Score =   145 bits (365),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 122/212 (58%), Gaps = 6/212 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  D Y G + +   +G+G+ I  +G ++I + ++ L+L N+L+VP+    L S +RL 
Sbjct  332   LTTRDRYNGKEQIHTASGSGMDIKHIGQSTIRTPTRNLYLRNILHVPRTKKNLISAHRLA  391

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTS--RATSTVWHR  2527
              +N+ F E H   F +KD IT+  LLRG    GLY LP S S    +    + T ++WH 
Sbjct  392   VDNHAFVEVHPRFFAIKDQITKNTLLRGPCCNGLYPLPASTSSSKQVLGAIKPTVSIWHS  451

Query  2526  RLGHPNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLY  2353
             RLGHP+  +  +V+   + P    + K LG   +C   K+ + P  + + +S   L+L++
Sbjct  452   RLGHPSWQIVQKVVSHNNLPCL-GESKELGVCDACQKGKSHQLPFLKSTSASNFPLELVF  510

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +D+WGPAP  S  G +Y++ F+DD+S+F W Y
Sbjct  511   SDVWGPAP-DSVGGRKYYVSFIDDFSKFTWIY  541


 Score =   121 bits (303),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = -3

Query  1216  ADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNA  1037
             +DGS+++YKARLVAKGF Q  G D+ DTFS VVK  T+R + S+ VS  W+LRQLDV NA
Sbjct  870   SDGSLDRYKARLVAKGFEQRYGIDYEDTFSPVVKAATIRTILSVAVSRGWSLRQLDVQNA  929

Query  1036  FLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             FL+G+L E VYM+QPPGYED   P+++      ALYGL+
Sbjct  930   FLHGYLEEEVYMRQPPGYEDRNKPNYI-CKLDKALYGLK  967


 Score = 68.6 bits (166),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 75/158 (47%), Gaps = 5/158 (3%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             +S KLT  NF  W+T ++P + G  + GY+   T  P   I         +    +    
Sbjct  17    ISEKLTKNNFSLWKTHILPVICGARMEGYLTGATQVPSAEIEVKEGEKGEITKKVSNPA-  75

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
                 Y AWI  DQ +L  L+SS+S E++       T+   W+ I   L + SRAR L+  
Sbjct  76    ----YEAWIAADQQVLGFLLSSISKEILIQVANVDTAAHAWKMIVGLLSTQSRARALNTR  131

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDE  3123
                   ++G SS  +Y+ + + L +++A AG P+  +E
Sbjct  132   IALATTQKGESSVSDYISKMKTLADEMASAGKPLDDEE  169



>emb|CAN77295.1| hypothetical protein VITISV_005638 [Vitis vinifera]
Length=1198

 Score =   191 bits (486),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 126/203 (62%), Gaps = 4/203 (2%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F+++VE QF   IK +Q D GGE+R     L + GI HR SC Y   Q
Sbjct  489   QTKDQALPAFKKFKLQVENQFDAKIKCLQSDNGGEFRSFKTFLQQTGIFHRFSCPYNSAQ  548

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N RVERK+RH+VETGLALLA  S+  ++W +AF+ AT LIN +P+ VLQ  SPY  L + 
Sbjct  549   NERVERKHRHVVETGLALLAHASLPMEFWQYAFQTATFLINRMPSKVLQNNSPYFTLFQK  608

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVF C CYP++RPYN HK++YRS   +FL Y    +G+ C++  +G++YI  H
Sbjct  609   VPDYESLRVFSCLCYPFIRPYNNHKLQYRSVQSLFLGYSLHNKGFLCLDFLTGRVYITPH  668

Query  1711  VHFYESIFLFSDSTLCSQPVPPT  1643
             V F E  F  +     + P+ PT
Sbjct  669   VVFDEGQFPLAK----THPLSPT  687


 Score =   159 bits (403),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 128/231 (55%), Gaps = 22/231 (10%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ S  YTG D + +GNG  L IS  G   + S+S+  HL  V +V  +S  L SV +  
Sbjct  257   LTSSSPYTGIDKVTIGNGKHLSISNTGSHRLLSDSRSFHLKKVFHVHFISANLISVAKFY  316

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRS-HFAYLTSRATST-----  2539
              +NN  FEF  + F VKD  T+ VL +G    GLYR PV  S   A++ +  +ST     
Sbjct  317   LDNNALFEFRSNSFFVKDLHTKKVLAQGKLENGLYRFPVLNSKKVAFVGAINSSTFYSHN  376

Query  2538  ---------VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT-------SCHLSKASR  2407
                      +WH RLGH + ++  +++QSC V+  K K+    T       SC L+K+ R
Sbjct  377   SSIFDNKVKLWHHRLGHASTNIVTQIMQSCNVSFEKNKNTVCSTVCSTVCSSCQLAKSHR  436

Query  2406  FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              P       +   L+L++TD+WGPA V STSG RYF+LF+DDYSR+ WFYP
Sbjct  437   LPTHLSLSCASKPLELVHTDLWGPASVKSTSGARYFILFLDDYSRYTWFYP  487


 Score =   162 bits (411),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = -3

Query  1330  AMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAG  1151
             AMD E  AL  N TW LV     +N++GCKWV++ K   DGSIE+YKARLVAKG+NQ  G
Sbjct  768   AMDLEIAALHRNQTWDLVEQPSKVNLIGCKWVYKLKHKPDGSIERYKARLVAKGYNQTHG  827

Query  1150  DDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPT  971
              D+F+TFSLVVK  T+R++ S+ +S  W +RQLDVHNAFLNG L E VYM QPPGY D T
Sbjct  828   LDYFETFSLVVKAATIRIILSVALSFQWEIRQLDVHNAFLNGELEEQVYMSQPPGYLDTT  887

Query  970   HP  965
              P
Sbjct  888   FP  889



>emb|CAN64288.1| hypothetical protein VITISV_022326 [Vitis vinifera]
Length=1508

 Score =   319 bits (818),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 180/439 (41%), Positives = 243/439 (55%), Gaps = 49/439 (11%)
 Frame = -3

Query  2227  TFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVERKY  2048
             TF +FR  +E Q + +IK IQ D GGE+      L   GI H+ SC +T +QNGR ERK 
Sbjct  768   TFITFRKMIENQLNSTIKCIQSDNGGEFIAFKPYLEAHGIVHQFSCPHTPQQNGRAERKI  827

Query  2047  RHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLR  1868
              H+VETG+ALLA+  +  +YW FAF+ +  LIN LP  +L F+SP   L    P Y  LR
Sbjct  828   CHLVETGMALLAQSFLPSKYWSFAFQTSVYLINLLPAKLLNFQSPLQVLFHKIPNYHHLR  887

Query  1867  VFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIF  1688
             VFGC C+P LRP N HK+ YRS  CVFL Y  + +GY C+++++ ++YI R V F+ES F
Sbjct  888   VFGCLCFPSLRPCNHHKLSYRSTACVFLGYASAHKGYICLDVSTSRLYISRDVLFHESSF  947

Query  1687  LFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSL---TSPVPLARGLPPLA  1517
              F  S     P+P   P  S   +   P  + ++P+  +   L   T     +  LPPL 
Sbjct  948   PF-QSIPAPSPLPQHTPLTS--ALINPPLLSTSSPSTVSFPVLTSSTDCTSTSDSLPPL-  1003

Query  1516  IEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*W  1337
                                                      L  T++P  Y+QA     W
Sbjct  1004  -----------------------------------------LQTTSEPHTYNQAXKSEPW  1022

Query  1336  RDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQV  1157
               AM  E+ ALL N TW LV   P  ++VGC+W+++ K   +GS+E++KARLVA+GF Q 
Sbjct  1023  VQAMQHEYQALLRNHTWSLVPPPPLAHIVGCRWIYKLKYLPNGSVERHKARLVAQGFTQT  1082

Query  1156  AGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYED  977
              G D+FDTFS +VKP T+RL+ +L VS  W +RQLDV NAFLNG L E V+M QP G+  
Sbjct  1083  LGVDYFDTFSPIVKPCTIRLILTLAVSFQWXIRQLDVENAFLNGDLQEEVFMAQPQGFVH  1142

Query  976   PTHPDHVRVSSSTALYGLR  920
             P +P +V      ALYGL+
Sbjct  1143  PQYPHYV-CKLHKALYGLK  1160


 Score = 90.9 bits (224),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 90/170 (53%), Gaps = 6/170 (4%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             +A  +S    Y+G+D + +G+G  L I   G+ S    SK+  L+ VL+VP+LS  L SV
Sbjct  569   SAQTLSHVQPYSGADQVTIGDGHSLPILNTGNKSFFFHSKVFCLNQVLHVPQLSTNLISV  628

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT----  2545
              +   +N  FF FH   F VKD +T+  LL+G    GLY  P S S  A++++ +     
Sbjct  629   SKFCTDNAXFFXFHSTHFFVKDQVTKQTLLKGWLRDGLYEFPSSSSTHAFVSTSSVPXLT  688

Query  2544  -STVWHRRLGHPNAHVQNRVLQSC-PVAPNKVKSLGSRTSCHLSKASRFP  2401
                +WH RLGHP A + ++ L SC P    ++  +     C L+K+   P
Sbjct  689   XGAIWHSRLGHPAAPILSKALASCNPSVSFQINKIAPCKICPLAKSHSLP  738


 Score = 57.4 bits (137),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 70/151 (46%), Gaps = 15/151 (10%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I W+TQ+   +       Y+D   PCPP  +     + D V      
Sbjct  257   NHALPIKLDXNNYILWKTQMENVVYANGFEEYIDGTKPCPPQELHTGELNPDFVQ-----  311

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ +LS L S+L+ ++M   VG  TS   W ++      SS+AR L
Sbjct  312   ----------WRRFDRMVLSWLYSTLTPDIMGQIVGFQTSHDAWMALHKIFSXSSKARIL  361

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLA  3153
                 +F   ++G    +EY+ + + + ++LA
Sbjct  362   QLRLEFQTAKKGADPMLEYILKIKTIXDNLA  392



>gb|AAK09230.1|AC084320_17 putative copia-like retrotransposon Hopscotch polyprotein [Oryza 
sativa Japonica Group]
 gb|AAK72882.1|AC091123_1 putative gag-pol protein [Oryza sativa Japonica Group]
Length=1219

 Score =   207 bits (527),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 131/191 (69%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS++++ F+ F+  VERQF+R I  +Q D GGEY+K++    ++GI H+ SC +TH+Q
Sbjct  541   KFKSEVFEKFKEFQSMVERQFNRKILGMQTDWGGEYQKLNSFFKQIGIAHQVSCPHTHQQ  600

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VERK+RHIVE GL+LLA  S+  ++WD AF  AT LIN LP  V+ F++P  RL   
Sbjct  601   NGAVERKHRHIVEIGLSLLAHASMPLKFWDEAFLAATYLINRLPRKVIDFDTPLARLFHQ  660

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LR FGC C+P LRPYN HK+++RS  CVFL +    +G++C+ + +G++YI R 
Sbjct  661   QPDYKSLRTFGCACWPNLRPYNTHKLQFRSKQCVFLGFSNLHKGFKCLEVATGQVYISRD  720

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  721   VTFDEQEFPFS  731


 Score =   142 bits (359),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 114/209 (55%), Gaps = 2/209 (1%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  ++Y G+D +   +G G+ I  +GH+ +P+ S+ LHL N+L+VPK S  L SV+RL 
Sbjct  331   LTTREKYKGTDQIHTASGEGMDIQHIGHSYVPTSSRPLHLKNILHVPKASKNLISVHRLV  390

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRL  2521
              +N  F E H+  F++KD +TR  +L G     LY LP             +   WH RL
Sbjct  391   ADNYAFLEIHQKYFLIKDKVTRRTILEGPCRRDLYPLPAGDPIKQVFAVMPSFERWHGRL  450

Query  2520  GHPNAHVQNRVL-QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDI  2344
             GH +  +  RV+ Q+     N+  S     +C   K+ + P  +    S N L+L+++D+
Sbjct  451   GHASKPIVLRVINQNKLPCSNESPSESVCDACQQGKSHQLPFPKFFSVSSNPLELIHSDV  510

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             WGPA   S    RY++ F+DDYS+F W Y
Sbjct  511   WGPAS-DSVGAKRYYVSFIDDYSKFVWIY  538


 Score =   117 bits (294),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = -3

Query  1441  MRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPH  1262
             +R + +  D + ++     + +P   ++A+G   W++AMD+E+ AL+ N+TW LV  +  
Sbjct  913   IRKKKIYTDGTVKYGCFTSSGEPQNLAEALGDRNWKEAMDKEYYALMKNETWHLVPPKKG  972

Query  1261  MNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLV  1082
             +N++ CKWV++ KR ADGS+++YK RLVAKGF Q  G D+ DTFS VVK  T+R + SLV
Sbjct  973   INIIDCKWVYKIKRKADGSLDRYKGRLVAKGFKQRYGIDYEDTFSPVVKAATIRTVLSLV  1032

Query  1081  VSHNWTL  1061
              S + +L
Sbjct  1033  ASKDTSL  1039



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score =   206 bits (523),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 133/191 (70%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS++++ F+ F+  VER F R I ++Q D GGEY+K++    K+GI H  SC +TH+Q
Sbjct  553   KYKSEVFEKFKEFQALVERMFDRKIIAMQTDWGGEYQKLNSFFAKIGIDHHVSCPHTHQQ  612

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHI+E GL+LL+  S+  ++WD AF  AT LIN +P+  +Q  +P  +L   
Sbjct  613   NGSAERKHRHIIEVGLSLLSYASMPLKFWDEAFVAATYLINRVPSKTIQNSTPLEKLFNQ  672

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC C+P+LRPYN HK+++RS  CVFL +    +G++C++++SG++YI R 
Sbjct  673   KPDYLSLRVFGCACWPHLRPYNTHKLQFRSKQCVFLGFSTHHKGFKCLDVSSGRVYISRD  732

Query  1711  VHFYESIFLFS  1679
             V F E+IF FS
Sbjct  733   VVFDENIFPFS  743


 Score =   143 bits (361),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 126/214 (59%), Gaps = 8/214 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  ++Y G++ +   +GAG+ IS +GH ++ + S+ +HL+NVLYVP+    L S  +L 
Sbjct  339   LTTKEKYNGNEQIHTASGAGMDISHIGHTTVHTPSRNIHLNNVLYVPQAKKSLISASQLA  398

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS----RSHFAYLTSRATSTVW  2533
              +N+ F E H   F +KD +T+ +LL G    GLY +P S     S  A  T++ + + W
Sbjct  399   TDNSAFLELHSKFFSIKDQVTKDILLEGRCRHGLYPIPKSFGRTTSKQALGTTKLSLSRW  458

Query  2532  HRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP+  +  +V+    + P  V+S+      +C  +K+ + P  R +  S+  L+L
Sbjct  459   HSRLGHPSLPIVKQVISKNNL-PCSVESVNQSVCNACQEAKSRQLPYVRSTSVSQFPLEL  517

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +++D+WGPAP  S    +Y++ F+DD+S+F W Y
Sbjct  518   VFSDVWGPAPE-SVGRNKYYVSFIDDFSKFTWIY  550


 Score =   177 bits (448),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = -3

Query  1441  MRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPH  1262
             +R   +  D + ++     T +P    +A+G   W+ AM+ E++AL+ NDTW LV  E  
Sbjct  906   IRKEKVYTDGTVKYGCFTSTGEPQNDKEALGDKNWKAAMEAEYDALIKNDTWHLVPYEKG  965

Query  1261  MNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLV  1082
              NV+GCKWV++ KR ADG++++YKARLVAKGF Q  G D+ DTFS VVK  T+R++ S+ 
Sbjct  966   QNVIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIA  1025

Query  1081  VSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             VS  W+LRQLDV NAFL+G L E VYM+QPPG+E  + P++V      ALYGL+
Sbjct  1026  VSRGWSLRQLDVQNAFLHGFLEEEVYMQQPPGFESFSKPNYV-CKLDKALYGLK  1078



>emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera]
Length=1523

 Score =   254 bits (648),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 172/498 (35%), Positives = 242/498 (49%), Gaps = 61/498 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+       F   V  QF   +K ++ D G E++      ++ GI H+ SC  T +QNG
Sbjct  626   KSEARSLLVHFVNLVANQFGSQVKIVRSDNGPEFKHTQFYSSR-GILHQTSCINTPQQNG  684

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RH++    ALL +  + + +W  A   A  LIN  PT +LQ ++P+ +L    P
Sbjct  685   VVERKHRHLLNVARALLFQSHLPKPFWGDAILTAAYLINRTPTPLLQGKTPFEKLFHKSP  744

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LRVFGCRC+    P    K + RS   VF+ YP   +GY+  +L   K  I R V 
Sbjct  745   NYSHLRVFGCRCFVSTHPLRPSKFDPRSIESVFIGYPHGQKGYKVYSLKDKKXLISRDVT  804

Query  1705  FYESIFLFSDSTLCSQPVP----PTIPWAS----------------EPVVTRAPCNTHAA  1586
             F+E+ F + +    + P      P++P                   +P  T +  + H  
Sbjct  805   FFETEFPYQNXLSTTSPSLDTFFPSLPQTPDIDDDHISFNHSGSNLQPSATSS-VDXHPQ  863

Query  1585  PT-----DSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRA-RAV*TQHQERGHVMRLRHM  1424
             PT      S+H+   S  P     PP+ I  P  + P R+ R   T    +   +     
Sbjct  864   PTLDNSHSSSHVDPPSSPPSLNTSPPV-ISQPSPSQPRRSSRPTKTPTTLQDFHIEAALP  922

Query  1423  TR-----DTSEQFHA-------------------------LNVTTDPTCYSQAVGHL*WR  1334
             +R      TSE  H+                         + +  +P  +SQAV    WR
Sbjct  923   SRPVPPSSTSEVAHSGTIHSLSQVLSYDRLSPMHKAFTVKITLAKEPRSFSQAVLDSRWR  982

Query  1333  DAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVA  1154
             +AM+ E  AL  N TW LV    H   +GCKWV++ K N DG+IE+YKARLVAKGF+QV 
Sbjct  983   EAMNTEIQALQANKTWSLVPLPSHKKPIGCKWVYKIKYNPDGTIERYKARLVAKGFSQVE  1042

Query  1153  GDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDP  974
             G D+ +TF+ V K TTVR+L SL     W L QLDV+NAFLNG L E VYM+ PPG+   
Sbjct  1043  GIDYRETFAPVAKLTTVRVLLSLASIQGWHLHQLDVNNAFLNGDLYEDVYMQLPPGFGRK  1102

Query  973   THPDHVRVSSSTALYGLR  920
                +H       +LYGL+
Sbjct  1103  G--EHRVCKLHKSLYGLK  1118


 Score = 94.0 bits (232),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 101/197 (51%), Gaps = 7/197 (4%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             ++++ +G    +S +G  S  ++     L NVL VP   + L S+ +L  ++     F +
Sbjct  432   IVKLPDGTSAHVSHIGTVSFSAQ---FVLHNVLCVPLFYLNLISISKLAFDSFYVTIFLR  488

Query  2667  DCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRV  2488
                 ++D  +  ++  G+ S GLY L + R     + +  T  +WH+RLGHP++ V   V
Sbjct  489   QVCFIQDLQSGKMIGMGTESEGLYCLNLPRKGTCNVVNTKTQDLWHQRLGHPSSKVS--V  546

Query  2487  LQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGF  2308
             L   P   NK   + + + C L+K +R P      SS +  DL++ DIWG   V S SG 
Sbjct  547   L--FPFLQNKTLDVSTCSICPLAKHTRTPFPLSVSSSDSCFDLIHVDIWGGYHVPSLSGA  604

Query  2307  RYFLLFVDDYSRFCWFY  2257
             +YFL  VDD+SR  W Y
Sbjct  605   QYFLTIVDDHSRSTWVY  621



>emb|CAC95126.1| gag-pol polyprotein [Populus deltoides]
Length=1382

 Score =   259 bits (662),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 174/476 (37%), Positives = 249/476 (52%), Gaps = 49/476 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+ ++ + +FR  ++ Q S  IK  + DLGGEY   K    L   G  H+ SC  T EQ
Sbjct  578   RSEFFEIYAAFRALIKTQHSAVIKCFRCDLGGEYTSNKFCQMLALDGTIHQTSCTDTPEQ  637

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVET  +LL    V  ++W  A   A  LIN +P+S     SP+ +L+  
Sbjct  638   NGVAERKHRHIVETARSLLLSAFVLSEFWGEAVLTAVSLINTIPSSHSSGLSPFEKLYGH  697

Query  1891  PPPYTFLRVFGCRCYPYLRPY-NRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
              P Y+  RVFGC  Y  L P+  R+K+  RSA CVFL Y    +GYRC +  + K+Y+  
Sbjct  698   VPDYSSFRVFGCT-YFVLHPHVERNKLSSRSAICVFLGYGEGKKGYRCFDPITQKLYVSH  756

Query  1714  HVHFYESIFLFS----DSTLCSQPVPPTIPWA------SEPVVTRAPCNTHAAPTDSAHM  1565
             HV F E I  FS      +L    +    P++      + P V R+ C  ++A T +   
Sbjct  757   HVVFLEHIPFFSIPSTTHSLTKSDLIHIDPFSEDSGNDTSPYV-RSICTHNSAGTGT---  812

Query  1564  SLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTR--DTSEQFHAL  1391
                    L  G P  +      TAP  +  +      +   +R+R  T+  D +   ++ 
Sbjct  813   -------LLSGTPEASFSS---TAPQASSEIVDPPPRQS--IRIRKSTKLPDFAYSCYSS  860

Query  1390  NVTT---------DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKW  1238
             + T+         +P+ Y +A+     + AMD+E +AL   DTW LV   P  +VVGC+W
Sbjct  861   SFTSFLAYIHCLFEPSSYKEAILDPLGQQAMDEELSALHKTDTWDLVPLPPGKSVVGCRW  920

Query  1237  VFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLR  1058
             V++ K N+DGSIE+YKARLVAKG++Q  G D+ +TF+ + K TT+R L ++     W + 
Sbjct  921   VYKIKTNSDGSIERYKARLVAKGYSQQYGMDYEETFAPIAKMTTIRTLIAVASIRQWHIS  980

Query  1057  QLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             QLDV NAFLNG L E VYM  PPG    +H          ALYGL+      +PRA
Sbjct  981   QLDVKNAFLNGDLQEEVYMAPPPGI---SHDSGYVCKLKKALYGLKQ-----APRA  1028


 Score = 87.4 bits (215),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 92/186 (49%), Gaps = 16/186 (9%)
 Frame = -1

Query  2769  LHLS--NVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLY  2596
             LHLS  NV  +PKL + L S+ ++ +  +    F      V+D  ++ ++  G    GLY
Sbjct  389   LHLSLPNVYLIPKLKLNLASIGQICDSGDYLVMFSGSFCCVQDLQSQKLIGTGRRENGLY  448

Query  2595  RLPVSRSHFAYLTSRATST------------VWHRRLGHPNAHVQNRVLQSCPVAPN-KV  2455
              L   +       +    +            +WH RLGH ++  + R L S     N K 
Sbjct  449   ILDELKVPVVVAATTVDLSFFRLSLSSSSFYLWHSRLGHVSSS-RLRFLASTGALGNLKT  507

Query  2454  KSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYS  2275
               +   + C L+K S  P +R +  S +  DL+++D+WGP+PV +  G RY++ F+DD++
Sbjct  508   CDISDCSGCKLAKFSALPFNRSTSVSSSPFDLIHSDVWGPSPVSTKGGSRYYVSFIDDHT  567

Query  2274  RFCWFY  2257
             R+CW Y
Sbjct  568   RYCWVY  573



>emb|CAN79148.1| hypothetical protein VITISV_004343 [Vitis vinifera]
Length=1334

 Score =   186 bits (471),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 119/183 (65%), Gaps = 0/183 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K    ++F +FR  VE Q   +IK IQ D GGE+      L   GI H+ SC +T +QNG
Sbjct  578   KDQALQSFITFRKMVENQLQTTIKCIQSDNGGEFLAFKPYLEAHGILHQFSCPHTPQQNG  637

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK RH+VETGLAL+A+  +  +YW +AF+ A  LIN LP  +L F+SP   L    P
Sbjct  638   RAERKIRHLVETGLALMAQSFLPSKYWTYAFQTAVYLINLLPAKLLHFQSPTQTLFHKLP  697

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRPY +HK+ YRS  CVFL Y P+ +GY C+++++ +IYI R+V 
Sbjct  698   NYHHLRVFGCLCFPSLRPYTQHKLCYRSTACVFLGYAPAHKGYLCLDVSTNRIYISRNVI  757

Query  1705  FYE  1697
             F+E
Sbjct  758   FHE  760


 Score =   160 bits (406),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 121/215 (56%), Gaps = 3/215 (1%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             +A  +S    Y+G+D + +G+G  L I   G  S    SK   L+ VL+VP LS  L SV
Sbjct  359   SAQTLSCVQPYSGTDQVTIGDGNSLPILNTGTKSFFFPSKTFSLNQVLHVPHLSTNLISV  418

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS--T  2539
              +   +N VFFEFH  CF VKD +T+ +LL+G    GLY    S    A++T+ + S   
Sbjct  419   SKFCTDNAVFFEFHSSCFFVKDQVTKKILLKGWLRDGLYEFSSSSPPRAFVTTGSFSDGA  478

Query  2538  VWHRRLGHPNAHVQNRVLQSC-PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
             +WH RLGHP   + ++ L SC P    ++  +     C L+K+   P    S  + + L 
Sbjct  479   IWHSRLGHPAVPILSKALASCNPSVTLQINKIAPCIICPLAKSHSLPYSLSSSHASHPLA  538

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             L++TD+WGPAP  S +G RYFL+F+DDYSR  W Y
Sbjct  539   LIHTDLWGPAPSTSITGARYFLIFIDDYSRHTWIY  573


 Score = 57.8 bits (138),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 74/157 (47%), Gaps = 15/157 (10%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I W+TQ+   +       Y++    CPP  +     + D V      
Sbjct  27    NHALPIKLDRSNYILWKTQMENVVYANGFEDYIEGTKSCPPKELPTGDLNPDFVQ-----  81

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ +LS + S+L+ ++M   VG  TS   W ++     +SS+AR +
Sbjct  82    ----------WRRFDRMVLSWMYSTLNPDIMGQIVGFQTSHEAWMALHKIFSASSKARIM  131

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                 +F   ++G  + ++Y+ + + + ++LA  G P+
Sbjct  132   QLRLEFQTTKKGGDAMLDYILKMKTISDNLAAVGEPV  168



>gb|AAD26943.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1454

 Score =   251 bits (641),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 158/458 (34%), Positives = 231/458 (50%), Gaps = 30/458 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS++   F +F  +VE Q+   +K+++ D   E +       K GI    SC  T EQ
Sbjct  653   KTKSEVLTVFPAFIQQVENQYKVKVKAVRSDNAPELKFTSFYAEK-GIVSFHSCPETPEQ  711

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    AL+ +  V    W      A  LIN  P+ +L  ++PY  L  T
Sbjct  712   NSVVERKHQHILNVARALMFQSQVPLSLWGDCVLTAVFLINRTPSQLLMNKTPYEILTGT  771

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LR FGC CY    P  RHK + RS  C+FL YP  ++GY+ M+L S  ++I R+
Sbjct  772   APVYEQLRTFGCLCYSSTSPKQRHKFQPRSRACLFLGYPSGYKGYKLMDLESNTVFISRN  831

Query  1711  VHFYESIFLF-----SDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPV  1547
             V F+E +F       S+S+L  +   P +P +S  +            +D+ H   + P 
Sbjct  832   VQFHEEVFPLAKNPGSESSL--KLFTPMVPVSSGII------------SDTTHSPSSLPS  877

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGH----VMRLRHMTRDTSEQFHALNVTT  1379
              ++  LPP      V+  P           +  H       + +     S   +  N+T 
Sbjct  878   QIS-DLPPQISSQRVRKPPAHLNDYHCNTMQSDHKYPISSTISYSKISPSHMCYINNITK  936

Query  1378  DP--TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGS  1205
              P  T Y++A     W +A+D E  A+   +TW++         VGCKWVF  K  ADG+
Sbjct  937   IPIPTNYAEAQDTKEWCEAVDAEIGAMEKTNTWEITTLPKGKKAVGCKWVFTLKFLADGN  996

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             +E+YKARLVAKG+ Q  G D+ DTFS V K TT++LL  +  S  W L+QLDV NAFLNG
Sbjct  997   LERYKARLVAKGYTQKEGLDYTDTFSPVAKMTTIKLLLKVSASKKWFLKQLDVSNAFLNG  1056

Query  1024  HLAETVYMKQPPGYEDPTH---PDHVRVSSSTALYGLR  920
              L E ++MK P GY +      P +V +    ++YGL+
Sbjct  1057  ELEEEIFMKIPEGYAERKGIVLPSNVVLRLKRSIYGLK  1094


 Score = 94.0 bits (232),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 93/191 (49%), Gaps = 4/191 (2%)
 Frame = -1

Query  2829  GAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVK  2650
             G  + IS VG   +  +   + L NVL++P+  + L S+  LT++      F K+   ++
Sbjct  464   GPTVKISGVGTLKLNDD---ILLKNVLFIPEFRLNLISISSLTDDIGSRVIFDKNSCEIQ  520

Query  2649  DSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPV  2470
             D I   +L +G     LY L V     + + +    ++WHRRLGH +    + +  S   
Sbjct  521   DLIKGRMLGQGRRVANLYLLDVGDQSIS-VNAVVDISMWHRRLGHASLQRLDAISDSLGT  579

Query  2469  APNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLF  2290
               +K K       CHL+K  +      +   K + DLL+ D+WGP  V +  G++YFL  
Sbjct  580   TRHKNKGSDFCHVCHLAKQRKLSFPTSNKVCKEIFDLLHIDVWGPFSVETVEGYKYFLTI  639

Query  2289  VDDYSRFCWFY  2257
             VDD+SR  W Y
Sbjct  640   VDDHSRATWMY  650



>emb|CAN73924.1| hypothetical protein VITISV_041509 [Vitis vinifera]
Length=1434

 Score =   186 bits (471),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 119/183 (65%), Gaps = 0/183 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K    ++F +FR  VE Q   +IK IQ D GGE+      L   GI H+ SC +T +QNG
Sbjct  578   KDQALQSFITFRKMVENQLQTTIKCIQSDNGGEFLAFKPYLEAHGILHQFSCPHTPQQNG  637

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK RH+VETGLAL+A+  +  +YW +AF+ A  LIN LP  +L F+SP   L    P
Sbjct  638   RAERKIRHLVETGLALMAQSFLPSKYWTYAFQTAVYLINLLPAKLLHFQSPTQTLFHKLP  697

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRPY +HK+ YRS  CVFL Y P+ +GY C+++++ +IYI R+V 
Sbjct  698   NYHHLRVFGCLCFPSLRPYTQHKLCYRSTACVFLGYAPAHKGYLCLDVSTNRIYISRNVI  757

Query  1705  FYE  1697
             F+E
Sbjct  758   FHE  760


 Score =   157 bits (398),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 120/215 (56%), Gaps = 3/215 (1%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             +A  +S    Y+G+D + +G+G  L I   G  S    SK   L+ VL+VP LS  L SV
Sbjct  359   SAQTLSCVQPYSGTDQVTIGDGNSLPILNTGTKSFFFPSKTFSLNQVLHVPHLSTNLISV  418

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS--T  2539
              +   +N VFFE H  CF VKD +T+ +LL+G    GLY    S    A++T+ + S   
Sbjct  419   SKFXTDNAVFFEXHSSCFFVKDQVTKKILLKGWLRDGLYEFSSSSPPRAFVTTGSFSDGA  478

Query  2538  VWHRRLGHPNAHVQNRVLQSC-PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
             +WH RLGHP   + ++ L SC P    ++  +     C L+K+   P    S  + + L 
Sbjct  479   IWHSRLGHPAVPILSKALASCNPSVTLQINKIAPCIICPLAKSHSLPYSLSSSHASHPLA  538

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             L++TD+WGPAP  S +G RYFL+F+DDYSR  W Y
Sbjct  539   LIHTDLWGPAPSTSITGARYFLIFIDDYSRHTWIY  573


 Score = 57.8 bits (138),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 74/157 (47%), Gaps = 15/157 (10%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I W+TQ+   +       Y++    CPP  +     + D V      
Sbjct  27    NHALPIKLDRSNYILWKTQMENVVYANGFEDYIEGTKSCPPKELPTGDLNPDFVQ-----  81

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ +LS + S+L+ ++M   VG  TS   W ++     +SS+AR +
Sbjct  82    ----------WRRFDRMVLSWMYSTLNPDIMGQIVGFQTSHEAWMALHKIFSASSKARIM  131

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                 +F   ++G  + ++Y+ + + + ++LA  G P+
Sbjct  132   QLRLEFQTTKKGGDAMLDYILKMKTISDNLAAVGEPV  168



>emb|CAN69851.1| hypothetical protein VITISV_009554 [Vitis vinifera]
Length=1282

 Score =   250 bits (638),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/471 (35%), Positives = 227/471 (48%), Gaps = 78/471 (17%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F+++VE QF   IK +Q D GGE+R     L +  I HR S  Y   Q
Sbjct  502   QTKDQALPVFKKFKLQVENQFDAKIKCLQXDNGGEFRSFKTFLQQTXIFHRFSXPYNSTQ  561

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NGRVERK+RH+VE GLALLA  S+  ++W +AF+  T LIN  P+               
Sbjct  562   NGRVERKHRHVVEXGLALLAHASLPMEFWQYAFQTXTFLINRXPSK--------------  607

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
                            P++ PYN HK++YRS   +FL Y    +G+ C++  +G++YI  H
Sbjct  608   ---------------PFIXPYNSHKLQYRSVQSLFLGYSLHNKGFLCLDFLTGRVYITPH  652

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEP----VVTRAPCNTHAAPTDSAHM-------  1565
             V F E  F  +       P+ PT   +++     ++T  P  T  +              
Sbjct  653   VVFDEGQFPLAKXX----PLSPTKXTSTDTLTPXIITSFPSPTFCSNGSHTXSLSSSPST  708

Query  1564  -----SLTSP-VPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ  1403
                  S++SP V  A    P AI      +P+ A         R     +R +T+  +  
Sbjct  709   SEASDSVSSPTVTPASSTLPEAIHEDQXPSPSPA--------PRMTTRLMRGITKKKTIF  760

Query  1402  FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTK  1223
               +    ++     QA+    W  AMD E  AL  N TW LV     +N++GCKWV++ K
Sbjct  761   XLSAXKISEXYTLKQALKDPNWIQAMDLEIAALHRNQTWDLVEQPSEVNLIGCKWVYKLK  820

Query  1222  RNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVH  1043
                DGSIE+YKARLVAKG NQ  G D+F+TFS VVK  T+R+              LDVH
Sbjct  821   HKPDGSIERYKARLVAKGXNQTHGLDYFETFSPVVKAATIRI--------------LDVH  866

Query  1042  NAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             NAFLNG L E VYM  PPGY D T    V      A+YGL+      +PRA
Sbjct  867   NAFLNGELEEQVYMSXPPGYLDTTFXTKV-CRLKKAIYGLKQ-----APRA  911


 Score = 93.6 bits (231),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = -1

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT---SCHLSKASRFPLDRVSYSSKNVLDL  2359
              RLGH +  +  +++QSC V+  K K+    T   SC L+K+ R P       +   L+L
Sbjct  406   ERLGHASTDIVTQIMQSCNVSFEKNKNTVCSTVCSSCQLAKSHRLPTHLSLSCASKPLEL  465

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGPAPV STSG RYF LF+DDYSR+ WFYP
Sbjct  466   VHXDLWGPAPVKSTSGARYFJLFLDDYSRYTWFYP  500


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 15/162 (9%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + +KL   N+I W++Q+   +       ++D  + CP   +     SG         
Sbjct  30    NHTLPVKLDRTNYILWKSQIDNVVFANGFEDFIDGSSICPDKELX----SG---------  76

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                 NPA+ AW +QD++ILS L SSL+   M   +G  +    W ++     SSSRAR +
Sbjct  77    --LINPAFVAWRRQDRTILSWLYSSLTPAXMAQIIGHNSXHSAWNALEKTFSSSSRARIM  134

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                 +    ++G+ S ++Y+ + +   + LA  G P+S  +Q
Sbjct  135   QLRLELQSTKKGSXSMIDYIMKVKGAADSLAAIGEPVSEQDQ  176



>gb|ABA95367.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=807

 Score =   206 bits (524),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 0/189 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+++ F  F+  VER     I ++Q D GGEY+K+H    K+GI+H  SC Y H+QN 
Sbjct  518   KSDVFQKFHEFQALVERLLGHKIITMQKDWGGEYQKLHSFFDKIGISHHVSCPYAHQQNS  577

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVE GLALLA  S+  + WD  F  A  LIN  P  V++FE+P  RL K  P
Sbjct  578   SAERKHRHIVEVGLALLAHASMPLKLWDEVFYTAAYLINRTPNKVIKFETPLERLFKQLP  637

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LRVFGC C+P LRPYN HK+++RS  CVFL Y    +G++C+++++G++YI R V 
Sbjct  638   NYSLLRVFGCACWPNLRPYNNHKLQFRSKQCVFLDYSHLHKGFKCLDVSTGRVYISRDVI  697

Query  1705  FYESIFLFS  1679
             F E++F FS
Sbjct  698   FDENVFSFS  706


 Score =   136 bits (343),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 113/206 (55%), Gaps = 5/206 (2%)
 Frame = -1

Query  2868  DEYTGSDVLRVGNGAGLIISRVGHASIPS-ESKLLHLSNVLYVPKLSVPLFSVYRLTNEN  2692
             ++Y G++ +   NG G+ I  +GHA + + ++  LHL NVL+VP  +  L S  RL  +N
Sbjct  311   EKYKGTEKIHTANGVGMQIKHIGHALVHTPDNHTLHLKNVLHVPHATKNLISASRLAEDN  370

Query  2691  NVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS-TVWHRRLGH  2515
              VF E H   F+VKD   R ++L+G    GLY  P   +   Y+ S A S   WH RL H
Sbjct  371   YVFLEIHSKYFLVKDRAMRNIILKGRCRKGLYPFPSEDA--KYVCSVAPSFARWHSRLSH  428

Query  2514  PNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGP  2335
             P   + +RV+    +   K  S     +C  +K+ + P  R +  S   L+L+Y+D+WG 
Sbjct  429   PTTPIVSRVVNQNKLPCQKSHSESVCDACQKAKSHQLPYSRSTSVSTRPLELVYSDVWGT  488

Query  2334  APVISTSGFRYFLLFVDDYSRFCWFY  2257
             AP  S  G ++++ F+DD+S+F W Y
Sbjct  489   APS-SVGGNKFYVSFIDDFSKFTWVY  513



>gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana]
Length=1436

 Score =   248 bits (634),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/447 (37%), Positives = 222/447 (50%), Gaps = 37/447 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KSD+   F SF   VE Q+   + S++ D   E  K +    K GI     C  T EQ
Sbjct  654   KQKSDVLTVFPSFLKMVETQYHTKVCSVRSDNAHEL-KFNELFAKEGIKADHPCPETPEQ  712

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++H++    AL+ +  +  +YW      A  LIN L + V+  E+PY RL K 
Sbjct  713   NFVVERKHQHLLNVARALMFQSGIPLEYWGDCVLTAVFLINRLLSPVINNETPYERLTKG  772

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ L+ FGC CY    P +R K + R+  C+FL YP  ++GY+ +++ +  + I RH
Sbjct  773   KPDYSSLKAFGCLCYCSTSPKSRTKFDPRAKACIFLGYPMGYKGYKLLDIETYSVSISRH  832

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSL---TSPVPL  1541
             V FYE IF F+ S + +       P    P           AP +  H+ L   +S  P 
Sbjct  833   VIFYEDIFPFASSNI-TDAAKDFFPHIYLP-----------APNNDEHLPLVQSSSDAPH  880

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDT--------------SEQ  1403
                     I  P +   TR R +   H +  H       T  T              SE 
Sbjct  881   NHDESSSMIFVPSEPKSTRQRKL-PSHLQDFHCYNNTPTTTKTSPYPLTNYISYSYLSEP  939

Query  1402  FHA-LNVTTD---PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNV-VGCKW  1238
             F A +N+ T    P  YS+A     W DAM +E +A +   TW  + D P   V VGCKW
Sbjct  940   FGAFINIITATKLPQKYSEARLDKVWNDAMGKEISAFVRTGTWS-ICDLPAGKVAVGCKW  998

Query  1237  VFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLR  1058
             +   K  ADGSIE++KARLVAKG+ Q  G DFF+TFS V K  TV++L SL     W L 
Sbjct  999   IITIKFLADGSIERHKARLVAKGYTQQEGIDFFNTFSPVAKMVTVKVLLSLAPKMKWYLH  1058

Query  1057  QLDVHNAFLNGHLAETVYMKQPPGYED  977
             QLD+ NA LNG L E +YMK PPGY +
Sbjct  1059  QLDISNALLNGDLEEEIYMKLPPGYSE  1085


 Score = 92.0 bits (227),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 93/206 (45%), Gaps = 13/206 (6%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +R+ NG  + I   G   +   +  L L NVL++P+    L SV  LT        F  D
Sbjct  449   VRLPNGHTVKIEGTGFIQL---TDALSLHNVLFIPEFKFNLLSVSVLTKTLQSKVSFTSD  505

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRLPVSRS---------HFAYLTSRATSTVWHRRLGHP  2512
               +++      +L +GS  G LY L + +S              + +  S +WH+RLGHP
Sbjct  506   ECMIQALTKELMLGKGSQVGNLYILNLDKSLVDVSSFPGKSVCSSVKNESEMWHKRLGHP  565

Query  2511  NAHVQNRVLQSCPVAPNKVKSLGSRTS-CHLSKASRFPLDRVSYSSKNVLDLLYTDIWGP  2335
             +    + +     +   K+    S    CHLSK    P   V++  +   +L++ D WGP
Sbjct  566   SFAKIDTLSDVLMLPKQKINKDSSHCHVCHLSKQKHLPFKSVNHIREKAFELVHIDTWGP  625

Query  2334  APVISTSGFRYFLLFVDDYSRFCWFY  2257
               V +   +RYFL  VDD+SR  W Y
Sbjct  626   FSVPTVDSYRYFLTIVDDFSRATWIY  651



>emb|CAN77085.1| hypothetical protein VITISV_044282 [Vitis vinifera]
Length=1520

 Score =   280 bits (715),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 169/457 (37%), Positives = 242/457 (53%), Gaps = 72/457 (16%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KSD++ TF  F   VE QFS  +K++ F+ GGE+ K+   L   GI+H  +  +T +Q
Sbjct  425   RHKSDVHSTFMQFTTMVENQFSCKLKNLYFNNGGEFIKLRSFLITRGISHYTTAPHTPQQ  484

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VER++RH+VETG+ LL   SV   YW +A      LIN+LPT +L ++SP+  L   
Sbjct  485   NGTVERRHRHVVETGMTLLHHASVPSTYWTYALATTVYLINHLPTPLLLYKSPFEALFGR  544

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LR  GC+CYP+L PY  +K++ +S PCVFL Y  +   ++C++L +GK+Y+ RH
Sbjct  545   TPNYHKLRTSGCQCYPWLVPYRTNKLQPKSQPCVFLEYSLTQHAFKCLDLHTGKLYLSRH  604

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPC------------NTHAAPT----  1580
             V F E +F F ++    Q + P    A+ P +  +P             + H  PT    
Sbjct  605   VIFDEHLFPFKNAPPHVQVLVP----ATSPRIFSSPSPMPPIRLATSYGSPHTPPTPETL  660

Query  1579  -------DSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVM--RLRH  1427
                    D +  SLT+     +  P +    P    P R          R H M  R   
Sbjct  661   ATFKPISDPSMTSLTT----LQSSPNIVSSLPAVPTPPR----------RTHPMPSRTPQ  706

Query  1426  MTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVG  1247
               +  + +F AL            V H  W                 KLV      N++G
Sbjct  707   WRKAMANEFTAL------------VSHGTW-----------------KLVPQSSASNIIG  737

Query  1246  CKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNW  1067
             CKWVF  KR+ DG+++++KA LVAKGFNQ    D+ +TFS ++KPTT+RL+ SL  S+ W
Sbjct  738   CKWVFHVKRHPDGTVDRFKAGLVAKGFNQRPDVDYTETFSPIIKPTTIRLILSLAFSNGW  797

Query  1066  TLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV  956
             +L QL+V+NAFL+G L E V+M QP G+ D +HP HV
Sbjct  798   SLHQLNVNNAFLHGQLTEQVFMPQPVGFVDQSHPQHV  834


 Score = 59.7 bits (143),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -1

Query  2367  LDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             L+ LY D+WGP+ V    G+ Y+LLFVD ++++CWFYP
Sbjct  386   LEFLYADVWGPSSVSFIDGYHYYLLFVDHFTKYCWFYP  423


 Score = 60.8 bits (146),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -1

Query  2865  EYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNV  2686
             EY G D + +G+G GL I+ +G  ++ S S+ L L   L+VP +   L  V++ T++NNV
Sbjct  293   EYEGQDEVVLGDGTGLQIAYIGSITLSSLSRSLMLKETLHVPLIRKNLIYVHKFTHDNNV  352

Query  2685  FFEFHKDCFIVKDSITRAVLLRGST  2611
               EFH   ++VKD I  AVL+ GS+
Sbjct  353   TIEFHPFFYLVKDRIMGAVLMHGSS  377



>gb|KHN01991.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1311

 Score =   263 bits (671),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 169/467 (36%), Positives = 239/467 (51%), Gaps = 32/467 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K++      +F   VE Q+++ IK I+ D G E+       +K GI H+ +C  T EQNG
Sbjct  498   KAETRDIIVNFIASVETQYNKKIKKIRSDNGYEFLMPSFYASK-GIMHQTTCVETPEQNG  556

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK++H++    ALL + ++   +W +A   AT L+N +PT  L   SPY +LH   P
Sbjct  557   IAERKHQHLLNVTRALLFQANLPSNFWCYALLHATYLVNCIPTPFLHNVSPYEKLHGHLP  616

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
               + LRVFGC CY      NR K++ R+ PC+F+ +  S +GY   NL    I   R+V 
Sbjct  617   EISHLRVFGCLCYASTLKANRKKLDPRAHPCIFIGFKASTKGYLVYNLHLHSIITSRNVV  676

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWAS------EPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             FYE  F     T  S P   TI   S      +P++ + P       TD   + LTS   
Sbjct  677   FYEDHFSQIPETQSSHPESSTILPKSFNISPHDPIIEKPPQPVIQETTDHTPLQLTSTDE  736

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQF------------  1400
              A          P ++  TR +   T  Q+  H +        TS ++            
Sbjct  737   SA--FSQRTKHEPRRS--TRPKHAPTYLQDYHHSLSSHDTKVSTSSRYPLSSVLSYSRLS  792

Query  1399  -------HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCK  1241
                     +++ T +P+ Y++A  +  W  AM+ E  AL  N+TWKL L  PH   +GC+
Sbjct  793   HTHKHFVMSISSTVEPSSYAEASQYDCWIKAMEAELQALQSNNTWKLTLLPPHKTAIGCR  852

Query  1240  WVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTL  1061
             WV++ K  ADGSIE+YKARLVAKG+ Q+ G D+   FS V K T VRLL ++V  + W L
Sbjct  853   WVYKIKHRADGSIERYKARLVAKGYTQMEGLDYLYAFSPVAKLTIVRLLLAMVAFNQWHL  912

Query  1060  RQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             RQLDV+NAFL+G L E VYM+ PPG   P      R+  S  LY L+
Sbjct  913   RQLDVNNAFLHGELDEEVYMQVPPGLSVPNSQMVCRLQRS--LYELK  957


 Score = 76.6 bits (187),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 87/188 (46%), Gaps = 9/188 (5%)
 Frame = -1

Query  2799  HASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLR  2620
             H+ I   SK + L NVLY+P  +  L S+ +L +  +    F     +++D+ TR  +  
Sbjct  308   HSGIVHLSKSITLFNVLYMPAFTFNLISISKLVSSTHCALIFSSTSCMLQDASTRTKIGI  367

Query  2619  GSTSGGLYRL---PVSRSHFAYLTSRATSTV----WHRRLGHPNAHVQNRVLQSCPVAPN  2461
                  GLY L    V++   + +       +    WH R+GH +      +    P+  N
Sbjct  368   VEEKHGLYHLIPDQVNKVICSTIIHPKCKIIPIDLWHFRMGHLSTERLQCMKPHYPILRN  427

Query  2460  KVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDD  2281
               K+    T CH +K  + P    +  + ++  LL+ DIWGP    S  G +YFL  VDD
Sbjct  428   D-KTFVCNT-CHYAKHKKLPFSSSTSHASHIFYLLHVDIWGPCSKPSMHGHKYFLTIVDD  485

Query  2280  YSRFCWFY  2257
             +SRF W +
Sbjct  486   HSRFTWVH  493



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score =   205 bits (522),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 129/189 (68%), Gaps = 0/189 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS++ + F  F+  VER F+R I ++Q D GGEY K+H   TK+GITH  SC +TH+QNG
Sbjct  555   KSEVIQKFHEFQALVERLFNRKIIAMQSDWGGEYEKLHSFFTKIGITHHVSCPHTHQQNG  614

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVE GL LLA  S+  ++WD AF+ A  LIN  PT +LQF +P   L    P
Sbjct  615   SAERKHRHIVEVGLTLLAYSSMPLKFWDEAFQAAVYLINRTPTKLLQFLTPLEHLFNQTP  674

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LRVFGC C+P+LRPYN HK+++RS  C FL Y    +G++C++ ++G++YI R V 
Sbjct  675   DYSSLRVFGCACWPHLRPYNTHKLQFRSKQCTFLGYSTLHKGFKCLDPSTGRVYISRDVI  734

Query  1705  FYESIFLFS  1679
             F E+ F F+
Sbjct  735   FDETNFPFA  743


 Score =   134 bits (336),  Expect(2) = 5e-83, Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 116/215 (54%), Gaps = 15/215 (7%)
 Frame = -1

Query  2868  DEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENN  2689
             D Y G D +   +GAG+ IS +GH+++ + ++ +HL N+LYVP  +  L S  RL ++N+
Sbjct  340   DRYKGQDQVHTASGAGMEISHIGHSTVRTPNRDIHLRNILYVPNANKNLVSANRLVSDNS  399

Query  2688  VFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH-------FAYLTSRATSTVWH  2530
              + E +   F +KD  T+ +L RG   G LY LP S  H        A+   + +   WH
Sbjct  400   AYMELYSKYFNLKDLATKKLLFRGPCRGRLYALPSSSPHERPRPLKEAFGAIKPSFERWH  459

Query  2529  RRLGHPNAHVQNRVLQS----CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
              RLGHP + +  +V+      C    NK        +C   K+ + P  R S  S + L+
Sbjct  460   SRLGHPASPIVEKVISKNNLPCLAESNKQSVCD---ACQQGKSHQLPYSRSSSMSSHPLE  516

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             L+Y+D+WGPA + S  G +Y++ F+ DYS+F W Y
Sbjct  517   LIYSDVWGPA-LTSVGGKQYYVSFIGDYSKFTWLY  550


 Score =   176 bits (447),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 139/228 (61%), Gaps = 10/228 (4%)
 Frame = -3

Query  1597  THAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTR  1418
             +HA  T +++  + SP  ++    P A    V  AP+R     T   +RG  +R   +  
Sbjct  870   SHATATPASNDDVPSPSHISAS-EPFATGEEVTQAPSRP----TTRLQRG--IRKEKVYT  922

Query  1417  DTSEQFHA--LNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGC  1244
             D + ++    L VT +P   + A+ +  W+ AMD E+ AL++N TW LV  +   NV+ C
Sbjct  923   DGTVKYKNTFLTVTGEPKNLTDALQNTNWKKAMDIEYEALMNNKTWHLVPPKQGRNVIDC  982

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWT  1064
             KWV++ KR  DGS+++YKARLVAKGF Q  G D+ DTFS VVK  T+R++ S+ VS  W 
Sbjct  983   KWVYKIKRKQDGSLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIVLSIAVSRGWC  1042

Query  1063  LRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             +RQLDV NAFL+G L E VYMKQPPGYED + P +V      ALYGL+
Sbjct  1043  MRQLDVQNAFLHGFLEEEVYMKQPPGYEDESFPGYV-CKLDKALYGLK  1089



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score =   196 bits (498),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 125/190 (66%), Gaps = 0/190 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS++++ F+ F+  VER F   I ++Q D GGEY+K++    K+GI+H  SC Y H+QNG
Sbjct  517   KSEVFQKFQEFQTLVERFFGHKILAVQTDWGGEYQKLNTFFAKIGISHHVSCPYAHQQNG  576

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RH++E  L LLA  S+  ++WD A   A  LIN  P+ V+ F  P  +L K  P
Sbjct  577   SAERKHRHLIEVALTLLAHASMPIKFWDEAVLAAAYLINRTPSKVINFACPLEQLFKEKP  636

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              YT LR+FGC  +P LRPYN+HK+ +RS  CVFL Y    +G++C+ + +G++Y+ R V 
Sbjct  637   NYTALRIFGCAVWPNLRPYNKHKLAFRSKRCVFLGYSNLHKGFKCLEIATGRVYVSRDVT  696

Query  1705  FYESIFLFSD  1676
             F ESIF FS+
Sbjct  697   FDESIFPFSE  706


 Score =   142 bits (359),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 114/208 (55%), Gaps = 8/208 (4%)
 Frame = -1

Query  2868  DEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENN  2689
             ++Y G D +   +GAG+ I  +G + I + ++ LHL N+L+VP+    L S +RL  +N 
Sbjct  309   EKYKGGDKIHTASGAGMEIKHIGDSVIHTPTRELHLKNILHVPQAKKNLISAHRLAMDNF  368

Query  2688  VFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPN  2509
              F E H + F++KD  TR  +L+G     LY LP S +   +  +  + + WH RLGHP 
Sbjct  369   AFLEVHSNYFLIKDRATRNTILKGRCRRRLYSLPTSPAKQVHAATTPSFSRWHSRLGHPA  428

Query  2508  AHVQNRVLQS----CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
               +  RVL      C    NK        +C   K+ + P  + S  S   L+L+++++W
Sbjct  429   VPIVTRVLSKNNLPCSTVANKDSICD---ACQKGKSHQLPYPKSSSVSSQPLELIFSNVW  485

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             GPAP IS  G ++++ F+DDYS+F W Y
Sbjct  486   GPAP-ISVGGKKFYVSFIDDYSKFTWVY  512


 Score =   172 bits (436),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = -3

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +AV +  W++AMD E+ AL+ N TW LV  +   NV+ CKWV++ KR ADGS+++YKARL
Sbjct  890   EAVNNKHWKEAMDAEYMALIENKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLDRYKARL  949

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VAKGF Q  G D+ DTFS VVK  T+R++ SL VS  W+LRQLDV NAFL+G L E VYM
Sbjct  950   VAKGFKQRYGIDYEDTFSPVVKAATIRIVLSLAVSRGWSLRQLDVKNAFLHGVLEEEVYM  1009

Query  1000  KQPPGYEDPTHPDHVRVSSSTALYGLR  920
             KQPPGYE  + P++V      ALYGL+
Sbjct  1010  KQPPGYEKKSMPNYV-CKLDKALYGLK  1035


 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 79/159 (50%), Gaps = 9/159 (6%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             VS KLT  N+  W  Q++  +RG  L G++   T  P   I   ++   +          
Sbjct  19    VSEKLTKGNYALWSAQVLAAIRGARLDGHITGATAAPSMEIEKTASDKTT-------EKI  71

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
              NPAY+ W   DQ +L  L+S+LS +++      +T+   W+ + A   + ++AR L+  
Sbjct  72    VNPAYQEWFASDQQVLGFLLSTLSRDILTQVATASTAAQAWQQVCAMFTAQTKARSLNVR  131

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                   ++GN S  EY G+ + L +++A +G P  LDE+
Sbjct  132   LTLTNTQKGNMSISEYCGKMKALADEIASSGKP--LDEE  168



>emb|CAA72989.1| unnamed protein product [Brassica oleracea var. viridis]
Length=1131

 Score =   244 bits (623),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 156/455 (34%), Positives = 224/455 (49%), Gaps = 36/455 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F +F  ++E Q++  IKS++ D   E         + GI    SC  T EQN 
Sbjct  615   KSDVLHIFPTFVNQIETQYNTKIKSVRRDNAPEL-SFTELFKEKGIVSYHSCPETLEQNS  673

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              +ERK++H++    AL+ +  V  QYW      A  LIN  P+ +L  +SPY  L    P
Sbjct  674   VLERKHQHLLNVARALMFQSQVPLQYWGDCVLTAAFLINRTPSPLLANKSPYEVLMGKAP  733

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LR FGC CY    P  RHK   RS  CVFL YP  ++GY+ ++L S KIYI R+V 
Sbjct  734   QYDQLRTFGCLCYGSTSPKQRHKFMPRSRACVFLGYPSGYKGYKLLDLESNKIYISRNVT  793

Query  1705  FYESIF------LFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             F+E IF         +S+L   P   T+P A  P ++ +P +T                 
Sbjct  794   FHEDIFPMAKHQKMDESSLHFFPPKVTVPSAPSPNISSSPFST-----------------  836

Query  1543  LARGLPPLAIEGPVQTAPTRARAV--*TQHQERGHVMRLRHMTRDTSEQFHALNVTTD--  1376
                 L P  I    +T P   +     + H     +      ++ +S     +N  T+  
Sbjct  837   ----LSP-QISKRQRTVPAHLKDFHCYSVHDSAYPISSTLSYSQISSHHLAYINSITNIP  891

Query  1375  -PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
              P  Y++      W ++ D+E +A+  NDTW +V        +GC+WV   K NADG++E
Sbjct  892   IPQSYAEVRQSKEWTESADKELDAMEENDTWDVVPLPKGKKAIGCRWVHTLKFNADGTLE  951

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
             + K+RLV KG+ Q  G D+ +TFS V K  TV+LL  +  S  W L QLD+ NAFLNG L
Sbjct  952   RRKSRLVGKGYTQKEGLDYIETFSPVAKMATVKLLLKVGASKKWFLHQLDISNAFLNGEL  1011

Query  1018  AETVYMKQPPGYED--PTHPDHVRVSSSTALYGLR  920
              E +YMK P GY +     P +       ++YGL+
Sbjct  1012  DEEIYMKLPEGYAERKGDLPPNAVCKLKKSIYGLK  1046


 Score = 94.4 bits (233),  Expect(2) = 8e-83, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 108/219 (49%), Gaps = 15/219 (7%)
 Frame = -1

Query  2898  CVTASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLF  2719
             C   SM +  D  T S+V  + NG  + IS VG   I   ++ + L NVLY+P+  + L 
Sbjct  402   CHDRSMYTSIDITTTSNV-NLPNGMIVKISGVG---IVQLNEHITLHNVLYIPEFRLNLL  457

Query  2718  SVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATST  2539
             S+  LT++      F      ++D      + +G     LY L V  S    + +    +
Sbjct  458   SISSLTSDIGSQVIFDVSSCAIQDPTKGWTIGQGRRVANLYVLDVKSSPMK-INAVVDIS  516

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVL--  2365
             +WH+RLGHP+    +++ ++     +K K       CHL+K       ++SYSS+N +  
Sbjct  517   LWHKRLGHPSYTRLDKISEALGTTKHKNKGDAHCHVCHLAKQK-----KLSYSSQNHICT  571

Query  2364  ---DLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                 LL+ D+WGP  V +  G++YFL  VDD+SR  W Y
Sbjct  572   ASFQLLHVDVWGPFSVETLEGYKYFLTIVDDHSRATWIY  610



>emb|CAN82380.1| hypothetical protein VITISV_021579 [Vitis vinifera]
Length=828

 Score =   187 bits (475),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 121/188 (64%), Gaps = 0/188 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K  +  +F +FR  +E Q   +IK IQ D GGE+      L   GI H+ SC +T +QNG
Sbjct  481   KDQVLHSFITFRKMIENQLHTTIKCIQSDNGGEFLAFKPYLEAHGILHQFSCPHTPQQNG  540

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK RH+VETGLAL+A+  +  +YW +AF+ A  LIN LP  +L F+SP   L    P
Sbjct  541   RAERKIRHLVETGLALMAQSFLPSKYWTYAFQTAVYLINLLPAKLLHFQSPIQALFHKLP  600

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRPY +HK+ YRS  CVFL Y P+  GY C+++++ +IYI R+V 
Sbjct  601   NYHHLRVFGCLCFPSLRPYTQHKLCYRSTACVFLGYAPAHNGYLCLDVSTSRIYISRNVI  660

Query  1705  FYESIFLF  1682
             F+ES F F
Sbjct  661   FHESYFPF  668


 Score =   150 bits (379),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 114/203 (56%), Gaps = 3/203 (1%)
 Frame = -1

Query  2856  GSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFE  2677
             G+D + +G+   L I   G  S    SK   L+ VL+VP LS  L SV +   +N VFFE
Sbjct  274   GTDQVTIGDSNSLPILHTGTKSFFFPSKTFSLNQVLHVPHLSTNLISVSKFCTDNVVFFE  333

Query  2676  FHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS--TVWHRRLGHPNAH  2503
             FH   F VKD +T+ +LL+G    GLY    S    A++T+ + S   +WH RLGHP A 
Sbjct  334   FHSSYFFVKDQVTKKILLKGWLRDGLYEFSSSSPPRAFVTTSSFSDGAIWHSRLGHPAAP  393

Query  2502  VQNRVLQSC-PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPV  2326
             + ++ L SC P    ++  +     C L+K+   P    S    + L L++TD+WGPAP 
Sbjct  394   ILSKALASCNPFVKLQINKIAPCIICPLAKSHSLPYSLSSSHVSHPLALIHTDLWGPAPS  453

Query  2325  ISTSGFRYFLLFVDDYSRFCWFY  2257
             IS +G RYFL+F+DDYSR  W Y
Sbjct  454   ISITGARYFLIFIDDYSRHTWIY  476



>emb|CAN72498.1| hypothetical protein VITISV_010513 [Vitis vinifera]
Length=1394

 Score =   183 bits (464),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 123/203 (61%), Gaps = 5/203 (2%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K     TF +FR  +E Q + +IK IQ D GGE+      L   GI H+ SC +T +QNG
Sbjct  586   KDQALSTFITFRKMIENQLNSTIKCIQSDNGGEFIAFKPYLEAHGIVHQFSCPHTPQQNG  645

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             R ERK  H+VETG+ALLA+  +  +YW FAF+ +  LIN LP  +L F+SP   L    P
Sbjct  646   RAERKICHLVETGMALLAQSFLPSKYWSFAFQTSVYLINLLPAKLLNFQSPLQVLFHKIP  705

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P LRP N HK+ YRS  CVFL Y  + +GY C+++++ ++YI R V 
Sbjct  706   NYHHLRVFGCLCFPSLRPXNHHKLSYRSTACVFLGYASAHKGYICLDVSTSRLYISRDVL  765

Query  1705  FYESIFLFSDSTLCSQPVPPTIP  1637
             F+ES F F      S P P  +P
Sbjct  766   FHESSFPFQ-----SIPAPSPLP  783


 Score =   154 bits (390),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 121/218 (56%), Gaps = 6/218 (3%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             +A  +S    Y+G+D + +G+G  L I   G+ S    SK+  L+ VL+VP+LS  L SV
Sbjct  364   SAQTLSHVQPYSGADQVTIGDGHSLPILNTGNKSFFFHSKVFCLNQVLHVPQLSTNLISV  423

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT----  2545
              +   +N VFFEFH   F VKD +T+  LL+G    GLY  P S S  A++++ +     
Sbjct  424   SKFCTDNAVFFEFHSTHFFVKDQVTKQTLLKGWLRDGLYEFPSSSSTHAFVSTSSVPALT  483

Query  2544  -STVWHRRLGHPNAHVQNRVLQSC-PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKN  2371
                +WH RLGHP   + ++ L SC P    ++  +     C L+K+        S  +  
Sbjct  484   PGAIWHSRLGHPAXPILSKALASCNPSVSFQINKIAPCKICPLAKSHSLXYSLSSSHASQ  543

Query  2370  VLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              L L++TD+WG AP  STSG  YFLLF+DDYSR+ W Y
Sbjct  544   PLALIHTDLWGXAPSPSTSGAXYFLLFIDDYSRYTWIY  581


 Score =   100 bits (249),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -3

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             ++  KARLVA+GF Q  G D+FDTFS +VK  T+RL+ +L VS  W +RQLDV NAFLNG
Sbjct  860   MKGIKARLVAQGFTQTXGVDYFDTFSPIVKXCTIRLILTLAVSFQWPIRQLDVENAFLNG  919

Query  1024  HLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              L E V+M  P G+  P +P +V      ALYGL+
Sbjct  920   DLQEEVFMAXPQGFVHPQYPHYV-CKLHKALYGLK  953


 Score = 63.5 bits (153),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  3605  HHFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdatta  3426
             +H + IKL   N+I W+TQ+   +       Y+DD  PCPP  +     + D V      
Sbjct  26    NHALPIKLDRNNYILWKTQMENVVYANGFEEYIDDTKPCPPQELHTGELNPDFVQ-----  80

Query  3425  aptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCL  3246
                       W + D+ +LS L S L+ ++M   +G  TS   W ++     +SS+AR L
Sbjct  81    ----------WRRFDRMVLSWLYSMLTPDIMGQIIGFQTSHDAWMALHKIFSASSKARIL  130

Query  3245  SPLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                 +F   ++G    +EY+ + + +  +LA  G P+
Sbjct  131   QLRLEFQTTKKGADPMLEYILKIKTISNNLAAIGEPV  167



>emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera]
Length=1461

 Score =   246 bits (628),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 238/479 (50%), Gaps = 48/479 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+     +SF   VE QF+R IK+++ D G E   +   L   GI +  SCAYT +QNG
Sbjct  634   KSETQGILQSFISWVETQFNRCIKTLRTDNGTEISSMKQYLDTKGINYHHSCAYTPQQNG  693

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RH++  G AL  + ++  ++W  + + A  LIN LPT +L  +SPY  L    P
Sbjct  694   VVERKHRHLLNVGRALRFQANLPLKFWGESIQTACYLINRLPTPLLSHKSPYQLLXNKLP  753

Query  1885  PYTFLRVFGCRCYP-YLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHV  1709
              Y  LR FGC CY   L P   HK + R+  C+F+ YP   +GYR  +L + K +    V
Sbjct  754   SYHHLRTFGCLCYATNLLP--THKFDQRARRCIFVGYPLGQKGYRVYDLXTNKFFSSXDV  811

Query  1708  HFYESIFLFSDSTLCSQ------PVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPV  1547
              F+E IF F  +    Q      P+P T   + EP+ T     T     D     L S +
Sbjct  812   VFHEHIFPFHTNPQEEQHDVVVLPLPQT---SYEPITTE----TTKPQADDQPPPLLSSL  864

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRL-------------------RH-  1427
                     L ++  V   P   R      Q   H+                      RH 
Sbjct  865   ESTSNERTLXLDTIVSPPPPTTRRSDRIKQPNVHLRNFHLYHTAKVASSQSSSLSGTRHP  924

Query  1426  MTRDTS-EQFH--------ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVL  1274
             +TR  S  Q          A+    +PT Y QAV    W++AM  E +AL  N TW L  
Sbjct  925   LTRYISYAQLSPKYRNFVCAITTLVEPTTYEQAVLDPKWQEAMAAELHALEQNHTWTLTP  984

Query  1273  DEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLL  1094
                    +GCKWV++ K N+DG++E+YKARLVAKGF Q  G D+ +TFS V K TTVR L
Sbjct  985   LPYGHRPIGCKWVYKIKYNSDGTVERYKARLVAKGFTQREGIDYKETFSPVAKLTTVRCL  1044

Query  1093  FSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGY-EDPTHPDHVRVSSSTALYGLR  920
              ++    +W+L Q+DV NAFL+G L E VYM+ P G+ +    P   R++ S  LYGL+
Sbjct  1045  LAIAAVRHWSLHQMDVQNAFLHGDLLEEVYMQLPLGFRQQGETPMVCRLNKS--LYGLK  1101


 Score = 90.9 bits (224),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 88/192 (46%), Gaps = 5/192 (3%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
             NG    I  +G   +    KL    +VL VP+  V L SV +LT        F  D  +V
Sbjct  443   NGGQAHIESIGSLHVTPHIKL---DDVLKVPQFQVNLLSVSKLTRALQCIVMFFFDFCVV  499

Query  2652  KDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCP  2473
             +D+ TR  +  G    GLY L   ++          S +WH+RLGHP++     + +  P
Sbjct  500   QDATTRKTIGLGKQHNGLYYLAQDQNPALAYAIHKHSDLWHQRLGHPSSGPLQVLAKVNP  559

Query  2472  VAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLL  2293
                   K +     C L+K +R        SS    DL++ DIWGP  + S SG  YFL 
Sbjct  560   KIYFDSKHVCD--ICPLAKQTRLSFPSSFISSHAPFDLIHCDIWGPHRINSHSGAXYFLT  617

Query  2292  FVDDYSRFCWFY  2257
              VDD++R+ W +
Sbjct  618   IVDDHTRYTWIH  629



>gb|KFK44388.1| hypothetical protein AALP_AA1G251100, partial [Arabis alpina]
Length=2090

 Score =   189 bits (481),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 131/209 (63%), Gaps = 3/209 (1%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             ++KS +  TF +F+  VE +F   I ++  D GGEY  +   L+  GI+H  S  +T E 
Sbjct  577   KLKSQVKDTFIAFKSLVENRFQTRIGTLYSDNGGEYIALRGFLSTHGISHFTSPPHTPEH  636

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV ++YW FAF  A  LIN LPT +L  +SP+ +L  T
Sbjct  637   NGLSERKHRHIVEMGLTLLSTASVPKKYWSFAFATAVDLINRLPTPLLHMQSPFQKLFGT  696

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFG  CYP+LRPYNRHK+E ++A C F+ Y P+   Y C+++  G++Y+ RH
Sbjct  697   DPNYDKLRVFGSACYPWLRPYNRHKLEDKAAQCAFMGYSPTQSAYYCLHIPIGRMYVSRH  756

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASE  1625
             V F E  F F++  L +   PPTI +  E
Sbjct  757   VQFDEGTFPFANLKLKA---PPTITFDEE  782


 Score =   145 bits (367),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 120/215 (56%), Gaps = 8/215 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    Y GSD + + +G+ + I++ G  S PS S+ L L  VLYVP L   L SVYRL 
Sbjct  363   LSLHQPYRGSDGVTIADGSTIPITQTGFKSFPSNSRDLQLHKVLYVPDLQKNLISVYRLC  422

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTV----W  2533
             N N V  EF    F VKD  T   LL+G T   LY  P+S S      +  +ST     W
Sbjct  423   NTNRVSVEFFPASFQVKDLSTETPLLQGRTINELYEWPISSSSPTAFAASPSSTTTLQSW  482

Query  2532  HRRLGHPNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP++ + N ++   S P++    + L S + C ++K  + P  + + +S   L+ 
Sbjct  483   HSRLGHPSSLIFNNIVSRFSIPISKQSSQPL-SCSDCFINKTHKIPFSKSTITSSKPLEY  541

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             +Y+D+W  +P++S   F+Y+L+FVD Y+R+ W YP
Sbjct  542   IYSDVWS-SPILSLENFKYYLIFVDHYTRYTWLYP  575


 Score =   189 bits (481),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 131/209 (63%), Gaps = 3/209 (1%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             ++KS +  TF +F+  VE +F   I ++  D GGEY  +   L+   I+H  S  +T E 
Sbjct  1630  KLKSQVKDTFIAFKSLVENRFQTRIGTLYSDNGGEYIALRGFLSTHSISHFTSPPHTPEH  1689

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV ++YW FAF  A  LIN LPT VL  +SP+ +L  T
Sbjct  1690  NGLSERKHRHIVEMGLTLLSTASVPKKYWSFAFATAVYLINRLPTPVLHMQSPFQKLFGT  1749

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFG  CYP+LRPYNRHK+E ++A C F+ Y P+   Y C+++ +G++Y+ RH
Sbjct  1750  DPNYDKLRVFGSACYPWLRPYNRHKLEDKAAQCAFMGYSPTQSAYYCLHIPTGRMYVSRH  1809

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASE  1625
             V F E  F F++  L +   PPTI +  E
Sbjct  1810  VQFDEGTFPFANLKLKA---PPTITFDEE  1835


 Score = 76.6 bits (187),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 71/136 (52%), Gaps = 15/136 (11%)
 Frame = -1

Query  2643  ITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTV----WHRRLGHPNAHVQNRVLQ--  2482
             +T   LL+G T   LY  P+S S      +  +ST     WH RLGHP++ + N ++   
Sbjct  1502  VTGTPLLQGRTINELYEWPISSSSPTAFAASPSSTTTLQSWHSRLGHPSSLIFNNIVSRF  1561

Query  2481  SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRY  2302
             S P++    + L S + C ++K  + P  + + +S   L+ +Y+D+W        S   Y
Sbjct  1562  SIPISKQSSQPL-SCSDCFINKTHKIPFSKSTITSSKPLEYIYSDVW--------SSHIY  1612

Query  2301  FLLFVDDYSRFCWFYP  2254
             +L+FVD Y+R+ W YP
Sbjct  1613  YLIFVDHYTRYTWLYP  1628


 Score =   154 bits (389),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 104/155 (67%), Gaps = 4/155 (3%)
 Frame = -3

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKRNADGSI  1202
             +P   SQA+    WR AM  E+NA L N +W LV   P  +  VGCKW+F  K N+DGS+
Sbjct  987   EPRTASQALKDERWRKAMGLEYNAQLDNHSWDLVPPPPPQVTRVGCKWIFTKKYNSDGSL  1046

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
              ++KARLVA+G+NQ  G D+ +TFS V+K TT+RL+  + V  +W ++QLDV+NAFL G 
Sbjct  1047  NRHKARLVAQGYNQRPGIDYAETFSPVIKSTTIRLVLGVAVGRSWPIKQLDVNNAFLQGT  1106

Query  1021  LAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             L + VYM QPPG+ D   PDHV R+    A+YGL+
Sbjct  1107  LTDEVYMNQPPGFIDRDKPDHVCRLRK--AIYGLK  1139



>emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera]
Length=1424

 Score =   196 bits (497),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 124/189 (66%), Gaps = 1/189 (1%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+ ++ F  F+ +VE Q    IK++Q D GGEYR     LT  GI HR SC YTHEQNG
Sbjct  604   KSEAFQVFLHFKSQVELQLGHKIKAVQSDWGGEYRSFTQYLTSNGIIHRISCPYTHEQNG  663

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVE G+ALLA+ S+  +YWD AF  +  LIN LPT VL+ +SP   L    P
Sbjct  664   LAERKHRHIVEHGIALLAQASLPFKYWDEAFRTSVYLINRLPTPVLKNKSPLEVLFHQKP  723

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ L+VFGC CYP LRP+N HK+++RS PC FL Y  + +GY+C++  +G I I R V 
Sbjct  724   SYSXLKVFGCMCYPNLRPFNHHKLQFRSIPCTFLGYSLNHKGYKCLS-PNGNILISRDVI  782

Query  1705  FYESIFLFS  1679
             F E  F F+
Sbjct  783   FDEXAFPFA  791


 Score =   139 bits (350),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 123/226 (54%), Gaps = 24/226 (11%)
 Frame = -1

Query  2865  EYTGSDVLRVGNGAGLIISRVGHASIPSE---SKLLHLSNVLYVPKLSVPLFSVYRLTNE  2695
             ++  SD + VGNG GL I  +GH S  S    SK L L  +L+VP+++  L SV +   +
Sbjct  375   QFPSSDEVFVGNGKGLPIHHIGHTSFSSSFIPSKTLALKQLLHVPEITKNLLSVSKFAAD  434

Query  2694  NNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLY-------RLPVSRSH-FA--YLTSRAT  2545
             N+VFFEFH     VKD  TR VL+ G   GGLY       +LP+  S  FA   L S+  
Sbjct  435   NHVFFEFHPTSCFVKDPSTRTVLMHGQLKGGLYVFDNTQLKLPLHNSSCFASTALPSKEP  494

Query  2544  S---------TVWHRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLD  2395
             +         T+WH RLGHP++H+ + VL  C +   NK+ SL     C + K  +    
Sbjct  495   TVPASPTSPFTLWHNRLGHPSSHIVSLVLNKCNLPHLNKIPSLICSXCC-MGKIHKSSFL  553

Query  2394  RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               + S    L+L++TD+WGPA   S+ G +Y++ F+D YSRF W Y
Sbjct  554   HSTSSYTKPLELIHTDLWGPASTPSSHGHQYYIHFIDAYSRFTWIY  599



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score =   195 bits (495),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 131/191 (69%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS++++ F+ F+  VER F R I ++Q D GGEY+K++    ++GI H  SC +TH+Q
Sbjct  556   KYKSEVFEKFKEFQALVERMFDRKIIAMQTDWGGEYQKLNSFFAQIGIDHHVSCPHTHQQ  615

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK++HI+E GL+LL+  S+  ++WD AF  AT LIN +P+  +Q  +P  +L   
Sbjct  616   NGSAERKHKHIIEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFNQ  675

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ LRVF C C+P+L PYN HK+++RS  CVFL +    +G++ ++++SG++YI R 
Sbjct  676   KPDYSSLRVFSCTCWPHLHPYNTHKLQFRSKQCVFLGFSTHHKGFKFLDVSSGRVYISRD  735

Query  1711  VHFYESIFLFS  1679
             V F E++F FS
Sbjct  736   VVFDENVFPFS  746


 Score =   139 bits (351),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 123/214 (57%), Gaps = 8/214 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  ++Y G + +   +GAG+ IS +GH  + + S+ +HL+NVLYVP+    L S  +L 
Sbjct  342   LTTKEKYNGGEQIHTASGAGMDISHIGHTIVHTPSRNIHLNNVLYVPQAKKNLISASQLA  401

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVW  2533
              +N+ F E H   F +KD +TR VLL G    GLY +P     S +  A   ++ + + W
Sbjct  402   ADNSAFLELHSKFFSIKDQVTRDVLLEGKCRHGLYPIPKSFGRSTNKQALGAAKLSLSRW  461

Query  2532  HRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP+  +  +V+    + P  V+S+      +C  +K+ + P  R +  S+  L+L
Sbjct  462   HSRLGHPSLPIVKQVISRNNL-PCSVESVNQSVCNACQEAKSHQLPYIRSTSVSQFPLEL  520

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +++D+WGPAP  S    +Y++ F+DD+S+F W Y
Sbjct  521   VFSDVWGPAPE-SVGRNKYYVSFIDDFSKFTWIY  553


 Score =   181 bits (458),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 1/155 (1%)
 Frame = -3

Query  1384  TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGS  1205
             T +P    +A+G   WRDAM+ E+NAL+ NDTW LV  E   N++GCKWV++ KR ADG+
Sbjct  937   TGEPQNDKEALGDKNWRDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKVKRKADGT  996

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             +++YK RL+AKGF Q  G D+ DTFS VVK  T+R++ S+ VS  W+LRQLDV N FL+G
Sbjct  997   LDRYKTRLIAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQNDFLHG  1056

Query  1024  HLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              L E VYM+QPPG+E  + PD+V    + ALYGL+
Sbjct  1057  FLEEEVYMQQPPGFESSSKPDYV-CKLNKALYGLK  1090



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score =   195 bits (495),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 131/191 (69%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS++++ F+ F+  VER F R I ++Q D GGEY+K++    ++GI H  SC +TH+Q
Sbjct  556   KYKSEVFEKFKEFQALVERMFDRKIIAMQTDWGGEYQKLNSFFAQIGIDHHVSCPHTHQQ  615

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK++HI+E GL+LL+  S+  ++WD AF  AT LIN +P+  +Q  +P  +L   
Sbjct  616   NGSAERKHKHIIEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFNQ  675

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ LRVF C C+P+L PYN HK+++RS  CVFL +    +G++ ++++SG++YI R 
Sbjct  676   KPDYSSLRVFSCTCWPHLHPYNTHKLQFRSKQCVFLGFSTHHKGFKFLDVSSGRVYISRD  735

Query  1711  VHFYESIFLFS  1679
             V F E++F FS
Sbjct  736   VVFDENVFPFS  746


 Score =   139 bits (351),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 123/214 (57%), Gaps = 8/214 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  ++Y G + +   +GAG+ IS +GH  + + S+ +HL+NVLYVP+    L S  +L 
Sbjct  342   LTTKEKYNGGEQIHTASGAGMDISHIGHTIVHTPSRNIHLNNVLYVPQAKKNLISASQLA  401

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVW  2533
              +N+ F E H   F +KD +TR VLL G    GLY +P     S +  A   ++ + + W
Sbjct  402   ADNSAFLELHSKFFSIKDQVTRDVLLEGKCRHGLYPIPKSFGRSTNKQALGAAKLSLSRW  461

Query  2532  HRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP+  +  +V+    + P  V+S+      +C  +K+ + P  R +  S+  L+L
Sbjct  462   HSRLGHPSLPIVKQVISRNNL-PCSVESVNQSVCNACQEAKSHQLPYIRSTSVSQFPLEL  520

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +++D+WGPAP  S    +Y++ F+DD+S+F W Y
Sbjct  521   VFSDVWGPAPE-SVGRNKYYVSFIDDFSKFTWIY  553


 Score =   176 bits (447),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -3

Query  1384  TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGS  1205
             T +P    +A+G   WRDAM+ E+NAL+ NDTW LV  E   N++GCKWV++ KR ADG+
Sbjct  937   TGEPQNDKEALGDKNWRDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKVKRKADGT  996

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             +++YK RL+AKGF Q  G D+ DTFS VVK  T+R++ S+ VS  W LRQLDV N FL G
Sbjct  997   LDRYKTRLIAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWNLRQLDVQNDFLRG  1056

Query  1024  HLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              L E VYM+QPPG+E  +  D+V    + ALYGL+
Sbjct  1057  FLEEEVYMQQPPGFESSSKRDYV-CKLNKALYGLK  1090



>emb|CAN64418.1| hypothetical protein VITISV_030041 [Vitis vinifera]
Length=1429

 Score =   196 bits (497),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/395 (36%), Positives = 191/395 (48%), Gaps = 51/395 (13%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F  F   +E +F+  IK +  D GGE+  +    T  GI+H  +  YT +QNG
Sbjct  421   KSDVKTIFPHFYKMIETRFNIKIKGVYSDNGGEFTVLRPFFTTHGISHYTTAPYTPQQNG  480

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER++ HIVETG  LL+  S+  +Y  +AF  AT LIN LP+ VL   SP   L K  P
Sbjct  481   VSERRHLHIVETGQTLLSHASLPSEYXAYAFATATYLINRLPSPVLHHISPLQALFKQQP  540

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LR FGC C+P ++PYN +K + +S PC+F+ Y  S   Y C +L S +IY  +HV 
Sbjct  541   RYEKLRSFGCLCFPLMKPYNTNKFQKKSVPCIFVGYSTSQSAYLCXHLQSQRIYTSKHVT  600

Query  1705  FYESIFLFSDSTLCS----------QPVPPTIPWASE--PVVTRAPCNT-HAAPTDSAHM  1565
             F ES++ F   ++ S              P +  AS   P +TRA  +   A+ T S   
Sbjct  601   FDESVYPFKQVSMQSPTDSSPSETSSFSGPILQLASRELPXITRAQGDIPSASSTPSEDP  660

Query  1564  SLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH-MTRDTSEQFHALN  1388
             +L  P        PL+    V   P+ + +              R  +TR  +  F    
Sbjct  661   ALVQPQE-----APLSTLDQVTLRPSTSVSQPENSMPSSPPPCPRTIITRSMNNIFRPKQ  715

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP---HMNVVGCKWVFRTKRN  1217
             + T                             T K  L EP     N+VGCK+VFR KRN
Sbjct  716   LHT-----------------------------TTKHPLPEPPEPSCNLVGCKFVFRKKRN  746

Query  1216  ADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
              DG+I +YKARLVAKGF+Q  G D+  TFS VVKP
Sbjct  747   PDGTISRYKARLVAKGFHQRPGIDYSQTFSPVVKP  781


 Score =   138 bits (348),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 118/208 (57%), Gaps = 5/208 (2%)
 Frame = -1

Query  2865  EYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNV  2686
             EY G+D + +G+G+GL I+  G  ++   ++   + + L VP ++  L SV+  T +NNV
Sbjct  211   EYDGTDEVIIGDGSGLPITHSGSLTLSFPNRKFQVEDTLCVPTINKNLISVHHYTKQNNV  270

Query  2685  FFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS--RSHFAYLTSRATSTVWHRRLGHP  2512
               EFH   F+ KD  T  +LL+G    G+Y L  S   +  A++  R ++  WH RLGH 
Sbjct  271   ILEFHPTYFLAKDWRTGEILLQGPCENGVYPLASSPAATPIAFVHERTSAXGWHXRLGHR  330

Query  2511  NAHVQNRVLQSCPVAPNKVKSLGSRT--SCHLSKASRFPLDRVSYSSKNVLDLLYTDIWG  2338
             +  V  R++ S  +      S GS    SC  +KA + P  +   +S    DLLYTD+WG
Sbjct  331   SFKVVXRLISSFSLPTTSCLS-GSNNCHSCSXNKAHQLPFHKHGLTSTTPFDLLYTDVWG  389

Query  2337  PAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             P+P  S +G RY+++FVD ++++ WF+P
Sbjct  390   PSPTPSLNGHRYYVIFVDHFTKYGWFFP  417



>gb|AAD25646.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1461

 Score =   242 bits (618),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 222/451 (49%), Gaps = 20/451 (4%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KSD+   F +F   VE Q+   +KS++ D   E         K GI    SC  T EQ
Sbjct  664   KSKSDVLTVFPAFIDLVENQYDTRVKSVRSDNAKELAFTEFYKAK-GIVSFHSCPETPEQ  722

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    AL+ + ++S  YW      A  LIN  P+++L  ++P+  L   
Sbjct  723   NSVVERKHQHILNVARALMFQSNMSLPYWGDCVLTAVFLINRTPSALLSNKTPFEVLTGK  782

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ L+ FGC CY       RHK   RS  CVFL YP  F+GY+ ++L S  ++I R+
Sbjct  783   LPDYSQLKTFGCLCYSSTSSKQRHKFLPRSRACVFLGYPFGFKGYKLLDLESNVVHISRN  842

Query  1711  VHFYESIFLFSDS----TLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             V F+E +F  + S    T  S    P  P +S   +T    +   +P+        +  P
Sbjct  843   VEFHEELFPLASSQQSATTASDVFTPMDPLSSGNSITSHLPSPQISPSTQISKRRITKFP  902

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
                            + P  +           H++ + ++++              P  Y
Sbjct  903   AHLQDYHCYFVNKDDSHPISSSLS-YSQISPSHMLYINNISK-----------IPIPQSY  950

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
              +A     W  A+DQE  A+   DTW++    P    VGCKWVF  K +ADGS+E++KAR
Sbjct  951   HEAKDSKEWCGAIDQEIGAMERTDTWEITSLPPGKKAVGCKWVFTVKFHADGSLERFKAR  1010

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVY  1004
             +VAKG+ Q  G D+ +TFS V K  TV+LL  +  S  W L QLD+ NAFLNG L ET+Y
Sbjct  1011  IVAKGYTQKEGLDYTETFSPVAKMATVKLLLKVSASKKWYLNQLDISNAFLNGDLEETIY  1070

Query  1003  MKQPPGYED---PTHPDHVRVSSSTALYGLR  920
             MK P GY D    + P +V      ++YGL+
Sbjct  1071  MKLPDGYADIKGTSLPPNVVCRLKKSIYGLK  1101


 Score = 91.7 bits (226),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 91/192 (47%), Gaps = 4/192 (2%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
              G  + IS VG   I   +K + L NVL++P+  + L S+  LT +      F   C  +
Sbjct  474   TGPNVRISGVGTVLI---NKDIILQNVLFIPEFRLNLISISSLTTDLGTRVIFDPSCCQI  530

Query  2652  KDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCP  2473
             +D      L  G   G LY L  ++S    + +    +VWH+RLGHP+    + + +   
Sbjct  531   QDLTKGLTLGEGKRIGNLYVLD-TQSPAISVNAVVDVSVWHKRLGHPSFSRLDSLSEVLG  589

Query  2472  VAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLL  2293
                +K K       CHL+K  +      +    +  +LL+ D+WGP  V +  G++YFL 
Sbjct  590   TTRHKNKKSAYCHVCHLAKQKKLSFPSANNICNSTFELLHIDVWGPFSVETVEGYKYFLT  649

Query  2292  FVDDYSRFCWFY  2257
              VDD+SR  W Y
Sbjct  650   IVDDHSRATWIY  661



>emb|CAN73272.1| hypothetical protein VITISV_013115 [Vitis vinifera]
Length=1178

 Score =   245 bits (626),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/461 (33%), Positives = 238/461 (52%), Gaps = 24/461 (5%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K+++++ F SF   V+RQFS+++K +Q D G E++ +    +  GI  + SC  T +QNG
Sbjct  363   KTEVFRMFMSFIAMVDRQFSQTVKVVQSDNGTEFKCLLDYFSATGILFQTSCVGTPQQNG  422

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK++HI+  G AL  + ++   +W  +   A  LIN  P+ +L  ++P+  L  TPP
Sbjct  423   RVERKHKHILNVGRALRFQANLPIYFWGESVLAAAHLINRTPSPLLHNKTPFEILFGTPP  482

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  +  FGC  + +       K   RS  CVFL YP   +G++  +L + ++++ R V 
Sbjct  483   SYAAIHTFGCLSFAHDXKSKGDKFASRSRKCVFLGYPFGKKGWKLFDLDTKELFVSRDVK  542

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS---PVPLAR  1535
             F+E +F F +    +      +P AS   ++  P        DS  +  +S     P+ +
Sbjct  543   FFEDVFPFGNPGAVNIIPENIVPTASSAPLSPGPEVVPTVGLDSLGLDNSSNGQSAPMGK  602

Query  1534  GL----PPLAIEG-----PVQTAPTRARAV*TQHQER-----GHVMRLRHMTRDTSEQFH  1397
             G+    P + +        V  +P+ A     QH         H +   + +    +   
Sbjct  603   GMRDKFPSVLLRDFVTHTVVAESPSPATPX-PQHPSGTPYPIAHYINCDNFSVHYRKFLA  661

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRN  1217
              +  + DP  + +A+  + W+ +M +E  AL  N TW L         +G +WV+RTK  
Sbjct  662   TIISSNDPKSFKEAMKDVGWQKSMHEEIRALEENGTWTLEPLPKGKRALGSQWVYRTKYF  721

Query  1216  ADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNA  1037
             ++G IE+ K+RLV  G +Q AG D+ +TFS V K TTVR   ++  S NW L Q+DVHNA
Sbjct  722   SNGDIERLKSRLVVLGNHQEAGIDYHETFSPVAKMTTVRAFLAIAASKNWELHQMDVHNA  781

Query  1036  FLNGHLAETVYMKQPPGYE--DPTHPDHVRVSSSTALYGLR  920
             FL+G L E VYMK PPG+E  DP     +R S    LYGL+
Sbjct  782   FLHGDLEEEVYMKLPPGFERSDPNLVCRLRKS----LYGLK  818


 Score = 87.8 bits (216),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 99/199 (50%), Gaps = 17/199 (9%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
             NG  ++ ++ G   +   S  + L NVLYVPKL+  L SV +LT++ +   +F+     +
Sbjct  170   NGESVVATQSGSVRL---SNNITLQNVLYVPKLNCNLLSVSQLTDDLHCIVQFNSYMCAI  226

Query  2652  KDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATSTVWHRRLGHPNAHVQNRVL  2485
             +D  TR ++  G    GLY    +      H +   + +T  +WH+R+GHP+     +V+
Sbjct  227   QDH-TRELIGTGVRRDGLYYFGGAEGDSVQHVSVHNAASTLELWHKRMGHPS----EKVV  281

Query  2484  QSCPVAPNKVKSLGSRTS-CHLSKASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTS  2314
             +  P   N   SL      C  +K  R  FPL      +  + + ++ D+WG    +S+ 
Sbjct  282   KLLPPVSNLKGSLNKACEICFRAKHXRDKFPLS--DNKATRIFEKIHCDLWGSYKHVSSC  339

Query  2313  GFRYFLLFVDDYSRFCWFY  2257
             G RYFL  VDD+SR  W Y
Sbjct  340   GARYFLTIVDDFSRAVWIY  358



>gb|AAB61111.1| Strong similarity to Zea mays retrotransposon Hopscotch polyprotein 
(gb|U12626) [Arabidopsis thaliana]
Length=1315

 Score =   247 bits (631),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 161/473 (34%), Positives = 237/473 (50%), Gaps = 48/473 (10%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGE--YRKIHHTLTKLGITHRKSCAYTH  2078
             R KSD+     +F   VE QF  +IK ++ D   E  + + +H+    GI    SC  T 
Sbjct  502   RNKSDVLTVIPTFVTMVENQFETTIKGVRSDNAPELNFTQFYHSK---GIVPYHSCPETP  558

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QN  VERK++HI+    +L  +  +   YW      A  LIN LP  +L+ + P+  L 
Sbjct  559   QQNSVVERKHQHILNVARSLFFQSHIPISYWGDCILTAVYLINRLPAPILEDKCPFEVLT  618

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
             KT P Y  ++VFGC CY    P +RHK   R+  C F+ YP  F+GY+ ++L +  I + 
Sbjct  619   KTVPTYDHIKVFGCLCYASTSPKDRHKFSPRAKACAFIGYPSGFKGYKLLDLETHSIIVS  678

Query  1717  RHVHFYESIFLFSDSTLCSQ---------PVPPTIPWASEPVVTRAPCNTHAAPTDSAHM  1565
             RHV F+E +F F  S L  +         P PP    +S+          H  P+DS+  
Sbjct  679   RHVVFHEELFPFLGSDLSQEEQNFFPDLNPTPPMQRQSSD----------HVNPSDSS--  726

Query  1564  SLTSPVPLARGLPPLAIEGP-VQTAPTRAR-------------AV*TQHQERGHVMRLRH  1427
               +S   L    P   +  P VQT+  +A+                T H+ R  +   R 
Sbjct  727   --SSVEILPSANPTNNVPEPSVQTSHRKAKKPAYLQDYYCHSVVSSTPHEIRKFLSYDR-  783

Query  1426  MTRDTSEQFHA-LNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVV  1250
                D    F A L+ T +P+ Y++A     WRDAM  EF+ L    TW++         +
Sbjct  784   -INDPYLTFLACLDKTKEPSNYTEAEKLQVWRDAMGAEFDFLEGTHTWEVCSLPADKRCI  842

Query  1249  GCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHN  1070
             GC+W+F+ K N+DGS+E+YKARLVA+G+ Q  G D+ +TFS V K  +V+LL  +     
Sbjct  843   GCRWIFKIKYNSDGSVERYKARLVAQGYTQKEGIDYNETFSPVAKLNSVKLLLGVAARFK  902

Query  1069  WTLRQLDVHNAFLNGHLAETVYMKQPPGY---EDPTHPDHVRVSSSTALYGLR  920
              +L QLD+ NAFLNG L E +YM+ P GY   +  + P +       +LYGL+
Sbjct  903   LSLTQLDISNAFLNGDLDEEIYMRLPQGYASRQGDSLPPNAVCRLKKSLYGLK  955


 Score = 83.6 bits (205),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 84/179 (47%), Gaps = 10/179 (6%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L L++VL++P+    L SV  LT        F +   +++D+    ++  G     LY +
Sbjct  323   LILNDVLFIPQFKFNLLSVSSLTKSMGCRIWFDETSCVLQDATRELMVGMGKQVANLYIV  382

Query  2589  PV-SRSHFAYLTSRATSTV-----WHRRLGHPNAHVQNRV--LQSCPVAPNKVKSLGSRT  2434
              + S SH    +S   ++V     WH+RLGHP+      +  L S P   N       R 
Sbjct  383   DLDSLSHPGTDSSITVASVTSHDLWHKRLGHPSVQKLQPMSSLLSFPKQKNNT-DFHCRV  441

Query  2433  SCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              CH+SK    P    +  S    DL++ D WGP  V +  G+RYFL  VDDYSR  W Y
Sbjct  442   -CHISKQKHLPFVSHNNKSSRPFDLIHIDTWGPFSVQTHDGYRYFLTIVDDYSRATWVY  499



>gb|KFK45117.1| hypothetical protein AALP_AA1G346500, partial [Arabis alpina]
Length=1203

 Score =   189 bits (481),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 137/220 (62%), Gaps = 6/220 (3%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             ++KS + +TF +F+  VE +F+  IK++  D GGE+  +   L+  GI+H  S  +T E 
Sbjct  566   KLKSQVKETFIAFKALVENRFNTKIKTLYSDNGGEFMALKAFLSSSGISHLTSPPHTPEH  625

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL    + + YW +AF  AT LIN +PT VL  ESP  +L  +
Sbjct  626   NGISERKHRHIVETGLTLLTHAKMPKTYWSYAFTTATYLINRMPTPVLDMESPVQKLFGS  685

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ LRVFGC C+P+LRPYN +K++ RS PC+F+ Y  +   Y C+  +SG++YI RH
Sbjct  686   QPNYSKLRVFGCLCFPWLRPYNTNKLQDRSTPCIFIGYSQTQSAYLCLQPSSGRVYITRH  745

Query  1711  VHFYESIF----LFSDSTLCSQPVPPTIPWASEPVVTRAP  1604
             V F ES F    L +  T+ +Q    T P   +P++T  P
Sbjct  746   VKFDESSFPFNKLITPKTIPAQTNATTQPL--QPIITTIP  783


 Score =   141 bits (356),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 118/214 (55%), Gaps = 14/214 (7%)
 Frame = -1

Query  2871  SDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNEN  2692
             S  Y G D + +G+G+GL I+  G  S+PS S+ L L++VL VP +   L SVYRL N+N
Sbjct  357   SQPYNGQDAVLIGDGSGLSITHTGSLSLPSSSRNLALNSVLCVPNIQKNLVSVYRLCNQN  416

Query  2691  NVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS----RSHFAYLTSRATSTVWHRR  2524
             NV  EF    F VKD  +    ++G T   LY  P S     S FA  T + ++T WH R
Sbjct  417   NVSVEFFPAHFQVKDLSSGVPFIQGKTKDELYEWPASPSTLTSFFASTTPKLSTTDWHHR  476

Query  2523  LGHPNAHVQNRVLQS----CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             LGHP+  + + ++      C  + N V S      C ++K  + P  + S  S   L+ +
Sbjct  477   LGHPSTTILHNIVSKFSLPCSRSVNNVCS-----DCAINKTHKLPFSQTSIVSTYPLEYV  531

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             +TD+W  +PV+S   ++Y+L+ VD YSR+ W YP
Sbjct  532   FTDLWS-SPVLSIDNYKYYLVLVDHYSRYTWMYP  564



>emb|CAB10526.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB78748.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1433

 Score =   282 bits (721),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 171/452 (38%), Positives = 233/452 (52%), Gaps = 31/452 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F +F   V  Q+   +KS++ D   E  K        GI    SC  T EQN 
Sbjct  641   KSDVLHVFPAFINMVHTQYQTKLKSVRSDNAHEL-KFTDLFAAHGIVAYHSCPETPEQNS  699

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK++HI+    ALL + ++  ++W      A  LIN LPT VL  +SPY +L   PP
Sbjct  700   VVERKHQHILNVARALLFQSNIPLEFWGDCVLTAVFLINRLPTPVLNNKSPYEKLKNIPP  759

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  L+ FGC CY    P  RHK E R+  CVFL YP  ++GY+ +++ +  + I RHV 
Sbjct  760   AYESLKTFGCLCYSSTSPKQRHKFEPRARACVFLGYPLGYKGYKLLDIETHAVSISRHVI  819

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSP---VPLAR  1535
             F+E IF F  ST+    +    P      + + P  T   P +   +  T P   V  ++
Sbjct  820   FHEDIFPFISSTI-KDDIKDFFP------LLQFPARTDDLPLEQTSIIDTHPHQDVSSSK  872

Query  1534  GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHAL--NVTTD--PTC  1367
              L P       Q  P +            H+    H   +T+E FHA   N+T    P  
Sbjct  873   ALVPFDPLSKRQKKPPK------------HLQDF-HCYNNTTEPFHAFINNITNAVIPQR  919

Query  1366  YSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
             YS+A     W DAM +E  A++  +TW +V   P+   +GCKWVF  K NADGSIE+YKA
Sbjct  920   YSEAKDFKAWCDAMKEEIGAMVRTNTWSVVSLPPNKKAIGCKWVFTIKHNADGSIERYKA  979

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLVAKG+ Q  G D+ +TFS V K T+VR++  L     W++ QLD+ NAFLNG L E +
Sbjct  980   RLVAKGYTQEEGLDYEETFSPVAKLTSVRMMLLLAAKMKWSVHQLDISNAFLNGDLDEEI  1039

Query  1006  YMKQPPGYED---PTHPDHVRVSSSTALYGLR  920
             YMK PPGY D      P H       ++YGL+
Sbjct  1040  YMKIPPGYADLVGEALPPHAICRLHKSIYGLK  1071


 Score = 47.4 bits (111),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 53/207 (26%), Positives = 76/207 (37%), Gaps = 51/207 (25%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +R+ N   + I+ +G   +   S  + L NVLY+P+    L S   LT E          
Sbjct  460   VRLPNDCTVKIAGIGFIQL---SDAISLHNVLYIPEFKFNLIS--ELTKE----------  504

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATST---------------VWH  2530
                        ++ RGS  G LY L  + ++        TS                 WH
Sbjct  505   ----------LMIGRGSQVGNLYVLDFNENNHTVSLKGTTSMCPEFSVCSSVVVDSVTWH  554

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTS--------CHLSKASRFPLDRVSYSSK  2374
             +RLGHP A+ +  +L    V   KVK +    S        CHLSK              
Sbjct  555   KRLGHP-AYSKIDLLSD--VLNLKVKKINKEHSPVCHVCHVCHLSKQKHLSFQSRQNMCS  611

Query  2373  NVLDLLYTDIWGPAPVISTSGFRYFLL  2293
                DL++ D WGP  V +      +LL
Sbjct  612   AAFDLVHIDTWGPFSVPTNDATWIYLL  638



>gb|AAF69172.1|AC007915_24 F27F5.11 [Arabidopsis thaliana]
Length=1313

 Score =   298 bits (762),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 186/482 (39%), Positives = 257/482 (53%), Gaps = 48/482 (10%)
 Frame = -3

Query  2248  VKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHE  2075
             +KSD   TF  F+  VE Q+   I S Q D GGE+  RK+   L + GI    SC YT +
Sbjct  499   LKSDFTHTFTVFQDMVENQYQTKIGSFQCDGGGEFTSRKLTDHLQQCGIKQLISCPYTSQ  558

Query  2074  QNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFE-SPYTRLH  1898
             QNG  ERK+RHI+E GL+++ + +  Q++W  AF  A+ LIN LPT+ L  + SPY +LH
Sbjct  559   QNGLAERKHRHIIELGLSMMFQSTRPQKFWVEAFYTASFLINLLPTTALDEKYSPYEKLH  618

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
               PP Y+ LRVFGC CYP LR Y  +K + RS  CVFL Y   ++GYRC   ++G++YI 
Sbjct  619   GKPPEYSALRVFGCACYPTLRDYASNKFDPRSLKCVFLGYNDKYKGYRCFLPSTGRVYIS  678

Query  1717  RHVHFYESIFLFSDSTLCSQP-----VPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS  1553
             RHV F E++F F+ S   S+P      P  + W           NT + P   +  SL +
Sbjct  679   RHVIFDETVFPFAQSH--SRPNSGSLTPLMLAWTKG-------INTVSKPQPKSDDSLFT  729

Query  1552  PVPLARGLPPLAIEGPVQTAPTRAR--AV*TQHQER--GHVMRLRH--------------  1427
                 +   PPL             R   V    +ER  G    L H              
Sbjct  730   ----SEDFPPLPTRETPILPIPIPRPTVVPAVEEERSYGCTAGLDHVPIGNNFSSSSHSP  785

Query  1426  -MTRDTSEQF--HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMN  1256
              +  +TS+Q     L+  +  T  ++ +    W  AM +E       +TW LV   P M 
Sbjct  786   GIAEETSDQSTERILDQLSTTTTQNETLKDPGWTGAMGEEMGNCKEAETWSLVPYTPDML  845

Query  1255  VVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVS  1076
             V+G KW+FRTK NADGS+++ KARLV +G+NQ  G D+ +T+S VV+  TVR +  L   
Sbjct  846   VLGSKWIFRTKLNADGSLQKLKARLVTQGYNQAEGIDYLETYSPVVRTATVRGVLHLATI  905

Query  1075  HNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SP  896
               W ++Q+DV NAFL+G L ETVYM QP G+ DP  P++V      +LYG++      SP
Sbjct  906   MEWDIKQMDVQNAFLHGDLTETVYMAQPAGFVDPDKPNYV-CHLHKSLYGMKQ-----SP  959

Query  895   RA  890
             RA
Sbjct  960   RA  961


 Score = 68.9 bits (167),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 14/127 (11%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L L++VL  P +S P  SV +LTN+    F+F  D   + D  TR +L +G  S GLY L
Sbjct  378   LPLNDVLVCPDISKPFLSVSKLTNDYPCVFQFDCDDVRIYDKATRKLLTKGKHSKGLYVL  437

Query  2589  PVSRSHFAYLTSR--ATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT------  2434
               S     Y + +  A+  +WH+RLGHP++    +VLQ   ++ NK  S+G+++      
Sbjct  438   KDSPVQALYSSRQQGASEDIWHQRLGHPHS----QVLQV--LSANKSISVGNKSTKMVCE  491

Query  2433  SCHLSKA  2413
             SC L K+
Sbjct  492   SCQLGKS  498


 Score = 60.5 bits (145),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 73/155 (47%), Gaps = 7/155 (5%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             V++KL  +N+   +TQ   FL GQ LLG+V+     PP T    +  G ++         
Sbjct  137   VTVKLNEQNYSLKKTQFESFLSGQNLLGFVNGSLKPPPATTPFNNIDGLTI-------EV  189

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
             PNP Y  W + DQ + + L+ SL++++M   V   TS  VW ++       S +R     
Sbjct  190   PNPEYHTWNRSDQVVRAWLLGSLNEDIMQEVVNCATSYQVWNALAQHCNKVSSSRLFELQ  249

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPIS  3132
              +   + + + S   YL   + + E LA  G P+S
Sbjct  250   RKLQTIDKQDKSMETYLKEIKRVCEQLASIGSPVS  284



>dbj|BAK41512.1| C-end truncated polyprotein [Arabidopsis thaliana]
Length=1048

 Score =   185 bits (469),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  +E +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  557   KQKSQVKETFITFKNLLENRFQTRIGTFYSDNGGEFVALREYFSQHGISHLTSPPHTPEH  616

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP+ +L  T
Sbjct  617   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPFQKLFGT  676

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + +IYI RH
Sbjct  677   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRIYISRH  736

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  737   VRFDENCFPFSNYLATLSPV  756


 Score =   144 bits (363),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (58%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  343   LSLHQPYTGGDDVMVADGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  402

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  403   NANGVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  462

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S + C ++K+++ P  + + +S   L+ +
Sbjct  463   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCSDCLINKSNKVPFSQSTINSTRPLEYI  522

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  523   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  555


 Score =   108 bits (271),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  936   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  995

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNW  1067
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W
Sbjct  996   NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSW  1046



>emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera]
Length=1361

 Score =   298 bits (763),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 186/455 (41%), Positives = 245/455 (54%), Gaps = 50/455 (11%)
 Frame = -3

Query  2161  DLGGEY--RKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRHIVETGLALLAEGSVSQQY  1988
             D G E+   K    L   GI  R +C YT  QNG VERK+R++ E GL L+    V    
Sbjct  545   DGGTEFTNNKFRSHLHSCGIDLRLACPYTPSQNGIVERKHRYVTEIGLTLMFHARVPLSL  604

Query  1987  WDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEY  1808
             WD AF  A  LIN LP   L  ++PY  L    P Y+ LR FGC C+PYLR Y+ +K+  
Sbjct  605   WDEAFSTAVFLINRLPPPSLAGKTPYELLFGKQPDYSMLRTFGCLCFPYLRDYSPNKLSP  664

Query  1807  RSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPW--  1634
             +S PCVFL Y    +G+RC++  + ++Y+ RHV FYE  F ++  ++  Q +P  I +  
Sbjct  665   KSTPCVFLGYSTLHKGFRCLDRKTHRVYVSRHVQFYEHTFPYNGDSV--QNLPSNIDYIH  722

Query  1633  --ASEPVVTRA--------------------PCNTHAAPTDSAHMSLTSP----VPLARG  1532
                S+  V+ +                    PCN      D  H+S TS     VPL   
Sbjct  723   FSESQECVSSSSNVSTSDSLPSPSFSNSLCLPCN------DIPHLSSTSSPGLQVPLDED  776

Query  1531  --LPPLAIEGPVQTAPTRARAV*TQHQ---ERGHVM----RLRHM--TRDTSEQFHALNV  1385
               L  +A +    +  + +  V T +     RG       RL H      +S+ F A   
Sbjct  777   SLLDSVATDSTTPSPISSSPRVTTSNHPMITRGKAGIFKPRLYHAMHISSSSQLFQAFLA  836

Query  1384  TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGS  1205
               +P  +  A  H  W  AMD E +AL  NDTW LV    H NVVGC+W+F+TK ++DGS
Sbjct  837   LKEPRGFKSAAKHPEWLSAMDDEIHALKKNDTWVLVPRPQHHNVVGCRWIFKTKLHSDGS  896

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             IE++KARLVA+GF+QV G DF DTFS VV+P TVR++ SL V+  W L QLDV NAFL+G
Sbjct  897   IERHKARLVAQGFSQVHGLDFGDTFSPVVRPATVRIILSLAVTSGWRLHQLDVKNAFLHG  956

Query  1024  HLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              L E VYM+QPPGY DP  P HV      ALYGL+
Sbjct  957   FLNEEVYMEQPPGYTDPQFPQHV-CRLKRALYGLK  990



>dbj|BAM42649.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   180 bits (456),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   149 bits (375),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 122/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP ++  L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNINKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (386),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>dbj|BAA78426.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   180 bits (456),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   149 bits (375),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 122/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP ++  L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNINKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   151 bits (382),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  + NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSKINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>ref|XP_010532348.1| PREDICTED: uncharacterized protein LOC104808371 [Tarenaya hassleriana]
Length=1788

 Score =   292 bits (748),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 178/489 (36%), Positives = 252/489 (52%), Gaps = 47/489 (10%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KSD+   F +F   +E QF + IK+I+ D   E       L K GI H  SCAYT EQ
Sbjct  420   RFKSDVMHIFPAFVTLIENQFQKVIKAIRSDNAPELSFKDLCLQK-GIVHYFSCAYTPEQ  478

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    +L+ + +V  +YW      A  LIN LP+ VLQ ++PY  L+  
Sbjct  479   NSVVERKHQHILNVARSLMFQSNVPAEYWSDCVRCAIYLINRLPSPVLQEKTPYEVLYDK  538

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LR FGC CY      +RHK   R+   VF+ YP  ++GY+ ++  + ++Y+ RH
Sbjct  539   PPAYEHLRAFGCLCYSSTNLKDRHKFSVRARAAVFIGYPQGYKGYKLLDPVTQEVYVSRH  598

Query  1711  VHFYESIF---------LFSDSTLCSQPVP-PTIPWASEPVV-TRAPCNTHAAPTDSAHM  1565
             V F+E IF          FS++++ SQP+P P  P  S  V  T AP     +  +S H+
Sbjct  599   VIFHEDIFPFLSQPNYSEFSNNSVSSQPIPLPIFPPNSTTVYQTVAPSVETPSTVESPHL  658

Query  1564  SLTSPV------------PLARGLPPLAIEGPVQTAPTR-------------------AR  1478
               T P             P A  LP    + P ++ P R                   ++
Sbjct  659   IQTHPTTEHQTVAPSAETPSAGNLPVFPEQRP-ESRPKRNVKAPGYLSQYYCNSTHHDSQ  717

Query  1477  AV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLH  1298
             A+ +       V+   H++ +  +    L+   +P  + +A+    W  AM+ E  AL  
Sbjct  718   AIFSTPYPMSSVLTYDHISPEYKQFLLNLHTDIEPKSFKEAILSPQWTQAMETEIQALTD  777

Query  1297  NDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVV  1118
             N TW +V        VGCKWV++ KRN+DG++E+YKARLVAKGF Q  G D+ DTFS V 
Sbjct  778   NGTWSIVSLPQSKKPVGCKWVYKVKRNSDGTVERYKARLVAKGFTQQEGIDYEDTFSPVA  837

Query  1117  KPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTH---PDHVRVS  947
             K  TV+LL +L    NW+L Q+DV NAFL+G L E +YM  PPGY  P     P +    
Sbjct  838   KLVTVKLLLALAAIKNWSLTQMDVTNAFLHGDLDEDIYMSLPPGYTPPVGQNLPKNAVCK  897

Query  946   SSTALYGLR  920
                +LYGL+
Sbjct  898   LQKSLYGLK  906


 Score = 36.2 bits (82),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = -1

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              P    S SG+RYFL+ VDD SR  W Y
Sbjct  390   APENSASISGYRYFLIIVDDASRSTWIY  417



>dbj|BAM44532.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   179 bits (455),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   148 bits (374),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT  +WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHCLWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (386),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score =   238 bits (608),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 164/476 (34%), Positives = 235/476 (49%), Gaps = 43/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F+ F   ++ QF  SI+ ++ D G EY      + +   GI H+ SCAYT +Q
Sbjct  576   RSELFSIFQLFYNEIKNQFGISIRILRSDNGREYLSHSFKNFMASHGILHQTSCAYTPQQ  635

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRL---  1901
             NG  ERK RH+VET   +L  G V Q +W  A   A  LIN +P+SVL  + P++ L   
Sbjct  636   NGVAERKNRHLVETTRTILIHGDVPQHFWGDAVLSACYLINRMPSSVLDNKIPHSILFPH  695

Query  1900  ---HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGK  1730
                H  PP     +VFG  C+ +       K+  RS  CVFL +  S +GY+C + +  +
Sbjct  696   DPLHSLPP-----KVFGSTCFVHNFSPGLDKLSPRSHKCVFLGFTRSQKGYKCFSPSLNR  750

Query  1729  IYICRHVHFYESIFLFSDSTLCSQP---------VPPTIPWASEP-----VVTRAPCNTH  1592
              +I   V F ES   F      S           V P+ P  S P     V +R    T 
Sbjct  751   YFISADVTFSESSLYFKSCPSPSMSSSNQVNIPLVVPSAPKDSPPPPTLQVYSRR--QTS  808

Query  1591  AAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH--MTR  1418
               P+D    SL  P P +   P +  + P+       + + +      H   L +  +++
Sbjct  809   HRPSDD---SLLVPTPHSPPAPTVEPDLPIAIR----KGIRSTRNPSPHYTALSYHRLSQ  861

Query  1417  DTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKW  1238
                    +++  + P     A+ H  WR AM  E NAL +N TW+LV      +VVGC+W
Sbjct  862   PFYTCLSSISSVSIPKSVGDALAHPGWRQAMLDEMNALQNNGTWELVPLPSRKSVVGCRW  921

Query  1237  VFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLR  1058
             VF  K   DG+I++ KARLVAKG+ Q+ G D+ DTFS V K  +VRL  ++     W L 
Sbjct  922   VFAIKVGPDGTIDRLKARLVAKGYTQIFGLDYGDTFSPVAKMASVRLFIAMAALQQWPLY  981

Query  1057  QLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             QLDV NAFLNG L E +YM+QPPG+        +      +LYGL+      SPRA
Sbjct  982   QLDVKNAFLNGDLQEEIYMEQPPGFVAQGESSGLVCRLRKSLYGLKQ-----SPRA  1032


 Score = 90.1 bits (222),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 91/173 (53%), Gaps = 11/173 (6%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L + NVLYVP     L S+ RLT   +    F KD   ++D  +  ++  G  S GLY+L
Sbjct  408   LSIDNVLYVPGSPFNLLSISRLTRSLDCVISFTKDSVSLQDRCSGRMIGTGCESHGLYQL  467

Query  2589  PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKAS  2410
              +S    A + S    ++ H RLGHP+     +++ S     + V SL S  SC   K  
Sbjct  468   QISAHVGAIMDS---PSLIHARLGHPSLAKMQQLVPSL----SNVSSL-SCESCQFGKHI  519

Query  2409  R--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             R  FP   VS  + +   L+++DIWGP+ + S  GF+YF+ F+DDYSR  W +
Sbjct  520   RSSFP-SSVSQRASSPFALVHSDIWGPSRIKSNLGFQYFVTFIDDYSRCTWVF  571



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score =   241 bits (615),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 165/465 (35%), Positives = 238/465 (51%), Gaps = 39/465 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + +S+I   + +F   VE QFS+ IK+ + D   EY +      L   G  H  +C  T 
Sbjct  577   KSRSEILSIYSNFAKMVETQFSKRIKTFRSDNALEYTQHAFQXLLHSYGTIHHLTCPGTS  636

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNGR ERK RHI++   ALL    +   +W  A   A   IN +P++V+  ++PY RL 
Sbjct  637   QQNGRAERKLRHILDXVRALLLSAKIPAPFWGEASLHAVHAINRIPSTVIHNQTPYERLF  696

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+P+  +K+E RS  C FL Y  + +GYRC +  S ++ + 
Sbjct  697   GSPPNYHHLRSFGSXCFVLLQPHEHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLRVS  756

Query  1717  RHVHFYESIFLFS----DSTLCSQPVPPTIPWASEPVVTRA----------PCNTHAAPT  1580
             R+V F+E           S+L +  V    P   E +V  A          P    A+P 
Sbjct  757   RNVVFWEHRLFVELSHFRSSLTNSSVLEIFP--DESLVPSANTLDLHLDFSPDIFDASPR  814

Query  1579  DSAHMSLTSPVP-LARGLPPLAI-EGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSE  1406
               A   +   +P    G P  A+ E P Q  P R            H  R+R +     +
Sbjct  815   QVADEQIIHELPHFEPGSPAPALPEDPPQDIPPR------------HSTRVRSIPPHLLD  862

Query  1405  Q--FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
                + AL    +P  Y +A     W+ AM +E +AL  N TW LV   P  +VVGCKW++
Sbjct  863   YHCYTALATLHEPQTYREASTDPLWQIAMKEELDALTKNHTWDLVTLPPGQSVVGCKWIY  922

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             + K  +DGS+E+YKARLVAKGF Q  G D+ +TF+ V + ++VR L ++  +  W L Q+
Sbjct  923   KIKTRSDGSVERYKARLVAKGFTQEYGIDYEETFAPVARISSVRALLAVAAARKWDLFQM  982

Query  1051  DVHNAFLNGHLAETVYMKQPPGYE-DPTHPDHVRVSSSTALYGLR  920
             DV NAFLNG L+E VYM+ PPG   +     H+R     ALYGL+
Sbjct  983   DVKNAFLNGDLSEEVYMQPPPGLSIESNKVCHLR----RALYGLK  1023


 Score = 87.0 bits (214),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 104/216 (48%), Gaps = 26/216 (12%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             + + +G+ +  + +G  S    +  L +  V +VP LS  L SV +L          +  
Sbjct  367   IHIADGSTMHGNSLGFVS----TSTLSVPGVFHVPDLSYNLCSVGQLAELGYRLIFXYSG  422

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS------------TVWHRRL  2521
             C IV+D  T   L  G   G ++  PV+  H   +   + +             +WH RL
Sbjct  423   C-IVQDXRTGQELGTGPRVGRMF--PVNNLHLPPVAPVSVAAATAAVSSLPSLALWHSRL  479

Query  2520  GH-PNAHVQNRVLQSC--PVAPNKVKSLGSR----TSCHLSKASRFPLDRVSYSSKNVLD  2362
             GH P++ VQ  V +     V+   + S+       TSC L K    P +     SK++ +
Sbjct  480   GHAPSSRVQQLVSRGLLGSVSRGLLGSVSKDNFDCTSCQLGKQPALPFNNSDSISKSIFE  539

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             L+++D+WGP+PV S  G RYF++F+DDYSR+ W +P
Sbjct  540   LIHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWIFP  575



>dbj|BAM42646.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   180 bits (456),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   148 bits (373),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 123/215 (57%), Gaps = 8/215 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL 
Sbjct  346   LSLHQPYTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLC  405

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + W
Sbjct  406   NTNRVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSW  465

Query  2532  HRRLGHPNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ 
Sbjct  466   HSRLGHPSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEY  524

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             +Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  525   IYSDVWS-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (387),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKNRPDYV-CRLRKAIYGLK  1109



>dbj|BAM42647.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM42648.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   180 bits (456),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   148 bits (373),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (386),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 4/161 (2%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V R+    A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLRK--AIYGLK  1109



>dbj|BAA78424.1| polyprotein [Arabidopsis thaliana]
 dbj|BAM44533.1| polyprotein [Arabidopsis thaliana]
Length=1330

 Score =   179 bits (455),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  415   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  474

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  475   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  534

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  535   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  594

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  595   VQFDERCFPFS  605


 Score =   148 bits (373),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  207   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  266

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  267   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  326

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  327   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  385

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  386   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  413


 Score =   153 bits (387),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  806   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  865

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  866   NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  925

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  926   AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  964



>gb|EPS62921.1| hypothetical protein M569_11867 [Genlisea aurea]
Length=1264

 Score =   234 bits (598),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/454 (35%), Positives = 230/454 (51%), Gaps = 42/454 (9%)
 Frame = -3

Query  2215  FRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRH  2042
             F   VE QF+ ++K I  D G E+        L   GI H KSC ++ +QNGRVERK+R 
Sbjct  605   FLQMVEVQFAATVKRIHTDNGTEFVNNACGSLLRSRGIFHHKSCPHSPQQNGRVERKHRQ  664

Query  2041  IVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVF  1862
             + E   ++L E ++ + +W  AF +A  LIN LP+  +  +SPY  L+   P  + LRVF
Sbjct  665   LAEAARSMLFEANLPKSFWGEAFLVAAYLINRLPSVAIGNKSPYEMLYGEAPDCSHLRVF  724

Query  1861  GCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLF  1682
             GC  Y      +R K+  RS P +F+ Y  +   YR MNL + K+Y+   V F E+ F +
Sbjct  725   GCLAYGLDTTPHRDKLAPRSFPSIFIGYTSTAHNYRLMNLYTKKVYVSHDVSFVENFFPY  784

Query  1681  SDSTLCSQPVPPTIPWASEP-VVTRAPCNTHAA-------PTDSAHMSLTSPVPLARG--  1532
                   + P+  ++P  S P +++  P N  A        PTDS        +    G  
Sbjct  785   HRK---AGPLDFSLPQVSSPTIISSQPSNAAAPTTDVLNFPTDSGAEGSADGLDTCAGNT  841

Query  1531  LPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD-TSEQFHALNVTTDPTCYSQA  1355
             +PP AI   ++ +P     +  +  + G  +R   + +     QFHA+          + 
Sbjct  842   VPPAAI---LEHSPNDPEFLVNEESDVGQFLRTIQLPKTFLLRQFHAV-------LLGRV  891

Query  1354  VGHL*WRDAMDQEFNALLHN---------DTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
             V    W   +     ++LH+          TW++         VGC+W+F+TK N DGS+
Sbjct  892   VLQHGWPIML-----SILHSISRLLICLIGTWEITDLPEGKRPVGCRWIFKTKLNPDGSV  946

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
              +YKARLVA+GF+Q+ G DF D F+ V K TTVRL  +L    +W L QLD++NAFL+G 
Sbjct  947   NRYKARLVAQGFSQIPGVDFTDVFAPVAKITTVRLFIALAAQRSWPLHQLDINNAFLHGF  1006

Query  1021  LAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             L   VYM  PPGY D   P   R+  S  LYGL+
Sbjct  1007  LDTEVYMCLPPGYSDARPPKVCRLLRS--LYGLK  1038


 Score = 93.2 bits (230),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 85/175 (49%), Gaps = 9/175 (5%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L LS+VL VP  +  L SVYRL  + N+   F  D +  +D  +  +L  G    GLYRL
Sbjct  421   LMLSDVLRVPGFTFNLLSVYRLAEKYNIRGIFDSDGWCFQDRRSNKILAAGDVLNGLYRL  480

Query  2589  PVSRSHFAYLTSRATSTV----WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHL  2422
                 S   Y ++ A S V    WH R GH +     RVL++     N   S     +C L
Sbjct  481   RDQESRQDY-SNFAKSDVDLRTWHLRFGHASF----RVLRNISFLNNFSSSDDFCHTCRL  535

Query  2421  SKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             SK +R P       ++   + L+ D+WGP    S SG RYFL  VDDYSR  W Y
Sbjct  536   SKPTRLPFPINFKRAEKSFEALHIDLWGPYHTPSRSGNRYFLTIVDDYSRAVWLY  590



>gb|AAC79110.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
 emb|CAB77781.1| putative polyprotein of LTR transposon [Arabidopsis thaliana]
Length=1456

 Score =   179 bits (455),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  541   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  600

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  601   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  660

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  661   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  720

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  721   VQFDERCFPFS  731


 Score =   148 bits (373),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  333   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  392

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  393   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  452

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  453   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  511

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  512   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  539


 Score =   153 bits (386),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  932   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  991

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  992   NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1051

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1052  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1090



>dbj|BAM44530.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   180 bits (456),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   147 bits (371),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 120/209 (57%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT   WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHCSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (386),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>dbj|BAK41511.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   183 bits (464),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  +E +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  562   KQKSQVKETFITFKNLLENRFQTRIGTFYSDNGGEFVALWEYFSQHGISHLTSPPHTPEH  621

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP+ +L  T
Sbjct  622   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPFQKLFGT  681

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + ++YI RH
Sbjct  682   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRLYISRH  741

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  742   VRFDENCFPFSNYLATLSPV  761


 Score =   144 bits (362),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (58%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  348   LSLHQPYTGGDDVMVADGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  407

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  408   NANGVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  467

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S + C ++K+++ P  + + +S   L+ +
Sbjct  468   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCSDCLINKSNKVPFSQSTINSTRPLEYI  527

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  528   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  560


 Score =   155 bits (393),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 105/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  949   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  1008

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YK RLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1009  NSDGSLNRYKVRLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1068

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   P++V      ALYGL+
Sbjct  1069  AFLQGTLTDDVYMSQPPGFIDKDRPNYV-CKLRKALYGLK  1107



>gb|AAK62793.1|AC027036_14 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAK41510.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   183 bits (464),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  +E +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  562   KQKSQVKETFITFKNLLENRFQTRIGTFYSDNGGEFVALWEYFSQHGISHLTSPPHTPEH  621

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP+ +L  T
Sbjct  622   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPFQKLFGT  681

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + ++YI RH
Sbjct  682   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRLYISRH  741

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  742   VRFDENCFPFSNYLATLSPV  761


 Score =   144 bits (362),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (58%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  348   LSLHQPYTGGDDVMVADGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  407

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  408   NANGVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  467

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S + C ++K+++ P  + + +S   L+ +
Sbjct  468   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCSDCLINKSNKVPFSQSTINSTRPLEYI  527

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  528   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  560


 Score =   155 bits (393),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 105/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  949   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  1008

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKAR VAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1009  NSDGSLNRYKARFVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1068

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   P++V      ALYGL+
Sbjct  1069  AFLQGTLTDDVYMSQPPGFIDKDRPNYV-CKLRKALYGLK  1107



>gb|AAK62788.1|AC027036_9 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAB84015.1| polyprotein [Arabidopsis thaliana]
Length=1466

 Score =   183 bits (464),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  +E +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  562   KQKSQVKETFITFKNLLENRFQTRIGTFYSDNGGEFVALWEYFSQHGISHLTSPPHTPEH  621

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP+ +L  T
Sbjct  622   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPFQKLFGT  681

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + ++YI RH
Sbjct  682   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRLYISRH  741

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  742   VRFDENCFPFSNYLATLSPV  761


 Score =   144 bits (362),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (58%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  348   LSLHQPYTGGDDVMVADGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  407

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  408   NANGVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  467

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S + C ++K+++ P  + + +S   L+ +
Sbjct  468   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCSDCLINKSNKVPFSQSTINSTRPLEYI  527

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  528   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  560


 Score =   157 bits (397),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  949   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  1008

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1009  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1068

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   P++V      ALYGL+
Sbjct  1069  AFLQGTLTDDVYMSQPPGFIDKDRPNYV-CKLRKALYGLK  1107



>dbj|BAM42650.1| Polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   179 bits (453),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL +L+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTILSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   148 bits (373),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (386),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>dbj|BAM44531.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   179 bits (455),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWLYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   147 bits (371),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 120/209 (57%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT   WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHCSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (387),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 106/161 (66%), Gaps = 4/161 (2%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V R+    A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYVCRLKK--AIYGLK  1109



>dbj|BAA87949.1| retrotransposon homolog, partial [Arabidopsis thaliana]
Length=847

 Score =   183 bits (464),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  +E +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  527   KQKSQVKETFITFKNLLENRFQTRIGTFYSDNGGEFVALWEYFSQHGISHLTSPPHTPEH  586

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP+ +L  T
Sbjct  587   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPFQKLFGT  646

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + ++YI RH
Sbjct  647   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRLYISRH  706

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  707   VRFDENCFPFSNYLATLSPV  726


 Score =   144 bits (362),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (58%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  313   LSLHQPYTGGDDVMVADGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  372

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  373   NANGVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  432

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S + C ++K+++ P  + + +S   L+ +
Sbjct  433   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCSDCLINKSNKVPFSQSTINSTRPLEYI  492

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  493   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  525



>dbj|BAA78427.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   179 bits (454),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GGE+  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGEFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWLYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   147 bits (371),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 120/209 (57%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT   WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHCSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   150 bits (379),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             AFL G L + +YM QPPG+ D   PD+  R+    A+YGL+
Sbjct  1071  AFLQGTLTDELYMSQPPGFVDKNRPDYFCRLKK--AIYGLK  1109



>dbj|BAA78423.1| polyprotein [Arabidopsis thaliana]
Length=1431

 Score =   182 bits (463),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 127/200 (64%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  +E +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  527   KQKSQVKETFITFKNLLENRFQTRIGTFYSDNGGEFVALWEYFSQHGISHLTSPPHTPEH  586

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP+ +L  T
Sbjct  587   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPFQKLFGT  646

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + ++YI RH
Sbjct  647   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRLYISRH  706

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  707   VRFDENCFPFSNYLATLSPV  726


 Score =   144 bits (362),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (58%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  313   LSLHQPYTGGDDVMVADGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  372

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  373   NANGVSVEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  432

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S + C ++K+++ P  + + +S   L+ +
Sbjct  433   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCSDCLINKSNKVPFSQSTINSTRPLEYI  492

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  493   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  525


 Score =   156 bits (394),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 105/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  914   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  973

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKAR VAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  974   NSDGSLNRYKARFVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1033

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   P++V      ALYGL+
Sbjct  1034  AFLQGTLTDDVYMSQPPGFIDKDRPNYV-CKLRKALYGLK  1072



>dbj|BAM44534.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   178 bits (451),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GG++  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGKFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   147 bits (372),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L LS VLYVP ++  L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLSKVLYVPNINKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N  +   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSFISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   154 bits (390),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSFVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>dbj|BAM44535.1| polyprotein [Arabidopsis thaliana]
Length=1475

 Score =   178 bits (451),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GG++  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGKFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   147 bits (372),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 121/209 (58%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L LS VLYVP ++  L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLSKVLYVPNINKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT + WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHSSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N  +   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSFISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   154 bits (390),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSFVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKERPDYV-CRLRKAIYGLK  1109



>dbj|BAM44529.1| polyprotein [Arabidopsis thaliana]
Length=1421

 Score =   178 bits (451),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 121/191 (63%), Gaps = 0/191 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF  F+  VE +F   I ++  D GG++  +   L++ GI+H  S  +T E 
Sbjct  560   KQKSQVKDTFIIFKSLVENRFQTRIGTLYSDNGGKFVVLRDYLSQHGISHFTSPPHTPEH  619

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVE GL LL+  SV + YW +AF +A  LIN LPT +LQ +SP+ +L   
Sbjct  620   NGLSERKHRHIVEMGLTLLSHASVPKTYWPYAFSVAVYLINRLPTPLLQLQSPFQKLFGQ  679

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  L+VFGC CYP+LRPYNRHK+E +S  C F+ Y  +   Y C+++ +G++Y  RH
Sbjct  680   PPNYEKLKVFGCACYPWLRPYNRHKLEDKSKQCAFMGYSLTQSAYLCLHIPTGRLYTSRH  739

Query  1711  VHFYESIFLFS  1679
             V F E  F FS
Sbjct  740   VQFDERCFPFS  750


 Score =   147 bits (371),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 120/209 (57%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG D + + +G+ + I+  G AS+P+ S+ L L+ VLYVP +   L SVYRL N N V 
Sbjct  352   YTGGDDVMIADGSTIPITHTGSASLPTSSRSLDLNKVLYVPNIHKNLISVYRLCNTNRVS  411

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T   LL+G T   LY  P++ S     FA   S+AT   WH RLGH
Sbjct  412   VEFFPASFQVKDLNTGVPLLQGKTKDELYEWPIASSQAVSMFASPCSKATHCSWHSRLGH  471

Query  2514  PNAHVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  + N V+   S PV  N    L S + C ++K+ + P    + +S   L+ +Y+D+W
Sbjct  472   PSLAILNSVISNHSLPVL-NPSHKLLSCSDCFINKSHKVPFSNSTITSSKPLEYIYSDVW  530

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   +RY+++FVD ++R+ W YP
Sbjct  531   S-SPILSIDNYRYYVIFVDHFTRYTWLYP  558


 Score =   153 bits (386),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR AM  E NA + N TW LV   P  + +VGC+W+F  K 
Sbjct  951   SLAANSEPRTAIQAMKDDRWRQAMGSEINAQIGNHTWDLVPPPPPSVTIVGCRWIFTKKF  1010

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  1011  NSDGSLNRYKARLVAKGYNQRPGLDYAETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1070

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   PD+V      A+YGL+
Sbjct  1071  AFLQGTLTDEVYMSQPPGFVDKDRPDYV-CRLRKAIYGLK  1109



>emb|CAN67925.1| hypothetical protein VITISV_021168 [Vitis vinifera]
Length=1354

 Score =   244 bits (623),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 169/476 (36%), Positives = 241/476 (51%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  521   RAELFSIFQKFYTEIQTQFNISIRXLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  580

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN++P+SVL  + P++ L   
Sbjct  581   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINHMPSSVLHDQIPHSLLFPD  640

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  641   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  699

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT-------------------RAPCNT  1595
               V F+E    FS +T  S PV   +P    P+V+                    AP   
Sbjct  700   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPDAMPPRPLQVYHRRPRVVAPLPF  755

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS  +   SP P       L I     T  TR            + +    ++  
Sbjct  756   PEAPADSLPIPSASPAPALPSPNDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSP  809

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV
Sbjct  810   YSAFISAISSVSLPKSTQEALSHPGWRQAMVDEMTALHSNGTWDLVVLPSGKSTVGCRWV  869

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L Q
Sbjct  870   YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQ  929

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ NAFL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  930   LDIKNAFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  978


 Score = 80.9 bits (198),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 19/175 (11%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+      S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  354   TSVLYTPECPFNXISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  412

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  413   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  461

Query  2418  KASRFPL-DRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R     R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  462   KHTRVSFTKRLNNRAKSPFELVHTDVWGPCRTXSTLGFQYFVTFIDDYSRCTWLF  516



>emb|CAN82859.1| hypothetical protein VITISV_025377 [Vitis vinifera]
Length=1578

 Score =   167 bits (422),  Expect(2) = 8e-79, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 123/211 (58%), Gaps = 4/211 (2%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS++   F  F+  VE +F+  IK++  D GGEY  +   L+  GI+H  +  +T +QNG
Sbjct  495   KSNVQTIFPQFQNLVENKFNTKIKNLYSDNGGEYIGLKSYLSVHGISHYTTAPHTPQQNG  554

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER++RH+VETGL LL +  +S  YW +AF+    LIN +PTS L  +SP+ +L K  P
Sbjct  555   VSERRHRHLVETGLTLLMDAHMSLSYWPYAFQTVAYLINRMPTSTLNNQSPFEKLFKQMP  614

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  L+ FGC CYP  RPYN+HK+E ++ PC F+ Y  S   Y C + T+ K +I R V 
Sbjct  615   NYLKLKQFGCLCYPLTRPYNKHKLEPKAQPCTFVGYSLSQNAYLCFDPTTQKFFISRDVI  674

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVT  1613
             F++  F FS+      P   T     +P VT
Sbjct  675   FHKGTFPFSNPKNLGSPSSTT----EDPSVT  701


 Score =   158 bits (399),  Expect(2) = 8e-79, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 123/209 (59%), Gaps = 5/209 (2%)
 Frame = -1

Query  2865  EYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNV  2686
             EY G+D + +G+G+GL +S +G  S+ S +++ HL + L+VP++   L SV+  T  NNV
Sbjct  283   EYDGTDEVVIGDGSGLPVSHIGSLSLASSNRVFHLCDTLFVPRIQKNLISVHHFTKHNNV  342

Query  2685  FFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV-----SRSHFAYLTSRATSTVWHRRL  2521
             + EFH   F+VKD IT A+LL+G    G+Y  P      S++  AY+  R T   WH+RL
Sbjct  343   YLEFHPTYFLVKDQITGAILLKGKCEDGVYPFPKHLPPNSKNVVAYVHERTTPDGWHKRL  402

Query  2520  GHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             GHP++ + N ++    +  NK   L   TSC  +KA R   +    +S   ++L+Y D+W
Sbjct  403   GHPSSKLVNHLIHVFSLPTNKNGHLSLCTSCSQNKAHRQTFNTHGLTSIVPMELIYKDVW  462

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             GP+  I   G +Y+++F   Y+++ W YP
Sbjct  463   GPSHDIGVDGSKYYVIFFYHYTKYIWLYP  491


 Score =   176 bits (445),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 173/347 (50%), Gaps = 34/347 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS +Y  F  F+   E +F   I ++  D GG Y+ + + L+  GI+H  +  +T   NG
Sbjct  1237  KSHVYDVFMRFKALXENKFKYRIITLYSDNGGXYQALDNFLSTNGISHLTTXPHTPXHNG  1296

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER + HIVETGL+LL   S+   YW +AF     LIN +PT  L   SP  ++ K+PP
Sbjct  1297  LFERCHXHIVETGLSLLNHASMPLTYWTYAFANVIYLINRMPTPTLHLSSPSNKIFKSPP  1356

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              YT L VFGC CYP+L  Y++HK++  SAPCVFL Y  +   Y C++L++ K YI  +V 
Sbjct  1357  NYTKLWVFGCLCYPWLHLYSQHKLDSHSAPCVFLGYSTTQSAYICLDLSTSKTYISCYVK  1416

Query  1705  FYESIFLFSDST---------LCSQPVPP--TIPWASE----PVVTRAPC---NTHAAPT  1580
             F E+ F F+            + S  +PP  T+P ++     P    + C   + +A P 
Sbjct  1417  FLENSFPFTTHQSHLAHPTLEIISNRLPPIQTLPISNGSLNMPPQRDSSCQHPSQNAQPL  1476

Query  1579  D--SAHMSLTSPVPLARGLPPLAIEGP---VQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
             D  S+ +    P P         I  P     T P   RA    H+    +  +  +++ 
Sbjct  1477  DRPSSPIDRLPPEPQNSETSSALITAPPTHQNTHPMTTRAKNNIHKPLTKMNLIAVLSQP  1536

Query  1414  TSEQFHALN-VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLV  1277
             +  + H +N   TDP           WR AM+ EF+AL+ N TW+LV
Sbjct  1537  SGIEPHTVNQALTDPK----------WRQAMNDEFDALVQNGTWELV  1573


 Score = 25.4 bits (54),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 7/24 (29%), Positives = 13/24 (54%), Gaps = 0/24 (0%)
 Frame = -1

Query  2325  ISTSGFRYFLLFVDDYSRFCWFYP  2254
             + T+   +     D Y+R+ W+YP
Sbjct  1210  VKTTSSEWHFRLADHYTRYIWYYP  1233


 Score =   128 bits (321),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 6/118 (5%)
 Frame = -3

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWT  1064
             +WVFR KR+ DG ++++KARLVAKGFN+  G D+ +TFS VVKP T+  + +L V   W+
Sbjct  740   QWVFRIKRHVDGFVDRFKARLVAKGFNERPGLDYKETFSPVVKPVTICTVLTLAVMQYWS  799

Query  1063  LRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             LRQLD++NAFL+GHL E VYMKQP G++ P  PDHV    + A+YGL+      +PRA
Sbjct  800   LRQLDINNAFLHGHLIEKVYMKQPLGFKSPKKPDHV-CCLTKAIYGLKQ-----APRA  851



>emb|CAN76679.1| hypothetical protein VITISV_034325 [Vitis vinifera]
Length=1117

 Score =   241 bits (614),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 166/476 (35%), Positives = 238/476 (50%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             ++++Y  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  G  H+ SCA+T +Q
Sbjct  388   RAELYSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGJLHQSSCAHTPQQ  447

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG   RK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  448   NGVAXRKNRHLVETAXTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  507

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  508   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  566

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTR-------------------APCNT  1595
               V F+E    FS +T  S PV   +P    P+V+                    AP   
Sbjct  567   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSXPDAMPPRPLQVYHRRPRVVAPLPF  622

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS       P+P A   P L     +  A  +            + +    ++  
Sbjct  623   PEAPADSL------PIPSASPAPALPSPNDLPIAVRKGXRSTRNPHPIYNFLSYHRLSSP  676

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV
Sbjct  677   YSAFVSAISSVSLPKSTHEALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWV  736

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L Q
Sbjct  737   YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQ  796

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ NAFL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  797   LDIKNAFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  845


 Score = 84.0 bits (206),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 13/172 (8%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  221   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIDIGRESQGLYHL-TS  279

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASR  2407
              S  A   S     + H RLGHP+     +++        +  +L S    SC L K +R
Sbjct  280   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVP-------RFSTLSSLPCESCQLGKHTR  332

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  333   ISFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  383



>emb|CAN83015.1| hypothetical protein VITISV_041694 [Vitis vinifera]
Length=1099

 Score =   234 bits (597),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/467 (32%), Positives = 239/467 (51%), Gaps = 29/467 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K+++++ F SF   V+RQFS+++K +Q D G E++ +    +  GI  + SC  T +QNG
Sbjct  277   KTEVFRMFMSFIAMVDRQFSQTVKVVQSDNGTEFKCLLDYFSATGILFQTSCVGTPQQNG  336

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK++HI+  G AL  + ++   +W  +   A  LIN  P+ +L  ++P+  L  TPP
Sbjct  337   RVERKHKHILNVGRALRFQANLPIYFWGESVLAAAHLINRTPSPLLHNKTPFEILFGTPP  396

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  +  FGC  + + +     K   RS  CVFL YP   +G++  +L + ++++ R V 
Sbjct  397   SYAAIHTFGCLSFAHDQKSKGDKFASRSRKCVFLGYPFGKKGWKLFDLDTKELFVSRDVK  456

Query  1705  FYESIFLFSD---STLCSQPVPPT----IPWASEPVVTRAPCNTHAAPTDSAHMSLTS--  1553
             F+E +F F +     +  + + PT    IP   + +             DS  +  +S  
Sbjct  457   FFEDVFPFGNPGAVNIIPENIVPTPKHKIPRLLQRLFHLGRKLFPTVGLDSLGLDNSSNG  516

Query  1552  -PVPLARGL----PPLAIEGPVQ---TAPTRARAV*TQHQERG------HVMRLRHMTRD  1415
                P+ +G+    P + +   V     A + + A  +     G      H +   + +  
Sbjct  517   QSAPMGKGMRDKFPSVLLRDFVTHTVVAESPSPATPSPQHPSGTPYPIAHYINCDNFSVH  576

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
               +    +  + DP  + +A+  + W+ +M +E  AL  N TW L         +G +WV
Sbjct  577   YRKFLATIISSNDPKSFKEAMKDVGWQKSMHEEIRALEENGTWXLEPLPKGKRALGSQWV  636

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +RTK  ++G IE+ K+RLV  G +Q AG D+ +TFS V K T VR   ++  S NW L Q
Sbjct  637   YRTKYFSNGDIERLKSRLVVLGNHQEAGIDYHETFSPVAKMTMVRAFLAIAASKNWELHQ  696

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYE--DPTHPDHVRVSSSTALYGLR  920
             +DVHNAFL+G L E VYMK PPG+E  DP     +R S    LYGL+
Sbjct  697   MDVHNAFLHGDLEEEVYMKLPPGFERSDPNLVCRLRKS----LYGLK  739


 Score = 90.1 bits (222),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 100/199 (50%), Gaps = 17/199 (9%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
             NG  ++ ++ G   +   S  + L NVLYVPKL+  L SV +LT++ +   +F+     +
Sbjct  84    NGESVVATQSGSVRL---SNNITLQNVLYVPKLNCNLLSVSQLTDDLHCIVQFNSYMCAI  140

Query  2652  KDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATSTVWHRRLGHPNAHVQNRVL  2485
             +D  TR ++  G    GLY    +      H +   + +T  +WH+R+GHP+     +V+
Sbjct  141   QDH-TRELIGTGVRRDGLYYFGGAEGDSVQHVSVHNAASTLELWHKRMGHPS----EKVV  195

Query  2484  QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKN---VLDLLYTDIWGPAPVISTS  2314
             +  P   N   SL    +C +   ++ P D+   S      + + ++ D+WG    +S+ 
Sbjct  196   KLLPPVSNLKGSLNK--ACEICFRAKHPRDKFPLSDNKATRIFEKIHCDLWGSYKHVSSC  253

Query  2313  GFRYFLLFVDDYSRFCWFY  2257
             G RYFL  VDD+SR  W Y
Sbjct  254   GARYFLTIVDDFSRAVWIY  272



>emb|CAN67546.1| hypothetical protein VITISV_027734 [Vitis vinifera]
Length=1635

 Score =   295 bits (756),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 184/473 (39%), Positives = 248/473 (52%), Gaps = 58/473 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + K      F+ F+++VE QF   IK +Q D GGE+R     L + GI  R SC Y   Q
Sbjct  404   QTKDQALPAFKKFKLQVENQFDAKIKCLQSDNGGEFRSFKTFLQQTGIFXRFSCPYNSAQ  463

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NGRVERK RH                    +AF   T LIN +P+ VLQ  SPY  L + 
Sbjct  464   NGRVERKXRH-------------------QYAFXTXTFLINRMPSKVLQNNSPYFTLFQK  504

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP++RPYN HK++YRS   +FL Y    +G+ C++  +G +YI  H
Sbjct  505   VPDYKSLRVFGCLCYPFIRPYNSHKLQYRSVQSLFLGYSLHNKGFLCLDFLTGXVYITPH  564

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHM-----------  1565
             V F E  F  + +     P+ PT   +++  +T A   +  +PT  ++            
Sbjct  565   VVFDEGQFPLAKT----HPLSPTKDTSTD-TLTPAIITSFPSPTFCSNGSHTSSLSSSPS  619

Query  1564  ------SLTSP-VPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD-TS  1409
                   S++SP V  A    P  I      +P+ A         R     +R +T+  T 
Sbjct  620   TSEASDSVSSPTVTXASSTLPEDIHEDQPPSPSPA--------PRMTTRLIRGITKKKTI  671

Query  1408  EQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFR  1229
                 A+ ++ +P    QA+    W  AMD E  AL  N TW LV     +N++G KWV++
Sbjct  672   LDLSAVKIS-EPYTLKQALKDPNWIQAMDLEIXALHRNQTWDLVEQPSEVNLIGXKWVYK  730

Query  1228  TKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
              K   DGSIE+YKARLVAKG+NQ  G D+F+TFS VVK  T+R++ ++ +S  W +RQLD
Sbjct  731   LKHKPDGSIERYKARLVAKGYNQTHGLDYFETFSPVVKAATIRIILTVALSFQWEIRQLD  790

Query  1048  VHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             VHNAFLNG L E VYM QPPGY D T P  V      ALYGL+      +PRA
Sbjct  791   VHNAFLNGELEEQVYMSQPPGYLDTTFPTKV-CRLKKALYGLKQ-----APRA  837


 Score = 80.9 bits (198),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 69/135 (51%), Gaps = 15/135 (11%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++ S  YTG+D + +GNG  L IS  G   +  +S+  HL  V +VP +S  L SV +  
Sbjct  257   LTSSSPYTGTDKVTIGNGKHLSISNTGSHRLLXDSRSFHLKKVFHVPFISANLISVAKFC  316

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV-SRSHFAYLTSRATST-----  2539
             ++NN   EF  + F VKD  T+ VL +G    GLYR PV +    A++ +  +ST     
Sbjct  317   SDNNALIEFRSNSFFVKDLHTKKVLAQGKLENGLYRFPVLNXKKVAFVGATNSSTFYSHN  376

Query  2538  ---------VWHRRL  2521
                      +WH RL
Sbjct  377   SSIFDNKVKLWHXRL  391



>emb|CAN76546.1| hypothetical protein VITISV_010420 [Vitis vinifera]
Length=1288

 Score =   234 bits (596),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/466 (35%), Positives = 230/466 (49%), Gaps = 51/466 (11%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS++ K    F   V++QF + +K+I+ D   E      +H+L   G+ H +SC  T +Q
Sbjct  511   KSEVQKYIPDFFAFVKKQFGKEVKAIRSDNAPELFLSNFYHSL---GVIHYRSCVETPQQ  567

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    ALL   S+   YW      A  LIN  P+  L  ++P+  LH  
Sbjct  568   NSVVERKHQHILNVARALLFXSSLPVCYWSDCILTAVYLINRTPSPFLNNKTPFEILHDK  627

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ LRVFGC CY      NR K   R+   VFL YP  F+GY+ +++ +  I I R+
Sbjct  628   LPDYSHLRVFGCLCYVSTLKANRTKFSPRAKAAVFLGYPFGFKGYKLLDIETRSISISRN  687

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARG  1532
              +   S  + SD  L    V P I                AA  D +    +S +P    
Sbjct  688   TNPCSSPDISSD--LFHDRVLPCI----------------AADNDQS----SSVLPRVVS  725

Query  1531  LPPLAIEGPVQTAPTRAR----------------AV*TQHQERGHVMR--LRHMTRDTSE  1406
              PPL +     + PTR                      +     H ++  L +     S 
Sbjct  726   QPPLQVAP--SSRPTRVSKQPSYLKDYHCSLINSVAHVETHSTSHPIQHFLSYDKLSPSY  783

Query  1405  QFHALNVT--TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
             +  +L+V+  ++P+ +++A     WR AMD E  AL  N T  +V      + VGCKWV+
Sbjct  784   KLFSLSVSIISEPSSFAKAAEIPEWRAAMDCELEALEENKTXSIVSLPVGKHPVGCKWVY  843

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             + K   DG+IE+YKARLVAKG+ Q  G D+ DTFS V K  TV+LL ++     W L QL
Sbjct  844   KXKHKXDGTIERYKARLVAKGYTQREGIDYVDTFSPVAKLVTVKLLLAIAAVKGWHLSQL  903

Query  1051  DVHNAFLNGHLAETVYMKQPPGY--EDPTHPDHVRVSSSTALYGLR  920
             DV+NAFL+G L E VYMK PPGY  +  + P +       +LYGL+
Sbjct  904   DVNNAFLHGDLNEEVYMKLPPGYNRKGESLPSNXVCLLHKSLYGLK  949


 Score = 89.7 bits (221),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 96/198 (48%), Gaps = 12/198 (6%)
 Frame = -1

Query  2829  GAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVK  2650
             G  + I RVG   +  + KLL   NVL+VP     L SV   T+  ++   F  D  I++
Sbjct  314   GITVPIDRVGSVILSKDVKLL---NVLFVPTFRYNLLSVSAFTDTLSLSMVFTPDACIIQ  370

Query  2649  DSITRAVLLRGSTSGGLYRLP----VSRSHFAYLTSRATSTV---WHRRLGHPNAHVQNR  2491
             +     ++ +GS  G LY+L     V+   F   +   TS +   WH RLGHP +  + +
Sbjct  371   EPSRGKMIGKGSRKGQLYQLDFDSFVADKAFVAASRIPTSNILSLWHSRLGHP-SFSRLK  429

Query  2490  VLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSG  2311
              LQS  +  +    L     C L+K    P   ++    +  DLL+ DIWGP  V S  G
Sbjct  430   GLQSV-LDFDSSFDLTPCNVCPLAKQRCLPYISLNKRCSSTFDLLHLDIWGPFSVGSVEG  488

Query  2310  FRYFLLFVDDYSRFCWFY  2257
             +++FL  VDDYSR  W Y
Sbjct  489   YKFFLTIVDDYSRVTWVY  506



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score =   238 bits (608),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 238/476 (50%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  678   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  737

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  738   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  797

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  798   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  856

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT-------------------RAPCNT  1595
               V F+E    FS +T  S PV   +P    P+V+                    AP   
Sbjct  857   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPDAMPPRPLQVYHRRPRVVAPLPF  912

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS  +   SP P       L I     T  TR            + +    ++  
Sbjct  913   PEAPADSLPIPSASPAPALPSPNDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSP  966

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV
Sbjct  967   YSAFVSAISSVSLPKSTHEALSHXGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWV  1026

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ D FS V K  +VRLL S+    +W L Q
Sbjct  1027  YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDXFSPVAKIASVRLLLSMAAMCSWPLYQ  1086

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ N FL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  1087  LDIKNXFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  1135


 Score = 84.7 bits (208),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  511   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDXSTGKTIGIGRESQGLYHL-TS  569

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  570   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  618

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  619   KHTRVSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  673



>emb|CAN71748.1| hypothetical protein VITISV_019194 [Vitis vinifera]
Length=1306

 Score =   221 bits (562),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 162/456 (36%), Positives = 226/456 (50%), Gaps = 25/456 (5%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             +S+++  F +F   ++ Q+  S+K ++ D G EY       ++ GI H+ SC  T  QNG
Sbjct  553   RSEVFSHFCAFSAEIKTQYDVSVKILRSDNGKEY-------SQWGILHQTSCVDTPSQNG  605

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK RH++ET  AL+ +  V +Q+W  A   A  LIN +PT VL+ + PY  +H    
Sbjct  606   VAERKNRHLLETARALMFQMKVPKQFWADAVSTACFLINRMPTVVLKGDIPYKVIHPQKS  665

Query  1885  PYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              +    R+FGC CY    RP+   K++ ++  CVFL Y    +GYRC +    K  +   
Sbjct  666   LFPLAPRIFGCTCYVRDTRPFVT-KLDPKALQCVFLGYSRLQKGYRCFSPDLNKYLVSTD  724

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARG  1532
             V F E    FS  T  S        W    VV   P    ++  DS   SL    P+   
Sbjct  725   VVFSEDTSFFSSPT--SSASEEDEEWLVYQVVNSRPTVGQSSVVDS-DASLAPSGPVVHI  781

Query  1531  LPPLAIEGPVQTAPTRARAV*T-QHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQA  1355
              P  A    VQ    R     T              +    S +  +++V   P   ++A
Sbjct  782   PPAPAKPPIVQVYSRRPVTTDTCPAPAPSSSDPSSDLDLPISLRKDSISV---PKTVTEA  838

Query  1354  VGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVA  1175
             + H  W++AM  E  AL  N TWKLV       VVGCKWVF  K N DGS+ + KARLVA
Sbjct  839   LNHPGWKNAMLXEICALEDNHTWKLVDLPQGKKVVGCKWVFAVKVNPDGSVARLKARLVA  898

Query  1174  KGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQ  995
             +G+ Q  G D+ DTFS V K  +VRL  S+  S  W + QLD+ NAFL+G L E VY++Q
Sbjct  899   RGYAQTYGVDYSDTFSPVAKLNSVRLFISIAASQQWMIHQLDIKNAFLHGDLEEEVYLEQ  958

Query  994   PPGYEDPTHPDHVRVSS-STALYGLRGVKMG*SPRA  890
             PPG+      ++ +V     ALYGL+      SPRA
Sbjct  959   PPGF--VAQGEYGKVCRLKKALYGLKQ-----SPRA  987


 Score =   101 bits (252),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 94/172 (55%), Gaps = 6/172 (3%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             + LS+VL +P L+  L SV +LT   N    F  D  + +D +T+    +G  S GLY L
Sbjct  382   ITLSSVLNLPNLAFNLISVSKLTKNLNCSVSFFPDHCVFQDLMTKRTFGKGHVSDGLYIL  441

Query  2589  PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKAS  2410
                        S A+    H RLGHP+  V  ++   CP   + + SL    SCH +K  
Sbjct  442   DEWVPRPVACVSTASPVEAHCRLGHPSLPVLKKL---CPQF-DTLPSLDCE-SCHFAKHH  496

Query  2409  RFPLD-RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             R  L  R++  ++++ +L+++D+WGP PV S +GFRYF+ FVDD+SR  W Y
Sbjct  497   RSSLGPRLNKRAESLFELVHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIY  548



>emb|CAN65410.1| hypothetical protein VITISV_040416 [Vitis vinifera]
Length=2253

 Score =   239 bits (610),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 168/476 (35%), Positives = 239/476 (50%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  1098  RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  1157

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  1158  NGVAERKNRHLVETARTLLLHNHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  1217

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  1218  QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  1276

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT-------------------RAPCNT  1595
               V F+E    FS +T  S PV   +P    P+V+                    AP   
Sbjct  1277  ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPDAMPPRPLQVYHRRPRVVAPLPF  1332

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS  +   SP P       L I     T  TR            + +    ++  
Sbjct  1333  PEAPADSLPIPSASPAPALPSPNDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSP  1386

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV
Sbjct  1387  YSAFVSAISSVSLPKSTHEALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWV  1446

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L Q
Sbjct  1447  YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQ  1506

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ N FL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  1507  LDIKNXFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  1555


 Score = 83.2 bits (204),  Expect(2) = 5e-78, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 99/211 (47%), Gaps = 26/211 (12%)
 Frame = -1

Query  2859  TGSDV--LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNV  2686
             T SD+  + + NG+  +   +G A        L L++V Y P+    L S+ ++T   N 
Sbjct  899   TTSDLPTVTLANGSQTVAKGIGXALP---LPSLPLTSVXYTPECPFNLISISKITRTLNC  955

Query  2685  FFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPN-  2509
                F      ++D  T   +  G  S GLY L  S S  A   S     + H RLGHP+ 
Sbjct  956   SITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TSDSSPAVCISTDAPLLIHNRLGHPSL  1014

Query  2508  AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYT  2350
             +  Q  V     L S P             SC L K +R  FP  R++  +K+  +L++T
Sbjct  1015  SKFQKMVPRFSTLSSLPCE-----------SCQLGKHTRVSFP-KRLNNRAKSPFELVHT  1062

Query  2349  DIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             D+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  1063  DVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  1093



>ref|XP_007014689.1| Uncharacterized protein TCM_040047 [Theobroma cacao]
 gb|EOY32308.1| Uncharacterized protein TCM_040047 [Theobroma cacao]
Length=678

 Score =   175 bits (443),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 123/191 (64%), Gaps = 0/191 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
              SD+Y     F+  V++ F+ SI  I  D GG+Y+K+   L   GI+H  +  YT E NG
Sbjct  275   NSDVYLLLPIFKALVKKAFNTSITCIYSDNGGKYQKMSKYLATHGISHLTTPPYTLELNG  334

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER+++HIVETGL LL   S+  ++W  AF++A   IN LPT +L  +SP+  L +TPP
Sbjct  335   AAERRHKHIVETGLTLLHHASMPLKFWSHAFQVAVYPINKLPTPLLNLKSPFEILFETPP  394

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ L+VFGC CYP+L+PYN+HK++ +S PCVFL Y  +   Y+C +  S +I++ RHV 
Sbjct  395   NYSKLKVFGCLCYPWLKPYNKHKLQPKSKPCVFLRYSINQSAYKCFDHESQRIFVSRHVM  454

Query  1705  FYESIFLFSDS  1673
             F E IF F+ +
Sbjct  455   FQEHIFPFTSA  465


 Score =   147 bits (370),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 129/223 (58%), Gaps = 13/223 (6%)
 Frame = -1

Query  2895  VTASM--MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPL  2722
             VTA +  +S   EY G + + VG G  L I+ +G + I + +K L L+NVL+VP ++  L
Sbjct  51    VTADLNNLSLYTEYGGLEKIAVGGGTSLSINHIGFSIISTTNKPLKLTNVLHVPVMNRNL  110

Query  2721  FSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTS----  2554
              S+ +    NNVF EF    F+VKDS   A L+R     GLY LP   SH + +T+    
Sbjct  111   ISISKFCKTNNVFVEFFPFHFLVKDSSMGAPLVRSLNRNGLYELPRCMSHLSMITTTFLS  170

Query  2553  -RATSTVWHRRLGHPNAHVQNRVLQ--SCP-VAPNKVKSLGSRTSCHLSKASRFPLDRVS  2386
              + +  VWHRRLGHP++ +   +L+    P +A NK  S     SC  +++ + P  + +
Sbjct  171   VKTSFDVWHRRLGHPSSEILTFMLKFFGLPSIASNKAFSCN---SCACNESHKLPFGQST  227

Query  2385  YSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              SS   L LLYTD+WGPA +    GFRY+++++D ++++ WF+
Sbjct  228   LSSTKHLQLLYTDVWGPAQISFVEGFRYYVIYIDHFTKYIWFF  270


 Score =   110 bits (275),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -3

Query  1336  RDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQV  1157
             R AM +EFNAL+ N TW LV       V+GCKWVF+ KR  DGSI++YKARLVAKGF+Q 
Sbjct  472   RQAMIEEFNALVKNQTWVLVPPSSKQTVIGCKWVFKIKRKPDGSIDRYKARLVAKGFHQR  531

Query  1156  AGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLR  1058
              G D+ DT   V+KPTT++++ S+ +S+ W ++
Sbjct  532   EGIDYTDTLIPVIKPTTIKIVLSIALSYGWPIQ  564



>gb|AAF99727.1|AC004557_6 F17L21.7 [Arabidopsis thaliana]
Length=1534

 Score =   192 bits (489),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 124/193 (64%), Gaps = 0/193 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  VE +F   I+++  D GGE+  +   L   GI+H  S  +T E 
Sbjct  655   KQKSQVRETFVAFKALVENRFQTKIRTLYSDNGGEFIALRQFLLTHGISHLTSLPHTPEH  714

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHI+ETGL LL + S+   YW +AF  A  LIN LP+SVL  ESPY++L KT
Sbjct  715   NGIAERKHRHILETGLTLLTQASIPTSYWTYAFGTAVYLINRLPSSVLNNESPYSKLFKT  774

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC C+P+LRPY  HK+E RS PCVFL Y  +   Y C++ +SG++Y  RH
Sbjct  775   SPNYLKLRVFGCSCFPWLRPYTNHKLERRSQPCVFLGYSLTQSAYLCLDRSSGRVYTSRH  834

Query  1711  VHFYESIFLFSDS  1673
             V F E  F FS S
Sbjct  835   VQFVEDQFPFSIS  847


 Score =   128 bits (322),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 115/209 (55%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G+ L I+  G +++ ++S+ L L+N+LYVP L   L SVY+L N N V 
Sbjct  447   YNGGEEVTIADGSTLPITHTGSSTLSTQSRSLALNNILYVPNLHKNLISVYKLCNANKVS  506

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  PV      S FA  T + T   WH RLGH
Sbjct  507   VEFFPAHFQVKDLSTGARLLQGRTKDELYEWPVPSNTPISLFASPTPKTTLPSWHSRLGH  566

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  V   ++   S PV+ +  K     + C ++K+ + P    +  S   L+ +Y+D+W
Sbjct  567   PSPPVLKSLVSQFSLPVSNSSQKHFPC-SHCLINKSHKLPFYSNTIISYTPLEYVYSDVW  625

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +PV S   F+Y+L+ VD Y+R+ W YP
Sbjct  626   T-SPVTSVDNFKYYLILVDHYTRYTWLYP  653


 Score =   149 bits (377),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = -3

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             P   +QA+    WR+AM +E NA + N+T++LV  +P+ NV+  KW+F  K   +G++++
Sbjct  1025  PNTVNQALRDEKWRNAMGEEINAQIRNNTFELVPPKPNQNVISTKWIFTLKYLPNGTLDR  1084

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             YKARLVA+GF Q  G  + +TFS VVK  T+RL+  L VS +WT++QLDV+NAFL G L 
Sbjct  1085  YKARLVARGFRQQYGLHYSETFSPVVKSLTIRLVLQLAVSRSWTIKQLDVNNAFLQGTLT  1144

Query  1015  ETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             + VY+ QPPG+ DP  P HV R+    ALYGL+
Sbjct  1145  DEVYVTQPPGFIDPDRPHHVCRLKK--ALYGLK  1175



>emb|CAN66496.1| hypothetical protein VITISV_036886 [Vitis vinifera]
Length=1092

 Score =   170 bits (430),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 119/191 (62%), Gaps = 0/191 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD++ TF  F   V+ QFS  +K++  D GGE+  +   LT  GI+H     +T +QNG
Sbjct  434   KSDVHSTFVQFTXMVKNQFSCKLKNLYSDNGGEFIXLRSFLTTRGISHYTIAPHTXQQNG  493

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VER +RH+VETG+ LL   SV    W +A   A  LIN LPTS+L ++SP+  L    P
Sbjct  494   TVERCHRHVVETGMTLLHHASVPSTXWTYALATAVYLINXLPTSLLSYKSPFEALFGRTP  553

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LR FGC+CYP+L  Y  +K++ +S PCVFL Y  +   ++C++L +GK+Y+ RHV 
Sbjct  554   NYHKLRTFGCQCYPWLVXYRTNKLQPKSQPCVFLGYSLTQHAFKCLDLHTGKLYLSRHVT  613

Query  1705  FYESIFLFSDS  1673
             F E +F F ++
Sbjct  614   FDEHLFXFKNA  624


 Score =   150 bits (380),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 119/216 (55%), Gaps = 9/216 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S   EY G D + +G+G GL I+ +G  ++ S S+ L L   L+VP +   L S ++ T
Sbjct  217   LSIHSEYEGQDEVVLGDGTGLQIAHIGSTTLSSPSRSLMLKETLHVPLIHKNLISXHKFT  276

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRS-------HFAYLTSRATS  2542
             ++NNV  EFH   ++VKD +T A L+RG    G+Y + +  S       H A   +R T 
Sbjct  277   HDNNVTIEFHPFFYLVKDRMTGAXLMRGRCENGVYPVALQSSSPQXNQIHLA--GTRVTF  334

Query  2541  TVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
               WH RLGH    + + +LQS  +     KS  S  SC  +K+ + P    S  +   L+
Sbjct  335   DCWHHRLGHXTPKILSSLLQSHDLPVASSKSTLSCISCQCNKSHKLPFSSTSLKNXVXLE  394

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              LY D+WGP+PV S  G+ Y+LL VD ++++CWF P
Sbjct  395   FLYDDVWGPSPVSSIDGYHYYLLLVDHFTKYCWFXP  430


 Score =   137 bits (346),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 100/168 (60%), Gaps = 22/168 (13%)
 Frame = -3

Query  1399  HALNVTT--------DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGC  1244
             H L+VTT        +PT  SQA+    WR AM  EF AL+ + TWKLV      N+VGC
Sbjct  627   HQLSVTTKHPLASPLEPTYTSQALKDPQWRKAMADEFTALVFHGTWKLVPQSSTSNIVGC  686

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWT  1064
             KWVFR K + DG             FNQ    D+ +TFS V+KPTT+ L+ SL +S+ W+
Sbjct  687   KWVFRIKXHPDG-------------FNQRPSVDYTETFSPVIKPTTIXLILSLALSNGWS  733

Query  1063  LRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             L QLDV+N FL+G L E V+M QP G+ D +HP HV  +   ++YGL+
Sbjct  734   LHQLDVNNVFLHGQLTEQVFMXQPVGFXDQSHPQHV-CALQKSIYGLK  780



>gb|KHN05285.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1346

 Score =   248 bits (632),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 163/488 (33%), Positives = 249/488 (51%), Gaps = 57/488 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+     ++F   ++ Q++ S+KSI+ D G E+       +K GI H+ SC  + +QNG
Sbjct  531   KSEARLHVQNFIHFIKTQYNHSVKSIRTDNGPEFLMPDFYASK-GILHQTSCVDSPQQNG  589

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK++ I+  G ALL + ++ + +W +A   A  ++N +P   LQ +SPYT L+ T P
Sbjct  590   RVERKHQQILNIGRALLVQSNLPKSFWCYAVSHAVYIMNRVPAPNLQNKSPYTLLYNTAP  649

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              +  L+VFG   +      +R K++ R+  CVFL Y    +G   ++L +  I++ R V 
Sbjct  650   DFDTLKVFGSLVFASTLQSHRTKLDLRARKCVFLGYKSGVKGVVLLDLLNNSIFLSRDVT  709

Query  1705  FYESIFLFSDSTLCSQPVPPTIPW------------------------------------  1634
              +E IF +  S+       P  PW                                    
Sbjct  710   HHEHIFPYQSSS-------PKTPWEYHSISPTPNDSDITLDSDISLDINAEQSPSPPHSS  762

Query  1633  -----ASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLPPLAIEGPV--QTAPTRARA  1475
                  +++ V++    +T   P D     L    P+ +   PL +   V   T+PT   +
Sbjct  763   LSPNISNDTVISDTSTST-PPPKDHNDSPLLHSKPIRQRRAPLHLSDYVCHNTSPTSHES  821

Query  1474  V*TQHQERGHVMRLRHMTRDT-SEQFHALNVT--TDPTCYSQAVGHL*WRDAMDQEFNAL  1304
             + +  + +  +     +T  + S +  ++++T  T+P  Y +A  H  W  AM +E NAL
Sbjct  822   LTSGTKSKYPLSSFHSLTLLSPSHKAFSMSITHCTEPQSYEEASKHEHWVTAMKEELNAL  881

Query  1303  LHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSL  1124
               N TWK+V   PH   +GCKWV++ K  A+G IE+YKARLVAKG+NQV G D+F+TFS 
Sbjct  882   AKNCTWKIVELPPHTKPIGCKWVYKVKHKANGQIERYKARLVAKGYNQVEGIDYFETFSP  941

Query  1123  VVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSS  944
             V K TTVR L ++    NW L QLDV+NAFL+G L E VYMK P G      P+ V    
Sbjct  942   VAKITTVRTLLAVAAIKNWHLHQLDVNNAFLHGDLQEDVYMKIPDGVT-CAKPNSV-CKL  999

Query  943   STALYGLR  920
               +LYGL+
Sbjct  1000  QKSLYGLK  1007


 Score = 72.8 bits (177),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 86/209 (41%), Gaps = 18/209 (9%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             ++++ NG  +     G     S      ++NVLYVP  +V L SV +L +       F  
Sbjct  322   IIKLPNGNHVTTKYAGTVVFSSS---FSITNVLYVPTFTVNLISVSQLCHHTPYTLNFTD  378

Query  2667  DCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS-------------TVWHR  2527
                 +++  +  ++  G +  GLY L  +    A      +S              +WH 
Sbjct  379   TICSIQEQKSLKMIGLGESRDGLYYLTQTNKECASSNYNISSIFSSANNVHIPENAIWHF  438

Query  2526  RLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTD  2347
             RLGH ++     +    P   N   S+     CH +K  + P     + +    DL++ D
Sbjct  439   RLGHLSSSRIALLHSQFPFIVNDSSSVCD--ICHFAKHRKLPFVHSYHKAIKCFDLIHFD  496

Query  2346  IWGPAPVISTSGFRYFLLFVDDYSRFCWF  2260
             IWGP  + S     YFL  VDD+SR+ W 
Sbjct  497   IWGPISIKSVHNHAYFLTAVDDHSRYTWI  525



>dbj|BAK41507.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   183 bits (464),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 126/200 (63%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  VE +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  543   KQKSQVKETFITFKNLVENRFQTRIGTFYSDNGGEFVALREYFSQHGISHLTSPPHTPEH  602

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP  +L  T
Sbjct  603   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPCQKLFGT  662

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + +IYI RH
Sbjct  663   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRIYISRH  722

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  723   VRFDENCFPFSNYLATLSPV  742


 Score =   137 bits (344),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 122/214 (57%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  329   LSLHQPYTGGDDVMVVDGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  388

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  389   NANGVSVEFFLASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  448

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S     ++K+++ P  + + +S   L+ +
Sbjct  449   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCLDSLINKSNKVPFSQSTINSTRPLEYI  508

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  509   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  541


 Score =   157 bits (398),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  930   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  989

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  990   NSDGSLNRYKARLVAKGYNQRPGLDYVETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1049

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   P++V      ALYGL+
Sbjct  1050  AFLQGTLTDDVYMSQPPGFIDKDRPNYV-CKLRKALYGLK  1088



>gb|AAC02672.1| polyprotein [Arabidopsis arenosa]
Length=1390

 Score =   187 bits (474),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 125/205 (61%), Gaps = 2/205 (1%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS + +TF +F   VE +F   I ++  D GGE+  +   L   GI+H  +  +T E 
Sbjct  564   RQKSQVRETFITFTALVENKFKSKIGTLYSDNGGEFIALRSFLASHGISHMTTPPHTPEL  623

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+S++YW +AF  A  LIN + T VL  ESPY +L   
Sbjct  624   NGISERKHRHIVETGLTLLSTASMSKEYWSYAFTTAVYLINRMLTPVLGNESPYMKLFGQ  683

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LRVFGC C+P+LRPY  HK++ RS PCV L Y  S   Y C++  +G++Y  RH
Sbjct  684   PPNYLKLRVFGCLCFPWLRPYTAHKLDNRSMPCVLLGYSLSQSAYLCLDRATGRVYTSRH  743

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIP  1637
             V F ESIF F  ST      PP+ P
Sbjct  744   VQFAESIFPF--STTSPSVTPPSDP  766


 Score =   133 bits (334),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 116/209 (56%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G+GL IS  G A +P+ ++ L L +VLYVP +   L SVYR+ N N V 
Sbjct  356   YNGGEEVTIADGSGLPISHSGSALLPTPTRSLDLKDVLYVPDIQKNLISVYRMCNTNGVS  415

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  PV    + S FA  T +     WH RLGH
Sbjct  416   VEFFPAHFQVKDLSTGARLLQGKTKNELYEWPVNSSIATSMFASPTPKTDLPSWHARLGH  475

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  +   ++   S P++ +    L   + C ++K+ + P    + +S + L+ LYTD+W
Sbjct  476   PSLPILKTLISKFSLPISHSLQNQLLC-SDCSINKSHKLPFYSNTIASSHPLEYLYTDVW  534

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P+ S   ++Y+L+ VD Y+R+ W YP
Sbjct  535   T-SPITSIDNYKYYLVIVDHYTRYTWLYP  562


 Score =   149 bits (375),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 110/185 (59%), Gaps = 11/185 (6%)
 Frame = -3

Query  1447  HVMRLRHMTRDTSEQFHALNVTTDPT--------CYSQAVGHL*WRDAMDQEFNALLHND  1292
             H MR R             N+ T PT          ++A+    WR AM  E NA   N 
Sbjct  906   HTMRTRSKNNIVKPNPKFANLATKPTPLKPIIPKTVAEALLDPNWRQAMCDEINAQTRNG  965

Query  1291  TWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
             T+ LV   P+ NV+GCKWVF  K   +G +++YKARLVAKGF+Q  G DF +TFS V+K 
Sbjct  966   TFDLVPPAPNQNVIGCKWVFTLKYLPNGVLDRYKARLVAKGFHQQYGHDFKETFSPVIKS  1025

Query  1111  TTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTA  935
             TTVR +  + VS  W++RQ+DV+NAFL G L++ VY+ QPPG+ D  +P HV R+    A
Sbjct  1026  TTVRSVLHVAVSKGWSIRQIDVNNAFLQGTLSDEVYVMQPPGFVDKDNPHHVCRLHK--A  1083

Query  934   LYGLR  920
             LYGL+
Sbjct  1084  LYGLK  1088


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 66/156 (42%), Gaps = 11/156 (7%)
 Frame = -2

Query  3587  KLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptpnp  3408
             +LT  NF+ W  Q+   L G +L GYVD   P PPPT      + D V        T N 
Sbjct  31    RLTDSNFVMWSRQVHALLDGYDLAGYVDGSVPIPPPT----RTTDDGV-------VTTNN  79

Query  3407  AYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLGQF  3228
              Y  W +QD+ + S L+ ++S  V  L     TS  VWE++ +   + S A       Q 
Sbjct  80    DYTLWKRQDKLVYSALLGAISLSVQPLLSKANTSAEVWETLSSTFANPSWAHVQQLRQQL  139

Query  3227  HYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                 +G  S V Y        + LA  G     +EQ
Sbjct  140   KQWTKGTKSVVTYFQGFTTRFDHLALLGKAPEREEQ  175



>dbj|BAA78425.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41505.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41506.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41508.1| polyprotein [Arabidopsis thaliana]
 dbj|BAK41509.1| polyprotein [Arabidopsis thaliana]
Length=1447

 Score =   183 bits (464),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 126/200 (63%), Gaps = 0/200 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS + +TF +F+  VE +F   I +   D GGE+  +    ++ GI+H  S  +T E 
Sbjct  543   KQKSQVKETFITFKNLVENRFQTRIGTFYSDNGGEFVALREYFSQHGISHLTSPPHTPEH  602

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ + YW +AF +A  LIN LPT +LQ ESP  +L  T
Sbjct  603   NGLSERKHRHIVETGLTLLSHASIPKTYWPYAFAVAVYLINRLPTPLLQLESPCQKLFGT  662

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN+HK++ +S  CVFL Y  +   Y C++L + +IYI RH
Sbjct  663   SPNYDKLRVFGCACYPWLRPYNQHKLDDKSRQCVFLGYSLTQSAYLCLHLQTSRIYISRH  722

Query  1711  VHFYESIFLFSDSTLCSQPV  1652
             V F E+ F FS+      PV
Sbjct  723   VRFDENCFPFSNYLATLSPV  742


 Score =   137 bits (344),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 77/214 (36%), Positives = 122/214 (57%), Gaps = 6/214 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG D + V +G+ + IS  G  S+ ++S+ L+L N+LYVP +   L SVYRL 
Sbjct  329   LSLHQPYTGGDDVMVVDGSTIPISHTGSTSLSTKSRPLNLHNILYVPNIHKNLISVYRLC  388

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  P++ S     FA  +S+AT + W
Sbjct  389   NANGVSVEFFLASFQVKDLNTGVPLLQGKTKDELYEWPIASSQPVSLFASPSSKATHSSW  448

Query  2532  HRRLGHPNAHVQNRVLQSCPVAP-NKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLL  2356
             H RLGHP   + N V+ +  ++  N      S     ++K+++ P  + + +S   L+ +
Sbjct  449   HARLGHPAPSILNSVISNYSLSVLNPSHKFLSCLDSLINKSNKVPFSQSTINSTRPLEYI  508

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             Y+D+W  +P++S   +RY+++FVD ++R+ W YP
Sbjct  509   YSDVWS-SPILSHDNYRYYVIFVDHFTRYTWLYP  541


 Score =   157 bits (398),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  1396  ALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP-HMNVVGCKWVFRTKR  1220
             +L   ++P    QA+    WR+AM  E NA + N TW LV   P H+ +VGC+W+F  K 
Sbjct  930   SLAAESEPRTAIQALKDERWRNAMGSEINAQIGNHTWDLVPPPPSHVTIVGCRWIFTKKY  989

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
             N+DGS+ +YKARLVAKG+NQ  G D+ +TFS V+K T++R++  + V  +W +RQLDV+N
Sbjct  990   NSDGSLNRYKARLVAKGYNQRPGLDYVETFSPVIKSTSIRIVLGVAVDRSWPIRQLDVNN  1049

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             AFL G L + VYM QPPG+ D   P++V      ALYGL+
Sbjct  1050  AFLQGTLTDDVYMSQPPGFIDKDRPNYV-CKLRKALYGLK  1088



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score =   239 bits (611),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 166/476 (35%), Positives = 239/476 (50%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  533   QAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  592

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  593   NGVAERKNRHLVETARTLLLHNHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  652

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  653   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  711

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT-------------------RAPCNT  1595
               V F+E    FS +T  S PV   +P    P+V+                    AP   
Sbjct  712   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPDAMPPRPLQVYHRRPRVVAPLPF  767

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS       P+P A   P L     +  A  +            + +    ++  
Sbjct  768   PEAPADSL------PIPSASPAPALPSPNDLPIAVXKGXRSTRNPHPIYNFLSYHRLSSP  821

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR  M  E  AL  N TW LV+     + VGC+WV
Sbjct  822   YSAFVSAISSVSLPKSTHEALSHPSWRQXMVDEMAALHSNGTWDLVVLPSGKSTVGCRWV  881

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L Q
Sbjct  882   YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQ  941

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ NAFL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  942   LDIKNAFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  990


 Score = 80.1 bits (196),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 85/172 (49%), Gaps = 13/172 (8%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY  +    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  366   TSVLYTXECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  424

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASR  2407
              S  A   S     + H RLGHP+     +++        +  +L S    SC L K +R
Sbjct  425   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVP-------RFSTLSSLPCESCQLGKHTR  477

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  478   VSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  528



>ref|XP_010058987.1| PREDICTED: uncharacterized protein LOC104446890 [Eucalyptus grandis]
Length=1378

 Score =   290 bits (741),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 248/466 (53%), Gaps = 48/466 (10%)
 Frame = -3

Query  2203  VERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRHIVET  2030
             VE   +  IK  Q D GGE+   K    L   GI    SC YT EQNG  ERK+RHIVE 
Sbjct  543   VENHHNCKIKKFQCDGGGEFVSHKFKAHLQSCGIKQLISCPYTPEQNGIPERKHRHIVEL  602

Query  2029  GLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGCRC  1850
             GLA+L    V  ++W  AF  A  ++N LPT  L+ +SP+T+LH+  P Y  LRVFGC C
Sbjct  603   GLAMLYHAKVPLKFWVDAFMTANYIVNILPTPKLEMQSPFTKLHQHKPRYDHLRVFGCAC  662

Query  1849  YPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSD--  1676
             YP LRPY +HK++ RS  CVFL Y    +GYRC+  T+G +YI RHV F E+ F FS   
Sbjct  663   YPCLRPYAQHKMDPRSLTCVFLGYNTHHKGYRCLVPTTGHVYISRHVTFDETFFPFSKKL  722

Query  1675  STLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMS---LTSPV---------PLARG  1532
             +T  S        W  E    + P NT    T S+H +      PV         P++  
Sbjct  723   ATHSSTYTRLYKLWTEEERFLQTP-NTELINTSSSHQTKYVQNLPVEQAFTEHIEPISTT  781

Query  1531  LPP--------------LAIEGP---VQTAPTRARAV*TQHQERGHVMR----LRHMTRD  1415
             + P              + I G      T P   ++V     +  H ++      HM   
Sbjct  782   VSPNDQVPSTTQSMSQQVNISGTTTVTATEPAIDQSVSNTQTQTIHPVQGTQPTHHMQTR  841

Query  1414  TSEQFHALN----------VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP  1265
             +      +N          V  +P     A+    W  AM +E NAL HN TW LV    
Sbjct  842   SKSGIVKVNPRYACLAQYQVPPEPKSVKSALADPGWYQAMQEEMNALHHNQTWLLVPRTN  901

Query  1264  HMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSL  1085
             +MNV+GCKWVF+TK  + GS+++ KARLVAKGF+Q  G DF +TFS V+K +TVRL+ S+
Sbjct  902   NMNVIGCKWVFKTKLTSTGSLDRLKARLVAKGFHQEQGIDFTETFSPVIKHSTVRLILSV  961

Query  1084  VVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVS  947
              +  +W++ QLDV NAFL+G L ETVYM+QPPG+  P +  ++ ++
Sbjct  962   AMVKHWSMHQLDVKNAFLHGTLNETVYMEQPPGFVHPQYDQYIGLA  1007


 Score = 55.1 bits (131),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 8/150 (5%)
 Frame = -2

Query  3584  LTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptpnpA  3405
             L   NF+ W+ Q   FLR Q+L G+V+ E   P  T+         V +        NP 
Sbjct  47    LAEDNFLLWQAQFHRFLRSQDLFGFVNGEITPPARTL--------QVDEGDQTVDISNPD  98

Query  3404  YRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLGQFH  3225
             Y  WIK DQ + S +  ++S++++ L +G  T+  +W+++       S A+     G+  
Sbjct  99    YNDWIKTDQLVSSWISGAISEDILSLIIGLNTAYELWQALLNRFTQKSVAKEFELRGKLQ  158

Query  3224  YLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
               ++ + +   YL   + + + L   G P+
Sbjct  159   ACQKRDRALSTYLREYKTICDQLNAIGKPV  188



>gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1402

 Score =   168 bits (426),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 147/272 (54%), Gaps = 10/272 (4%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             ++KSD Y  F +F   VE Q +  I   Q D GGE+   K    L   GI    S  +T 
Sbjct  561   KLKSDFYNIFVAFHKLVENQLNHKISVFQCDGGGEFVNHKFLQHLQNHGIQQHISYPHTP  620

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFE-SPYTRL  1901
             +QNG  ERK+RH+VE GL++L +  V  ++W  AF  A  LIN LPTS ++   SPY +L
Sbjct  621   QQNGLAERKHRHLVELGLSMLFQSKVPLKFWVEAFFTANFLINLLPTSAVEDAISPYEKL  680

Query  1900  HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
             H+T P YT LR FGC C+P +R Y  +K + RS  CVFL Y   ++GYRC+   +G++YI
Sbjct  681   HQTTPDYTALRSFGCACFPTMRDYAMNKFDPRSLKCVFLGYNDKYKGYRCLYPPTGRVYI  740

Query  1720  CRHVHFYESIFLFSD--STLCSQPVPPTI-PW--ASEPVVTRAPCNTHAAPTDSAHMSL-  1559
              RHV F E+ + FS     L SQP  P +  W    E  V++AP     A       +L 
Sbjct  741   SRHVIFDETAYPFSHHYKHLHSQPTTPLLAAWFKGFESSVSQAPPKVSPAQPPQRKATLP  800

Query  1558  TSPVPLARGLPPLAIEGPVQTAPTRARAV*TQ  1463
             T P+  A   PPL    P Q +   A A+ +Q
Sbjct  801   TPPLFTAADFPPLPRRSP-QLSQNSAAALVSQ  831


 Score =   151 bits (381),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 123/213 (58%), Gaps = 6/213 (3%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             + QS  Y GSD + V +G  L I+  G  ++ S S  + L++VL  P ++  L SV +LT
Sbjct  349   LQQSQPYHGSDAVMVADGNFLPITHTGSTNLASSSGNVPLTDVLVCPSITKSLLSVSKLT  408

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR---ATSTVWH  2530
              +     EF  D   + D  T+ +L+ GST  GLY L       A+ ++R   A+  VWH
Sbjct  409   QDYPCTVEFDSDGVRINDKATKKLLIMGSTCDGLYCLKDDSQFKAFFSTRQQSASDEVWH  468

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKV-KSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLY  2353
             RRLGHP+  V  +++++  ++ NK  KSL    +C L K++R P    S++S   L+ ++
Sbjct  469   RRLGHPHPQVLQQLVKTNSISINKTSKSLCE--ACQLGKSTRLPFVSSSFTSNRPLERVH  526

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              D+WGP+P+ S  GFRY+ +F+D YSRF W YP
Sbjct  527   CDLWGPSPITSVQGFRYYAVFIDHYSRFSWIYP  559


 Score =   137 bits (345),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 6/163 (4%)
 Frame = -3

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +P   + A+ H  W  AM +E       +TW LV   P+M+V+G KWVFRTK +ADG++ 
Sbjct  924   EPKTVTAALKHPGWTGAMTEEMGNCSETNTWSLVPYTPNMHVLGSKWVFRTKLHADGTLN  983

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
             + KAR+VAK F Q  G  + +T+S VV+  TV+L+  L  + NW L+Q+DV NAFL+G L
Sbjct  984   KLKARIVAKCFLQEEGIGYLETYSPVVRTPTVQLVLHLATALNWELKQMDVKNAFLHGDL  1043

Query  1018  AETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              ETVYM QP G+ D + P HV +    ++YGL+      SPRA
Sbjct  1044  NETVYMTQPAGFVDKSKPTHVCLLHK-SIYGLKQ-----SPRA  1080


 Score = 65.1 bits (157),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 74/155 (48%), Gaps = 7/155 (5%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             V++ LT +N+I W++Q   FL GQ LLG+V    P P  T       G +       + +
Sbjct  15    VTVTLTAKNYILWKSQFESFLDGQGLLGFVTGSIPAPSQTSVVSDIDGST-------SAS  67

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
             PNP Y  W K D+ + S L+ S  ++++ + V   TS  VW S+       S +R     
Sbjct  68    PNPEYYTWFKTDRVVKSWLLGSFLEDILSVVVNCNTSHEVWISVANHFNRVSSSRLFELQ  127

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPIS  3132
              +   + + + S  EYL   + + + LA  G P++
Sbjct  128   RRLQNVSKRDKSMDEYLKDLKTICDQLASVGSPVT  162



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score =   180 bits (456),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 126/192 (66%), Gaps = 1/192 (1%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFD-LGGEYRKIHHTLTKLGITHRKSCAYTHE  2075
             + KS++++ F+ F+  VER F R I ++Q D  GG Y+K++    ++G+           
Sbjct  552   KYKSEVFEKFKEFQALVERMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIR  611

Query  2074  QNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHK  1895
             QNG  ERK+RHIVE GL+LL+  S+  ++WD AF  AT LIN +P+  +Q  +P  +L  
Sbjct  612   QNGSAERKHRHIVEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFN  671

Query  1894  TPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
               P Y+ LRVFGC C+P+LRPYN HK+++RS  CVFL +    +G++C++++SG++YI R
Sbjct  672   QKPDYSSLRVFGCACWPHLRPYNTHKLQFRSKQCVFLGFSTHHKGFKCLDVSSGRVYISR  731

Query  1714  HVHFYESIFLFS  1679
              V F E++F FS
Sbjct  732   DVVFDENVFPFS  743


 Score =   139 bits (350),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 123/214 (57%), Gaps = 8/214 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             ++  ++Y G + +   +GAG+ IS +GH  + + S+ +HL+NVLYVP+    L S  +L 
Sbjct  338   LTTKEKYNGGEQIHTASGAGMDISHIGHTIVHTPSRNIHLNNVLYVPQAKKNLISASQLA  397

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVW  2533
              +N+ F E H   F +KD +TR VLL G    GLY +P     S +  A   ++ + + W
Sbjct  398   ADNSAFLELHSKFFSIKDQVTRDVLLEGKCRHGLYPIPKFFGRSTNKQALGAAKLSLSRW  457

Query  2532  HRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP+  +  +V+    + P  V+S+      +C  +K+ + P  R +  S+  L+L
Sbjct  458   HSRLGHPSLPIVKQVISRNNL-PCSVESVNQSVCNACQEAKSHQLPYIRSTSVSQFPLEL  516

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +++D+WGPAP  S    +Y++ F+DD+S+F W Y
Sbjct  517   VFSDVWGPAPE-SVGRNKYYVSFIDDFSKFTWIY  549


 Score =   189 bits (479),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 6/184 (3%)
 Frame = -3

Query  1441  MRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPH  1262
             +R   +  D + ++   + T +P    +A+G   WRDAM+ E+NAL+ NDTW LV  E  
Sbjct  915   IRKEKVYTDGTVKYGCFSSTGEPQNDKEALGDKNWRDAMETEYNALIKNDTWHLVPYEKG  974

Query  1261  MNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLV  1082
              N++GCKWV++ KR ADG++++YKARLVAKGF Q  G D+ DTFS VVK  T+R++ S+ 
Sbjct  975   QNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIA  1034

Query  1081  VSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*  902
             VS  W+LRQLDV NAFL+G L E VYM+QPPG+E  + PD+V      ALYGL+      
Sbjct  1035  VSRGWSLRQLDVQNAFLHGFLEEEVYMQQPPGFESSSKPDYV-CKLDKALYGLKQ-----  1088

Query  901   SPRA  890
             +PRA
Sbjct  1089  APRA  1092


 Score = 57.4 bits (137),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 76/161 (47%), Gaps = 10/161 (6%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             H VS KL   N   W+ Q+   +RG  LLGY++ +   P   +        SV       
Sbjct  19    HSVSEKLGKANHALWKAQVSAAVRGARLLGYLNGDIKAPDAEL--------SVTIDGKTT  70

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
               PNPA+  W   DQ +L  L+SSLS +V+       T+   W SI A   + +RAR ++
Sbjct  71    TKPNPAFEDWEANDQLVLGYLLSSLSRDVLIQVATCKTAAEAWRSIEALYSTGTRARAVN  130

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPISLDEQ  3120
                     ++G     EY+ + + L +++A  GHP  LDE+
Sbjct  131   TRLALTNTKKGTMKIAEYVAKMRALGDEMAAGGHP--LDEE  169



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score =   236 bits (602),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 166/476 (35%), Positives = 238/476 (50%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  651   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAXEYFSAQFTSFMSHXGILHQSSCAHTPQQ  710

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  711   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  770

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFG  C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  771   QPLY-FLPPRVFGXTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  829

Query  1717  RHVHFYESIFLFS---DSTLCSQPVPPTIPWASEP----------------VVTRAPCNT  1595
               V F+E    FS   +S   S+ +P  IP  S P                VV   P   
Sbjct  830   XDVTFFEDSPFFSTTSESLPVSEVLP--IPIVSPPDAMPPRPLQVYHRRPRVVAXLPFP-  886

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS       P+P A   P L     +  A  +            + +    ++  
Sbjct  887   -EAPADSL------PIPSASPAPALPSPNDLPIAVRKGXRSTRNPHPIYNFLSYHRLSSP  939

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV
Sbjct  940   YSAFVSAISSVSLPKSTHEALSHPGWRQAMVDEMTALHSNGTWDLVVLPSGKSTVGCRWV  999

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L Q
Sbjct  1000  YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQ  1059

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ N FL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  1060  LDIKNVFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  1108


 Score = 82.8 bits (203),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 87/172 (51%), Gaps = 13/172 (8%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L   
Sbjct  484   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSD  543

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASR  2407
              S    +++ A   + H RLGHP+     +++        +  +L S    SC L K +R
Sbjct  544   SSPXVCISTDAPLLI-HNRLGHPSLSKFQKMVP-------RFSTLSSLPCESCQLGKHTR  595

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  596   VSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  646



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score =   238 bits (608),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 161/463 (35%), Positives = 237/463 (51%), Gaps = 35/463 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + +S+I   + +F   VE QFS+ IK+ + D   EY +      L   G  H  +C  T 
Sbjct  487   KSRSEILSIYSNFAKMVETQFSKRIKTFRSDNALEYTQHAFQALLHSYGTIHHPTCPGTS  546

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNGR ERK RHI++T  ALL    +   +W  A   A   IN +P++V+  ++PY RL 
Sbjct  547   QQNGRAERKLRHILDTVRALLLSAKIPAPFWGEASLHAVHAINRIPSAVIHNQTPYERLF  606

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+P+  +K+E +S  C FL Y  + +GYRC +  S ++ + 
Sbjct  607   GSPPNYHHLRSFGSACFVLLQPHEHNKLEPQSRLCCFLGYGETQKGYRCYDPVSHRLRVS  666

Query  1717  RHVHFYESIFLFS----DSTLCSQPVPPTIPWAS--------EPVVTRAPCNTHAAPTDS  1574
             R+V F+E           S+L +  V    P  S        +P +  +P     +P   
Sbjct  667   RNVVFWEHRLFVELSHFRSSLTNSSVLEIFPDESIVPSTNTFDPHLDFSPDIFDVSPRQV  726

Query  1573  AHMSLTSPVP-LARGLP-PLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ-  1403
             A   +   +P    G P P   E P Q  P R            H  R+R +     +  
Sbjct  727   ADEQINHELPHFEPGSPAPTLPEDPPQDIPPR------------HSTRVRSIPPHLLDYH  774

Query  1402  -FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRT  1226
              + AL    +P  Y +A     W+ AM +E +AL  N TW LV   P  +VVGCKW+++ 
Sbjct  775   CYTALATLYEPQTYREASTDPLWQIAMKEELDALTKNHTWDLVTLPPGQSVVGCKWIYKI  834

Query  1225  KRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDV  1046
             K  +DGS+E+YKARLVAKGF Q  G D+ +TF+ V + ++VR L ++  +  W L Q+DV
Sbjct  835   KTRSDGSVERYKARLVAKGFTQEYGIDYEETFAPVARISSVRALLAVAAARKWDLFQMDV  894

Query  1045  HNAFLNGHLAETVYMKQPPGYE-DPTHPDHVRVSSSTALYGLR  920
              N FLNG L+E VYM+ PPG   +     H++     ALYGL+
Sbjct  895   KNVFLNGDLSEEVYMQPPPGLSVESNKVCHLQ----RALYGLK  933


 Score = 80.9 bits (198),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = -1

Query  2538  VWHRRLGH-PNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
             +WH RLGH P++ VQ  V  S  +  +  K     TSC L K    P +     SK++ +
Sbjct  392   LWHSRLGHAPSSRVQQLV--SRGLLGSVSKDNFDCTSCQLGKQPALPFNNSESISKSIFE  449

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             L+++D+WGP PV S  G RYF++F+DDYSR+ W +P
Sbjct  450   LIHSDVWGPFPVASIGGSRYFVVFIDDYSRYSWIFP  485



>ref|XP_010038745.1| PREDICTED: uncharacterized protein LOC104427339 [Eucalyptus grandis]
Length=878

 Score =   284 bits (726),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 249/466 (53%), Gaps = 48/466 (10%)
 Frame = -3

Query  2203  VERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRHIVET  2030
             V+ Q +  IK +Q D GGE+   K    L   GI    SC YT EQNG  ERK+RHIVE 
Sbjct  356   VKNQHNCKIKKLQCDGGGEFVSHKFKAHLQLYGIQQLISCPYTPEQNGIPERKHRHIVEL  415

Query  2029  GLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGCRC  1850
             GLA+L    V  + W  AF  A  ++N LPT  L+ +SP+ +L +  P Y  LRVFGC  
Sbjct  416   GLAMLYHAKVPLKCWVDAFMTANYIVNILPTPKLKMQSPFAKLCQHKPRYDHLRVFGCAY  475

Query  1849  YPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSD--  1676
             YPYLRPY +HK++ +S  CVFL Y    +GYRCM  T+G +YI RHV F E+ F FS   
Sbjct  476   YPYLRPYAQHKMDPQSLTCVFLGYNTHHKGYRCMVPTTGHVYISRHVIFDETFFPFSKKL  535

Query  1675  STLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMS-----------LTSPV-PLARG  1532
             +T  S        W  E    + P +T    T S+H +           LT  + P++  
Sbjct  536   ATYSSTYTHLYKLWTEEERFLQTP-STELINTSSSHQTRYVQNPPTEQVLTEHIDPISTT  594

Query  1531  L--------------PPLAIEGPVQTAPTR------ARAV*TQ--HQERG----HVMRLR  1430
             +              P + I G      T          + TQ  H  +G    H M+ R
Sbjct  595   ILPDDQVPSTTQSISPQVNISGTTTVTATEPAIDQNVSNIQTQSIHSVQGTQPTHHMQTR  654

Query  1429  HMTR--DTSEQFHAL---NVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEP  1265
               +     + Q+  L    V  +P     A+  L W  AM +E NAL HN TW LV    
Sbjct  655   SKSSIVKVNPQYACLAQYQVPPEPKSIKSALADLGWYQAMQEEMNALHHNQTWLLVPRTN  714

Query  1264  HMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSL  1085
             +MNV+GCKWVF+ K  + GS+++ KARLVAKGF+Q  G DF +TFS V+K  TVRL+ S+
Sbjct  715   NMNVIGCKWVFKAKLTSTGSLDRLKARLVAKGFHQEEGIDFTETFSPVIKHATVRLILSI  774

Query  1084  VVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVS  947
              +  +W++ QLDV NAFL+G L ETVYM+QPPG+  P +  ++ ++
Sbjct  775   AMVKHWSIHQLDVKNAFLHGTLNETVYMEQPPGFVHPQYSQYIGLA  820


 Score = 68.6 bits (166),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 78/156 (50%), Gaps = 8/156 (5%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             +FV+I+L   NF+ W+ Q   FLR Q+L G+V+ ETP P  T+      GD         
Sbjct  18    NFVTIRLAEDNFLLWQAQFHRFLRSQDLFGFVNGETPSPAKTLQ--VEEGDQT------V  69

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
               PNP Y  WIK DQ + S +  ++S++++ L +G  T+  +W+++       S A+   
Sbjct  70    DIPNPDYNDWIKTDQLVSSWISGAVSEDILSLIIGLNTAYELWQALLNRFTQKSVAKEFE  129

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
               G+    ++ + +   YL   + + + L   G P+
Sbjct  130   LRGKLRACQKRDRALSTYLREYKTICDQLNAIGKPV  165



>emb|CAN67588.1| hypothetical protein VITISV_036280 [Vitis vinifera]
Length=1379

 Score =   289 bits (739),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 187/435 (43%), Positives = 234/435 (54%), Gaps = 51/435 (12%)
 Frame = -3

Query  2095  SCAYTHEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFES  1916
             SC YT  QNGR ERK+RH+ ETGLALL    V  QYW  AF  AT +IN LP  VL   S
Sbjct  2     SCPYTPSQNGRAERKHRHVTETGLALLFHSHVPPQYWVDAFSTATYIINRLPLPVLGGLS  61

Query  1915  PYTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTS  1736
             P+  L    P Y     FGCR YP LR Y  HK   RS PC+FL Y  S +G+RC + T+
Sbjct  62    PFEVLFGKSPNYENFHPFGCRVYPCLRDYAPHKFSPRSLPCIFLGYSSSHKGFRCFDTTT  121

Query  1735  GKIYICRHVHFYESIFLFSDSTLCS-----------QP----------------VPPTIP  1637
              + YI RH  F E  F FS+++  +           +P                VPP+ P
Sbjct  122   SRTYITRHARFDEHFFPFSNTSSATSIADIGLSNFFEPCALEPSPSTSSPTTTRVPPSPP  181

Query  1636  -------WASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL-ARGLPPLAIEGPVQTAPTRA  1481
                    +A EP+   +     +AP  ++  +  SPVP  A  L P A   P+    T  
Sbjct  182   CHFCADDFAVEPLQVSS-----SAPESTSSSAAVSPVPASATTLVPFA--APMDPIHTTT  234

Query  1480  RAV*TQH----QERGHVMRLRHMTR----DTSEQFHALNVTTDPTCYSQAVGHL*WRDAM  1325
              A    H    + +  + + RH        +S   HAL  T++P  +  A  +  W  AM
Sbjct  235   SAAPASHPMITRAKSGIFKPRHPAHLSFVQSSPLIHALLATSEPKGFKSAAKNPAWLAAM  294

Query  1324  DQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDD  1145
             D +  AL  N TW LV    + N+VG KWVFRTK  + GSIE++KARLVAKG+ Q+ G D
Sbjct  295   DDKIKALQTNHTWDLVPRPSNTNIVGSKWVFRTKFLSYGSIERFKARLVAKGYTQLPGLD  354

Query  1144  FFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHP  965
             + DTFS VVK +TVR++ SL VSH W LRQLDV NAFLNG L ETVYM+QP GY DP HP
Sbjct  355   YKDTFSPVVKASTVRVVLSLAVSHKWPLRQLDVKNAFLNGILHETVYMEQPLGYVDPRHP  414

Query  964   DHVRVSSSTALYGLR  920
              HV      ALYGL+
Sbjct  415   LHV-CKLKKALYGLK  428



>dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. russellianum]
Length=1591

 Score =   224 bits (571),  Expect(2) = 7e-77, Method: Compositional matrix adjust.
 Identities = 174/541 (32%), Positives = 243/541 (45%), Gaps = 106/541 (20%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R KS++   F  F   +  Q+S +I+ ++ D GGEY    +       GI H+ +C  T 
Sbjct  711   RHKSEVATKFVEFYHMIHTQYSSTIQILRTDNGGEYFAGALQQFFRDNGIIHQTTCPDTP  770

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNG  ERK R ++E   AL+ E SV +  W  A   AT L N LPT  L  ++P   L 
Sbjct  771   EQNGVAERKNRTLLEMTRALMLESSVPRFLWPEAVSTATYLSNRLPTVTLNHQTPLDVLA  830

Query  1897  K--------TPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNL  1742
                      T PP    +VFGC  + ++   +R K++  +  CVF+ Y  + +GYRC N 
Sbjct  831   SQTLIPSLLTLPP----KVFGCTVFIHISKTHRDKLDPCAEKCVFVGYASTQKGYRCYNP  886

Query  1741  TSGKIYICRHVHFYESIFLFSDSTLCSQPVP--------PTIPWAS--------EPVVTR  1610
              + +I++  +  F E+ F F         +         P + W+         EP  T 
Sbjct  887   RTRQIHVTLNCVFLETEFFFGTHPRSQGEIATDGYLDWLPNLSWSVADPTRQVVEPACTI  946

Query  1609  APC-NTHAAP---------------TDSAHMSLTSPVPLA--------------------  1538
             AP  N  + P                +S H    SPVP +                    
Sbjct  947   APSDNMDSIPVPTNDIPRENVLQQVNESIHDDTGSPVPFSSPPFVPNTTLDDSLTTSIAI  1006

Query  1537  ------------------RGLPPLAIEG--PVQTAPTR-ARA----V*TQHQERGHVMRL  1433
                               R LPP    G  P + +PT+ ARA    V T  +  GH  + 
Sbjct  1007  PDPSSELDHTNPCVKEQGRTLPPRKTRGVPPDRYSPTKIARATLYPVSTSRKNLGHAAKA  1066

Query  1432  RHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNV  1253
                T+  SE+         P    +A     WRDAM  E +AL  N+TW+     P    
Sbjct  1067  -FFTQICSEKI--------PRTVDEACSQSNWRDAMIMEMDALNKNNTWERCQLPPGKRT  1117

Query  1252  VGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSH  1073
             VGC+WVF  K  ADG+IE++KARLVAKG+ Q  G D+ +TFS V +  T+R+LF++  + 
Sbjct  1118  VGCRWVFTVKYKADGTIERHKARLVAKGYTQTYGVDYSETFSPVARIDTIRVLFAIAATE  1177

Query  1072  NWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPR  893
             NW L Q DV NAFL+G L E V+M  PPG+     P  V    + ALYGL+      SPR
Sbjct  1178  NWPLHQFDVKNAFLHGTLKEEVFMDPPPGFSKEFLPGQV-CKLNRALYGLKQ-----SPR  1231

Query  892   A  890
             A
Sbjct  1232  A  1232


 Score = 94.4 bits (233),  Expect(2) = 7e-77, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 94/184 (51%), Gaps = 25/184 (14%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             + L N L VP LS  L S+ +LT   +     +    +++D  T+A++ RG+ +GGLY +
Sbjct  537   ITLQNCLLVPSLSTKLLSISQLTKALDCVVLMYPSFCLLQDIRTQAIIGRGTENGGLYYV  596

Query  2589  PVSRSHFAYLTSRATST----VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT----  2434
                  H +   +  T T    +WHRRLGHP+     ++            +L SRT    
Sbjct  597   DAVVQHGSSNLATGTVTRQIWLWHRRLGHPSFSYLQKLF----------PTLFSRTLPPL  646

Query  2433  SCHLSKASRFPLDRVSYSSKN-----VLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRF  2269
             +C     ++ P  R +Y S N     V  L+++D+WGP+P  +  GF+YF++FVDD SR 
Sbjct  647   TCDTCLRAKQP--RATYRSNNTRVNKVFSLIHSDVWGPSPHSTPCGFKYFVIFVDDCSRM  704

Query  2268  CWFY  2257
              W Y
Sbjct  705   TWLY  708



>dbj|BAB10876.1| polyprotein [Arabidopsis thaliana]
Length=1429

 Score =   181 bits (459),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 134/231 (58%), Gaps = 15/231 (6%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +   F +F+  VE +F   I+++  D GGE+  +   L   GI+H  S  +T E 
Sbjct  545   KQKSQVKDVFVAFKALVENRFQSRIRTLYSDNGGEFIGLRPFLAAHGISHLTSPPHTPEH  604

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGLALL   S+ + +W +AF  A  LIN +PT VLQ  SPY +L + 
Sbjct  605   NGLAERKHRHIVETGLALLTHASLPKTFWTYAFATAVYLINRMPTEVLQGTSPYVKLFQM  664

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC CYP+LRPYN +K+E RS  CVFL Y  +   Y C+++ + +IY  RH
Sbjct  665   SPNYLKLRVFGCLCYPWLRPYNTNKLEARSTMCVFLGYSLTQSAYLCLDIATNRIYTSRH  724

Query  1711  VHFYESIFLFS-------DST-LCSQPVPPTIPWASEPVVTRAPCNTHAAP  1583
             V F ES F F+       DST   SQP    +     P++ R P   H AP
Sbjct  725   VQFVESSFPFASPRTSETDSTQTMSQPTTTNV----IPLLQRPP---HIAP  768


 Score =   137 bits (344),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 117/215 (54%), Gaps = 8/215 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG + + + +G+GL IS  G A +P+ S+ L L ++LYVP +S  L SVYRL 
Sbjct  331   LSMHQPYTGGEEVTIADGSGLPISHTGSALLPTPSRSLALKDILYVPNVSKNLISVYRLC  390

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTV----W  2533
             N N V  EF    F VKD  T A LL+G T   LY  PV++     LT+  +       W
Sbjct  391   NANQVSVEFFPAHFQVKDLNTGARLLQGRTRNELYEWPVNQKSITILTASPSPKTDLSSW  450

Query  2532  HRRLGHPNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H+RLGHP   +   V+     P++    K L   + C ++K+ + P    +  S   L+ 
Sbjct  451   HQRLGHPALPILKDVVSHFHLPLSNTIPKQLPC-SDCSINKSHKLPFFTNTIVSSQPLEY  509

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             LYTD+W  +P IS   ++Y+L+ VD ++R+ W YP
Sbjct  510   LYTDVWT-SPCISVDNYKYYLVIVDHFTRYTWMYP  543


 Score =   160 bits (404),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 104/155 (67%), Gaps = 3/155 (2%)
 Frame = -3

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
             T PT  +QA+    WR+AM +E NA + N TW LV  E   +V+ CKW+F  K N DGSI
Sbjct  919   TIPTTVAQALKDPNWRNAMSEEINAQMKNHTWDLVSPEEAKHVISCKWIFTLKYNVDGSI  978

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
              +YKARLVA+GFNQ  G D+ +TFS V+K TT+R +  + V  NW++ Q+D++NAFL G 
Sbjct  979   ARYKARLVARGFNQQYGIDYSETFSPVIKSTTIRTVLEVAVKRNWSIHQVDINNAFLQGT  1038

Query  1021  LAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             L E VY+ QPPG+ D   P HV R++   ALYGL+
Sbjct  1039  LNEEVYVSQPPGFIDRDRPSHVCRLNK--ALYGLK  1071



>emb|CAB10225.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
 emb|CAB78488.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
Length=1489

 Score =   246 bits (627),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 165/507 (33%), Positives = 230/507 (45%), Gaps = 64/507 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R K D+   F  F   V  QF+  IK+I+ D   E       + + G+ H  SCAYT +Q
Sbjct  672   RNKKDVSSVFPEFIKLVSTQFNAKIKAIRSDNAPEL-GFTEIVKEHGMLHHFSCAYTPQQ  730

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    ALL + ++  QYW      A  LIN LP+ +L  +SPY  +   
Sbjct  731   NSVVERKHQHILNVARALLFQSNIPMQYWSDCVTTAVFLINRLPSPLLNNKSPYELILNK  790

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ L+ FGC C+     + R K   R+  CVFL YP  ++GY+ ++L S  + + R+
Sbjct  791   QPDYSLLKNFGCLCFVSTNAHERTKFTPRARACVFLGYPSGYKGYKVLDLESHSVTVSRN  850

Query  1711  VHFYESIFLFSDSTLCSQ----------PVPP------TIPWASE---------------  1625
             V F E +F F  S L ++          P+P       T+P   E               
Sbjct  851   VVFKEHVFPFKTSELLNKAVDMFPNSILPLPAPLHFVETMPLIDEDSLIPTTTDSRTADN  910

Query  1624  ---------PVVTRAPCNTHAAPTDSAHMSLT-----------------SPVPLARGLPP  1523
                      P +     NT     DS  + +T                 S VP    LPP
Sbjct  911   HASSSSSALPSIIPPSSNTETQDIDSNAVPITRSKRTTRAPSYLSEYHCSLVPSISTLPP  970

Query  1522  LAIEGPVQTAP---TRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAV  1352
                  P+   P   T +    T       V+     T        A N  T+P  +SQA+
Sbjct  971   TDSSIPIHPLPEIFTASSPKKTTPYPISTVVSYDKYTPLCQSYIFAYNTETEPKTFSQAM  1030

Query  1351  GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAK  1172
                 W     +E  A+  N TW +    P  NVVGCKWVF  K N DG++E+YKARLVA+
Sbjct  1031  KSEKWIRVAVEELQAMELNKTWSVESLPPDKNVVGCKWVFTIKYNPDGTVERYKARLVAQ  1090

Query  1171  GFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQP  992
             GF Q  G DF DTFS V K T+ +++  L     WTL Q+DV +AFL+G L E ++M  P
Sbjct  1091  GFTQQEGIDFLDTFSPVAKLTSAKMMLGLAAITGWTLTQMDVSDAFLHGDLDEEIFMSLP  1150

Query  991   PGYEDPTH---PDHVRVSSSTALYGLR  920
              GY  P     P +       ++YGL+
Sbjct  1151  QGYTPPAGTILPPNPVCRLLKSIYGLK  1177


 Score = 72.4 bits (176),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 81/183 (44%), Gaps = 34/183 (19%)
 Frame = -1

Query  2778  SKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGL  2599
             ++ L L NVL+VP     L SV  L    +    F+ DC ++++     ++ RG     L
Sbjct  512   TQKLILHNVLHVPDFKFNLMSVSSLVKTISCSAHFYVDCCLIQELSQGLMIGRGRLYHNL  571

Query  2598  YRLPVSRSHFAYLTSRA---TSTV------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSL  2446
             Y L    +  +  T  A   T +V      WH+RLGHP++ V  ++ +   ++ N + S 
Sbjct  572   YILETENTSPSTSTPAACLFTGSVLNDGHLWHQRLGHPSSVVLQKLKRLAYISHNNLAS-  630

Query  2445  GSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFC  2266
                                     N  DL++ DIWGP  + S  GFRYFL  VDD +R  
Sbjct  631   ------------------------NPFDLVHLDIWGPFSIESIEGFRYFLTVVDDCTRTT  666

Query  2265  WFY  2257
             W Y
Sbjct  667   WVY  669



>emb|CAN71185.1| hypothetical protein VITISV_014270 [Vitis vinifera]
Length=1024

 Score =   233 bits (594),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 164/460 (36%), Positives = 238/460 (52%), Gaps = 26/460 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  269   RAELFSIFQKFYXEIQTQFNISIRVLRSDNAREYFSAPFTSFMSHHGILHQSSCAHTPQQ  328

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   +L  G+V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  329   NGVAERKNRHLVETARTILLHGNVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  388

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  389   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  447

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRA---PCNTHAAPTDSAHMSLTSPV  1547
               V F+E    FS +T  S PV   +P    P+V+ +   P     AP DS      SP 
Sbjct  448   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPSDAMPPRPLQAPADSLPTPXASPA  503

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTC  1367
             P       L I     T  TR            + +    ++   S    A++  + P  
Sbjct  504   PALPSPDDLPIAIRKGTRSTR------NPHPIYNFLSYHRLSSPYSAFVSAISSVSLPKS  557

Query  1366  YSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
               +A+ H  WR  M  E  AL    TW LV+     + VGC+WV+  K   DG +++ KA
Sbjct  558   THEALSHPGWRQXMMDEMAALHSTXTWDLVVLPSGKSTVGCRWVYAVKVGXDGQVDRLKA  617

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLVAKG+ QV G D+ +TFS V K  +VRLL S+    +W L QLD+ NAFL+G L E V
Sbjct  618   RLVAKGYTQVYGSDYGETFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDLXEEV  677

Query  1006  YMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             YM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  678   YMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  710


 Score = 85.1 bits (209),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ +LT   N    F      ++D  T   +  G  S GLY L  S
Sbjct  102   TSVLYTPECPFNLISISKLTRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  160

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  161   DSSAAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  209

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  210   KHTRVSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  264



>gb|AAD14478.1| Strong similarity to gb|AF039376 Evelknievel retrotransposon 
polyprotein from Arabidopsis arenosa [Arabidopsis thaliana]
Length=1194

 Score =   178 bits (451),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 119/195 (61%), Gaps = 0/195 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +   F +F+  V  +F R I  +  D GGE+  +   L+  GITH  +  +T E 
Sbjct  519   KQKSHVKDVFMTFKALVANKFQRKIIHLYSDNGGEFIALRSFLSSNGITHLTTPPHTPEH  578

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL + S+ + YW +AF +A  LIN + + V+   SPY RL   
Sbjct  579   NGISERKHRHIVETGLTLLGQASMPKSYWSYAFTIAIYLINRMSSDVIGGISPYKRLFGQ  638

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVFGC C+P+LRPY  HK++ R APCVFL Y  +   Y C+N T+G++Y  RH
Sbjct  639   APNYLKLRVFGCLCFPWLRPYTTHKLDDRPAPCVFLGYSQTQSAYLCLNRTTGRVYTSRH  698

Query  1711  VHFYESIFLFSDSTL  1667
             V F E+ + F+  TL
Sbjct  699   VQFVENTYPFTKPTL  713


 Score =   138 bits (348),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 119/215 (55%), Gaps = 8/215 (4%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    YTG + + + +G+GL IS  G A I + S+ L L++VLYVP +   L SVYR+ 
Sbjct  305   LSLHQPYTGGEDVTIADGSGLSISHTGSALISTPSRSLALTDVLYVPNIHKNLISVYRMC  364

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS----RSHFAYLTSRATSTVW  2533
             N N V  EF    F VKD  T   LL+G T   LY  PV+     SHF   T +   T W
Sbjct  365   NANKVSVEFFPAHFQVKDLKTGVQLLQGRTKDELYEWPVNPPKPSSHFTTTTPKTDLTSW  424

Query  2532  HRRLGHPNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             H RLGHP+      V+   S PV+ N ++   + + C L+K  + P    + +S   L+ 
Sbjct  425   HSRLGHPSLSTLKVVVSQFSLPVS-NSLQKQFNCSDCLLNKTHKLPFHTNTITSTQPLEY  483

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             LY D+W  +P++S   F+Y+L+ VD Y+R+ WFYP
Sbjct  484   LYIDLWT-SPIVSIDNFKYYLVIVDHYTRYSWFYP  517


 Score =   156 bits (394),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = -3

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             PT  ++A+    WR+AM +EFNA L N T+ LV  +PH N VG +W+F  K N DGSI +
Sbjct  899   PTTVAEALRDPNWRNAMSEEFNAGLRNSTYDLVPPKPHQNFVGTRWIFTIKYNPDGSINR  958

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             YKAR +AKGF+Q  G D+ +TFS V+K TTV+ +  + VS +W +RQLD++NAFL G L 
Sbjct  959   YKARFLAKGFHQQHGLDYSNTFSPVIKSTTVQTVLDIAVSRSWDIRQLDINNAFLQGRLT  1018

Query  1015  ETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             E VY+ QPPG+ +P  P++V      AL+GL+
Sbjct  1019  EDVYVAQPPGFINPDRPNYV-CHLKKALHGLK  1049



>ref|XP_008674202.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Zea mays]
Length=756

 Score =   238 bits (607),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 171/469 (36%), Positives = 238/469 (51%), Gaps = 32/469 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S++   +++F   +  QFS  IK+ + D GGEY        LT  G   + SC   H Q
Sbjct  174   RSELISIYKTFARMIHTQFSTHIKTFRSDSGGEYLSDNFRQFLTSEGTLAQLSCPGAHAQ  233

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHI+ET   LL    V   +W  A   A  LIN  P+S L  ++P   L  T
Sbjct  234   NGVAERKHRHIIETARTLLISSFVPSHFWGEAVSTAVYLINRQPSSKLSGKTPGEVLFGT  293

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LRVFGC CY  L P  R K+  +S  CVFL Y P  +GYRC + +S ++ I R 
Sbjct  294   PPRYDHLRVFGCTCYVLLSPRERTKLTAQSVECVFLGYSPEHKGYRCYDSSSRRMRISRD  353

Query  1711  VHFYESI-FLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR  1535
             V F E+  F ++ ST  S     +  + S P ++     +    +    +   +P   + 
Sbjct  354   VSFNENRPFFYNSSTHSSFYSTESTSFMSLPPISETSSVSPPTVSTPDVLIPITPPSTST  413

Query  1534  GLPPLAIEGPV-QTAPTRARAV*TQHQE-------------------RGHVMRLRHMTRD  1415
               P  + + PV QT   R R+  T   +                   +G+ +R R  T  
Sbjct  414   TSPSYSSKPPVTQTYIRRPRSTPTASPDDDPVADTCTNNDDSHVVFNQGYHLRDRG-TIA  472

Query  1414  TSEQF---HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGC  1244
               E++    A  V  +P+ Y +A G   W+ AM  E NAL    TW +V     +  + C
Sbjct  473   APERYGFSRAGAVIAEPSSYKEASGIPEWQLAMTDELNALHRTCTWDVVPLPAGVVPITC  532

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWT  1064
             KWVF+ K  +DGSIE+YKARLVA+GF Q  G D+ +TF+ V   TTVR L ++  S +WT
Sbjct  533   KWVFKVKTKSDGSIERYKARLVARGFQQTQGIDYDETFAPVAHLTTVRALLAVAASSSWT  592

Query  1063  LRQLDVHNAFLNGHLAETVYMKQPPGYEDPT-HPDHVRVSSSTALYGLR  920
             + Q+DV NAFL+G L E VYM  PPG E P+ H   +R     ALYGL+
Sbjct  593   ISQMDVKNAFLHGDLHEEVYMHPPPGIEVPSGHVCRLR----RALYGLK  637


 Score = 78.2 bits (191),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = -1

Query  2568  AYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRV  2389
             A L S A+   WH RLGH      + +++S  +    V+S      CHL K  + P    
Sbjct  66    ATLASVASFAQWHHRLGHLCGSRLSTLIKSGCLGHTSVESDFHCKGCHLGKQIQLPYFTS  125

Query  2388  SYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                S    DL+++DIWGPAP +S  G++Y+++F+DD+SR+ W Y
Sbjct  126   HSHSVQPFDLVHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWIY  169



>gb|AAK43485.1|AC084807_10 polyprotein, putative [Arabidopsis thaliana]
 dbj|BAH30336.1| hypothetical protein [Arabidopsis thaliana]
Length=1459

 Score =   178 bits (452),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 94/220 (43%), Positives = 132/220 (60%), Gaps = 4/220 (2%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS +  TF +F+  VE +F   I+++  D GGE+  +   L   GI+H  S  +T E NG
Sbjct  570   KSQVKATFIAFKALVENRFQAKIRTLYSDNGGEFIALRDFLVSNGISHLTSPPHTPEHNG  629

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVETGL LL + SV ++YW +AF  A  LIN +PT VL  +SP+ +L  + P
Sbjct  630   LSERKHRHIVETGLTLLTQASVPREYWTYAFATAVYLINRMPTPVLCLQSPFQKLFGSSP  689

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P+LRPY R+K+E RS  CVFL Y  +   Y C+++ + ++Y  RHV 
Sbjct  690   NYQRLRVFGCLCFPWLRPYTRNKLEERSKRCVFLGYSLTQTAYLCLDVDNNRLYTSRHVM  749

Query  1705  FYESIFLFSDS----TLCSQPVPPTIPWASEPVVTRAPCN  1598
             F ES + F+ S    +  S   PP    +S P  +  PC+
Sbjct  750   FDESTYPFAASIREQSQSSLVTPPESSSSSSPANSGFPCS  789


 Score =   137 bits (346),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 120/218 (55%), Gaps = 14/218 (6%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             +S    Y G + + + +G GL I + G   +PS+++ L L  VLYVP +   L SVYRL 
Sbjct  354   LSLHQPYNGGEYVMIADGTGLTIKQTGSTFLPSQNRDLALHKVLYVPDIRKNLISVYRLC  413

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATSTVW  2533
             N N V  EF    F VKD  T  +LL+G T   LY  PV+     + F   + + T + W
Sbjct  414   NTNQVSVEFFPASFQVKDLNTGTLLLQGRTKDDLYEWPVTNPPATALFTSPSPKTTLSSW  473

Query  2532  HRRLGHPNAHVQNRVLQ--SCPV---APNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNV  2368
             H RLGHP+A + N +L   S PV   + NK     S + C ++K+ + P    S  S + 
Sbjct  474   HSRLGHPSASILNTLLSKFSLPVSVASSNKT----SCSDCLINKSHKLPFATSSIHSSSP  529

Query  2367  LDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             L+ ++TD+W  +P+IS   ++Y+L+ VD Y+R+ W YP
Sbjct  530   LEYIFTDVWT-SPIISHDNYKYYLVLVDHYTRYTWLYP  566


 Score =   158 bits (399),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 3/155 (2%)
 Frame = -3

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
             ++P   +QA+    WR AM  EF+A   N TW LV   P  ++VGC+WVF+ K   +G I
Sbjct  948   SEPNTVTQALKDKKWRFAMSDEFDAQQRNHTWDLVPPNPTQHLVGCRWVFKLKYLPNGLI  1007

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             ++YKARLVAKGFNQ  G D+ +TFS V+K TT+R++  + V  NW L+QLDV+NAFL G 
Sbjct  1008  DKYKARLVAKGFNQQYGVDYAETFSPVIKATTIRVVLDVAVKKNWPLKQLDVNNAFLQGT  1067

Query  1021  LAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             L E VYM QPPG+ D   P HV R+    A+YGL+
Sbjct  1068  LTEEVYMAQPPGFVDKDRPSHVCRLRK--AIYGLK  1100



>emb|CAN75900.1| hypothetical protein VITISV_033582 [Vitis vinifera]
Length=1041

 Score =   230 bits (586),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 162/461 (35%), Positives = 238/461 (52%), Gaps = 33/461 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   E      T  ++  GI H+ SCA+T +Q
Sbjct  265   RAELFSIFQKFYAEIQTQFNISIRVLRSDNARECFSAPFTSFMSHHGILHQSSCAHTPQQ  324

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  RH+VET   +L   +V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  325   NGVAERNNRHLVETAXTILLHSNVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  384

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  385   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  443

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
               V F+E    FS +T  S PV   +P    P+V+         P D+       P+ + 
Sbjct  444   ADVTFFEDSPFFS-TTSESLPVXEVLPI---PIVS---------PPDAMP---PRPLQVY  487

Query  1537  RGLPPLAIEGPVQTAPTRARAV*TQHQERGH----VMRLRHMTRDTSEQFHALNVTTDPT  1370
                PP+    P   AP  A    T+     H     +    ++   S    A++  + P 
Sbjct  488   HRRPPVVAPLPFAEAPAIAVRKGTRSTRNPHPIYNFLSYHRLSSPYSAXVSAISSXSLPK  547

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
                +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ K
Sbjct  548   STHEALSHPSWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRLK  607

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVAKG+ QV G D+  TFS V K  +VRLL S+    +W L QLD+ NAFL+G LAE 
Sbjct  608   ARLVAKGYTQVYGSDYGGTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDLAEE  667

Query  1009  VYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  668   VYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  701


 Score = 85.9 bits (211),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 87/172 (51%), Gaps = 13/172 (8%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ +LT+  N    F      ++D  T   +  G  S GLY L + 
Sbjct  98    TSVLYTPECPFNLISISKLTHTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTLD  157

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASR  2407
              S  A   S     + H RLGHP+     +++        +  +L S    SC L K +R
Sbjct  158   SSA-AVCISIDAPLLIHNRLGHPSLSKFQKMVP-------RFSTLSSLPCESCQLGKHTR  209

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L+YTD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  210   VLFP-KRLNNRAKSPFELVYTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  260



>emb|CAN74286.1| hypothetical protein VITISV_036410 [Vitis vinifera]
Length=1262

 Score =   234 bits (598),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 166/460 (36%), Positives = 232/460 (50%), Gaps = 49/460 (11%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  533   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  592

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  593   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  652

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  653   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  711

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT---RAPCNTHAAPTDSAHMSLTSPV  1547
               V F+E    FS +T  S PV   +P    P+V+     P     AP DS       P+
Sbjct  712   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPDAMPPRPLQAPADSL------PI  761

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTC  1367
             P A   P L     +  A                   +R  TR T       N       
Sbjct  762   PSASPAPALPSPNDLPIA-------------------VRKGTRSTRNPHPIYNFFDT---  799

Query  1366  YSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
               +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ KA
Sbjct  800   -HEALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRLKA  858

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QL + N FL+G LAE V
Sbjct  859   RLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMXAMCSWPLYQLXIKNVFLHGDLAEEV  918

Query  1006  YMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             YM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  919   YMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  951


 Score = 80.1 bits (196),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P     L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  366   TSVLYTPXCPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  424

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASR  2407
              S  A   S       H RLGHP+    ++  +  P    +  +L S    SC L K +R
Sbjct  425   DSSPAVCISTDAPLXIHNRLGHPSL---SKFXKMVP----RFSTLSSLPCESCQLGKHTR  477

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L++ D+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  478   VSFP-KRLNNRAKSPFELVHXDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  528



>emb|CAN71132.1| hypothetical protein VITISV_007235 [Vitis vinifera]
Length=1259

 Score =   219 bits (559),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 160/462 (35%), Positives = 227/462 (49%), Gaps = 45/462 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F +F   ++ Q+  S+K ++ D G EY      + ++  GI H+ SC  T  Q
Sbjct  534   RSEVFSHFCAFXAEIKTQYDVSVKILRSDNGKEYVSNSFQNYMSHNGILHQTSCVDTPSQ  593

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH++ET  AL+ +  V +Q+W  A   A  LIN +PT VL+ + PY  +H  
Sbjct  594   NGVAERKNRHLLETXRALMFQMKVPKQFWADAVSTACFLINXMPTVVLKGDIPYKVIHPQ  653

Query  1891  PPPYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                +    R+FGC CY    RP+   K++ ++  CVFL Y    +GYRC +    K  + 
Sbjct  654   KSLFPLEPRIFGCTCYVRDTRPFXT-KLDPKALQCVFLGYSRLQKGYRCFSPDLNKYLVS  712

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDS----AHMS-LTS  1553
               V F E    FS  T  S        W    VV   P    ++  DS    AH+  L++
Sbjct  713   TDVVFSEDTSFFSSPT--SSASEEDEEWLVYQVVNSRPTVGQSSVVDSDASLAHLGVLSA  770

Query  1552  PVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDP  1373
             PV                T P  A +      +    + LR             +  + P
Sbjct  771   PVT-------------TDTCPAPAPSSSDPSSDLDLSISLRK------------DSISVP  805

Query  1372  TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQY  1193
                ++A+ H  W++A  +E  AL  N TWKLV       VVGCKWVF  K N DGS+ + 
Sbjct  806   KTVTEALNHPGWKNAXLEEIYALEDNHTWKLVDSPQGKKVVGCKWVFAVKVNPDGSVARL  865

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             KARLVA G+ Q  G D+ DTFS V K  +VRL  S+  S  W + QLD+ NAFL+G L E
Sbjct  866   KARLVAXGYAQTYGVDYSDTFSPVAKLNSVRLFISIAASQXWMIHQLDIKNAFLHGXLEE  925

Query  1012  TVYMKQPPGYEDPTHPDHVRVSS-STALYGLRGVKMG*SPRA  890
              VY++QPPG+      ++ +V     ALYGL+      SPRA
Sbjct  926   EVYLEQPPGF--VAQGEYXKVCRLKKALYGLKQ-----SPRA  960


 Score = 95.1 bits (235),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 101/195 (52%), Gaps = 9/195 (5%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCF  2659
             V +G+   I   G    P+ S  + LS+VL +P L+  L SV +LT   N    F  D  
Sbjct  343   VADGSTYEIKASGTVK-PTSS--ITLSSVLNLPNLAFNLISVSKLTKNLNCSVSFFPDHC  399

Query  2658  IVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQS  2479
             + +D +T+    +G  S GLY L           S A+    H RLGHP   V  ++   
Sbjct  400   VFQDLMTKRTFGKGHVSDGLYILDEWVPRPVACVSTASPIEAHCRLGHPFLPVLKKL---  456

Query  2478  CPVAPNKVKSLGSRTSCHLSKASRFPLD-RVSYSSKNVLDLLYTDIWGPAPVISTSGFRY  2302
             CP   + + SL    SCH +K  R  L  R++  ++++ +L+++D+WG  PV S +GF+Y
Sbjct  457   CPQF-DTLPSLDCE-SCHFAKHHRSSLGPRLNKRAESLFELVHSDVWGXCPVTSQTGFQY  514

Query  2301  FLLFVDDYSRFCWFY  2257
             F+ FVDD+SR  W Y
Sbjct  515   FVTFVDDFSRMTWIY  529



>emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera]
Length=1304

 Score =   230 bits (586),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 165/471 (35%), Positives = 233/471 (49%), Gaps = 47/471 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  522   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  581

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  582   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAXLTACYLINRMPSSVLHDQIPHSLLFPD  641

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L +      
Sbjct  642   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLET------  694

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVV--------------TRAPCNTHAAPT  1580
                H Y   F+ +DS   S+ +P  IP  S P                  AP     AP 
Sbjct  695   ---HRY---FISADSLPVSEVLP--IPIVSPPDAMPPRPLQVYHRRPRVVAPLPFPEAPA  746

Query  1579  DSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQF  1400
             DS  +   SP P       L I     T  TR            + +    ++   S   
Sbjct  747   DSLPIPSASPAPALPSPNDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSPYSAFV  800

Query  1399  HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKR  1220
              A++  + P    +A+ H  W   M  E  AL  N TW LV+     + VGC+W +  K 
Sbjct  801   SAISSVSLPKSTHEALSHPGWXQXMVDEMAALHSNGTWDLVVLPSGKSTVGCRWXYAVKV  860

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
               DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ N
Sbjct  861   GPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKN  920

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             AFL+G LAE VYM+QPPG+  P     V R+  S  LYGL+      SPRA
Sbjct  921   AFLHGDLAEEVYMEQPPGFVAPGESGLVCRLRRS--LYGLKQ-----SPRA  964


 Score = 84.0 bits (206),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  355   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  413

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  414   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  462

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  463   KHTRVSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  517



>gb|AAC02666.1| polyprotein [Arabidopsis thaliana]
Length=1451

 Score =   181 bits (458),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 142/258 (55%), Gaps = 15/258 (6%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS + + F +F   VE +F   I ++  D GGE+  +   L   GI+H  +  +T E 
Sbjct  564   RKKSQVREMFITFTALVENKFKFKIGTLYSDNGGEFIAMRSFLASHGISHMTTPPHTPEL  623

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ ++YW +AF  A  LIN + T VL  ESPY +L   
Sbjct  624   NGISERKHRHIVETGLTLLSTASMPKEYWSYAFATAVYLINRMLTPVLGNESPYVKLFGQ  683

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LR+FGC C+P+LRPY  HK++ RS PCV L Y  S   Y C++  +G++Y  RH
Sbjct  684   PPNYLKLRIFGCLCFPWLRPYTAHKLDNRSVPCVLLGYSLSQSAYLCLDRATGRVYTSRH  743

Query  1711  VHFYESIFLF----------SDSTLCSQPVPPTIPWASEPVVT-----RAPCNTHAAPTD  1577
             V F ES F F          SD  L     P ++P  + P+ T      +    H +P+ 
Sbjct  744   VQFAESSFPFSTTSPSVTPPSDPPLSQDTRPVSVPLLARPLTTAPPSSPSCSAPHRSPSQ  803

Query  1576  SAHMSLTSPVPLARGLPP  1523
             S ++S  +P+  +  L P
Sbjct  804   SENLSPPAPLQPSLSLSP  821


 Score =   133 bits (334),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 116/209 (56%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G+GL IS  G A +P+ ++ L L +VLYVP +   L SVYR+ N N V 
Sbjct  356   YNGDEEVTIADGSGLPISHSGSALLPTPTRSLALKDVLYVPDIQKNLISVYRMCNTNGVS  415

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  PV    + S FA  T +     WH RLGH
Sbjct  416   VEFFPAHFQVKDLSTGARLLQGKTKNELYEWPVNSSIATSMFASPTPKTDLPSWHARLGH  475

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  +   ++   S P++ +    L   + C ++K+ + P    + +S + L+ LYTD+W
Sbjct  476   PSLPILKALISKFSLPISHSLQNQLLC-SDCSINKSHKLPFYSNTIASSHPLEYLYTDVW  534

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P+ S   ++Y+L+ VD Y+R+ W YP
Sbjct  535   T-SPITSIDNYKYYLVIVDHYTRYTWLYP  562


 Score =   146 bits (369),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 109/185 (59%), Gaps = 11/185 (6%)
 Frame = -3

Query  1447  HVMRLRHMTRDTSEQFHALNVTTDPT--------CYSQAVGHL*WRDAMDQEFNALLHND  1292
             H MR R             N+ T PT           +A+    WR AM  E NA   N 
Sbjct  910   HTMRTRSKNNIVKPNPKFANLATKPTPLKPIIPKTVVEALLDPNWRQAMCDEINAQTRNG  969

Query  1291  TWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
             T+ LV   P+ NVVGCKWVF  K  ++G +++YKARLVAKGF+Q  G DF +TFS V+K 
Sbjct  970   TFDLVPPAPNQNVVGCKWVFTLKYLSNGVLDRYKARLVAKGFHQQYGHDFKETFSPVIKS  1029

Query  1111  TTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTA  935
             TTVR +  + VS  W++RQ+DV+NAFL G L++ VY+ QPPG+ D  +  HV R+    A
Sbjct  1030  TTVRSVLHIAVSKGWSIRQIDVNNAFLQGTLSDEVYVTQPPGFVDKDNAHHVCRLYK--A  1087

Query  934   LYGLR  920
             LYGL+
Sbjct  1088  LYGLK  1092



>gb|AAC02669.1| polyprotein [Arabidopsis thaliana]
Length=1451

 Score =   181 bits (458),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 142/258 (55%), Gaps = 15/258 (6%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS + + F +F   VE +F   I ++  D GGE+  +   L   GI+H  +  +T E 
Sbjct  564   RKKSQVREMFITFTALVENKFKFKIGTLYSDNGGEFIAMRSFLASHGISHMTTPPHTPEL  623

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ ++YW +AF  A  LIN + T VL  ESPY +L   
Sbjct  624   NGISERKHRHIVETGLTLLSTASMPKEYWSYAFATAVYLINRMLTPVLGNESPYVKLFGQ  683

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LR+FGC C+P+LRPY  HK++ RS PCV L Y  S   Y C++  +G++Y  RH
Sbjct  684   PPNYLKLRIFGCLCFPWLRPYTAHKLDNRSVPCVLLGYSLSQSAYLCLDRATGRVYTSRH  743

Query  1711  VHFYESIFLF----------SDSTLCSQPVPPTIPWASEPVVT-----RAPCNTHAAPTD  1577
             V F ES F F          SD  L     P ++P  + P+ T      +    H +P+ 
Sbjct  744   VQFAESSFPFSTTSPSVTPPSDPPLSQDTRPVSVPLLARPLTTAPPSSPSCSAPHRSPSQ  803

Query  1576  SAHMSLTSPVPLARGLPP  1523
             S ++S  +P+  +  L P
Sbjct  804   SENLSPPAPLQPSLSLSP  821


 Score =   133 bits (334),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 116/209 (56%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G+GL IS  G A +P+ ++ L L +VLYVP +   L SVYR+ N N V 
Sbjct  356   YNGDEEVTIADGSGLPISHSGSALLPTPTRSLALKDVLYVPDIQKNLISVYRMCNTNGVS  415

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  PV    + S FA  T +     WH RLGH
Sbjct  416   VEFFPAHFQVKDLSTGARLLQGKTKNELYEWPVNSSIATSMFASPTPKTDLPSWHARLGH  475

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  +   ++   S P++ +    L   + C ++K+ + P    + +S + L+ LYTD+W
Sbjct  476   PSLPILKALISKFSLPISHSLQNQLLC-SDCSINKSHKLPFYSNTIASSHPLEYLYTDVW  534

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P+ S   ++Y+L+ VD Y+R+ W YP
Sbjct  535   T-SPITSIDNYKYYLVIVDHYTRYTWLYP  562


 Score =   145 bits (366),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 109/185 (59%), Gaps = 11/185 (6%)
 Frame = -3

Query  1447  HVMRLRHMTRDTSEQFHALNVTTDPT--------CYSQAVGHL*WRDAMDQEFNALLHND  1292
             H MR R             N+ T PT           +A+    WR AM  E NA   N 
Sbjct  910   HTMRTRSKNNIVKPNPKFANLATKPTPLKPIIPKTVVEALLDPNWRQAMCDEINAQTRNG  969

Query  1291  TWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
             T+ LV   P+ NVVGCKWVF  K  ++G +++YKARLVAKGF+Q  G DF +TFS V+K 
Sbjct  970   TFDLVPPAPNQNVVGCKWVFTLKYLSNGVLDRYKARLVAKGFHQQYGHDFKETFSPVIKL  1029

Query  1111  TTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTA  935
             TTVR +  + VS  W++RQ+DV+NAFL G L++ VY+ QPPG+ D  +  HV R+    A
Sbjct  1030  TTVRSVLHIAVSKGWSIRQIDVNNAFLQGTLSDEVYVTQPPGFVDKDNAHHVCRLYK--A  1087

Query  934   LYGLR  920
             LYGL+
Sbjct  1088  LYGLK  1092



>gb|AAC02664.1| polyprotein [Arabidopsis thaliana]
Length=1451

 Score =   181 bits (458),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 142/258 (55%), Gaps = 15/258 (6%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS + + F +F   VE +F   I ++  D GGE+  +   L   GI+H  +  +T E 
Sbjct  564   RKKSQVREMFITFTALVENKFKFKIGTLYSDNGGEFIAMRSFLASHGISHMTTPPHTPEL  623

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL+  S+ ++YW +AF  A  LIN + T VL  ESPY +L   
Sbjct  624   NGISERKHRHIVETGLTLLSTASMPKEYWSYAFATAVYLINRMLTPVLGNESPYVKLFGQ  683

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LR+FGC C+P+LRPY  HK++ RS PCV L Y  S   Y C++  +G++Y  RH
Sbjct  684   PPNYLKLRIFGCLCFPWLRPYTAHKLDNRSVPCVLLGYSLSQSAYLCLDRATGRVYTSRH  743

Query  1711  VHFYESIFLF----------SDSTLCSQPVPPTIPWASEPVVT-----RAPCNTHAAPTD  1577
             V F ES F F          SD  L     P ++P  + P+ T      +    H +P+ 
Sbjct  744   VQFAESSFPFSTTSPSVTPPSDPPLSQDTRPVSVPLLARPLTTAPPSSPSCSAPHRSPSQ  803

Query  1576  SAHMSLTSPVPLARGLPP  1523
             S ++S  +P+  +  L P
Sbjct  804   SENLSPPAPLQPSLSLSP  821


 Score =   133 bits (334),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 116/209 (56%), Gaps = 8/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G+GL IS  G A +P+ ++ L L +VLYVP +   L SVYR+ N N V 
Sbjct  356   YNGDEEVTIADGSGLPISHSGSALLPTPTRSLALKDVLYVPDIQKNLISVYRMCNTNGVS  415

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  PV    + S FA  T +     WH RLGH
Sbjct  416   VEFFPAHFQVKDLSTGARLLQGKTKNELYEWPVNSSIATSMFASPTPKTDLPSWHARLGH  475

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P+  +   ++   S P++ +    L   + C ++K+ + P    + +S + L+ LYTD+W
Sbjct  476   PSLPILKALISKFSLPISHSLQNQLLC-SDCSINKSHKLPFYSNTIASSHPLEYLYTDVW  534

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P+ S   ++Y+L+ VD Y+R+ W YP
Sbjct  535   T-SPITSIDNYKYYLVIVDHYTRYTWLYP  562


 Score =   146 bits (369),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 109/185 (59%), Gaps = 11/185 (6%)
 Frame = -3

Query  1447  HVMRLRHMTRDTSEQFHALNVTTDPT--------CYSQAVGHL*WRDAMDQEFNALLHND  1292
             H MR R             N+ T PT           +A+    WR AM  E NA   N 
Sbjct  910   HTMRTRSKNNIVKPNPKFANLATKPTPLKPIIPKTVVEALLDPNWRQAMCDEINAQTRNG  969

Query  1291  TWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
             T+ LV   P+ NVVGCKWVF  K  ++G +++YKARLVAKGF+Q  G DF +TFS V+K 
Sbjct  970   TFDLVPPAPNQNVVGCKWVFTLKYLSNGVLDRYKARLVAKGFHQQYGHDFKETFSPVIKS  1029

Query  1111  TTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTA  935
             TTVR +  + VS  W++RQ+DV+NAFL G L++ VY+ QPPG+ D  +  HV R+    A
Sbjct  1030  TTVRSVLHIAVSKGWSIRQIDVNNAFLQGTLSDEVYVTQPPGFVDKDNAHHVCRLYK--A  1087

Query  934   LYGLR  920
             LYGL+
Sbjct  1088  LYGLK  1092



>gb|AGJ83729.1| gag-pol polyprotein, partial [Caragana korshinskii]
Length=732

 Score =   248 bits (634),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 166/454 (37%), Positives = 237/454 (52%), Gaps = 26/454 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+    +  FR  V+ Q +  IK  + DLGGEY   K    L   G  H+ SC  T +Q
Sbjct  94    RSEFLDIYHMFRAMVKTQHNAVIKCFRCDLGGEYTSNKFSELLAYDGTLHQSSCTDTPQQ  153

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHI+ET  +LL   SV  ++W  A   A   IN +P+SV+   SP+ +L+ +
Sbjct  154   NGVAERKHRHIIETARSLLLSASVPSEFWGEAVLTAVHAINRIPSSVISGLSPFEKLYAS  213

Query  1891  PPPYTFLRVFGCRCYPYLRP-YNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
              P Y+ L+VFG  C+  LRP   R K+  RSA CVFL Y    +GYRC +  + K+Y+ R
Sbjct  214   VPDYSSLKVFGSTCF-VLRPQVERSKLSSRSAICVFLGYGDGQKGYRCYDPHARKLYVSR  272

Query  1714  HVHFYESIFLFSDSTLCSQP-------VPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLT  1556
             HV F E I  +S S+  S         + P  P  S    T + CN     T++     T
Sbjct  273   HVVFLEHIPFYSFSSESSITNSSELTHIDPFGPNDS----TSSDCNVENCRTNT-----T  323

Query  1555  SPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTS--EQFHALNVT  1382
             +P      +PP A   P    P   R   ++H++   +    + T   S      +++  
Sbjct  324   TPDDDITLVPPTAQPPPAIVDPPPPRYP-SRHRKSTQLPDFVYSTYSASFVSFLSSIHSL  382

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
             ++P+ Y +A+    W+ AM +E  AL   DTW LV   P    +G +WV++ K  +DGS+
Sbjct  383   SEPSSYEEAILDPLWQQAMAEELFALRKTDTWDLVPLPPGKRAIGSRWVYKIKTKSDGSV  442

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             E+YKARLVAKGF+Q  G D+ +TF+ V K TT+R L ++     W + Q+DV NAFLNG 
Sbjct  443   ERYKARLVAKGFSQQYGMDYEETFAPVAKMTTIRTLIAVASIRQWDVSQMDVKNAFLNGE  502

Query  1021  LAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             L E VYM  P G    +H          ALYGL+
Sbjct  503   LHEEVYMVPPQGV---SHNQGEVCKLKKALYGLK  533


 Score = 65.5 bits (158),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 0/89 (0%)
 Frame = -1

Query  2523  LGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDI  2344
             LGH +A     +  +  +   +   +     C L+K S  P  +    S    DL+++D+
Sbjct  1     LGHVSASRLKYLASTGALGKLQTSDISDCCGCKLAKFSALPFSKSVSLSYAPFDLVHSDV  60

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             WGP+PV +  G RY++ F+DDY+R+CW Y
Sbjct  61    WGPSPVPTKGGSRYYVSFIDDYTRYCWVY  89



>emb|CAN80547.1| hypothetical protein VITISV_010898 [Vitis vinifera]
Length=1181

 Score =   243 bits (619),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 170/473 (36%), Positives = 239/473 (51%), Gaps = 36/473 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  393   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  452

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  453   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  512

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  513   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  571

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPT--IPWASEPVV--------------TRAPCNTHAA  1586
               V F+E    FS +T  S PV     IP  S P V                AP     A
Sbjct  572   ADVTFFEDSPFFS-TTSESLPVSEVLPIPIVSPPDVMPPRPLQVYHRRPRVVAPLPFPEA  630

Query  1585  PTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSE  1406
             P DS  +   SP P       L I     T  TR            + +    ++   S 
Sbjct  631   PADSLPIPSASPAPALPSPNDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSPYSA  684

Query  1405  QFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRT  1226
                A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  
Sbjct  685   FVSAISSVSLPKSTHEALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAV  744

Query  1225  KRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDV  1046
             K   +G +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+
Sbjct  745   KVGPEGQVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDI  804

Query  1045  HNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
              N FL+G LAE VYM+QPPG+  P     V R+  S  LYGL+      SPRA
Sbjct  805   KNVFLHGDLAEEVYMEQPPGFVAPGESGLVCRLRRS--LYGLKQ-----SPRA  850


 Score = 70.1 bits (170),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 93/211 (44%), Gaps = 44/211 (21%)
 Frame = -1

Query  2859  TGSD--VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNV  2686
             T SD  ++ + NG+  +   +G A        L L++VLY P+    L S+ ++T   N 
Sbjct  212   TTSDLPIVTLANGSQTVAKGIGLAL---PLPSLPLTSVLYTPECPFNLISISKITRTLNC  268

Query  2685  FFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPN-  2509
                F      ++D  T   +  G    G                   S + H RLGHP+ 
Sbjct  269   SITFSDKFVTLQDRSTGKTIGIGLMHSG-------------------SLLIHNRLGHPSL  309

Query  2508  AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYT  2350
             +  Q  V     L S P             SC L K +R  FP  R++  +K+  +L++T
Sbjct  310   SKFQKMVPRFSTLSSLPCE-----------SCQLGKHTRVSFP-KRLNNRAKSPFELVHT  357

Query  2349  DIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             D+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  358   DVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  388



>emb|CAN68235.1| hypothetical protein VITISV_037104 [Vitis vinifera]
Length=2041

 Score =   238 bits (606),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/449 (34%), Positives = 219/449 (49%), Gaps = 52/449 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTL--TKLGITHRKSCAYTH  2078
             + KS +   F+SF+  VE Q  + +K ++ D GGEY     ++   + GI H+ +  Y+ 
Sbjct  1277  KTKSQVLSMFKSFKKMVETQSGQXVKVLRTDNGGEYTSKEFSVFCQEAGIVHQLTAPYSP  1336

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             + NG  ERK R ++E    +L E  + +  W  A   +  L+N LPT  +Q ++P     
Sbjct  1337  QXNGVSERKNRTVMEMARCMLFEKKLPKLLWAEAVNTSVYLLNRLPTKSVQSKTPIEAWS  1396

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P    L+VFG  CY ++    R K++ R+   VF+ Y    +GYR  +L+  KI I 
Sbjct  1397  GVKPSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIVIS  1456

Query  1717  RHVHFYESIFLFSDSTL---CSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPV  1547
             R VHF E+ +   D      C Q  P  +  A E  +   P +  A          TS  
Sbjct  1457  RDVHFDENSYWXWDLKKVHKCDQTTPSILEPAIESTIIEGPLDVEA----------TSDT  1506

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTC  1367
             P+ +  P   +                   ER ++                  V  +PTC
Sbjct  1507  PVLKMRPLFDV------------------YERCNL------------------VHAEPTC  1530

Query  1366  YSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
             Y++A   L W +AM  E +A+  N TWKL       N +G KWVFRTK N+DGSI ++KA
Sbjct  1531  YTEAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSIFRHKA  1590

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLV KGF QVAG D+ DTF+ V +  T+RLL +L     W +  LDV +AFLNG L E +
Sbjct  1591  RLVVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQMGWKVYHLDVKSAFLNGILLEEI  1650

Query  1006  YMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             Y++QP G+E   H +H       ALYGL+
Sbjct  1651  YVQQPEGFEVIGH-EHKVYKLHKALYGLK  1678


 Score = 74.7 bits (182),  Expect(2) = 4e-75, Method: Composition-based stats.
 Identities = 57/200 (29%), Positives = 95/200 (48%), Gaps = 6/200 (3%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +++GNG  +     G  +I ++     ++NVLY+P L   L SV ++   N     F ++
Sbjct  1077  VKLGNGEXVQAKGKGTIAISTKRGTKIVTNVLYIPDLDQNLLSVAQML-RNGYXVSFKEN  1135

Query  2664  -CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRV  2488
              CFI     T    ++ + +    +L +   H  +      S VWH+R  H N      +
Sbjct  1136  FCFISDVHGTEIXKIKMNGNSFYLKLDLVEGH-VFSAKIDESVVWHKRYXHFNLKSLRFM  1194

Query  2487  LQSCPVAPNKVKSLGSRT--SCHLSKASRFPLDR-VSYSSKNVLDLLYTDIWGPAPVIST  2317
              ++  V      S+ ++T  SC L K  R P  + +S  + + L+L+++DI GP    S 
Sbjct  1195  QEAXMVEDMPEISVNAQTCESCELGKQQRQPFPQNMSKRATHKLELIHSDICGPMSTTSL  1254

Query  2316  SGFRYFLLFVDDYSRFCWFY  2257
             S   YF LF+DD+SR  W Y
Sbjct  1255  SNNVYFALFIDDFSRMTWVY  1274



>emb|CAN76493.1| hypothetical protein VITISV_007584 [Vitis vinifera]
Length=1120

 Score =   224 bits (570),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 144/392 (37%), Positives = 198/392 (51%), Gaps = 29/392 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSD+   F  F   +E +F+  IK +  D GGE+  +    T  GI+H     Y  +QNG
Sbjct  429   KSDVKTIFPHFYKMIETRFNIKIKGVYSDNGGEFTVLRPFFTTHGISHYTITPYIPQQNG  488

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ER++RHIVETG  LL+  S+  +YW +AF   T LIN LP+ V   +SP   L K   
Sbjct  489   VSERRHRHIVETGQTLLSHASLPSEYWAYAFATXTYLINRLPSPVFHHKSPLQALFKQXX  548

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  L  FGC C+  ++PYN +K + +  PC+F+ Y  S   Y C++L S +IY  +HV 
Sbjct  549   RYEKLXSFGCLCFXLMKPYNTNKFQKKYVPCIFVGYSTSQSAYLCLHLQSQRIYTSKHVT  608

Query  1705  FYESIFLFS----DSTLCSQPV------PPTIPWASE--PVVTRAPCNT-HAAPTDSAHM  1565
             F ES+  F      S + S P+       P +  AS   P +TRA  +   A+ T S   
Sbjct  609   FDESVHPFKQVSMQSPIDSSPLETSSFSAPILQLASRELPAITRAQGDIPSASSTPSEDP  668

Query  1564  SLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH-MTRDTSEQF----  1400
             +L  P        PL+    V   P+ + +              R  +TR  +  F    
Sbjct  669   ALVQPQE-----APLSTSNQVTLRPSTSVSQPENSIPSSPPPCPRTIITRSMNNIFRPKQ  723

Query  1399  ------HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKW  1238
                   H L    +P+C SQA+    WR AM +E  +LL + TW+LV   P  N+VGCK+
Sbjct  724   LHTTTKHPLPEPPEPSCVSQALKDPHWRKAMSEEVTSLLQHGTWELVPPTPGQNLVGCKF  783

Query  1237  VFRTKRNADGSIEQYKARLVAKGFNQVAGDDF  1142
             VFR KRN DG+I QYKARLVAKGF+Q    D 
Sbjct  784   VFRKKRNPDGTISQYKARLVAKGFHQQPVKDM  815


 Score = 88.6 bits (218),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 87/204 (43%), Gaps = 61/204 (30%)
 Frame = -1

Query  2865  EYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNV  2686
             EY G+D + +G+G                      S+ L VP ++  L SV+  T +NNV
Sbjct  283   EYDGTDEIIIGDG----------------------SDTLCVPTINKNLISVHHFTKQNNV  320

Query  2685  FFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNA  2506
               EFH   F+VKD     + L+G    G+Y LP S          AT   +         
Sbjct  321   ILEFHPTYFLVKDRRXGEIXLQGPCENGVYPLPSSXX--------ATXIAF---------  363

Query  2505  HVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPV  2326
                                +  RTS     A + P  +   +S    DLLYTD+WGP+  
Sbjct  364   -------------------VHERTSV---AAHQLPFHKHGLTSTTPFDLLYTDVWGPSXT  401

Query  2325  ISTSGFRYFLLFVDDYSRFCWFYP  2254
              S +G RY+++F+D ++++ WF+P
Sbjct  402   PSLNGHRYYVIFIDHFTKYVWFFP  425


 Score = 54.3 bits (129),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (44%), Gaps = 14/155 (9%)
 Frame = -2

Query  3596  VSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaapt  3417
             ++ +LT  NF  W  Q    L G  L GYVD    CPP                T+    
Sbjct  19    ITARLTPTNFPSWHAQFESLLLGYNLFGYVDGTHTCPP--------------LPTSTNAA  64

Query  3416  pnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPL  3237
                A+  W +QD+ ILS +++S+S  ++ L     TS   W  +     S SR R +   
Sbjct  65    ATTAHHLWFRQDKLILSAIMTSVSPTLIPLIATSQTSYQAWTKLTKLYVSRSRTRVMQLK  124

Query  3236  GQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPIS  3132
                  +++GN S +EYL   + + ++LA    P+S
Sbjct  125   EDLTLMQRGNRSIIEYLHSVKTIADELALIDAPLS  159



>emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera]
Length=1237

 Score =   229 bits (583),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 157/457 (34%), Positives = 224/457 (49%), Gaps = 79/457 (17%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  533   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  592

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+S+L  + P++ L   
Sbjct  593   NGVAERKKRHLVETARTLLLHNHVPFRFWGDAVLTACYLINRMPSSILHDQIPHSLLFPD  652

Query  1891  PPPYTF-LRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
              P Y   LRVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I  
Sbjct  653   QPLYFLPLRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFISA  712

Query  1714  HVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS-PVPLA  1538
              V F+E                                       DS   S TS  +P++
Sbjct  713   DVTFFE---------------------------------------DSPFFSTTSESLPVS  733

Query  1537  RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQ  1358
             + LP L +  P    P   R +   H+      R R  T +T                  
Sbjct  734   KVLPILIVSPPDAMPP---RPLQVYHR------RPRVSTHET------------------  766

Query  1357  AVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLV  1178
              + H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ KARLV
Sbjct  767   -LSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRLKARLV  825

Query  1177  AKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMK  998
             AKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ NAFL+G LAE VYM+
Sbjct  826   AKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDLAEEVYME  885

Query  997   QPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             QPPG+        V R+  S  LYGL+      SPRA
Sbjct  886   QPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  915


 Score = 83.2 bits (204),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 83/174 (48%), Gaps = 21/174 (12%)
 Frame = -1

Query  2754  VLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRS  2575
             VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S S
Sbjct  368   VLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TSDS  426

Query  2574  HFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLSKA  2413
               A   S     + H RLGHP+ +  Q  V     L S P             SC L K 
Sbjct  427   SPAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLGKH  475

Query  2412  SR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  476   TRVSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  528



>gb|AAG10817.1|AC011808_5 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1413

 Score =   256 bits (655),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 159/452 (35%), Positives = 226/452 (50%), Gaps = 19/452 (4%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KSD+   F  F   VE Q+   +K+++ D   E  K      + GI    SC  T EQ
Sbjct  629   KYKSDVLTIFPDFITMVETQYDTKVKAVRSDNAPEL-KFEELYRRKGIVAYHSCPETPEQ  687

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N  VERK++HI+    ALL +  +   YW      A  +IN  P+ V+  ++ +  L K 
Sbjct  688   NSVVERKHQHILNVARALLFQSQIPLSYWGDCILTAVFIINRTPSPVISNKTLFEMLTKK  747

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P YT L+ FGC CY    P  RHK E R+  C FL YP  ++GY+ ++L S  I+I R+
Sbjct  748   VPDYTHLKSFGCLCYASTSPKQRHKFEDRARTCAFLGYPSGYKGYKLLDLESHTIFISRN  807

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR-  1535
             V FYE +F F      ++P          P +     ++H +       +  S VP  + 
Sbjct  808   VVFYEDLFPFK-----TKPAENEESSVFFPHIYVDRNDSHPSQPLPVQETSASNVPAEKQ  862

Query  1534  ----GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTC  1367
                   PP  ++     + T +    T H     V+    ++       +A+N   +P  
Sbjct  863   NSRVSRPPAYLKDYHCNSVTSS----TDH-PISEVLSYSSLSDPYMIFINAVNKIPEPHT  917

Query  1366  YSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
             Y+QA     W DAM  E  AL  N TW +         VGCKWV++ K NADGS+E+YKA
Sbjct  918   YAQARQIKEWCDAMGMEITALEDNGTWVVCSLPVGKKAVGCKWVYKIKLNADGSLERYKA  977

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLVAKG+ Q  G D+ DTFS V K TTV+LL ++  +  W+L QLD+ NAFLNG L E +
Sbjct  978   RLVAKGYTQTEGLDYVDTFSPVAKLTTVKLLIAVAAAKGWSLSQLDISNAFLNGSLDEEI  1037

Query  1006  YMKQPPGY---EDPTHPDHVRVSSSTALYGLR  920
             YM  PPGY   +  + P +       +LYGL+
Sbjct  1038  YMTLPPGYSPRQGDSFPPNAVCRLKKSLYGLK  1069


 Score = 55.1 bits (131),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 81/196 (41%), Gaps = 54/196 (28%)
 Frame = -1

Query  2829  GAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVK  2650
             G  + +  VG+ ++ ++   L L NVLY+P+  + L SV  LT +      F   C +V 
Sbjct  480   GTTIRVGGVGNIAVNAD---LILKNVLYIPEFRLNLLSVSALTTDIGARVVFDPTCCVVH  536

Query  2649  DSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPV  2470
             D      L +GST G                    S +    LG      +N+ L  C +
Sbjct  537   D------LTKGSTIG--------------------SDLLTDVLGI--FKTKNKGLLHCDI  568

Query  2469  APNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVL-----DLLYTDIWGPAPVISTSGFR  2305
                          C  +K  +     ++Y S++ +     DLL+ D+WGP    +  G+ 
Sbjct  569   -------------CQRAKQKK-----LTYPSRHNICLAPFDLLHIDVWGPFSEPTQEGYH  610

Query  2304  YFLLFVDDYSRFCWFY  2257
             YFL  VDD++R  W Y
Sbjct  611   YFLTIVDDHTRVTWVY  626



>emb|CAB46043.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB80958.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1474

 Score =   180 bits (456),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 131/213 (62%), Gaps = 4/213 (2%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS +  TF +F+  VE +F   I+++  D GGE+  +   L   GI+H  S  +T E NG
Sbjct  565   KSQVKSTFIAFKALVENRFQAKIRTLYSDNGGEFIALREFLVSNGISHLTSPPHTPEHNG  624

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK+RHIVETGL LL + SV ++YW +AF  A  LIN +PT VL  ESP+ +L  + P
Sbjct  625   LSERKHRHIVETGLTLLTQASVPREYWPYAFAAAVYLINRMPTPVLSMESPFQKLFGSKP  684

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  LRVFGC C+P+LRPY  +K+E RS  CVFL Y  +   Y C ++   ++Y  RHV 
Sbjct  685   NYERLRVFGCLCFPWLRPYTHNKLEERSRRCVFLGYSLTQTAYLCFDVEHKRLYTSRHVV  744

Query  1705  FYESIFLFSDSTLCSQPVPPTIPW--ASEPVVT  1613
             F E+ F FS+  L SQ   PT+ +  +S P+VT
Sbjct  745   FDEASFPFSN--LTSQNSLPTVTFEQSSSPLVT  775


 Score =   131 bits (330),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 117/209 (56%), Gaps = 9/209 (4%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G DV+ + +G  L I++ G   +PS ++ L L+ VLYVP +   L SVYRL N N V 
Sbjct  356   YNGDDVM-IADGTSLKITKTGSTFLPSNARDLTLNKVLYVPDIQKNLVSVYRLCNTNQVS  414

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T  +LL+G T   LY  PV+       F   + + T + WH RLGH
Sbjct  415   VEFFPASFQVKDLNTGTLLLQGRTKDELYEWPVTNPKATALFTTPSPKTTLSSWHSRLGH  474

Query  2514  PNAHVQNRVLQ--SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIW  2341
             P++ + N ++   S PV+ +    L   + C ++K+ + P    S  S + L+ +++D+W
Sbjct  475   PSSSILNTLISKFSLPVSVSASNKLAC-SDCFINKSHKLPFSISSIKSTSPLEYIFSDVW  533

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
               +P++S   ++Y+L+ VD ++R+ W YP
Sbjct  534   M-SPILSPDNYKYYLVLVDHHTRYTWLYP  561


 Score =   157 bits (396),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = -3

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
             ++PT  +QA+    WR AM  EF+A   N TW LV  E  + +VGCKWVF+ K   +G+I
Sbjct  964   SEPTNVTQALKDKKWRFAMSDEFDAQQRNHTWDLVPHESQL-LVGCKWVFKLKYLPNGAI  1022

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             ++YKARLVAKGFNQ  G D+ +TFS V+K TT+RL+  + V  +W ++QLDV+NAFL G 
Sbjct  1023  DKYKARLVAKGFNQQYGVDYAETFSPVIKSTTIRLVLDVAVKKDWEIKQLDVNNAFLQGT  1082

Query  1021  LAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             L E VYM QPPG+ D   P HV R+    A+YGL+
Sbjct  1083  LTEEVYMAQPPGFIDKDRPTHVCRLRK--AIYGLK  1115



>gb|ACB45089.1| putative polyprotein [Solanum habrochaites]
Length=849

 Score =   218 bits (556),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 156/473 (33%), Positives = 226/473 (48%), Gaps = 35/473 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIH--HTLTKLGITHRKSCAYTH  2078
             + KSD++   + F   ++RQF   IK  + D G E+   H        GI H+ SC YT 
Sbjct  359   KYKSDVFIVLKDFLQLIQRQFGGYIKIFRSDNGTEFFNSHCSELFRTAGIVHQSSCVYTP  418

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG VER++R I+E   A+  + ++  ++W    + A  LIN +P++ L   SP+    
Sbjct  419   QQNGVVERRHRQILEVARAIRFQANLPIRFWGLCVQNAVYLINRIPSTALSGRSPFAVFF  478

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P    LRV GC CY      +  K + RS   V + Y  + +GY+  +L++   +I 
Sbjct  479   GKEPSLHHLRVMGCLCYAVNHHTHGDKFDTRSIKSVLMGYSTTQKGYKLYDLSTQTFFIS  538

Query  1717  RHVHFYESIFLFS-------DSTLCSQP----------VPPTIPWASEPVVTRAPCNTHA  1589
             R V F E  + F        DS+    P          +P    + + P  T    +T +
Sbjct  539   RDVTFREDQYPFQHIQDESCDSSFFENPDMFVYDDSSTIPLHETFITSPDQTSTSIDTPS  598

Query  1588  APTDSAHMSLTSPVPLARGL----PPLAIEGPVQTA---PTRARAV*TQHQERGHVMRLR  1430
                 S H   ++   L R      PP  +   V  A   PT +    T H     +    
Sbjct  599   PSPISHHFGTSTTTDLRRSTRSSKPPGWLHDFVHIATHSPTSSLTCSTAHP----LSSYM  654

Query  1429  HMTRDTSEQFHAL---NVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHM  1259
               +  ++  F +L   +   +PT Y++AV H  W  AM+ E  AL  N TW LV      
Sbjct  655   SYSSISTPYFQSLCNFSAIPEPTSYNEAVQHSHWIQAMELELKALHDNHTWDLVPLPLGK  714

Query  1258  NVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
               +GCKWV++ K NA G +E+YKARLVAKG+ Q  G D+ +TFS VVK  TVR++ SL  
Sbjct  715   KAIGCKWVYKVKFNAQGEVERYKARLVAKGYTQQEGLDYQETFSPVVKMVTVRVVLSLAA  774

Query  1078  SHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              H W L Q+DV NAFL G L E VYM  PPG          +++ S  LYGL+
Sbjct  775   MHGWFLHQMDVFNAFLQGDLVEEVYMVPPPGLLQQGESKVCKLNKS--LYGLK  825


 Score = 92.8 bits (229),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 86/178 (48%), Gaps = 13/178 (7%)
 Frame = -1

Query  2763  LSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLY----  2596
             +S+VLY+P     L SV  LT E +    F+ D  I++D  T  V   GS   GLY    
Sbjct  183   ISHVLYIPDFKYNLLSVSELTKELHCCMVFYPDHCILQDLHTVKVKGTGSMENGLYYWSH  242

Query  2595  ----RLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKS-LGSRTS  2431
                  +  S S    L++     +WHRRLGH    + ++VLQ   +      S L S   
Sbjct  243   IVSPTVAYSVSPSVALSTLDDVDLWHRRLGH----IPHKVLQQMQIPHISSSSKLTSCPI  298

Query  2430  CHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             C L+K +R P  +    + NV DL++ D+WGP    +  G RYFL  VDD SR  W +
Sbjct  299   CPLAKQTRLPFPQSPTRADNVFDLIHADVWGPYKFPTHDGNRYFLTLVDDCSRMIWIF  356



>emb|CAN74241.1| hypothetical protein VITISV_006638 [Vitis vinifera]
Length=1280

 Score =   214 bits (545),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 159/458 (35%), Positives = 224/458 (49%), Gaps = 20/458 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F +F   ++ Q+  S+K ++ D G EY      + ++  GI H+ SC  T  Q
Sbjct  518   RSEVFSHFCAFSAEIKTQYDVSMKILRSDNGKEYVSNSFQNYMSHNGILHQTSCVDTPSQ  577

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK  H++ET  AL+ +  V +Q+W  A   A  LIN  PT VL+ + PY  +H  
Sbjct  578   NGVAERKNXHLLETARALMFQMKVPKQFWADAVSTACFLINRXPTVVLKGDIPYKVIHPQ  637

Query  1891  PPPYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                +    R+FGC CY    RP+   K++ ++  CVFL Y    +GYRC +    K  + 
Sbjct  638   KSLFPLAPRIFGCTCYVRDTRPF-VTKLDPKALQCVFLGYSRLQKGYRCFSPDLNKYLVS  696

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
               V F E    FS  T  S        W    VV   P    ++  DS   SL    P+ 
Sbjct  697   TDVVFSEDTSFFSSPT--SSASEEDEEWLVYQVVNSRPTVGQSSVVDS-DASLAHSGPVV  753

Query  1537  RGLPPLAIEGPVQTAPTRARAV*T-QHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYS  1361
                P  A    VQ    R     T              +    S +  +++V   P   +
Sbjct  754   NIPPAPAKPPIVQVYSRRPVTTDTCPAPAPSSSDPSSDLDLPISLRKDSISV---PKTVT  810

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +A+ H  W++AM +E  AL  N TWKLV       VVGCKWVF  K N DGS+ + KARL
Sbjct  811   EALNHPGWKNAMLEEICALEDNHTWKLVDLPQGKKVVGCKWVFAXKVNPDGSVARLKARL  870

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VA+G+ Q  G D+  TFS V K  +V L  S+  S  W + QLD+ NAFL+G L E VY+
Sbjct  871   VARGYAQTYGVDYSXTFSPVAKLNSVXLFISIAASQXWMIXQLDIKNAFLHGDLEEEVYL  930

Query  1000  KQPPGYEDPTHPDHVRVSS-STALYGLRGVKMG*SPRA  890
             +QPPG+      ++ +V     ALYGL+      SPRA
Sbjct  931   EQPPGF--VAQGEYGKVCRLKKALYGLKQ-----SPRA  961


 Score = 96.7 bits (239),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 92/172 (53%), Gaps = 6/172 (3%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             + LS+VL +P L+  L SV +LT   N    F  D  + +D +T+    +G  S GLY L
Sbjct  347   ITLSSVLNLPNLAFNLISVSKLTKNLNCSVSFFXDHCVFQDLMTKXTFGKGHVSBGLYIL  406

Query  2589  PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKAS  2410
                        S A+    H RLGHP+  V  ++   CP   + + SL    SCH +K  
Sbjct  407   DEWVPRPVACVSTASPVEAHCRLGHPSLPVLKKL---CPQF-DTLPSLDCE-SCHFAKHH  461

Query  2409  RFPLD-RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             R  L  R++   +++ +L+++D+WGP PV S +GFRYF+ FVDD+SR    Y
Sbjct  462   RSSLGPRLNKRXESLFELVHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTXIY  513



>emb|CAN67539.1| hypothetical protein VITISV_021584 [Vitis vinifera]
Length=1652

 Score =   213 bits (542),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 221/466 (47%), Gaps = 58/466 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R K ++++TF  F   V+ QFS SIK+++ D GGEY   +    LT  GI H++SC  T 
Sbjct  652   RSKFEVFRTFTEFLAYVDNQFSTSIKTLRTDSGGEYLSTEFQAFLTSKGIIHQRSCPSTP  711

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK  H+++                                     ESPY RL 
Sbjct  712   QQNGVAERKNHHLLDV-----------------------------------MESPYFRLF  736

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y  LR+FGC C+ +L P+ RHK+  +S  C FL Y    +G+ C + T  +  I 
Sbjct  737   AKQPSYDHLRIFGCVCFVHLPPHKRHKLSAQSVRCAFLGYNMCQKGFVCYDPTLHRTRIS  796

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASE-------PVVTR-APCNTHAAPTDSAHMS  1562
             R+V F+E+   F  S+         +  + E       P+ +R  P   +   +    +S
Sbjct  797   RNVIFFENQHFFPVSSSTVSSSSTMVLPSFEQQFSDLHPLSSRFQPSIVYTRRSRPQSLS  856

Query  1561  LTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVT  1382
             +  P+     L   ++  P   AP+   +         +           S    AL+  
Sbjct  857   VAHPISDPTTLQIQSVAVP--PAPSVRCSSRVSVPPNRYGFPSSSSGNSISALIAALSNF  914

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
               PT YS A  H  WR AM +E  AL  N TW +    P +  +GCKWV+  K  +DGS+
Sbjct  915   DIPTYYSHATKHDCWRQAMQEEIAALEANHTWDIEPCLPTIVPLGCKWVYSVKVRSDGSL  974

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             ++YKARL A G NQ  G  + +TF+ V K TTVR + +L  S++W L Q+DV N FL+G 
Sbjct  975   DRYKARLFALGNNQEYGVSYEETFAHVAKMTTVRTILALAASNDWPLHQMDVKNVFLHGD  1034

Query  1021  LAETVYMKQPPG-YEDPT-HPDHVRVSSSTALYGLRGVKMG*SPRA  890
             L E +YMK PPG +  PT H   +R S    LYGL+      +PRA
Sbjct  1035  LKECIYMKPPPGLFPSPTSHVCKLRRS----LYGLKQ-----APRA  1071


 Score = 97.8 bits (242),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 108/215 (50%), Gaps = 37/215 (17%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G   ++  NG+ L+I+ +G AS    SK    ++V   P+LS    SV +L + N   
Sbjct  459   YAGQSSIQTANGSSLLIAAIGDAS----SKF---TDVFLAPQLSTNRISVGQLVDNN---  508

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT---------STVWH  2530
                   C +    IT+     G   G L+ L +    F+ L+S  +         S +WH
Sbjct  509   ------CAVTGKPITK-----GPKVGRLFPLFLPIPDFSSLSSIESFACNNVSDLSMMWH  557

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT--SCHLSKASR--FPLDRVSYSSKNVLD  2362
             R LGHPN  + + VL S  +  NK +S  S    SC L K+    FPL   +  + +  D
Sbjct  558   RHLGHPNTQILSHVLNS-DLPDNKDRSSLSLECDSCKLGKSKTLLFPLH--ASRASHCFD  614

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             L+++D+WGP+PV S   F+Y++ F+DD+SRF W Y
Sbjct  615   LIHSDVWGPSPVSSHEKFKYYVTFIDDHSRFTWVY  649



>gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana]
Length=1392

 Score =   164 bits (416),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 119/196 (61%), Gaps = 5/196 (3%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGE---YRKIHHTLTKLGITHRKSCAYT  2081
             ++KSD +  F  F+  VE Q+   I   Q D GGE   Y+ + H L   GI    SC +T
Sbjct  555   KLKSDFFSVFVLFQQLVENQYQHKIAMFQCDGGGEFVSYKFVAH-LASCGIKQLISCPHT  613

Query  2080  HEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVL-QFESPYTR  1904
              +QNG  ER++R++ E GL+L+    V  + W  AF  +  L N LP+S L   +SPY  
Sbjct  614   PQQNGIAERRHRYLTELGLSLMFHSKVPHKLWVEAFFTSNFLSNLLPSSTLSDNKSPYEM  673

Query  1903  LHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIY  1724
             LH TPP YT LRVFG  CYPYLRPY ++K + +S  CVFL Y   ++GYRC++  +GK+Y
Sbjct  674   LHGTPPVYTALRVFGSACYPYLRPYAKNKFDPKSLLCVFLGYNNKYKGYRCLHPPTGKVY  733

Query  1723  ICRHVHFYESIFLFSD  1676
             ICRHV F E  F +SD
Sbjct  734   ICRHVLFDERKFPYSD  749


 Score =   146 bits (368),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 116/215 (54%), Gaps = 3/215 (1%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSV  2713
             T   +  S  Y+G D + VGNG  L I+ +G   +      L L +VL  P ++  L SV
Sbjct  340   TTDGLQNSQTYSGDDSVIVGNGDFLPITHIGTIPLNISQGTLPLEDVLVCPGITKSLLSV  399

Query  2712  YRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS--T  2539
              +LT++    F F  D  ++KD  T+ +L +G+   GLY L        Y T + +S   
Sbjct  400   SKLTDDYPCSFTFDSDSVVIKDKRTQQLLTQGNKHKGLYVLKDVPFQTYYSTRQQSSDDE  459

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             VWH+RLGHPN  V   ++++  +  NK  S     +C + K  R P     + S   L+ 
Sbjct  460   VWHQRLGHPNKEVLQHLIKTKAIVVNKTSS-NMCEACQMGKVCRLPFVASEFVSSRPLER  518

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGPAPV S  GF+Y+++F+D+YSRF WFYP
Sbjct  519   IHCDLWGPAPVTSAQGFQYYVIFIDNYSRFTWFYP  553


 Score =   147 bits (370),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = -3

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +P    +A+    W +AM +E   +   DTW LV  E    ++GCKWVF+TK N+DGS++
Sbjct  796   EPKSVKEALKDEGWTNAMGEEMGTMHETDTWDLVPPEMVDRLLGCKWVFKTKLNSDGSLD  855

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
             + KARLVA+G+ Q  G D+ +T+S VV+  TVR +  +   + W+L+QLDV NAFL+  L
Sbjct  856   RLKARLVARGYEQEEGVDYVETYSPVVRSATVRSILHVATINKWSLKQLDVKNAFLHDEL  915

Query  1018  AETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              ETV+M QPPG+EDP+ PD+V      A+Y L+
Sbjct  916   KETVFMTQPPGFEDPSRPDYV-CKLKKAIYDLK  947



>ref|XP_010113352.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXC35359.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=3263

 Score =   233 bits (595),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 158/528 (30%), Positives = 243/528 (46%), Gaps = 82/528 (16%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++ + F +F + V+ QF+  I+ ++ D   EY    ++  L   GI H  SC  T 
Sbjct  612   KEKSEVGQIFHTFNLMVQNQFNSRIQVLKSDNAREYFTSSLNTYLQNHGIIHLSSCVDTP  671

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK RH++E    L+   +V   +W  A   AT LIN +P+ VL F+SP   L 
Sbjct  672   QQNGVAERKNRHLLEVARCLMFSSNVPNYFWGEAILTATYLINRMPSRVLTFQSPRQLLL  731

Query  1897  KTPPPYTFL------RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTS  1736
             +  P    +      +VFGC  + ++ P +R K + R+  C+FL Y P+ +GY+C +  S
Sbjct  732   ENFPHTRAVSSDLPPKVFGCTAFVHVYPQHRSKFDPRANKCIFLGYSPTQKGYKCYSPIS  791

Query  1735  GKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLT  1556
              + Y    V F+E +F +  S +  + +     W  E ++   P +   +P  S  + + 
Sbjct  792   KRFYTTMDVSFFEHVFFYPKSRVQGESMNEHQIW--ESILESVPSSHSESPRPSQTVPID  849

Query  1555  SPVPLARGLPPLAIEGPV---QTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQF-----  1400
             S  P+   + P  +  PV     AP  A      +  R     L H ++ T  Q+     
Sbjct  850   SSTPVPLSVQPTNVSSPVPVQSVAPQLANENLQVYIRRKKRQELEHGSQPTCGQYIDSIS  909

Query  1399  -----------------HALNVTTDPT--------CYSQAVGHL*WRDAMDQEFNAL---  1304
                               +++ +T P         C    +G+    + +   + A    
Sbjct  910   SPPEENMGTDREGDVSTPSIDDSTLPIALRKGVRRCTDHPIGNYVTYEGLSPSYKAFATS  969

Query  1303  -------------LHNDTWK----------------LVLDEP-HMNVVGCKWVFRTKRNA  1214
                          L N  WK                 + D P     VGCKW+F  K  A
Sbjct  970   LDGTQIPSTIHEALQNSEWKKAVQDEIDALEKNGTWTITDLPGGKRPVGCKWIFTIKYKA  1029

Query  1213  DGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAF  1034
             DGS+E++KARLVA+GF Q  G D+ +TF+ V K  T+R+L SL V+ +W L+QLD+ NAF
Sbjct  1030  DGSVERFKARLVARGFTQSYGIDYQETFAPVAKLNTIRILLSLAVNQDWCLQQLDIKNAF  1089

Query  1033  LNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             LNG L E VYM+ PPG+E     + V      +LYGL+      SPRA
Sbjct  1090  LNGDLEEEVYMEIPPGFEGSMTKNQV-CKLRKSLYGLKQ-----SPRA  1131


 Score = 75.9 bits (185),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 102/233 (44%), Gaps = 27/233 (12%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++      +G   + + +G+   I+  G   +  E   L+L +VL+VP L   L S+ 
Sbjct  382   AALLQNYKPSSGHSSVHIADGSNSKIAGTGSIKLTKE---LYLDSVLHVPNLDCNLLSIS  438

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH--------------  2572
             +L  +     +F+ +  I +D  +  ++       GLY L   RS               
Sbjct  439   KLACDLQCVTKFYPNLCIFQDLKSGKMIGSAELCSGLYLLSCDRSSNQVSQASCVQSQSL  498

Query  2571  FAYLTSRATSTV--------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSK  2416
                  S + S V         H RLGHP+     ++     +  NK  +      C ++K
Sbjct  499   LGSFNSVSNSNVNKDSEIILLHYRLGHPSFVYLAKLFPKLFI--NKNPASFHCEICQIAK  556

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +R    ++ Y    V  L+++D+WGP+ + + SG R+F+ FVDD++R  W Y
Sbjct  557   HTRTVYPQIPYKPSTVFSLIHSDVWGPSRIKNVSGTRWFVTFVDDHTRVTWVY  609



>emb|CAN72168.1| hypothetical protein VITISV_004170 [Vitis vinifera]
Length=1415

 Score =   236 bits (602),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 162/506 (32%), Positives = 246/506 (49%), Gaps = 61/506 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++   F++F + V+ QF+  I+ ++ +   EY    +   L    I H  SC  T 
Sbjct  563   KEKSEVGHIFQTFNLMVQNQFNSKIQVLKSNNAKEYFTSSLSTYLQNHDIIHISSCVDTP  622

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESP-----  1913
             +QNG  E K RH++E    L+   +V   +W  A   AT LIN +P+ VL F+SP     
Sbjct  623   QQNGVAEHKNRHLLEVARCLMFSSNVPNYFWGEAILTATYLINRMPSRVLTFQSPRQLFL  682

Query  1912  ----YTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN  1745
                 +TR   +  P   L+VFGC  + ++ P NR K   R+  C+FL Y P+ +GY+C +
Sbjct  683   KQFPHTRAASSDLP---LKVFGCMAFVHVYPQNRSKFAPRANKCIFLGYSPTQKGYKCYS  739

Query  1744  LTSGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWAS--EPVVT---RAPCNTHAAPT  1580
              T+ + Y    V F+E +F +  S +  + +     W S  E V +    +P  +  APT
Sbjct  740   PTNKRFYTTXDVXFFEHVFFYPKSHVQGESMNEHQVWESLLEGVPSFHSESPNPSQFAPT  799

Query  1579  D----------SAH-------MSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQER  1451
             +           AH       +++ SP+P+    P LA E        RA  +     + 
Sbjct  800   ELSTPMPSSVXPAHHTNVPSPVTIQSPMPIQPIAPQLANENLQNIGEDRAGELLIPSIDD  859

Query  1450  GHV-MRLRHMTRDT--------------SEQFHALNVTTD----PTCYSQAVGHL*WRDA  1328
               + + LR   R                S  + A   + D    P    +A     W+ A
Sbjct  860   STLPIALRKGVRRCTDHPIGNYVTYEGLSPSYRAFATSLDDTQVPNTIQEAFKISEWKKA  919

Query  1327  MDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGD  1148
             +  E +AL  N TW +        +VGCKW+F  K  ADGS+E++KARLVA+GF Q  G 
Sbjct  920   VQDEIDALEKNGTWTITDLPVGKRLVGCKWIFTIKYKADGSVERFKARLVARGFTQSYGI  979

Query  1147  DFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTH  968
             D+ +TF+ V K  T+R+L SL V+ +W L+QLD+ NAFLNG L E VY++ PPG+E+   
Sbjct  980   DYQETFAPVAKLNTIRILLSLAVNQDWCLQQLDIKNAFLNGDLEEEVYIEIPPGFEESMA  1039

Query  967   PDHVRVSSSTALYGLRGVKMG*SPRA  890
              + V      +LY L+      SPRA
Sbjct  1040  KNQV-CKLQKSLYDLKQ-----SPRA  1059


 Score = 73.2 bits (178),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 100/212 (47%), Gaps = 8/212 (4%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++       G   + + +G+   I+  G   +   +K L+L +V ++P L   L S+ 
Sbjct  356   AAILQNYKPSNGHSSVHIADGSKSKIAGTGSTKL---TKDLYLDSVFHIPNLDCNLLSIS  412

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVW-  2533
             +L  +     +F+ +  + +D  +  ++       GLY L  S   F+   ++ +  +  
Sbjct  413   KLARDLQCVTKFYPNSCVFQDLKSGKMIGSAELCSGLYLL--SCGQFSNQVNKDSEIIML  470

Query  2532  HRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLY  2353
             H RLGHP+     ++     +  NK  +      C  +K +R    ++ Y    V  L++
Sbjct  471   HYRLGHPSFVYLAKLFPKLFI--NKNPASYHCEICQFAKHTRTVYPQIPYKPLTVFSLVH  528

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +D+WGP+ + +  G R+F+ FVDD++R  W +
Sbjct  529   SDVWGPSRIKNIFGTRWFVTFVDDHTRVTWVF  560



>emb|CAN77638.1| hypothetical protein VITISV_007620 [Vitis vinifera]
Length=705

 Score =   238 bits (606),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/442 (36%), Positives = 225/442 (51%), Gaps = 13/442 (3%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R K ++++TF  F   V+ QFS SIK+++ D GGEY   +    L   GI H+ SC  T 
Sbjct  261   RSKXEVFRTFTEFLAYVDNQFSTSIKTLRTDSGGEYLSTEFQAFLASKGIIHQCSCPSTP  320

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK  H+++     L E SV   +W  A ++AT LIN L + VL  ESPY  L 
Sbjct  321   QQNGVAERKNXHLLDVVXTXLLESSVPSMFWVEALKIATHLINRLXSQVLHMESPYFXLF  380

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y  LR+FGC C+ +L P+ RHK+  +S  C FL Y    +G+ C + T  +  I 
Sbjct  381   AKQPSYDHLRIFGCVCFVHLPPHERHKLSAQSVRCAFLGYIMCQKGFVCYDPTLHRTRIS  440

Query  1717  RHVHFYESIFLF-----SDSTLCSQPVPPTIPWASE--PVVTR-APCNTHAAPTDSAHMS  1562
             R+V F+E+   F     + S+  +  +P      S+  PV +R  P   +   +    +S
Sbjct  441   RNVIFFENQHFFPVSFSTVSSSSTVVLPSFEQQFSDLHPVSSRFQPGIVYTRHSRPQSLS  500

Query  1561  LTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVT  1382
             +  P+     L   ++  P      R+  V       G    +       S    AL+  
Sbjct  501   VAHPISDLTTLQIQSVPAPPTPLVCRSPRVSIPPNRYGFPSSIS--GNSISALTAALSNF  558

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
               P CYS    H  WR AM +E  AL  N TW      P +  + CKWV+  K  +DGS+
Sbjct  559   DIPICYSHIAKHDCWRQAMQEEIAALEANHTWDXEPCPPTIVPLXCKWVYSVKVXSDGSL  618

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             ++YKARLVA G NQ  G ++ +TF+ V K TTVR + +L  S NW L Q+DV N FL+G 
Sbjct  619   DRYKARLVALGNNQEYGVNYEETFAPVAKMTTVRTILALAASSNWPLHQMDVKNVFLHGD  678

Query  1021  LAETVYMKQPPGYEDPTHPDHV  956
             L E +YMK PPG   P+   HV
Sbjct  679   LKECIYMKPPPGLX-PSPTSHV  699


 Score = 70.1 bits (170),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 74/144 (51%), Gaps = 12/144 (8%)
 Frame = -1

Query  2655  VKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT---------STVWHRRLGHPNAH  2503
             V+D +T   + +G   G L+ L +    F+ L+S  +         S VWHRRLGHPN  
Sbjct  116   VQDQVTGEPIAKGPKVGRLFPLFLPVPDFSPLSSIKSFACNXVSDLSMVWHRRLGHPNTQ  175

Query  2502  VQNRVLQSCPVAPNKVKSLGSRT--SCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAP  2329
             + + VL S  +  NK +S  S    SC L K+        +  + +  DL+++D+  P+ 
Sbjct  176   ILSHVLNS-NLPGNKDRSSLSLECDSCKLGKSXTLSFPLHASRASHCFDLIHSDVXEPSL  234

Query  2328  VISTSGFRYFLLFVDDYSRFCWFY  2257
             V S   F+Y++ F+DD+SRF   Y
Sbjct  235   VSSHEKFKYYVTFIDDHSRFTXVY  258



>emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera]
Length=1355

 Score =   201 bits (510),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/404 (31%), Positives = 205/404 (51%), Gaps = 25/404 (6%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++++ F+ F   V   FS  IK+++ D G EY    + + L   GI H+ SC  T 
Sbjct  588   KSKSEVFECFKDFHRLVITHFSAHIKTLRTDNGTEYTSHNMKNYLISHGIVHQTSCVNTP  647

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK R ++E   A++ + +V + +W +    AT LIN LP+ VL F  P   L 
Sbjct  648   QQNGVAERKNRDLLEKTRAIMMQMNVPKHFWSYGVLTATYLINRLPSRVLDFLCPLEVLQ  707

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRH-KIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
             +  P  + L+VFGC C+ +L    R  K++ R+  CVFL Y  + +GYRC + T+ ++++
Sbjct  708   QKKPDLSHLKVFGCTCFVHLSATQRRDKLDPRAVKCVFLGYSQTQKGYRCYDTTAKRLFV  767

Query  1720  CRHVHFYESIFLFSDST-----------------LCSQPVPPTIPWASEPVVTRAPCNTH  1592
              R V F E+  +F +S                  +  Q + PTI   +E  V        
Sbjct  768   SRDVQFVETSPIFENSNQGEILSDFVPLPEVAANIEQQSIAPTIQHPTEASVESTI--NQ  825

Query  1591  AAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDT  1412
                  + ++ ++    L R  PP     P +     A AV    ++    +  ++++   
Sbjct  826   VVQESAPNIDISEQTTLPRRNPPRERHPPAKFRDYIAAAVRYPPEK---FLSYQNLSTSH  882

Query  1411  SEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
                  A++   +P  + +A     WR +MD E  AL   +TW +V   P  +VVGC+WV+
Sbjct  883   LAYLTAISSVHEPKNFHEANSQPMWRKSMDDELKALEETNTWNIVHLPPGKHVVGCRWVY  942

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVR  1100
             R K N DGSIE+ K+R+VA+GF Q  G D+ +TF+ V K +TV+
Sbjct  943   RFKFNPDGSIERPKSRVVAQGFTQHFGVDYKETFAPVAKMSTVK  986


 Score =   105 bits (262),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 109/218 (50%), Gaps = 26/218 (12%)
 Frame = -1

Query  2898  CVTASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLF  2719
             C +++ +S +D   G DV   G G   ++S+    +I SE        VLYVP   V L 
Sbjct  390   CSSSTFVSVAD---GKDVPVQGKGKTKLVSK----TIESE--------VLYVPSFPVQLL  434

Query  2718  SVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLP----VSRSHFAYLTSR  2551
             SV +LT+  N    F  D  + +D IT+  +  G    GL+       + +   A  +S 
Sbjct  435   SVQQLTSTLNCDVLFTSDKVLFQDRITKKTIGEGFQLHGLFYFSSDDRLCKGFQASFSST  494

Query  2550  ATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKN  2371
                ++WH+RLGHP+  V N++  S P      K       CH SK++R P +     S  
Sbjct  495   NKHSLWHQRLGHPSESVFNKIHPSLP------KGTDGCDICHYSKSTRLPFNLSLSKSSE  548

Query  2370  VLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             + +L+++D+WGP   +S  GF+YF+ F+DD+S+  W Y
Sbjct  549   MFELVHSDVWGPFS-LSIDGFKYFVTFIDDFSKVTWVY  585



>gb|AAT38747.2| Polyprotein, putative [Solanum demissum]
Length=1402

 Score =   213 bits (541),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 158/494 (32%), Positives = 230/494 (47%), Gaps = 53/494 (11%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F +F   ++ QF+ S+  ++ D   E+      + + + GI H+ SC  T  Q
Sbjct  587   RSEVFSHFSNFCAEIKTQFNASVHILRSDNAREFMSASFQNYMNQYGILHQSSCVDTPSQ  646

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH++ET   LL +  V +Q+W      A+ LIN +P++VL  + PY  L   
Sbjct  647   NGVAERKNRHLLETARVLLFQMKVPKQFWADTVSTASFLINRMPSTVLNGDIPYGVLFPN  706

Query  1891  PPPYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P +    +VFG  CY   +RP+   K++ ++  CVFL Y    +GYRC + T  +  + 
Sbjct  707   KPLFPLEPKVFGSTCYVRDVRPH-ITKLDPKALKCVFLGYSRLQKGYRCYSPTLNRYMVS  765

Query  1717  RHV--------------------HFYESIFLFSDSTLCSQ---PVPPTIPWASEPVVTRA  1607
               V                       E   ++  +   S+    VP ++  + E V + A
Sbjct  766   IDVVFSESISFFSSPDTFPTQGQQEDEEWLIYRTTPSRSEQHKEVPGSVEQSMENVSSDA  825

Query  1606  PCNTHAAPTDSAH-----MSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQER---  1451
             P      P    +      + T P P      PL    PV  +PT    +    ++    
Sbjct  826   PLAQTKPPIVQVYSRRQVTNDTCPAPTLSSSDPL----PVNPSPTENLDIPIALRKGKRQ  881

Query  1450  -------GHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHND  1292
                     + +   H++  +     +L+    P    +A+ H  W DAM  E +AL  N 
Sbjct  882   CPSIYSIANFISYDHLSPTSCSLIASLDSIFVPKTVREALNHPGWYDAMLDEIHALDDNH  941

Query  1291  TWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKP  1112
             TW LV        VGCKWVF  K N DGS+ + KARLVAKG+ Q  G D+ DTFS V K 
Sbjct  942   TWNLVDLPKGKKAVGCKWVFTIKVNPDGSMARLKARLVAKGYAQTYGVDYSDTFSPVAKL  1001

Query  1111  TTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTAL  932
             T+VRL  SL  S NW L QL + NAFL+G L E VYM+QPPG+        V       L
Sbjct  1002  TSVRLFISLAASQNWPLHQLAIKNAFLHGDLQEEVYMEQPPGFVAQGENGKV-CHLKKPL  1060

Query  931   YGLRGVKMG*SPRA  890
             YGL+      SPRA
Sbjct  1061  YGLKQ-----SPRA  1069


 Score = 93.6 bits (231),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 91/172 (53%), Gaps = 6/172 (3%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             + LS+VL +P  +  L SV +LT E   F   + D  + +D +T+ ++ +   S GLY L
Sbjct  416   ITLSSVLGLPSHAFNLISVSKLTKELKCFVSLYPDHCLFQDLMTKQIIGKRHVSDGLYIL  475

Query  2589  PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKAS  2410
                       +S  +    H RLGHP+  V  ++   CP   N V S+    SCH +K  
Sbjct  476   DEWTPPSVACSSIVSPFEAHCRLGHPSLPVLKKL---CPQFHN-VPSIDCE-SCHFAKHH  530

Query  2409  RFPLD-RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             R  L  R +  +    +L+++D+WGP PV+S  GFRYF+ F+DD+SR  W Y
Sbjct  531   RISLSPRNNKRANFAFELVHSDVWGPCPVVSKVGFRYFVTFMDDFSRMTWIY  582



>emb|CAN66243.1| hypothetical protein VITISV_015916 [Vitis vinifera]
Length=1258

 Score =   232 bits (592),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 160/467 (34%), Positives = 238/467 (51%), Gaps = 25/467 (5%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F  +++ +F+ SI+ ++ D   EY     T  +++ GI H+ SC +T +Q
Sbjct  508   RTELFSIFQKFYAKIQTRFNISIRVLRSDNAKEYFSAPFTSFMSQHGIIHQSSCTHTPQQ  567

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N   ERK +H+VET   LL    VS ++W+ A   A  LIN +P+ VL  + P++ L   
Sbjct  568   NRVAERKNQHLVETARTLLLHNHVSFRFWEDAVLTACYLINRMPSFVLHDQIPHSLLFPD  627

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL   VFGC C+       + K+  R+  C+FL Y    +GYRC +  + + ++ 
Sbjct  628   QPLY-FLPPHVFGCTCFVQNLTLGQDKLSARATKCIFLGYSRLQKGYRCYSSETHRYFLS  686

Query  1717  RHVHFYESIFLFSDSTL--CSQPVPPTIPWASEP-VVTRAPCNTH-------AAPTDSAH  1568
               V F+E    FS S     S+ +P  +P  S P VV   P   +         P+ +A 
Sbjct  687   ADVTFFEDSPFFSTSEFLPVSEVLP--LPIISPPDVVPSRPLQVYHRRHRVAVPPSLAAI  744

Query  1567  MSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALN  1388
              + + P+P A   P L     +  A  +            +      ++   S    AL+
Sbjct  745   PADSPPIPSASLAPALPPSTDLPIAVRKGNRSTRNPHPIYNFFSYHRLSSPYSAFVSALS  804

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
               + P    +A+ H  WR AM  E  AL  NDTW LV+     + VGC+WV+  K   DG
Sbjct  805   SVSLPKSTPKALSHPGWRQAMVDEMAALHSNDTWDLVVLPYGKSTVGCRWVYTVKVGPDG  864

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
              +++ KARLVAKG+ QV G D+ DTFSLV K  +VRLL S+    +W L QLD+ N FL+
Sbjct  865   QVDRLKARLVAKGYTQVYGSDYGDTFSLVAKIASVRLLLSMAAMRSWHLYQLDIKNVFLH  924

Query  1027  GHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             G L E VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  925   GDLVEEVYMEQPPGFVAQGESSLVCRLRRS--LYGLKQ-----SPRA  964


 Score = 73.9 bits (180),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 91/198 (46%), Gaps = 17/198 (9%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHA-SIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDC  2662
             + NG+  +    G A  +PS    L   +VLY  +    L S+ ++T   N    F    
Sbjct  319   LANGSQTMAKGFGFAHPLPS----LPFHSVLYAHECPFNLISISKITRTLNCSITFSDKF  374

Query  2661  FIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQ  2482
               ++D  T   +  G  S GLY L  +    A   S     + H RLGHP+     +++ 
Sbjct  375   VTLQDRSTGKTIGIGRESQGLYHL--TSPSPAVCISTDAPLLIHSRLGHPSLSKFQKMV-  431

Query  2481  SCPVAPN--KVKSLGSRTSCHLSKASR-FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSG  2311
                  PN   + SL    SC L K +R      ++  +K   +L++TD+WGP    ST G
Sbjct  432   -----PNFSSLSSLACE-SCQLGKHTRVLSPKHLNNRAKYPFELVHTDVWGPCRTASTLG  485

Query  2310  FRYFLLFVDDYSRFCWFY  2257
             F+YF+ F+DDYSR  W +
Sbjct  486   FQYFVTFIDDYSRCTWLF  503



>ref|XP_004149623.1| PREDICTED: uncharacterized protein LOC101211618 [Cucumis sativus]
Length=2085

 Score =   248 bits (633),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 158/481 (33%), Positives = 235/481 (49%), Gaps = 48/481 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSDI +    F   +E QFS+ IK  + D   E         K G TH+ SCAYT +QN 
Sbjct  468   KSDILQVIPRFFKLIETQFSKVIKVFRSDNAPELN-FRDLFAKTGTTHQFSCAYTPQQNS  526

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK++H++    AL+ +  V   +W      A  LIN  P  +L   +P+  L K   
Sbjct  527   VVERKHQHLLNVARALMFQSKVPLIFWGECVLSAAYLINRTPMVLLSNNTPFAALFKKKA  586

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  ++ FGC  Y      NR K + R+ PCVF+ +PP  +GYR  ++   K +I R V 
Sbjct  587   DYNIIKTFGCLAYASTPSVNRSKFDPRAQPCVFMGFPPGIKGYRLYDIAKRKFFISRDVL  646

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPC----------------NTHAAPTDS  1574
             F+E +F F   ++  + +P +  +  + V+   PC                 T  +P DS
Sbjct  647   FFEELFPFH--SIKEKDIPISHDFLEQFVI---PCPLFDCLEKEDSIDARPTTEDSPEDS  701

Query  1573  AHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRL-------------  1433
               +    P     G      + P+   P   R     H    ++                
Sbjct  702   HGVDDQDPHISNSGETSNTDQEPI---PIMTRKSSRPHHPPSYLKDFYCNLTSQNSTPFP  758

Query  1432  --RHMTRDTSEQFHA---LNVTT--DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVL  1274
               ++++ +   Q H     NVT+  +PT Y QAV H  WR AM +E  A+   +TW +V 
Sbjct  759   LNQYLSYNAYSQHHKNYMFNVTSIYEPTYYHQAVKHHTWRKAMAEEIEAMERTNTWTIVS  818

Query  1273  DEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLL  1094
                  + VG KWV++ K   DG+I++YKARLVAKG+NQ  G DF DTFS V K +TV++ 
Sbjct  819   IPKDHHTVGSKWVYKVKCKPDGTIDRYKARLVAKGYNQQEGIDFLDTFSPVAKISTVKIF  878

Query  1093  FSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPD---HVRVSSSTALYGL  923
              +L  S+NW++ Q+D++NAFLNG L E V+M  P GY+    PD    +    + ++YGL
Sbjct  879   LALATSYNWSISQMDINNAFLNGDLFEEVHMTLPLGYQVSQVPDKGEKLACKLNKSIYGL  938

Query  922   R  920
             +
Sbjct  939   K  939


 Score = 58.2 bits (139),  Expect(2) = 3e-73, Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 10/113 (9%)
 Frame = -1

Query  2583  SRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVA--PN--KVKSLGSRTSCHLSK  2416
             S +H A L  +  +++WH+R+GHP+      + +   ++  PN  +V  +     C L+K
Sbjct  357   STAHTA-LMCKVWASMWHKRMGHPSISRIKELAKMIEISDFPNCKEVYHI-----CPLAK  410

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               R     ++  ++NV +L++ DIWGP    + +G  Y    VDD SR+ W Y
Sbjct  411   QRRLSFPILNNIAENVFELIHCDIWGPFKTPTHAGHSYSATIVDDKSRYTWVY  463


 Score = 80.1 bits (196),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 49/184 (27%), Positives = 84/184 (46%), Gaps = 16/184 (9%)
 Frame = -1

Query  2778  SKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGL  2599
             S  L L +VLY+P     L SV  L  ++     F     +++D      + +   + GL
Sbjct  1711  SNDLVLKDVLYIPDFKYNLLSVSTLLKDDKFAISFADSNCLIQDKWLLKTIGKAELTNGL  1770

Query  2598  YRLPVSRS-----HFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVA--PNKVKSLGS  2440
             Y L +            L  + ++++WH+R+GHP+      + +   ++  PN       
Sbjct  1771  YLLRMKNEKVNCIQHTALMCKVSASMWHKRMGHPSISRIKELAKMIEISDFPN------C  1824

Query  2439  RTSCH---LSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRF  2269
             +  CH   L+K  R     ++  ++N+ DL++ DIWGP    + +G  YF   VDD SR+
Sbjct  1825  KEVCHICPLAKQRRLSFPILNNIAENIFDLIHCDIWGPFKTPTHAGHSYFATIVDDKSRY  1884

Query  2268  CWFY  2257
              W Y
Sbjct  1885  TWVY  1888


 Score = 53.1 bits (126),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KSDI +    F   +E QFS+ IK  + D   E         K G TH+ SCAYT +QN 
Sbjct  1893  KSDILQVIPRFFKLIETQFSKVIKVFRSDNAPELN-FRDLFAKTGTTHQFSCAYTPQQNS  1951

Query  2065  RVERKYRHIVETGL  2024
              VERK++H++   +
Sbjct  1952  VVERKHQHLLNEAI  1965



>emb|CAN64963.1| hypothetical protein VITISV_002891 [Vitis vinifera]
Length=1318

 Score =   232 bits (591),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/440 (34%), Positives = 223/440 (51%), Gaps = 30/440 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + + +I   + +F    E QFS+ IK+ + D   EY +      L   GI H  +C  T 
Sbjct  535   KSRFEILPIYSNFAKMDETQFSKRIKTFRSDNALEYTQYAFQALLHSYGIVHHLTCPGTS  594

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +Q  R ERK RHI++T  ALL    V   +W      A   IN +P++V+  ++PY RL 
Sbjct  595   QQKCRAERKLRHILDTVCALLLSAKVPVPFWGEVGLHAIHAINRIPSAVIHNQTPYERLF  654

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+P+   K+E RS    FL Y  + +GYRC +  S  + + 
Sbjct  655   GSPPGYHHLRSFGSACFVLLQPHEHKKLEPRSRLYCFLGYGETQKGYRCYDPVSHCLRVS  714

Query  1717  RHVHFYESIFLFS----DSTLCSQPVPPTIPWAS--------EPVVTRAPCNTHAAPTDS  1574
             R+V F+E           S+L +  +    P  S        +P +  +    +A+P   
Sbjct  715   RNVVFWEHRLFVELSHFRSSLTNSSILEIFPNESLVPSTNTFDPPLDFSQDIFYASPRQV  774

Query  1573  AHMSLTSPVP-LARGLPPLAI-EGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ-  1403
                 +   +P    G P  A+ E P Q  P R            H  R+R +     +  
Sbjct  775   VDEQIDDELPHFEPGSPAPALPEDPPQDIPPR------------HSTRVRSIPPHLLDYH  822

Query  1402  -FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRT  1226
              + AL    +P  Y +A     W+ AM +E +AL  N TW LV   P  ++VGCKW+++ 
Sbjct  823   CYTALATLHEPRTYREAFTDPLWQIAMKEELDALTKNHTWDLVTFPPEQSMVGCKWIYKI  882

Query  1225  KRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDV  1046
             K  +DGS+E+YKARLVAKGF Q  G D+ +TF+ V + ++VR L ++V +  W L Q+DV
Sbjct  883   KTRSDGSVERYKARLVAKGFTQEYGIDYEETFAPVARISSVRALLAVVAARKWDLFQMDV  942

Query  1045  HNAFLNGHLAETVYMKQPPG  986
              NAFLNG L+E VYM+ PPG
Sbjct  943   KNAFLNGDLSEEVYMQPPPG  962


 Score = 73.9 bits (180),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 85/185 (46%), Gaps = 36/185 (19%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L +  V +VP LS  L S+ +L         ++  C IV+D  TR  L  G   G ++  
Sbjct  372   LSVPEVFHVPDLSYNLCSMGQLAELGYRLIFYYFRC-IVQDPRTRQELGTGPRVGRMF--  428

Query  2589  PVSRSHFAYLTSRATS------------TVWHRRLGHPNAHVQNRVLQSCPVAPN-KVKS  2449
             PV+  H   +   +               +WH  LGH               AP+ +V+ 
Sbjct  429   PVNNLHLPPVAPVSVVAAAAAVSSLPSLALWHSCLGH---------------APSSRVQQ  473

Query  2448  LGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRF  2269
             L SR      K    P +     S ++ +L+++D+WGP+P+ S  G RYF++F+DDYSR+
Sbjct  474   LVSR-----GKQPTLPFNNSESISNSIFELIHSDVWGPSPIASIGGSRYFVVFIDDYSRY  528

Query  2268  CWFYP  2254
              W +P
Sbjct  529   SWIFP  533



>emb|CAN74984.1| hypothetical protein VITISV_035210 [Vitis vinifera]
Length=2408

 Score =   223 bits (567),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 157/463 (34%), Positives = 225/463 (49%), Gaps = 61/463 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + +S+I   + +F   +E QFS+ IK+ + D   EY +      L   G  H  +C  T 
Sbjct  1695  KSRSEILSIYSNFAKMIETQFSKRIKTFRSDNALEYTQHAFQALLHSYGTVHHLTCPGTS  1754

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNGR ERK RHI++T  ALL    +   +W  A   A   IN +P++V+  ++PY RL 
Sbjct  1755  QQNGRAERKLRHILDTVRALLLSAKIPAPFWGEAALHAVHAINRIPSAVIHNQTPYERLF  1814

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+ +  +K+E RS  C FL Y  + +GYRC +  S  + + 
Sbjct  1815  GSPPVYHHLRSFGSACFVLLQSHEHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHXLRVS  1874

Query  1717  RHVHFYESIFLFS----DSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSP  1550
             R+V F+E           S+L +  V    P   E +V     +      +  H     P
Sbjct  1875  RNVVFWEHRLFVELSHFRSSLTNSSVLEIFP--XESLVADEQID-----DELPHFETGFP  1927

Query  1549  VPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ--FHALNVTTD  1376
              P    LP    E P Q  P R            H  R+R +     +   + AL    +
Sbjct  1928  APT---LP----EDPPQDIPPR------------HSTRVRSIPPHLLDYHCYTALATLHE  1968

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             P  Y +A     W+ AM +E +AL  N TW LV   P  +VVGCKW+++ K  +DGS+E+
Sbjct  1969  PQTYREASTDPLWQIAMKEELDALTKNHTWDLVPLPPGQSVVGCKWIYKIKTRSDGSVER  2028

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             YKARLVAKGF Q  G D+ +TF+ V +                 +  +DV NAFLNG L+
Sbjct  2029  YKARLVAKGFTQEYGIDYEETFAPVAR-----------------ISSMDVKNAFLNGDLS  2071

Query  1015  ETVYMKQPPGYE-DPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             E VYM+ PPG   +     H+R     ALYGL+      +PRA
Sbjct  2072  EAVYMQPPPGLSVESNKVCHLR----RALYGLKQ-----APRA  2105


 Score = 82.8 bits (203),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 91/186 (49%), Gaps = 20/186 (11%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L +  V +VP LS  L SV +L          +  C IV+D  T   L  G   G ++  
Sbjct  1514  LSVPGVFHVPDLSYNLCSVGQLAELGYRLIFXYSGC-IVQDPRTGXELGTGPRVGXMF--  1570

Query  2589  PVSRSHF------------AYLTSRATSTVWHRRLGHPNAHVQNRVLQ--SCPVAPNKVK  2452
             PVS  H             A ++S  +  + H RLGH ++   +RV Q  S  +  +  K
Sbjct  1571  PVSNLHLPPVAPVSIATAAAAVSSLPSLALXHSRLGHXSS---SRVQQLVSRGLLGSXSK  1627

Query  2451  SLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSR  2272
              +   TSC L K    P +     S ++ +L+++D+WGP+PV S    RYF++F+DDYSR
Sbjct  1628  DIFXCTSCXLXKQPALPFNNXESISNSIFELIHSDVWGPSPVASIGXSRYFVVFIDDYSR  1687

Query  2271  FCWFYP  2254
             + W +P
Sbjct  1688  YSWIFP  1693



>emb|CAN74430.1| hypothetical protein VITISV_010987 [Vitis vinifera]
Length=2471

 Score =   233 bits (595),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 160/461 (35%), Positives = 237/461 (51%), Gaps = 43/461 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + +S+I   + +F   +E QFS+ IK+ + D   EY +      L   G  H  +C  T 
Sbjct  851   KSRSEILSIYNNFAKMIETQFSKRIKTFRSDNALEYTQHAFQALLHSYGTVHHLTCPGTS  910

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNGR ERK RHI++T  ALL    +   +W  A   A   IN +P++V+  ++PY RL 
Sbjct  911   QQNGRAERKLRHILDTVRALLLSAKIPAPFWGEAALHAVHAINRIPSAVIHNQTPYERLF  970

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+ +  +K+E RS  C FL Y  + +GYRC +  S ++ + 
Sbjct  971   GSPPVYHHLRSFGSACFVLLQSHEHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLRVS  1030

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP--  1544
             +         +F + +L    VP T  +  +P +  +P     +P   A   +   +P  
Sbjct  1031  Q---------IFPNESL----VPSTNTF--DPPLDFSPDIFDVSPRQVADEQIDDELPHF  1075

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ--FHALNVTTDPT  1370
               R   P   E P Q  P R            H  R+R +     +   + AL    +P 
Sbjct  1076  ETRSPAPTLPEDPPQDIPPR------------HSTRVRSIPPHLLDYHCYTALATLHEPQ  1123

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
              Y +A     W+ AM +E +AL  N TW LV   P  +VVGCKW+++ K  +DGS+E+YK
Sbjct  1124  TYREASTDPLWQIAMKEELDALTKNHTWDLVPLPPGQSVVGCKWIYKIKTRSDGSVERYK  1183

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVAKGF Q  G D+ +TF+ V + ++VR L ++  +  W L Q+DV NAFLNG L+E 
Sbjct  1184  ARLVAKGFTQEYGIDYEETFAPVARISSVRALLAVAAARQWDLFQMDVKNAFLNGDLSEA  1243

Query  1009  VYMKQPPGYE-DPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             VYM+ PPG   +     H+R     ALYGL+      +PRA
Sbjct  1244  VYMQPPPGLSVESNKVCHLR----RALYGLKQ-----APRA  1275


 Score = 71.6 bits (174),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 83/182 (46%), Gaps = 51/182 (28%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L +  V +VP LS  L SV +L      F  ++  C IV+D  TR  L  G   G ++ +
Sbjct  709   LFVPGVFHVPDLSYNLCSVGQLAELGYRFIFYYSGC-IVQDPKTRQELGTGPRVGRMFTV  767

Query  2589  ------PVSRSHFAYLTSRATS----TVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGS  2440
                   PV+  + A + +  +S     +WH RLGH ++   +RV                
Sbjct  768   SNLHLPPVAPVYIAIVAAAVSSLPSLALWHSRLGHASS---SRV----------------  808

Query  2439  RTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWF  2260
                                  +++ +L+++D+W P+PV S  G RYF++F+DDYSR+ W 
Sbjct  809   ---------------------QHIFELIHSDVWEPSPVASIGGSRYFVIFIDDYSRYSWI  847

Query  2259  YP  2254
             +P
Sbjct  848   FP  849


 Score = 75.5 bits (184),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -3

Query  1396  ALNVTT--DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTK  1223
             AL++++  + T YS+      W+DAM  +  AL  N TW L    P  +++GC+WV++ K
Sbjct  76    ALSISSHFESTLYSKVALTPEWQDAMLTKLQALKVNSTWSLTSLPPRKHLIGCEWVYKIK  135

Query  1222  RNADGSIEQYKARLVAKGFNQVAGDDFFDTF  1130
               A+GSIE YKA LVAKGF      DF D F
Sbjct  136   YKANGSIETYKAYLVAKGFTHQEWVDFIDLF  166



>gb|AAG50751.1|AC079733_19 polyprotein, putative [Arabidopsis thaliana]
Length=1468

 Score =   231 bits (589),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 165/504 (33%), Positives = 234/504 (46%), Gaps = 69/504 (14%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+  K  + F   VERQF   IK ++ D G E+  +       GI H  SC  T  QNG
Sbjct  612   KSETQKHLKDFIALVERQFDTEIKIVRSDNGTEFLCMREYFLHKGIAHETSCVGTPHQNG  671

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK+RHI+    AL  +  +  Q+W      A  LIN  P+ +LQ +SPY  L+KT P
Sbjct  672   RVERKHRHILNIARALRFQSYLPIQFWGECILSAAYLINRTPSMLLQGKSPYEMLYKTAP  731

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ LRVFG  CY + + +   K   RS  CVF+ YP   +G+R  +L   K ++ R V 
Sbjct  732   KYSHLRVFGSLCYAHNQNHKGDKFAARSRRCVFVGYPHGQKGWRLFDLEEQKFFVSRDVI  791

Query  1705  FYESIFLFS--------DSTLCSQPVPPTIPWASEP--VVTRAPCNTHAAPTDSA-----  1571
             F E+ F +S        +  L     PP I  A  P  ++ R        P  +      
Sbjct  792   FQETEFPYSKMSCNEEDERVLVDCVGPPFIEEAIGPRTIIGRNIGEATVGPNVATGPIIP  851

Query  1570  --HMSLTSPVPLA--RGLPPLAIEGPVQT----------APTRARAV*TQHQERGHVMRL  1433
               +   +SP        L P      VQT          AP + R    Q Q+    M+L
Sbjct  852   EINQESSSPSEFVSLSSLDPFLASSTVQTADLPLSSTTPAPIQLRRSSRQTQK---PMKL  908

Query  1432  RHMTRDTSEQ-------------------------------FHALNVTTDPTCYSQAVGH  1346
             ++   +T                                    A+    +PT Y++A+  
Sbjct  909   KNFVTNTVSVESISPEASSSSLYPIEKYVDCHRFTSSHKAFLAAVTAGMEPTTYNEAMVD  968

Query  1345  L*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGF  1166
               WR+AM  E  +L  N T+ +V   P    +G KWV++ K  +DG+IE+YKARLV  G 
Sbjct  969   KAWREAMSAEIESLRVNQTFSIVNLPPGKRALGNKWVYKIKYRSDGAIERYKARLVVLGN  1028

Query  1165  NQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPG  986
              Q  G D+ +TF+ V K +TVRL   +  + +W + Q+DVHNAFL+G L E VYMK P G
Sbjct  1029  CQKEGVDYDETFAPVAKMSTVRLFLGVAAARDWHVHQMDVHNAFLHGDLKEEVYMKLPQG  1088

Query  985   Y--EDPTHPDHVRVSSSTALYGLR  920
             +  +DP+    +  S    LYGL+
Sbjct  1089  FQCDDPSKVCRLHKS----LYGLK  1108


 Score = 74.3 bits (181),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 81/180 (45%), Gaps = 29/180 (16%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             L L +V YV +L   L SV ++ +EN+             D  TR V   G    G +  
Sbjct  448   LILKSVFYVKELESDLISVGQMMDENHCV-----------DRTTRMVTRIGKRENGSFCF  496

Query  2589  PVSRSHFAYLTS-RATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR------TS  2431
                 +  A  TS +A   +WHRRLGH +  + N       + P ++ S G         +
Sbjct  497   RGMENAAAVHTSVKAPFDLWHRRLGHASDKIVN-------LLPRELLSSGKEILENVCDT  549

Query  2430  CHLSKASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             C  +K +R  FPL      S +   L++ D+WGP    S SG RYFL  VDDYSR  W Y
Sbjct  550   CMRAKQTRDTFPLS--DNRSMDSFQLIHCDVWGPYRAPSYSGARYFLTIVDDYSRGVWVY  607



>emb|CAN65144.1| hypothetical protein VITISV_026080 [Vitis vinifera]
Length=1220

 Score =   212 bits (540),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 154/455 (34%), Positives = 211/455 (46%), Gaps = 70/455 (15%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             +S+++  F +F   ++ Q+  S K +  D G EY       ++ GI H+ SC  T  QN 
Sbjct  514   RSEVFSHFCAFSAXIKTQYDVSXKILXSDNGKEY-------SQWGILHQTSCVDTXSQNX  566

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK RH++ET  AL+ +  V +Q+W  A   A  LIN +PT VL+ + PY  +H    
Sbjct  567   VXERKNRHLLETARALMFQMKVPKQFWADAVSTACFLINRMPTVVLKGDIPYKXIHPQKS  626

Query  1885  PYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              +    R+FGC CY    RP+   K++ ++  CVFL Y    +GYRC +    K  +   
Sbjct  627   LFPLAPRIFGCTCYVRDTRPFVT-KLDPKALQCVFLGYSRLQKGYRCFSPDLNKYLVSTD  685

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARG  1532
             V F E    FS  T  S        W    VV   P    ++  DS              
Sbjct  686   VVFSEDTSFFSSPT--SXASEEDEEWLVYQVVNSRPTVGQSSVVDSD-------------  730

Query  1531  LPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAV  1352
                LA  GPV                                    +N+   P     A+
Sbjct  731   -ASLAHSGPV------------------------------------VNIPPAPAKPPIAL  753

Query  1351  GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAK  1172
              H  W++AM +E  AL  N TW LV       VVGCKWVF  K   DGS+ + KARLVA+
Sbjct  754   NHPGWKNAMLEEICALEDNHTWXLVDLPQGKKVVGCKWVFAVKVXPDGSVARLKARLVAR  813

Query  1171  GFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQP  992
             G+ Q  G D+ DTFS V K  +VRL  S+  S  W + QLD+ NAFL+G L E VY++QP
Sbjct  814   GYAQTYGVDYSDTFSPVAKLNSVRLFISIAASQQWMIHQLDIKNAFLHGDLEEEVYLEQP  873

Query  991   PGYEDPTHPDHVRVSS-STALYGLRGVKMG*SPRA  890
             PG+      ++ +V     ALYGL+      SPRA
Sbjct  874   PGF--VAQGEYGKVCRLKKALYGLKQ-----SPRA  901


 Score = 92.4 bits (228),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 87/171 (51%), Gaps = 20/171 (12%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             + LS+VL +P L+  L SV +LT   N    F  D  + +D +T+    +G  S GLY L
Sbjct  359   ITLSSVLNLPNLAFNLISVSKLTKNLNCSVSFFPDHCVFQDLMTKRTFGKGHVSDGLYIL  418

Query  2589  PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKAS  2410
                        S A+    H RLGHP+  V  +++ S     +   SLG R         
Sbjct  419   DEWVPRPVACVSTASPVEAHCRLGHPSLPVLKKIMSS-----HHRSSLGPR---------  464

Query  2409  RFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                   ++  ++++ +L+++D+WGP PV S +GFRYF+ FVDD+SR  W Y
Sbjct  465   ------LNKRAESLFELVHSDVWGPCPVTSQTGFRYFVTFVDDFSRMTWIY  509



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score =   224 bits (571),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 157/458 (34%), Positives = 222/458 (48%), Gaps = 85/458 (19%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F  F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  533   RAELFSIFXKFYTEIQTQFNISIRVLRSDNAXEYFSAQFTSFMSHHGILHQSSCAHTPQQ  592

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  593   NGVAERKNRHLVETARTLLLHXHVPFRFWGDAVLTACYLINRMPSSVLHDQJPHSLLFPD  652

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  653   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  711

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS-PVPL  1541
               V F+E                                       DS   S TS  +P+
Sbjct  712   ADVTFFE---------------------------------------DSPFFSTTSESLPV  732

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYS  1361
             +  LP ++I  P    P R   V                       +H   +        
Sbjct  733   SEVLP-ISIVSPPDAMPPRPLQV-----------------------YHRRPL--------  760

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ KARL
Sbjct  761   EALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRLKARL  820

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ NAFL+G LAE VYM
Sbjct  821   VAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDLAEEVYM  880

Query  1000  KQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             +QPPG+        V R+  S  LYGL+      SPRA
Sbjct  881   EQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  911


 Score = 80.5 bits (197),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 83/176 (47%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  366   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  424

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRV------LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H  LGHP+     ++      L S P             SC L 
Sbjct  425   DSSPAVCISTDAPLLIHNXLGHPSLSKFXKMVPHFFTLSSLPCE-----------SCQLG  473

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  474   KHTRVSFP-KRLNNRAKSXFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  528



>gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum]
Length=1333

 Score =   223 bits (569),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 159/474 (34%), Positives = 230/474 (49%), Gaps = 61/474 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTL--TKLGITHRKSCAYTH  2078
             + KS+ ++TF+ F+  VE Q    IKS++ D GGE+      L   + GI    +  YT 
Sbjct  542   KFKSETFETFKKFKAFVENQSGNKIKSLRTDRGGEFLSNDFNLFCEENGIRRELTAPYTP  601

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNG  ERK R +VE   + L    +   +W  A       +N  PT  +   +P    +
Sbjct  602   EQNGVAERKNRTVVEMARSSLKAKGLPDYFWGEAVATVVYFLNISPTKDVWNTTPLEAWN  661

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P  + LR+FGC  Y  +  ++  K++ +S  C+F+ Y    + YR  N  SGK+ I 
Sbjct  662   GKKPRVSHLRIFGCIAYALVNFHS--KLDEKSTKCIFVGYSLQSKAYRLYNPISGKVIIS  719

Query  1717  RHVHFYESI-FLFSDSTLCSQPVPPTIPWASEPVV-----------------TRAPCNTH  1592
             R+V F E + + F+   + S      +P   E  V                   AP  T 
Sbjct  720   RNVVFNEDVSWNFNSGNMMSNI--QLLPTDEESAVDFGNSPNSSPVSSSVSSPIAPSTT-  776

Query  1591  AAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDT  1412
              AP +S+      P+PL R               TR +    ++            T +T
Sbjct  777   VAPDESS----VEPIPLRR--------------STREKKPNPKYSN----------TVNT  808

Query  1411  SEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
             S QF  L   +DP CY +AV    W++AM +E  A+  N TW+LV      NV+G KWVF
Sbjct  809   SCQFALL--VSDPICYEEAVEQSEWKNAMIEEIQAIERNSTWELVDAPEGKNVIGLKWVF  866

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             RTK NADGSI+++KARLVAKG++Q  G DF +TFS V +  TVR++ +L    +  + Q 
Sbjct  867   RTKYNADGSIQKHKARLVAKGYSQQQGVDFDETFSPVARFETVRVVLALAAQLHLPVYQF  926

Query  1051  DVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             DV +AFLNG L E VY+ QP G+    + + V      ALYGL+      +PRA
Sbjct  927   DVKSAFLNGDLEEEVYVSQPQGFMITGNENKV-YKLRKALYGLKQ-----APRA  974


 Score = 80.9 bits (198),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 101/219 (46%), Gaps = 10/219 (5%)
 Frame = -1

Query  2892  TASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPS-ESKLLHLSNVLYVPKLSVPLFS  2716
             + S+    DE   S+V R+G+   + I   G   I + +  +  L +V YVP L+  L S
Sbjct  324   SKSLFRDLDESQKSEV-RLGDDKQVHIEGKGTVEIKTVQGNVKFLYDVQYVPTLAHNLLS  382

Query  2715  VYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLT--SRATS  2542
             V +L         +   C I      R +     T   ++ L +S    + L    +  +
Sbjct  383   VGQLMTSGYSVVFYDNACDIKDKESGRTIARVPMTQNKMFPLDISNVGNSALVVKEKNET  442

Query  2541  TVWHRRLGHPNAHVQNRVLQSCPVA--PNKVKSLGSRTSCHLSKASR--FPLDRVSYSSK  2374
              +WH R GH N +    ++Q   V   PN +K L     C   K +R  FP+ + S+ + 
Sbjct  443   NLWHLRYGHLNVNWLKLLVQKDMVIGLPN-IKELDLCEGCIYGKQTRKSFPVGK-SWRAT  500

Query  2373  NVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               L+L++ D+ GP  + S  G RYFL+F DDYSRF W Y
Sbjct  501   TCLELVHADLCGPMKMESLGGSRYFLMFTDDYSRFSWVY  539



>ref|XP_008379771.1| PREDICTED: uncharacterized protein LOC103442736 [Malus domestica]
Length=1017

 Score =   272 bits (695),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 164/441 (37%), Positives = 234/441 (53%), Gaps = 60/441 (14%)
 Frame = -3

Query  2191  FSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRHIVETGLAL  2018
             F+  I+++Q D GGEY  +     L   GITH KSC YT EQNG VERK+RHI+ET + L
Sbjct  583   FATPIQTLQSDGGGEYVSKAFQSFLLAKGITHHKSCPYTPEQNGLVERKHRHIIETTVTL  642

Query  2017  LAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGCRCYPYL  1838
             L    +   +W +A + A  LIN +PT VL   SP+  L    P  + LR FGC CYP L
Sbjct  643   LQTARLPALFWSYACQTAIYLINRMPTPVLGNHSPFELLFGLLPVISHLRSFGCACYPLL  702

Query  1837  RPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSD------  1676
             +PYN  K++ ++  C+FL Y  +++GY C  ++  ++YI RHV F ES F ++D      
Sbjct  703   KPYNDSKLQPKTTKCIFLGYATNYKGYICYEVSKQRLYISRHVVFDESQFPYTDLLFHHN  762

Query  1675  -----STLCSQPVP-----------PTIPWASE-----------PVVTRAPCNTHAAPTD  1577
                  ST+ S PVP           PT+P  S+           P ++ +P  +    + 
Sbjct  763   SSHIGSTIHS-PVPIVSTDNVVVSMPTVPITSQSHPASSNLPGSPTISLSPITSSPLSSQ  821

Query  1576  SAHMSLTS--PVPLARGLPPLAIEG---------------PVQTAPTRARAV*TQHQERG  1448
             S     TS  PV L  G P   +                 P+   P + R+      + G
Sbjct  822   SITAFTTSQPPVALVNGSPQSQVPAVQFHPDTLSVVLEVPPINLHPMQTRS------KSG  875

Query  1447  HVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDE  1268
              + ++  +      +   L++  +PT Y  A  +  W  AM +E + L    TW LV+  
Sbjct  876   IIKKIALLATVQESEGTDLSL-IEPTSYKSAFKNPIWFKAMQEEISVLHTQGTWNLVVIP  934

Query  1267  PHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFS  1088
                N+VGCKW+F+ KR++DG+I ++KARLVAKGF+Q  G D+ +TFS VVKPTTVRL+ +
Sbjct  935   SSKNLVGCKWIFKIKRHSDGTIARHKARLVAKGFSQEPGIDYGETFSPVVKPTTVRLVLA  994

Query  1087  LVVSHNWTLRQLDVHNAFLNG  1025
             L     W+LRQLDV NAFL+G
Sbjct  995   LAAQFGWSLRQLDVKNAFLHG  1015



>ref|XP_010507647.1| PREDICTED: uncharacterized protein LOC104784298 [Camelina sativa]
Length=921

 Score =   177 bits (450),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 127/223 (57%), Gaps = 4/223 (2%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS I   F++F+  VE  F  + +++  D GGEY  +   L   GI+H  +  +T E 
Sbjct  515   RNKSVIQSVFKAFKPLVENHFWETTQTLYSDNGGEYIALRGYLASHGISHYTTPPHTLEH  574

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGLALL++ S+  +YW +AF  A  LIN LPT  L   SPY +L   
Sbjct  575   NGISERKHRHIVETGLALLSQASMPLRYWSYAFSTAVYLINRLPTPSLSDISPYHKLFAV  634

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP Y  LRVFGC C+P+LRPY  HK++ RS  CVFL Y  +   Y C+++ SG++Y+ RH
Sbjct  635   PPNYNKLRVFGCACFPWLRPYTSHKLDARSKRCVFLGYSLTQSAYCCLDVQSGRVYVSRH  694

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAP  1583
             V F E  F F     CS   P T      P  +  P     AP
Sbjct  695   VQFLEIDFPFR----CSVLAPATSDNGLTPTASVIPLVQSFAP  733


 Score =   124 bits (310),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 109/208 (52%), Gaps = 6/208 (3%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             YTG + + +G+G+GL+I+  G   + + SK   L NVL VP +   L  VYR  N N V 
Sbjct  307   YTGGEDVVIGDGSGLLITHTGSTILSTLSKSFELENVLCVPNIHKNLIYVYRFCNANQVS  366

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSH----FAYLTSRATSTVWHRRLGH  2515
              +F    F VKD  TR  LL+  T   LY  P+S S     +A  T + T + WH RLGH
Sbjct  367   IKFFPAWFQVKDLSTRVRLLQDQTKNDLYEWPISASQAAAFYASPTPKTTLSSWHARLGH  426

Query  2514  PNAHV-QNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWG  2338
             P+A V Q  V +      +   +  S + C L+K  +        +S   L  L+TD+W 
Sbjct  427   PSASVLQTIVSRFSLPLSSSASAPLSCSECLLNKTHKLSFASSFITSVRPLQYLFTDVWT  486

Query  2337  PAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
              +PV S   F+Y+L+ VD ++R+ WFYP
Sbjct  487   -SPVASVDNFKYYLILVDHFTRYTWFYP  513



>emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera]
Length=1125

 Score =   214 bits (545),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 213/410 (52%), Gaps = 30/410 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+      +F   V+ QF  SI +I+ D GGE+        + G T++ SC YT +QNG
Sbjct  348   KSETQHLLVNFFSFVQTQFHVSIANIRVDNGGEFFSXREFFKQKGTTYQHSCVYTPQQNG  407

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RHI+E+  A   +  +   +W      A  +IN LPT +L  ++P+ RL+   P
Sbjct  408   VVERKHRHILESARAFXFQAHLPLPFWAECVSTAVHIINRLPTPLLSRQTPFERLYGKLP  467

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ +RVFGC  Y     +  HK   R+  C+FL YP   + Y+  +L + +++  R V 
Sbjct  468   SYSHIRVFGCLAYA-TNVHVPHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVV  526

Query  1705  FYESIFLF---------SDSTLCSQPVPPTIPWASEPVVTRA--PCNTHAAPTDSAHMSL  1559
             F+E+IF +         SD  L S  +    P   EP++ R+  P +   A  D     +
Sbjct  527   FHETIFPYESIPSPSSNSDPFLLSHHLASPPP---EPILRRSQRPHHPPMALRDYVCNQV  583

Query  1558  TSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT  1379
             TSP      LPPL+      ++P +     T++     V   R+  +  S    A++   
Sbjct  584   TSP----NHLPPLS------SSPQKG----TRYPLCNFVSYHRYSPQHRSFT-AAVSQDI  628

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +PT Y++A  H  W++AM  E   L  N TW L    P    +GC+WV++ K ++DG+IE
Sbjct  629   EPTSYAEATSHSHWQEAMQSELATLEANHTWSLTSLPPGKKPIGCRWVYKIKXHSDGTIE  688

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
             ++KARLVAKG+ Q+ G D+ DTFS   K   VR L +L  + NW+L QLD
Sbjct  689   RFKARLVAKGYTQLEGIDYHDTFSPTAKMIXVRCLLALAAAQNWSLHQLD  738


 Score = 87.8 bits (216),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 98/214 (46%), Gaps = 42/214 (20%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
             +G    I+ +G+  + S + L    NVL VP   V L SV R+T + N    F     I+
Sbjct  142   SGEQAPITSIGNLPLNSAATL---KNVLGVPSFKVDLMSVSRVTKDLNCSVTFFPHWCIL  198

Query  2652  KDSITRAVLLRGSTSGGLYRL-------PVSRSHFAYLTS--------RATSTVWHRRLG  2518
             +D  TR  +  G    GLY L       P +++  A  TS         +++ +WHRRLG
Sbjct  199   QDLTTRTTIGLGEQRDGLYYLVALASEKPKTQTPSAATTSCRSPSSQVTSSTALWHRRLG  258

Query  2517  HPNA--------HVQNRVLQS---CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKN  2371
             H ++        H+ N   QS   C V             C L+K  + P    S SS  
Sbjct  259   HLSSSRLDFMAKHLLNFHFQSNNACDV-------------CALAKQRQLPFSVSSISSVR  305

Query  2370  VLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRF  2269
               +L++ DIWGP  + S SG +YFL  VDDYSRF
Sbjct  306   PFELIHCDIWGPYKIASLSGAKYFLTIVDDYSRF  339



>emb|CAN71037.1| hypothetical protein VITISV_011061 [Vitis vinifera]
Length=1220

 Score =   227 bits (579),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 151/457 (33%), Positives = 217/457 (47%), Gaps = 64/457 (14%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +   F+SF+  VE Q  +++K +  D GGEY      LT           Y  +Q
Sbjct  534   KTKSQVLSMFKSFKKMVETQSGQNVKVLIIDNGGEYISKEFNLT---------APYLPQQ  584

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             N   ERK + ++E    +L E  + +  W  A   +  L+N LPT  +Q ++P       
Sbjct  585   NEVSERKNKTVMEMARCMLFEKRLPKLLWAEAVNTSVYLLNRLPTKSVQSKTPIEAWFGV  644

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    L+VFG  CY ++    R K++ R+   VF+ Y    +GYR  +L+  KI I R 
Sbjct  645   KPSVKHLKVFGSLCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIVISRD  704

Query  1711  VHFYESIFL---FSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             VHF E+ +          C Q  P  +  A E ++   P +  A          TS  P+
Sbjct  705   VHFDENSYWNWDLKKVHKCDQNTPSILEPAIESIIIEGPLDVEA----------TSDTPM  754

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYS  1361
              + + PL+                                 D  E+ +   V  +PTCY+
Sbjct  755   LK-MRPLS---------------------------------DVYERCNL--VHAEPTCYT  778

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +A   L W  AM  E +A+  N TWKL       N +G KWVFRTK N+DGSI ++KARL
Sbjct  779   EAARFLEWIKAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSIFRHKARL  838

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             V KGF QVA  D+ DTF+LV K  T+RLL +L     W +  L+V +AFLNG L E +Y+
Sbjct  839   VVKGFAQVARVDYGDTFALVAKHDTIRLLLALASQMGWKVYHLNVKSAFLNGILLEEIYV  898

Query  1000  KQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             +QP G+E   H +H       A+YGL+      +PRA
Sbjct  899   QQPEGFEVIGH-EHKVYKLHKAVYGLKQ-----APRA  929


 Score = 74.7 bits (182),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 99/202 (49%), Gaps = 10/202 (5%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +++GNG  +     G  +I ++     ++NVLY+P L   L SV ++   N     F ++
Sbjct  334   VKLGNGEVVQAKGKGTIAISTKRGTKIVTNVLYIPDLDQNLLSVAQMLR-NGYAVSFKEN  392

Query  2664  -CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRA-TSTVWHRRLGHPNAHVQNR  2491
              CFI   ++    + +   +G ++ L +        +++   S VWH+  GH N     R
Sbjct  393   FCFIT--NVQEKEIAKIKMNGNIFYLKLDLVEGHVFSAKIDESVVWHKSYGHFNLKSL-R  449

Query  2490  VLQSCPVAPNKVK-SLGSRT--SCHLSKASRFPL-DRVSYSSKNVLDLLYTDIWGPAPVI  2323
              +Q   +  + ++ S+ ++T  SC L K  R P    +S  + + L+L+++ I GP  + 
Sbjct  450   FMQEAGMVEDMLEISVNAQTCESCELGKQQRQPFPQNMSKRATHELELIHSYICGPMSIA  509

Query  2322  STSGFRYFLLFVDDYSRFCWFY  2257
             S S   YF LF+DD SR  W Y
Sbjct  510   SLSNNVYFALFIDDLSRMTWVY  531



>emb|CAN77210.1| hypothetical protein VITISV_000141 [Vitis vinifera]
Length=1236

 Score =   226 bits (577),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 159/461 (34%), Positives = 228/461 (49%), Gaps = 54/461 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI  ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  465   RAELFSIFQKFYAEIQTQFNISIHVLRSDNAREYFSAPFTSFMSHHGILHQSSCAHTPQQ  524

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   +L   +V  ++W      A  LIN +P+SVL  + P++ L   
Sbjct  525   NGVAERKNRHLVETARTILLHSNVPFRFWGDVVLTACYLINRMPSSVLHDQIPHSLLFPN  584

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVF C C+ ++    + K+  ++  C FL Y    +G RC +L + + +I 
Sbjct  585   QPLY-FLPPRVFSCTCFVHILTPGQDKLSAKAMKCFFLGYSRIQKGCRCYSLETHRYFIS  643

Query  1717  RHVHFYESIFLFS---DSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPV  1547
              +V F+E    FS   +S   S+ +P  I   ++ V  R     H  P  +A        
Sbjct  644   AYVTFFEDSPFFSITSESLSVSEVLPLPIVSPADVVSPRPFQVYHRRPRVTA--------  695

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTD-PT  1370
                   P L  E P  + PT                        ++    AL    D P 
Sbjct  696   ------PLLFAEAPANSLPT-----------------------PSASPAPALPSPNDLPI  726

Query  1369  CYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
                +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ K
Sbjct  727   AIRKALSHPGWRQAMVDEMVALHSNGTWDLVVLPFGKSTVGCRWVYAVKVGPDGQVDRLK  786

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVAKG+ QV G D+ DTFSLV K  + RLL S+    +W L QLD+ NAFL+G L E 
Sbjct  787   ARLVAKGYTQVYGSDYGDTFSLVAKIASARLLLSMTAMCSWPLYQLDIKNAFLHGDLVEE  846

Query  1009  VYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  847   VYMEQPPGFVTQGESGLVCRLRRS--LYGLKQ-----SPRA  880


 Score = 75.1 bits (183),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 83/172 (48%), Gaps = 23/172 (13%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ +LT   N    F        D  T  +   G  S GLY L  S
Sbjct  308   TSVLYTPECPFNLISISKLTRTLNCSITF-------SDKFTIGI---GRESQGLYHL-TS  356

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGS--RTSCHLSKASR  2407
              S  A   S     + H RLGH   H  ++  +  P    +  +L S    SC L K +R
Sbjct  357   DSSVAVCISTDAPLLIHNRLGH---HSLSKFQKMVP----RFSTLSSLPYESCQLGKHTR  409

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L++ D+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  410   VSFP-KRLNNRAKSPFELVHIDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  460



>emb|CDY58610.1| BnaCnng33390D [Brassica napus]
Length=856

 Score =   167 bits (422),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 118/195 (61%), Gaps = 0/195 (0%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +  TF +F+  VE +F   + ++  + GGE+  +   L+  GI+H  S  +T E 
Sbjct  343   KQKSQVRDTFIAFKAIVENRFQTKLMTLYSENGGEFIALRQFLSTHGISHLTSPPHTPEH  402

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RHIVETGL LL +  +   YW +AF  A  L+N LP+SVL+  SPY +L + 
Sbjct  403   NGIAERKHRHIVETGLTLLHQAVMPATYWTYAFSTAVYLMNRLPSSVLENTSPYQKLFQQ  462

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y  LRVF C CYP+LR Y  HK+E RS  CVFL Y  +   Y C+N ++G+IY  RH
Sbjct  463   TPHYQKLRVFCCACYPWLRLYVSHKLEQRSQLCVFLGYSLTQSAYLCLNKSTGRIYTLRH  522

Query  1711  VHFYESIFLFSDSTL  1667
             V F E  F FS  T+
Sbjct  523   VQFVEDHFPFSIKTV  537


 Score =   134 bits (338),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 120/213 (56%), Gaps = 16/213 (8%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G + + + +G+GL IS  G +S+ + S+ L L+N+L+VP L   L SVYRL N N V 
Sbjct  135   YNGGEEVVIADGSGLPISHTGSSSLTTPSRSLALNNILFVPNLHKNLISVYRLCNTNKVS  194

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV----SRSHFAYLTSRATSTVWHRRLGH  2515
              EF    F VKD  T A LL+G T   LY  PV    S S FA  + + T + WH RLGH
Sbjct  195   VEFFPAHFQVKDLSTGARLLQGRTKDELYEWPVQTTRSISLFASPSPKTTLSSWHARLGH  254

Query  2514  PNAHVQNRVLQ------SCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLY  2353
             P+    N VLQ      S P++    K     + C ++K+ + P    +  S+  L+ +Y
Sbjct  255   PS----NTVLQTLVSHFSLPLSTTSHKQ-SPCSHCLINKSHKLPFYSNTIHSQKPLEYVY  309

Query  2352  TDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             +D+W  +P+IS   F+Y+L+FVD Y+R+ W YP
Sbjct  310   SDVWT-SPLISVDNFKYYLVFVDHYTRYTWLYP  341



>gb|AGV40508.1| hypothetical protein [Phaseolus vulgaris]
Length=1121

 Score =   171 bits (434),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 113/190 (59%), Gaps = 1/190 (1%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS +   F++F+  VE Q    I ++Q D   EY  +   L + GI HR SC YTHEQNG
Sbjct  454   KSQVKNVFKTFKNLVENQTGYKIHALQSDNAKEYLSLTSYLQECGINHRLSCPYTHEQNG  513

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RHIV+ GL LL+  S+  ++W  AF  A   IN LPT VL+ ++PY  L K PP
Sbjct  514   YVERKHRHIVDMGLTLLSTASLPLKFWAEAFVAAVHTINVLPTDVLKGDNPYNMLFKHPP  573

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y   +VFGC CYP LRPYN++K  +RS  C+FL Y     GY C+    GK  + RHV 
Sbjct  574   NYKKFKVFGCACYPNLRPYNQYKFVFRSTCCLFLRYSIRHAGYICLT-QDGKTIVSRHVV  632

Query  1705  FYESIFLFSD  1676
             F E  F + D
Sbjct  633   FDEKSFPYKD  642


 Score =   129 bits (325),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 120/220 (55%), Gaps = 11/220 (5%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHAS-IPSES-KLLHLSNVLYVPKLSVPLFS  2716
             +S+ S    Y G+D++++G+G GL IS +G A+ +PS S K L L+++L+VP ++  L S
Sbjct  232   SSVYSDKQPYDGTDLVKMGSGKGLFISHIGSANFLPSTSNKPLFLTDLLHVPSITKNLLS  291

Query  2715  VYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLP-------VSRSHFAYLT  2557
             V +   +NNV FEFH +   V D  T+ VLL+G     LY           S    +++ 
Sbjct  292   VSKFCRDNNVIFEFHSNSCYVLDQETKRVLLQGYLKDSLYIFSDLHSLSSCSVHSMSFIA  351

Query  2556  SRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSS  2377
                +   WH R GH + ++  ++L SC +  +      S  SC   K  + P    +++ 
Sbjct  352   EPISVNQWHERFGHCSFNILKKILASCDIFVSNNIVFCS--SCVRGKCHQLPFYNSTHTY  409

Query  2376  KNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                L L+YTD+WGP  V+ ++G RY++ FVD YS+F W Y
Sbjct  410   SQPLRLIYTDVWGPTSVLVSNGARYYVSFVDAYSKFTWLY  449


 Score =   115 bits (287),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = -3

Query  1237  VFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLR  1058
             V R K NADGS+++ KARLVAKGF+Q AG D+ +TFS +V+ +T+RL+ + VVS  W++R
Sbjct  735   VTRAKLNADGSLQRCKARLVAKGFHQTAGIDYAETFSPIVRHSTIRLVLAHVVSSRWSIR  794

Query  1057  QLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             Q+D++NAFLNG L E V+M+QPPG+   T   H+    + A+YGL+
Sbjct  795   QIDINNAFLNGDLQECVFMQQPPGFNTTT--PHLVCQLNKAIYGLK  838



>gb|AAG51247.1|AC055769_6 copia-type polyprotein, putative; 28768-32772 [Arabidopsis thaliana]
Length=1334

 Score =   226 bits (576),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/462 (31%), Positives = 226/462 (49%), Gaps = 27/462 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS+ ++ F+ F+  VER+  + +  ++ D GGEY  R+      + GI  + + AYT +Q
Sbjct  537   KSETFQFFKEFKAEVERESGKKLVCLRSDRGGEYNSREFDEYCKEFGIKRQLTAAYTPQQ  596

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK R ++     +L E SV +++W  A + A  ++N  P+  L   +P  +    
Sbjct  597   NGVAERKNRSVMNMTRCMLMEMSVPRKFWPEAVQYAVYILNRSPSKALNDITPEEKWSSW  656

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    LR+FG   Y  +    R K++ +S  CV        + YR  +  +GKI I R 
Sbjct  657   KPSVEHLRIFGSLAYALVPYQKRIKLDEKSIKCVMFGVSKESKAYRLYDPATGKILISRD  716

Query  1711  VHFYES-IFLFSDSTLCSQPVPPTIPWAS---EPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             V F E   + + D +L  + V     W +   EP     P   H    D           
Sbjct  717   VQFDEERGWEWEDKSLEEELV-----WDNSDHEPAGEEGPEINHNGQQDQEETEEEEETV  771

Query  1543  LA---RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVT-TD  1376
                  + LP +   G  Q    R + V  +    G+   L  +T+D  ++  AL +   D
Sbjct  772   AETVHQNLPAVGTGGVRQ----RQQPVWMKDYVVGNARVL--ITQDEEDEVLALFIGPDD  825

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             P C+ +A     WR AM+ E  ++  N+TW+LV       V+G KW+F+TK N  G +++
Sbjct  826   PVCFEEAAQLEVWRKAMEAEITSIEENNTWELVELPEEAKVIGLKWIFKTKFNEKGEVDK  885

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             +KARLVAKG++Q  G DF++ F+ V K  T+RL+  L     W++ QLDV +AFL+G L 
Sbjct  886   FKARLVAKGYHQRYGVDFYEVFAPVAKWDTIRLILGLAAEKGWSVFQLDVKSAFLHGDLK  945

Query  1015  ETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             E V+++QP G+E       V      ALYGL+      +PRA
Sbjct  946   EDVFVEQPKGFEVEEESSKV-YKLKKALYGLKQ-----APRA  981


 Score = 74.7 bits (182),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (45%), Gaps = 14/209 (7%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +R+G+   + +   G   +  + ++  +S+V +VP L   LFSV +L  +   F      
Sbjct  325   VRLGDDRRMAVEGKGKLRLEVDGRIQVISDVYFVPGLKNNLFSVGQLQQKGLRFIIEGDV  384

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRL--PVSRSHFAYLTS-----RATSTVWHRRLGHPNA  2506
             C +   +  R V+    T   ++ +   V +S     T         + +WH+R GH N 
Sbjct  385   CEVWHKTEKRMVMHSTMTKNRMFVVFAAVKKSKETEETRCLQVIGKANNMWHKRFGHLN-  443

Query  2505  HVQNRVLQSCPVAPNKVK-SLGSRTS----CHLSKASRFPLDRVS-YSSKNVLDLLYTDI  2344
             H   R L    +     K  LG   +    C   K  R  + + S + S  VL L++TDI
Sbjct  444   HQGLRSLAEKEMVKGLPKFDLGEEEAVCDICLKGKQIRESIPKESAWKSTQVLQLVHTDI  503

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              GP    STSG RY L F+DD+SR CW Y
Sbjct  504   CGPINPASTSGKRYILNFIDDFSRKCWTY  532



>emb|CAN80930.1| hypothetical protein VITISV_005279 [Vitis vinifera]
Length=1291

 Score =   221 bits (562),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/457 (33%), Positives = 216/457 (47%), Gaps = 72/457 (16%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +   F+SF+  VE Q  +++K       G    I    T           Y+ +Q
Sbjct  558   KTKSQVLSMFKSFKKMVETQSGQNVK-------GASELIMELTT----------PYSPQQ  600

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK R ++E    +L E  + +  W  A   +  L+N LPT  +Q ++P       
Sbjct  601   NGVSERKNRTVMEMARCMLFEKKLPKLLWAEAVNTSVYLLNRLPTKSVQSKTPIEAWSGV  660

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    L+VFG  CY ++    R K++ R+   VF+ Y    +GYR  +L+  KI I R 
Sbjct  661   KPSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIVISRD  720

Query  1711  VHFYESIFLFSDSTL---CSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             VHF E+ +   D      C Q  P  +  A E  +   P +  A          TS  P 
Sbjct  721   VHFDENSYWNWDLKKVHKCDQTTPSILEPAIESTIIEGPLDVEA----------TSDTP-  769

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYS  1361
                                             V+++R ++ D  E+ +   V  +PTCY+
Sbjct  770   --------------------------------VLKMRPLS-DVYERCNL--VHAEPTCYT  794

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +A   L W +AM  E +A+  N TWKL       N +G KWVFRTK N+DGSI ++KARL
Sbjct  795   EAARFLEWIEAMKAEIDAIERNGTWKLTELPEAKNAIGVKWVFRTKFNSDGSIFRHKARL  854

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             V KGF QVAG D+ DTF+ V +  T+RLL +L     W +  LDV +AFLNG L E +Y+
Sbjct  855   VVKGFAQVAGVDYGDTFAPVARHDTIRLLLALAGQRGWKVYHLDVKSAFLNGILLEEIYV  914

Query  1000  KQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             +QP G+E   H +H       ALYGL+      +PRA
Sbjct  915   QQPEGFEVIGH-EHKVYKLHKALYGLKQ-----APRA  945


 Score = 80.1 bits (196),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 94/200 (47%), Gaps = 6/200 (3%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +++GNG  +     G  +I ++      +NVLY+P L   L SV ++   N     F ++
Sbjct  358   VKLGNGEVVQAKGKGTIAISTKKGTKIXTNVLYIPDLDQNLLSVAQMLR-NGYAISFKEN  416

Query  2664  -CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRV  2488
              CFI     T    ++ + +    +L +   H  +      S VWH+R GH N      +
Sbjct  417   FCFISDVHGTEIAKIKMNGNSFYLKLDLVEGH-VFSAKIDESVVWHKRYGHFNLKSLRFM  475

Query  2487  LQSCPVAPNKVKSLGSRT--SCHLSKASRFPL-DRVSYSSKNVLDLLYTDIWGPAPVIST  2317
              ++  V      S+ ++T  SC L K  R P    +S  + + L+L+++DI GP    S 
Sbjct  476   QEAGMVEDMPEISVNAQTCESCELGKQQRQPFPQNMSKRATHKLELIHSDICGPMSTTSL  535

Query  2316  SGFRYFLLFVDDYSRFCWFY  2257
             S   YF LF+DD+SR  W Y
Sbjct  536   SNNVYFALFIDDFSRMTWVY  555



>ref|XP_004137882.1| PREDICTED: ABC transporter C family member 13-like [Cucumis sativus]
Length=2377

 Score =   240 bits (612),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 158/451 (35%), Positives = 230/451 (51%), Gaps = 49/451 (11%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S++   F +F   ++ QF+ SIK+++ D  GEY    +   L + GI H+ SCA T  Q
Sbjct  1109  RSELLSHFCAFHTEIKNQFNVSIKTLRTDNAGEYFSHSLGSYLCENGIIHQSSCADTPSQ  1168

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH++ET  AL  +  VS+ +W  A   A  LIN +P+SVL  E PY  L  T
Sbjct  1169  NGVAERKNRHLLETAHALSFQMHVSKIFWVDAVSTACFLINRMPSSVLNGEIPYRVLFPT  1228

Query  1891  PPPYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                +    ++FGC C+   +RP++  K++ +S  C+FL Y    +GYRC   T  +  + 
Sbjct  1229  KHLFPIAPKIFGCVCFVRDVRPHHT-KLDPKSLKCIFLGYSRVQKGYRCYCPTLKRYLVS  1287

Query  1717  RHVHFYESI-FLFSDSTLC-------------------SQPVPPTIPWASEPVVTRAPCN  1598
               V F+E   F  S S+LC                   S  VPP+ P  S+    R P  
Sbjct  1288  PDVVFFEDTPFTSSPSSLCQREDDNLFIYEVTSPTPSLSTDVPPSRPLISQVYSRRPP--  1345

Query  1597  THAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQER------GHVMR  1436
                 P+DS               PP  +      AP+   ++  +  +R         + 
Sbjct  1346  --PQPSDSC--------------PPSMLPSSCDPAPSDDLSIALRKGKRKCTYPVSSFIS  1389

Query  1435  LRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMN  1256
                ++  T     +L  T+ P    +A+ H  W++AM +E  AL  NDTW LV       
Sbjct  1390  YHQLSPSTYAFITSLESTSIPNYVHEALSHPRWQNAMIEEMTALDDNDTWDLVSRPAGKK  1449

Query  1255  VVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVS  1076
              +GCKWVF  K N DG++ + KARLVAKG+ Q+ G D+ DTFS V K T++RL  S+  +
Sbjct  1450  AIGCKWVFAVKMNPDGTVTRLKARLVAKGYAQIYGTDYSDTFSPVAKLTSIRLFLSMAAT  1509

Query  1075  HNWTLRQLDVHNAFLNGHLAETVYMKQPPGY  983
             + W+L QLD+ NAFL+G L E VYM+QPPG+
Sbjct  1510  NKWSLHQLDIKNAFLHGDLQEEVYMEQPPGF  1540


 Score = 60.5 bits (145),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  2394  RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             RV   +    +L+++DIWGP PV+S +GFRYF+ FVDD+SR  W Y
Sbjct  1059  RVDKRAIAPFELVHSDIWGPCPVVSQTGFRYFVTFVDDHSRLTWLY  1104


 Score =   133 bits (335),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 3/143 (2%)
 Frame = -3

Query  1339  WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQ  1160
             WR AM +E  A+    TW +V      + VG KWV++ K   DG+I++YKARLVAKG+NQ
Sbjct  1549  WRKAMVEEIEAMERTKTWTIVSIPKDHHTVGSKWVYKVKCKPDGTIDRYKARLVAKGYNQ  1608

Query  1159  VAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYE  980
               G DF DTFS V K +TV++  +L  S+NW++ Q+D++NAFLNG L E V+M  P GY+
Sbjct  1609  QEGIDFLDTFSPVAKISTVKIFLALATSYNWSISQMDINNAFLNGDLFEEVHMTLPLGYQ  1668

Query  979   DPTHPD---HVRVSSSTALYGLR  920
                 PD    +    + ++YGL+
Sbjct  1669  TSQVPDKGEKLACKLNKSIYGLK  1691



>dbj|BAB11200.1| copia-type polyprotein [Arabidopsis thaliana]
 emb|CAC37622.1| polyprotein [Arabidopsis thaliana]
Length=1334

 Score =   226 bits (575),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/462 (31%), Positives = 226/462 (49%), Gaps = 27/462 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS+ ++ F+ F+  VER+  + +  ++ D GGEY  R+      + GI  + + AYT +Q
Sbjct  537   KSETFQFFKEFKAEVERESGKKLVCLRSDRGGEYNSREFDEYCKEFGIKRQLTAAYTPQQ  596

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK R ++     +L E SV +++W  A + A  ++N  P+  L   +P  +    
Sbjct  597   NGVAERKNRSVMNMTRCMLMEMSVPRKFWPEAVQYAVYILNRSPSKALNDITPEEKWSSW  656

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    LR+FG   Y  +    R K++ +S  CV        + YR  +  +GKI I R 
Sbjct  657   KPSVEHLRIFGSLAYALVPYQKRIKLDEKSIKCVMFGVSKESKAYRLYDPATGKILISRD  716

Query  1711  VHFYES-IFLFSDSTLCSQPVPPTIPWAS---EPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             V F E   + + D +L  + V     W +   EP     P   H    D           
Sbjct  717   VQFDEERGWEWEDKSLEEELV-----WDNSDHEPAGEEGPEINHNGQQDQEETEEEEETV  771

Query  1543  LA---RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVT-TD  1376
                  + LP +   G  Q    R + V  +    G+   L  +T+D  ++  AL +   D
Sbjct  772   AETVHQNLPAVGTGGVRQ----RQQPVWMKDYVVGNARVL--ITQDEEDEVLALFIGPGD  825

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             P C+ +A     WR AM+ E  ++  N+TW+LV       V+G KW+F+TK N  G +++
Sbjct  826   PVCFEEAAQLEVWRKAMEAEITSIEENNTWELVELPEEAKVIGLKWIFKTKFNEKGEVDK  885

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             +KARLVAKG++Q  G DF++ F+ V K  T+RL+  L     W++ QLDV +AFL+G L 
Sbjct  886   FKARLVAKGYHQRYGVDFYEVFAPVAKWDTIRLILGLAAEKGWSVFQLDVKSAFLHGDLK  945

Query  1015  ETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             E V+++QP G+E       V      ALYGL+      +PRA
Sbjct  946   EDVFVEQPKGFEVEEESSKV-YKLKKALYGLKQ-----APRA  981


 Score = 74.7 bits (182),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (45%), Gaps = 14/209 (7%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +R+G+   + +   G   +  + ++  +S+V +VP L   LFSV +L  +   F      
Sbjct  325   VRLGDDRRMAVEGKGKLRLEVDGRIQVISDVYFVPGLKNNLFSVGQLQQKGLRFIIEGDV  384

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRL--PVSRSHFAYLTS-----RATSTVWHRRLGHPNA  2506
             C +   +  R V+    T   ++ +   V +S     T         + +WH+R GH N 
Sbjct  385   CEVWHKTEKRMVMHSTMTKNRMFVVFAAVKKSKETEETRCLQVIGKANNMWHKRFGHLN-  443

Query  2505  HVQNRVLQSCPVAPNKVK-SLGSRTS----CHLSKASRFPLDRVS-YSSKNVLDLLYTDI  2344
             H   R L    +     K  LG   +    C   K  R  + + S + S  VL L++TDI
Sbjct  444   HQGLRSLAEKEMVKGLPKFDLGEEEAVCDICLKGKQIRESIPKESAWKSTQVLQLVHTDI  503

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              GP    STSG RY L F+DD+SR CW Y
Sbjct  504   CGPINPASTSGKRYILNFIDDFSRKCWTY  532



>gb|AAF25964.2|AC017118_1 F6N18.1 [Arabidopsis thaliana]
Length=1207

 Score =   226 bits (575),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/462 (31%), Positives = 226/462 (49%), Gaps = 27/462 (6%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS+ ++ F+ F+  VER+  + +  ++ D GGEY  R+      + GI  + + AYT +Q
Sbjct  442   KSETFQFFKEFKAEVERESGKKLVCLRSDRGGEYNSREFDEYCKEFGIKRQLTAAYTPQQ  501

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK R ++     +L E SV +++W  A + A  ++N  P+  L   +P  +    
Sbjct  502   NGVAERKNRSVMNMTRCMLMEMSVPRKFWPEAVQYAVYILNRSPSKALNDITPEEKWSSW  561

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    LR+FG   Y  +    R K++ +S  CV        + YR  +  +GKI I R 
Sbjct  562   KPSVEHLRIFGSLAYALVPYQKRIKLDEKSIKCVMFGVSKESKAYRLYDPATGKILISRD  621

Query  1711  VHFYES-IFLFSDSTLCSQPVPPTIPWAS---EPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             V F E   + + D +L  + V     W +   EP     P   H    D           
Sbjct  622   VQFDEERGWEWEDKSLEEELV-----WDNSDHEPAGEEGPEINHNGQQDQEETEEEEETV  676

Query  1543  LA---RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVT-TD  1376
                  + LP +   G  Q    R + V  +    G+   L  +T+D  ++  AL +   D
Sbjct  677   AETVHQNLPAVGTGGVRQ----RQQPVWMKDYVVGNARVL--ITQDEEDEVLALFIGPDD  730

Query  1375  PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
             P C+ +A     WR AM+ E  ++  N+TW+LV       V+G KW+F+TK N  G +++
Sbjct  731   PVCFEEAAQLEVWRKAMEAEITSIEENNTWELVELPEEAKVIGLKWIFKTKFNEKGEVDK  790

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             +KARLVAKG++Q  G DF++ F+ V K  T+RL+  L     W++ QLDV +AFL+G L 
Sbjct  791   FKARLVAKGYHQRYGVDFYEVFAPVAKWDTIRLILGLAAEKGWSVFQLDVKSAFLHGDLK  850

Query  1015  ETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             E V+++QP G+E       V      ALYGL+      +PRA
Sbjct  851   EDVFVEQPKGFEVEEESSKV-YKLKKALYGLKQ-----APRA  886


 Score = 74.7 bits (182),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (45%), Gaps = 14/209 (7%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +R+G+   + +   G   +  + ++  +S+V +VP L   LFSV +L  +   F      
Sbjct  230   VRLGDDRRMAVEGKGKLRLEVDGRIQVISDVYFVPGLKNNLFSVGQLQQKGLRFIIEGDV  289

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRL--PVSRSHFAYLTS-----RATSTVWHRRLGHPNA  2506
             C +   +  R V+    T   ++ +   V +S     T         + +WH+R GH N 
Sbjct  290   CEVWHKTEKRMVMHSTMTKNRMFVVFAAVKKSKETEETRCLQVIGKANNMWHKRFGHLN-  348

Query  2505  HVQNRVLQSCPVAPNKVK-SLGSRTS----CHLSKASRFPLDRVS-YSSKNVLDLLYTDI  2344
             H   R L    +     K  LG   +    C   K  R  + + S + S  VL L++TDI
Sbjct  349   HQGLRSLAEKEMVKGLPKFDLGEEEAVCDICLKGKQIRESIPKESAWKSTQVLQLVHTDI  408

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              GP    STSG RY L F+DD+SR CW Y
Sbjct  409   CGPINPASTSGKRYILNFIDDFSRKCWTY  437



>ref|XP_008383301.1| PREDICTED: uncharacterized protein LOC103446021 [Malus domestica]
Length=970

 Score =   169 bits (428),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/359 (33%), Positives = 171/359 (48%), Gaps = 37/359 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KSD   TF  F   V  QFS  I+ +Q D GGEY  + +   L   GI H+KSC YT EQ
Sbjct  610   KSDFCTTFIGFYAYVLTQFSTKIRILQSDGGGEYISKPLQSFLLXKGILHQKSCPYTPEQ  669

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK+RH++ET + LL    +  ++W FA + A  LIN +PT +L  +S +  L+  
Sbjct  670   NGMAERKHRHVIETAVTLLQTAQMPPKFWYFACQTAIYLINRMPTPLLSNQSLFEALYGA  729

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    LR FGC CYP LRPYN  K++ ++  C+FL Y   ++G+ C  ++  + +I RH
Sbjct  730   VPVIHHLRTFGCACYPLLRPYNTTKLQPKTTKCIFLGYASRYKGFICYVVSQNRFFISRH  789

Query  1711  VHFYESIFLFSD------------STLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSA-  1571
             V F E  F + D             TL  QP PP +      +VT  P + H +P  S+ 
Sbjct  790   VVFSEHDFPYKDLLAHTNSKSSCSVTLDPQPSPPIV--TPHHIVTILPQDPHTSPVSSSL  847

Query  1570  -----------HMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHM  1424
                        H S + P  +   +    I   +  +P   + V +      H M+ R  
Sbjct  848   SPSPSPTQSPFHASPSLPQSITGAVSDNHISVVLDHSPETLQVVPSIPPINLHPMQTRSK  907

Query  1423  TRDTSEQ--FHALNVTTD-------PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVL  1274
             +  + ++    AL  +TD       P+ Y  A+    W  AM +E +AL    TW LV 
Sbjct  908   SGISKKKVFLSALAASTDVDLSICEPSTYKSALKSSIWFQAMQEEISALHGQGTWSLVF  966


 Score =   130 bits (328),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 116/222 (52%), Gaps = 11/222 (5%)
 Frame = -1

Query  2886  SMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYR  2707
             S +S +  Y  ++V++  NG GL +S +G+A I      + L++VLYVPKLS  L SV++
Sbjct  385   SNLSLASPYPTNEVIQTANGEGLHVSHIGNAVIKPSMHPIKLNSVLYVPKLSQNLLSVHK  444

Query  2706  LTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL-------PVSRS----HFAYL  2560
             +  +NN +  F   CF ++D  T  +L +G  S GLY +       P +      H A L
Sbjct  445   ICLDNNCWLIFDAFCFWIQDKATGRILYKGLCSNGLYPISSLANVCPAASQGMVRHKALL  504

Query  2559  TSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYS  2380
                  S  WH RLGHP+  V + +L    V   K  S     SC   K  + P       
Sbjct  505   GQLVNSFTWHNRLGHPSNSVVSLMLHKSNVVLPKTSSSVLCQSCLEGKFCKLPFYPSVNK  564

Query  2379  SKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             S    +++++D+WGPAP +S  G+RY++ F+D+ ++F W +P
Sbjct  565   SVIPFEVVHSDLWGPAPCVSVDGYRYYVTFIDECTKFSWLFP  606



>ref|XP_010051209.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104439906 
[Eucalyptus grandis]
Length=2021

 Score =   179 bits (455),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 120/193 (62%), Gaps = 2/193 (1%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R K+D Y  F  F+ +VE Q    IK+ Q D GGE+   K    L   GI  + SC +T 
Sbjct  626   RAKADFYDIFILFQKQVENQLDCKIKTFQCDGGGEFISHKFQTHLHSHGIKQQVSCPHTP  685

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNG  ERK+RH+VE GLA+L    V  +YW  AF  A  +IN LPT  LQ +SPY+RL+
Sbjct  686   EQNGVSERKHRHVVELGLAMLYHAEVPLKYWVDAFLTAIYIINMLPTPKLQMQSPYSRLY  745

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
             +  P Y  LRVFGC C+P LRPY +HK++ RS  C+F+ Y    +GYRC+  T+G+IYI 
Sbjct  746   QKEPSYDHLRVFGCACFPCLRPYAQHKLDSRSLTCIFIGYSARHKGYRCLVPTTGRIYIS  805

Query  1717  RHVHFYESIFLFS  1679
             +HV F E  F F+
Sbjct  806   KHVIFDERFFPFT  818


 Score =   120 bits (301),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 111/210 (53%), Gaps = 13/210 (6%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G+D + +GNG+ L I   G   + ++   L L++VL VP +   L SV +LT++    
Sbjct  421   YYGTDTVMIGNGSCLPIIYTGDTLLHTKVDSLPLNDVLIVPDIKKNLISVSKLTDDYPCS  480

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATS---TVWHRRLGHP  2512
             F F K    +KD+ T   LL G    GLYR+  S +  A+LT R  +    +WH+RL H 
Sbjct  481   FVFDKTGVYIKDNYTNTTLLLGRKVKGLYRVD-SHTTEAFLTQRHRALGEDLWHQRLAHT  539

Query  2511  N----AHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDI  2344
             N     ++QN+    C       +   +  SC ++K +  P       +   L+ ++ DI
Sbjct  540   NLKTLQYLQNQQHIYC-----NTRIQNTCRSCQIAKHTALPFPLSESVTSTPLEKVHCDI  594

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             WGP+PVIS   F+Y+++ VDD+SRF W YP
Sbjct  595   WGPSPVISFQNFKYYVILVDDFSRFSWIYP  624


 Score =   158 bits (399),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 105/156 (67%), Gaps = 1/156 (1%)
 Frame = -3

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
             V  +P     A+ +  W  AM +E +AL HN TW L+     MNV+GCKWVF+TK  +DG
Sbjct  964   VPAEPRSVKSALANQGWYTAMKEEMDALHHNQTWILIPRTTDMNVIGCKWVFKTKLASDG  1023

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             S+++ KARLVAKGF+Q  G DF +TFS VVK  T+RL+ S+ + + W + QLDV NAFL+
Sbjct  1024  SLDRLKARLVAKGFHQEEGVDFTETFSPVVKHATIRLVLSVAMMNQWPIHQLDVKNAFLH  1083

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             G L ETVYM+QPPG+     P+HV +    +LYGLR
Sbjct  1084  GTLTETVYMEQPPGFIQSQTPNHVCLLKK-SLYGLR  1118


 Score = 65.5 bits (158),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 74/156 (47%), Gaps = 8/156 (5%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             +FV+IKLT  NF+ W+ Q   FLR Q+L G+V+ E   P  T+         V       
Sbjct  18    NFVTIKLTEENFLLWQDQFHRFLRSQDLFGFVNGEVLSPAKTL--------QVEKGNQTI  69

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
               PNP Y  WIK DQ + S +  ++S+ ++ L +G  T+  +W+++       S A+   
Sbjct  70    EIPNPDYNDWIKTDQLVSSWISGAVSENILSLIIGLNTAYELWQTLLNRFTQKSVAKEFE  129

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
               G     ++ + S   YL   + + + L   G P+
Sbjct  130   LRGILQACQKRDRSLSTYLKEFKSVCDQLNAIGKPV  165



>emb|CAN76645.1| hypothetical protein VITISV_004685 [Vitis vinifera]
Length=1196

 Score =   233 bits (595),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 235/466 (50%), Gaps = 34/466 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K+++++ F SF   V++QFS+ +K +Q D G E++ +    +  GI  + SC  T +QNG
Sbjct  490   KTEVFQMFMSFIAMVDQQFSQIVKVVQSDNGTEFKCLLDYFSATGILFQTSCVGTPQQNG  549

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK++HI+  G AL  + ++   +W  +   A  LIN  P+ +L  ++P+  L  TPP
Sbjct  550   RVERKHKHILNVGRALRFQANLPIYFWGESVLAAAHLINXTPSPLLHNKTPFEILFGTPP  609

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y  +  FGC  + + +     K   RS  CVFL YP   +G++  +L + ++++ R V 
Sbjct  610   SYAAIHTFGCLSFAHDKKSKGDKFASRSRKCVFLGYPFGKKGWKLXDLDTKELFVSRDVK  669

Query  1705  FYESIFLFSD---STLCSQPVPPTIPWA----------------SEPVVTRAPCNTHAAP  1583
             F+E +F F +     +    + PT+                   +    T+ P      P
Sbjct  670   FFEDVFPFGNPGAXNIIXDNIVPTVNVEIDSDFADFVDDDADLPNPQAQTQNPNLIQPEP  729

Query  1582  TDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ  1403
                  +S  S V    GL  L ++    T+  ++  +    +++   + LR     T   
Sbjct  730   QAHQDLSPGSEVVPTIGLDSLGLD---NTSNGQSAPMGKGMRDKFPSVLLREFVTHTVVA  786

Query  1402  FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMN---VVGCKWVF  1232
                   T  P   S+A+  + W+ +M +E  AL  N TW L   EP  N    +G +WV+
Sbjct  787   ESPSPATPSPQHSSEAMKDVGWQKSMHEEIRALKENGTWTL---EPLPNGKCALGSQWVY  843

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             RTK  ++G IE+ K RLV  G +Q A  D+ +TFS + K TTVR   ++  S NW L Q+
Sbjct  844   RTKYFSNGDIERLKYRLVVLGNHQEADIDYHETFSPIAKMTTVRAFLAIAASKNWELHQM  903

Query  1051  DVHNAFLNGHLAETVYMKQPPGYE--DPTHPDHVRVSSSTALYGLR  920
             DVHNAFL+G L E VYMK PPG+E  DP     +R S    LYGL+
Sbjct  904   DVHNAFLHGDLEEEVYMKLPPGFESXDPNLVCRLRKS----LYGLK  945


 Score = 66.6 bits (161),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 68/140 (49%), Gaps = 13/140 (9%)
 Frame = -1

Query  2655  VKDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATSTVWHRRLGHPNAHVQNRV  2488
             +K+  TR ++  G    GLY    +      H +   + +T  +WH+R+GHP+     +V
Sbjct  352   LKNXHTRELIGTGVRRDGLYYFDGAEGDSVQHVSVHNAASTLELWHKRMGHPS----EKV  407

Query  2487  LQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKN---VLDLLYTDIWGPAPVIST  2317
             ++  P   N   SL    +C +   ++ P D+   S      + + ++ D+WG    +S+
Sbjct  408   VKLLPPVSNLKGSLNK--ACEICFRAKHPRDKFPLSDNKATRIFEKIHCDLWGSYKHVSS  465

Query  2316  SGFRYFLLFVDDYSRFCWFY  2257
              G RYFL  VDD+SR  W Y
Sbjct  466   CGARYFLTIVDDFSRAVWIY  485



>dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsis thaliana]
Length=1499

 Score =   206 bits (524),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/457 (30%), Positives = 213/457 (47%), Gaps = 22/457 (5%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS++   F+ F+  VE Q    IK ++ D GGE+  R+      + GI H  +  Y+ +Q
Sbjct  557   KSEVITKFKIFKPYVENQSESRIKRLRTDGGGEFLSREFIKLCQESGIHHEITTPYSPQQ  616

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFE-SPYTRLHK  1895
             NG  ER+ R +VE   +++ E  +S ++W  A   +T L N LP+  L+   +P      
Sbjct  617   NGVAERRNRTLVEMARSMIEEKKLSNKFWAEAIATSTYLQNRLPSKSLEKGVTPMEIWSG  676

Query  1894  TPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICR  1715
               P    L+VFGC CY ++    R K++ ++   +F+ Y    +GYR   L   KI + +
Sbjct  677   KKPSVDHLKVFGCVCYIHIPDEKRRKLDTKAKQGIFVGYSNESKGYRVFLLNEEKIEVSK  736

Query  1714  HVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR  1535
              V F E      D     + +   +   S+        N H     +A   L      +R
Sbjct  737   DVTFDEKKTWSHDEKGERKAILSLVKINSQEQGGGNDLNAHIDQVSNAFNQLHIS---SR  793

Query  1534  GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHA--LNVTTDPTCYS  1361
             G+     EG     P   R++     +   V        +     H   L +  +P    
Sbjct  794   GVQNSHEEGEESVGPRGFRSINNLMDQTNEV--------EGEALIHEMCLMMAEEPQALE  845

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +A+    W +AM +E   +  N TW++V      NV+  KW+FR K +A G   + KARL
Sbjct  846   EAMKDEKWIEAMREELRMIEKNKTWEVVARPKDKNVISVKWIFRLKTDASGEAIKRKARL  905

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VA+GF Q  G D+ +TF+ V +  T+R + ++     W L Q+DV +AFLNG L E VY+
Sbjct  906   VARGFTQEYGVDYLETFAPVSRYDTIRTIMAIAAQQGWKLFQMDVKSAFLNGDLEEEVYI  965

Query  1000  KQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             +QPPG+ +      V +    ALYGL+      +PRA
Sbjct  966   EQPPGFIEEKEEGKV-LKLHKALYGLKQ-----APRA  996


 Score = 92.8 bits (229),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 106/205 (52%), Gaps = 11/205 (5%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRL-TNENNVFFEFH  2671
             ++R+GNG  ++    G   + +      + +VLYVP+L+  L SV ++ +N   V FE +
Sbjct  351   IIRIGNGGKVVSEGKGDIRVSTNKGDHVIKDVLYVPELARNLLSVSQMISNGYRVIFEDN  410

Query  2670  KDCFIVKDSITRAVL---LRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHV  2500
             K C +++D   R +L   ++  +   +++     ++ A+      + +WH+R GH N + 
Sbjct  411   K-C-VIQDLKGRKILDIKMKDRSFPIIWKKSREETYMAFEEKEEQTDLWHKRFGHVN-YD  467

Query  2499  QNRVLQSCPVAPNKVK---SLGSRTSCHLSKASRFPLDRVSYSSKN-VLDLLYTDIWGPA  2332
             +   +Q+  +     K     G   +C + K SR    + S S+ N  L+L+++D+ GP 
Sbjct  468   KIETMQTLKIVEKLPKFEVIKGICAACEMGKQSRRSFPKKSQSNTNKTLELIHSDVCGPM  527

Query  2331  PVISTSGFRYFLLFVDDYSRFCWFY  2257
                S +G RYFL F+DD+SR  W Y
Sbjct  528   QTESINGSRYFLTFIDDFSRMTWVY  552



>emb|CAN67317.1| hypothetical protein VITISV_019719 [Vitis vinifera]
Length=1240

 Score =   215 bits (548),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 159/464 (34%), Positives = 229/464 (49%), Gaps = 71/464 (15%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTH  2078
             + + +++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T 
Sbjct  546   KTRVELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTP  605

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK RH+  +            ++W  A   A  LIN +P+SVL  + P++ L 
Sbjct  606   QQNGVAERKNRHLSRSTF----------RFWGDAVLTACYLINRMPSSVLHDQIPHSLLF  655

Query  1897  KTPPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIY  1724
                P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +G RC +L + + +
Sbjct  656   PDQPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGCRCYSLETHRYF  714

Query  1723  ICRHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
             I   V F+E    FS +T  S PV   +P    P+V+  P  ++A  T S   S  SP  
Sbjct  715   ISADVTFFEDSPFFS-TTSESLPVSKVLPI---PIVS--PPESYAPSTTSGLSS--SPAH  766

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH-MTRDTSEQFHALNVTTDPTC  1367
             L                                   L H ++         L + T P  
Sbjct  767   L-----------------------------------LTHFLSLRLHLPRLCLLLMTYPLL  791

Query  1366  YS----QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +     +A+ H  WR AM  E  AL  N TW LV+  P  + VGC+WV+  K   DG ++
Sbjct  792   FGKSTHEALSHPGWRQAMVDEMTALHSNGTWDLVVLPPGKSTVGCRWVYAVKVGPDGQVD  851

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
             + KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ NAFL+G L
Sbjct  852   RLKARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDL  911

Query  1018  AETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             AE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  912   AEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  948


 Score = 83.6 bits (205),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  381   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  439

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  440   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  488

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  489   KHTRVSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  543



>emb|CAN74964.1| hypothetical protein VITISV_006810 [Vitis vinifera]
Length=1248

 Score =   195 bits (495),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 156/469 (33%), Positives = 221/469 (47%), Gaps = 60/469 (13%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F +F   ++            D G EY    +   +T+ GI H+ SC  T  Q
Sbjct  512   RSEVFSHFCAFCAEIKTH----------DNGKEYMSNSLQSYMTQHGILHQSSCVDTPSQ  561

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH++ET  ALL +  V +Q+W  A  +A  LIN +P++VL    PY+ L   
Sbjct  562   NGVAERKNRHLLETARALLFQMKVPKQFWADAISIACFLINRMPSTVLNDPIPYSILFPK  621

Query  1891  PPPYTFL-RVFGCRCYPY-LRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                +    R+FG  CY   +RP +  K++ ++  CVFL Y    +GYRC +    K  + 
Sbjct  622   KSLFPVEPRIFGSTCYVRDVRP-SVTKLDPKALKCVFLGYSRLQKGYRCFSPDLNKYVVS  680

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEP---VVTRAPCNTHAAPTDSAHMSLTSPV  1547
               V F E    +S         PP      E    ++ +      + PTDS+      P 
Sbjct  681   TDVVFSEDTPFYSS--------PPNSESEGEGENWLIYQE--TIPSTPTDSSEQ----PQ  726

Query  1546  PLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTR-------DTSEQFHALN  1388
              +   LP  A    VQ          + HQE          +        D     H  +
Sbjct  727   AVVDLLPAPAKPPIVQEY--------SSHQETKDTCPAPTSSLSDPPSDLDLPIGLHKDS  778

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
             V+  P    +A+ H  W +AM +E  AL  N TW  V      NVVGCKWVF  K N +G
Sbjct  779   VSI-PKTVKKALNHPGWYNAMLEEIQALEVNHTWNRVDLPIGKNVVGCKWVFAIKVNPNG  837

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             S+ + KARLVA+G+ Q  G D+ +TFS V +  +V L+ S+  S +W L QLD+ NAFL+
Sbjct  838   SVARLKARLVAEGYAQTYGVDYSNTFSPVARLASVHLIISITASQHWPLHQLDIKNAFLH  897

Query  1027  GHLAETVYMKQPPGYEDPTHPD---HVRVSSSTALYGLRGVKMG*SPRA  890
             G L E VYM+QPPG+          H+R S    LYGL+      SPRA
Sbjct  898   GDLQEEVYMEQPPGFVAQVEYGKVCHLRKS----LYGLKQ-----SPRA  937


 Score =   103 bits (257),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 97/174 (56%), Gaps = 10/174 (6%)
 Frame = -1

Query  2769  LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRL  2590
             + LS+VL +PKL+  L SV +LT + N    F  D  + +D +T+ ++ +G    GLY L
Sbjct  341   ITLSSVLSLPKLAFNLISVSKLTKDLNCCISFFLDHCLFQDLMTKQIIGKGHVYDGLYIL  400

Query  2589  PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT--SCHLSK  2416
                       +S A+S   H RLGHP+  V  ++   CP    +  SL S    SCH +K
Sbjct  401   DAWVPRSVACSSIASSVKAHCRLGHPSLPVLKKL---CP----QFHSLPSFNCESCHFAK  453

Query  2415  ASRFPLD-RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                  L  RV+  ++++ +L++ D+WGP P+ S +GFRYF+ FVDD+SR  W Y
Sbjct  454   HHYSSLSPRVNKRAESIFELVHFDVWGPCPITSKTGFRYFVTFVDDFSRMTWIY  507



>emb|CAN67240.1| hypothetical protein VITISV_037460 [Vitis vinifera]
Length=1174

 Score =   236 bits (602),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 167/466 (36%), Positives = 241/466 (52%), Gaps = 41/466 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + +S+I   + +F   VE QFS+ IK+ + D   EY +      L   G  H  +C  T 
Sbjct  396   KSRSEILPIYSNFAKMVETQFSKRIKTFRSDNALEYTQYAFQALLHSYGTVHHLTCPGTS  455

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNGR ERK RHI++T  ALL    V   +W  A   A   IN +P++V+  + PY RL 
Sbjct  456   QQNGRAERKLRHILDTVHALLLYAKVPAPFWGEAGLHAVHAINRIPSAVIHNQIPYERLF  515

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+P+  +K+E RS  C FL Y  + +GYRC +L S ++ + 
Sbjct  516   GSPPDYHHLRSFGSACFVLLQPHEHNKLEPRSTLCCFLGYGETQKGYRCYDLVSHRLRVS  575

Query  1717  RHVHFYESIFLFS----DSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMS--LT  1556
             R+V F+E           S+L +  V    P   E ++            D   M+  +T
Sbjct  576   RNVVFWEHRLFVELSHFRSSLTNSSVLEIFP--DESLI------FFMLLLDRLQMNRLMT  627

Query  1555  SPVPLARGLPPLAI-EGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ--FHALNV  1385
             S + L+ G P  A+ E P Q  P R            H+ R+R +     +   + A   
Sbjct  628   SYLTLSLGPPAPALPEDPPQDIPPR------------HLTRVRSIPPHLLDYHCYIAFAT  675

Query  1384  TTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGS  1205
               +P  Y +A     W+ AM +E +AL  N TW LV   P  +VVGCKW+++ K  +DGS
Sbjct  676   LHEPQTYREASIDPLWQIAMKEELDALTKNHTWDLVTLPPRQSVVGCKWIYKIKTLSDGS  735

Query  1204  IEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNG  1025
             +E+YKA LVAKGF Q  G D  +TF+ V + ++VR L ++  +  W L Q+DV NAFLNG
Sbjct  736   VERYKACLVAKGFTQEYGIDSEETFAPVARISSVRALLAVAAARKWDLFQMDVKNAFLNG  795

Query  1024  HLAETVYMKQPPGYE-DPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              L+E VYM+ PPG   +     H+R     ALYGL+      +PRA
Sbjct  796   DLSEEVYMQPPPGLSVESNKVCHLR----RALYGLKQ-----APRA  832


 Score = 61.6 bits (148),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  2376  KNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             +++ +L+++D+WGP+PV S  G RYF++F+DDYSR+ W +P
Sbjct  354   QHIFELIHSDVWGPSPVASIGGSRYFVIFIDDYSRYSWIFP  394



>emb|CAN74951.1| hypothetical protein VITISV_030567 [Vitis vinifera]
Length=2203

 Score =   157 bits (396),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 102/167 (61%), Gaps = 0/167 (0%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS        F   V+R+F   +K +Q D GGE+  +   L K GI  R  C + H+QNG
Sbjct  543   KSQATSIVLQFIALVDRKFPTKLKCLQTDWGGEFHPLQSLLQKKGILFRHPCPHVHQQNG  602

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             +VERK+R IVE GL LLA+  +   +W  AF  AT L+N LPT VL  ++PY  L K+ P
Sbjct  603   KVERKHRSIVEIGLTLLAKSQLPFTFWWHAFSTATYLLNRLPTPVLHCKTPYELLFKSSP  662

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN  1745
              + FL+ FGC CYPYLRPY  HK+EY+S  C F+ Y  S +GY C++
Sbjct  663   DFLFLKTFGCACYPYLRPYKNHKLEYQSTQCTFIGYSLSHKGYLCVS  709


 Score =   140 bits (354),  Expect(2) = 1e-70, Method: Composition-based stats.
 Identities = 84/255 (33%), Positives = 124/255 (49%), Gaps = 50/255 (20%)
 Frame = -1

Query  2868  DEYTGSDVLRVGNGAGLIISRVGHASIPSE--SKLLHLSNVLYVPKLSVPLFSVYRLTNE  2695
             D Y+G+  + VGNG  L IS VGH S PS   SK LHL+NVL+VP+++  L SV + T +
Sbjct  285   DHYSGTGNVVVGNGQTLDISSVGHTSFPSRKSSKSLHLANVLHVPQITKNLISVAKFTQD  344

Query  2694  NNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR------------------SHF  2569
             N+V  EF   C  VKD  +R +LL+G+   GLY+L +S+                   H 
Sbjct  345   NDVILEFDSHCCFVKDKKSREILLQGNLKEGLYQLDISKVSSNRQFVGFSEDTNVFLPHL  404

Query  2568  AYLTS------------------RATST------------VWHRRLGHPNAHVQNRVLQS  2479
             A   S                  +  ST            +WH+RLGHP   + + VL  
Sbjct  405   ATTPSTVNKQSVAPSVGYSLQVNKIESTRCVEDNNTGVGHLWHQRLGHPCNKIVSLVLDR  464

Query  2478  CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYF  2299
               +       L   T+C L KA +FPL      ++   +L+++D+W PA   S  G++Y+
Sbjct  465   LGIKSKLQNELNFCTACPLGKAKQFPLPTTINKTQVPFELVFSDVWEPAHTTSCDGYKYY  524

Query  2298  LLFVDDYSRFCWFYP  2254
             + FVD ++ + W YP
Sbjct  525   IAFVDAFTNYTWIYP  539


 Score =   155 bits (391),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 120/444 (27%), Positives = 193/444 (43%), Gaps = 56/444 (13%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKI--HHTLTKLGITHRKSCAYTHEQ  2072
             KS+ +  F  F  +V+ +   SI  I+ D G E+          K GI H  S   T +Q
Sbjct  1136  KSEAFYEFSKFCNKVQNEKGFSITCIRSDHGREFENFDFEEYCNKHGINHNFSAPRTPQQ  1195

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VERK R + E    +L E ++ + +W  A   +  ++N +    +  ++PY      
Sbjct  1196  NGVVERKNRTLQEMARTMLNENNLPKYFWAEAVNTSCYVLNRILLRPILKKTPYELWKNK  1255

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P  ++ +VFGC+C+      N  K + +S   +FL Y  S + +R  N  +  +    H
Sbjct  1256  KPNISYFKVFGCKCFILNTKDNLGKFDAKSDVGIFLGYSTSSKAFRVFNKRTMVVEESIH  1315

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARG  1532
             V F E     S+++L  +          E  + +          +S         PLA  
Sbjct  1316  VIFDE-----SNNSLQERESXDD-DLGLETSMGKLQIEDKRQQEESGEDPKKEDSPLA--  1367

Query  1531  LPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAV  1352
             LPPL+       A T         Q+ G +    H  +    ++                
Sbjct  1368  LPPLSTSAKENQAKTS--------QKIGSLSSTIHKIKSLKCKYG---------------  1404

Query  1351  GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAK  1172
                                   +LV    + +V+G KWVFR K + +G I + KARLVA+
Sbjct  1405  ----------------------ELVPRPSNQSVIGTKWVFRNKMDENGIIVRNKARLVAQ  1442

Query  1171  GFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQP  992
             G+NQ  G D+ +TF+ V +   +R+L +     ++ L Q+DV +AFLNG + E VY++QP
Sbjct  1443  GYNQEEGIDYEETFAPVARLEAIRMLLAFACFKDFILYQMDVKSAFLNGFINEEVYVEQP  1502

Query  991   PGYEDPTHPDHVRVSSSTALYGLR  920
             PG++    P+HV      ALYGL+
Sbjct  1503  PGFQSFNFPNHV-FKLKKALYGLK  1525


 Score = 50.1 bits (118),  Expect(2) = 7e-43, Method: Composition-based stats.
 Identities = 36/141 (26%), Positives = 66/141 (47%), Gaps = 11/141 (8%)
 Frame = -1

Query  2658  IVKDSITRAVLLRGSTSGGLYRLPVSR--SHFAYLTS-RATSTVWHRRLGHPNAHV----  2500
             I+KD      +  G     +Y + +S+   H    +S    S +WHRRLGH N  +    
Sbjct  991   IIKDIQNDKTIFMGHRCENVYAINISKYDGHDRCFSSMHDQSWLWHRRLGHANMDLISQL  1050

Query  2499  -QNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSY-SSKNVLDLLYTDIWGPAPV  2326
              ++ +++  P    +   +    +C + K  +      ++ S+   L+LL+ D++GP+  
Sbjct  1051  NKDELVRGLPKINFQKDKICE--ACQMGKQIKNSFKNKNFISTSRPLELLHMDLFGPSRT  1108

Query  2325  ISTSGFRYFLLFVDDYSRFCW  2263
              S  G  Y  + VDD+SR+ W
Sbjct  1109  PSLGGKSYAYVIVDDFSRYTW  1129



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score =   237 bits (605),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 166/476 (35%), Positives = 237/476 (50%), Gaps = 42/476 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  510   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  569

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  570   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAILTACYLINRMPSSVLHDQIPHSLLFPD  629

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  630   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  688

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT-------------------RAPCNT  1595
               V F+E    FS +T  S PV   +P    P+V+                    AP   
Sbjct  689   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPEAMPPRPLQVYHRRPRVVAPLPF  744

Query  1594  HAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRD  1415
               AP DS  +   SP P       L I     T  TR            + +    ++  
Sbjct  745   PEAPADSLPIPSASPAPALPSPXDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSP  798

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
              S    A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV
Sbjct  799   YSAFVSAISSVSLPKSTHEALSHPGWRQAMVDEMAALHSNGTWDLVVLPXGKSTVGCRWV  858

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  + RLL S+    +W L Q
Sbjct  859   YAVKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSXVAKIASXRLLLSMAAMCSWPLYQ  918

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             LD+ N FL+G L E VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  919   LDIKNXFLHGDLXEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  967


 Score = 60.5 bits (145),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 74/170 (44%), Gaps = 32/170 (19%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  366   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  424

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASR--  2407
              S  A +  R ++                            + SL       L K +R  
Sbjct  425   DSSPAKMVPRFST----------------------------LSSLPCEFMFSLVKHTRVS  456

Query  2406  FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             FP   ++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  457   FP-KXLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  505



>emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera]
Length=707

 Score =   259 bits (662),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 163/407 (40%), Positives = 221/407 (54%), Gaps = 47/407 (12%)
 Frame = -3

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
              QNG  ERK+RH++ETGL L+    V    W  AF     LIN LP+  L  ++PY  L 
Sbjct  31    SQNGIAERKHRHVIETGLTLMFHARVPLSLWVEAFSTVVFLINRLPSLSLAGKTPYELLF  90

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y+  R FGC C+PYLR Y+ +K+  +S P VFL Y    +G++C++  + ++Y+ 
Sbjct  91    GKQPDYSMPRTFGCLCFPYLRDYSPNKLSPKSTPYVFLGYSTLHKGFQCLDCKTHRVYVS  150

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWA----SEPVVTRA-------------------  1607
             RHV FYE  F ++   +  Q +P  I +     S+  V+ +                   
Sbjct  151   RHVQFYEHTFPYNGDFV--QNLPSNIDYIHFSESQECVSSSSNVSTSDSLSSPSFSNSLC  208

Query  1606  -PCNTHAAPTDSAHMSLTSP----VPLARG--LPPLAIEGPVQTAPTRA-RAV*TQHQ--  1457
              PCN      D  H+SLTS     VPL     L  +A +    +  + + R   + H   
Sbjct  209   LPCN------DIPHLSLTSSPGPQVPLDDDSLLDSIATDSTTPSLVSSSPRVTNSSHPMI  262

Query  1456  ERGHVM----RLRHM--TRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHN  1295
              RG       RL H+     +S+ F AL    +P  +  A  H  W  AMD E +AL  N
Sbjct  263   TRGKAGIFKPRLYHVMHISSSSQLFQALLALKEPCGFKPAAKHPKWLSAMDDEIHALKKN  322

Query  1294  DTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVK  1115
             DTW LV    H NVVGC+WVF+TK ++DGSIE++KA LVA+GF+QV G DF DTFS VV+
Sbjct  323   DTWVLVPRPQHHNVVGCRWVFKTKLHSDGSIERHKACLVAQGFSQVHGLDFGDTFSPVVR  382

Query  1114  PTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDP  974
             P TVR++ SL V+    L +LDV NAFL+G L E VYM+QPPGY DP
Sbjct  383   PATVRIILSLAVTSGLRLHKLDVKNAFLHGFLNEEVYMEQPPGYTDP  429



>ref|XP_008374275.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 [Malus domestica]
Length=740

 Score =   175 bits (443),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 120/188 (64%), Gaps = 2/188 (1%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             K+ +++ F  F   ++  FS ++K +Q D GGEY   +  + LT  GI H KSC YT EQ
Sbjct  270   KAXVFEIFVQFHAYIQNYFSATVKVLQSDGGGEYVSTRFQNFLTTKGIVHXKSCPYTPEQ  329

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET + LL + S+S ++W  A   +T L+N LPTSVL+  SP+  L+K+
Sbjct  330   NGLAERKNRHLVETAVTLLQKASLSSKFWFHACATSTYLVNRLPTSVLKMHSPFEVLYKS  389

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             PP    LRVFGC CYP L+PY  +K++ ++  C+FL Y   ++GY C  ++  K+ + RH
Sbjct  390   PPTLDHLRVFGCACYPSLKPYRTNKLDPKTTMCIFLGYAAQYKGYICYAISDNKLIVSRH  449

Query  1711  VHFYESIF  1688
             V F ES+F
Sbjct  450   VLFDESVF  457


 Score =   119 bits (298),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 114/215 (53%), Gaps = 4/215 (2%)
 Frame = -1

Query  2886  SMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYR  2707
             S +  +  Y  S+ +   NG GL IS +G A + + S  L L++VL+VP+LS  L S+Y+
Sbjct  52    SNLQAATPYASSETVTGANGEGLQISHIGQACLSTPSHTLELNSVLHVPQLSQHLLSMYQ  111

Query  2706  LTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATST  2539
             L  +NN      +    ++D +T  VL +G ++  +Y LP+ +    +  A+L  +   +
Sbjct  112   LCKDNNCRCIVDEFSVCIQDKVTNKVLYQGLSNQAVYPLPLLKPPKTNPAAFLGQKINDS  171

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             +WH RLGHP   V    L    +  +      + T+    K ++ P   ++  S   L++
Sbjct  172   LWHCRLGHPTNSVLQVALSKSAITSSCNSPSQTCTAXLQGKFTKLPFPVMASKSFVPLEV  231

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             ++ D+WGP+P  S  G+ Y++ F+D+ +R+ W +P
Sbjct  232   IHXDVWGPSPTKSIEGYSYYVSFIDECTRYTWIFP  266



>emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera]
Length=1161

 Score =   220 bits (560),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/426 (34%), Positives = 209/426 (49%), Gaps = 73/426 (17%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D G EY     T  ++  GI H  SCA+T +Q
Sbjct  453   RAELFSIFQKFYAEIQTQFNISIRVLRSDNGREYFSAPFTSFMSHHGILHLSSCAHTPQQ  512

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   +L   +V  ++W      A  LIN +P+SVL  + P++ L   
Sbjct  513   NGVAERKNRHLVETARTILLHSNVLFRFWGDVVLTACYLINRMPSSVLHDQIPHSLLFPD  572

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  573   QPLY-FLPPRVFGCTCFVHILTPKQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  631

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS-PVPL  1541
               V F+E                                       DS   S TS  +P+
Sbjct  632   ADVTFFE---------------------------------------DSPFFSTTSESLPV  652

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYS  1361
             +  LP + I  P    P R              +++ H     S                
Sbjct  653   SEVLP-IPIVSPPDAMPPRP-------------LQVYHRCPRVSTH--------------  684

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
             +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ KARL
Sbjct  685   EALSHPGWRQAMVDEMVALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRLKARL  744

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ N FL+G LAE VYM
Sbjct  745   VAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNVFLHGDLAEEVYM  804

Query  1000  KQPPGY  983
             +QPPG+
Sbjct  805   EQPPGF  810


 Score = 73.6 bits (179),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 82/176 (47%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             +++LY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  286   TSILYTPECLFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  344

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H  LGHP+ +  Q  V     L S P             SC L 
Sbjct  345   DSSPAVCISTDAPLLIHNHLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  393

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+W      ST GF+YF+ F+DDYSR  W +
Sbjct  394   KHTRVSFP-KRLNNRAKSPFELVHTDVWSLCRTASTLGFQYFVTFIDDYSRCTWLF  448



>gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum]
Length=1775

 Score =   203 bits (517),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 151/483 (31%), Positives = 229/483 (47%), Gaps = 64/483 (13%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F+SF   ++ QF  SI++ + D   EY   +    +T  GI H+ +C YT +Q
Sbjct  581   RSELFSIFKSFFAEIQNQFGVSIRTFRSDNALEYLSSQFREFMTHQGIIHQTTCPYTPQQ  640

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYT-----  1907
             NG  ERK RH++ET   LL E +V  ++W  A   +  LIN +P+S +Q + P++     
Sbjct  641   NGVAERKNRHLIETARTLLLESNVPLRFWGDAVLTSCYLINRMPSSSIQNQVPHSILFPQ  700

Query  1906  -RLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGK  1730
               L+  PP     RVFG  C+ +     + K+  R+  CVFL Y    +GYRC +    +
Sbjct  701   SHLYPIPP-----RVFGSTCFVHNLAPGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHR  755

Query  1729  IYICRHVHFYESIFLFSDST----LCSQPVPPTIP---------WASEPVVTRAPCNTH-  1592
               +   V F+ES   ++ S         P+P  +P          ++ PVV       H 
Sbjct  756   YLMSADVTFFESQPYYTSSNHPDVSMVLPIPQVLPVPTFVESTVTSTSPVVVPPLLTYHR  815

Query  1591  -----AAPTDSAHMSLTSPVPLARGLPP---LAIEGPVQTAPTRARAV*TQHQERGHVMR  1436
                    P DS H     P P A   PP   LA++  +++         T++    +   
Sbjct  816   RPRPTLVPDDSCHA--PDPAPTADLPPPSQPLALQKGIRS---------TRNTNPHYTFL  864

Query  1435  LRHMTRDTSEQF-HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHM  1259
               H        F  +L+  + P    +A+ H  WR AM  E +AL  + TW+LV      
Sbjct  865   SYHRLSSPHYAFVSSLSSISIPKTTGEALSHSGWRQAMVDEMSALHKSGTWELV------  918

Query  1258  NVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
                    +   K   DG +++ KARLVAKG+ Q+ G D+ DTF+ V K  +VRL  S+  
Sbjct  919   ------SLPAVKIGPDGQVDRLKARLVAKGYTQIFGLDYSDTFAPVAKIASVRLFLSMAA  972

Query  1078  SHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*S  899
               +W L QLD+ NAFL+G L E VYM+QPPG+        +      +LYGL+      S
Sbjct  973   VRHWPLHQLDIKNAFLHGDLEEEVYMEQPPGFVAQGESSSLVCRLRRSLYGLKQ-----S  1027

Query  898   PRA  890
             PRA
Sbjct  1028  PRA  1030


 Score = 89.7 bits (221),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 91/170 (54%), Gaps = 7/170 (4%)
 Frame = -1

Query  2763  LSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV  2584
             L +VLYVP     L SV RLT   +    F  D F+++D  T  ++  G  S GLY L  
Sbjct  413   LDSVLYVPGSPFNLASVSRLTKALHCSITFFDDFFLMQDRSTGQMIGTGHESQGLYYLTS  472

Query  2583  SRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRF  2404
             S S  A  +   +  + H+RLGH +     +++ S     + + +L    SC L K +R 
Sbjct  473   SNS-LAACSITDSPDLIHKRLGHSSLSKLQKMVPSL----SSLSTLDCE-SCQLGKHTRA  526

Query  2403  PLDRVSYS-SKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
                R +   S+++  L+++DIWGP+ V ST GFRYF+ F+DDYS+  W +
Sbjct  527   TFSRSTEGRSESIFSLVHSDIWGPSRVSSTLGFRYFVSFIDDYSKCTWVF  576



>emb|CAN64002.1| hypothetical protein VITISV_023116 [Vitis vinifera]
Length=1211

 Score =   247 bits (630),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 161/463 (35%), Positives = 232/463 (50%), Gaps = 65/463 (14%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             R KS+  KTF +F+ +VE QF   IKS+Q + GGE+R     L + GI HR SC  T +Q
Sbjct  440   RNKSEAIKTFVNFKTQVELQFDSKIKSLQTNWGGEFRAFQSYLAENGIVHRVSCPXTQQQ  499

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VE K+R IVE GL LL   S+  ++WD +F +   L N LPT VL  + P   L K+
Sbjct  500   NGVVEXKHRTIVEHGLTLLHTTSLPLKFWDESFRIVVYLSNRLPTVVLHHKCPIEVLFKS  559

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+FL+VFGC C+P LRPYN HK++Y S  C FL Y    +GY CM+ ++G++YI R 
Sbjct  560   IPBYSFLKVFGCSCFPNLRPYNTHKLQYXSEECTFLGYSLKHKGYXCMS-SNGRVYISRD  618

Query  1711  VHFYESIFLFSDSTLCSQPVPPTI--------PWASEPVVTRAPCNTHAAPTDSAH-MSL  1559
             V F E+ F +S +   S  +P T+        P AS P+++     T  +P  SA  +S 
Sbjct  619   VIFNETSFPYSKTIQASSCLPSTVSPFTSHLSPSASPPILSPTMLPTPTSPISSARXISE  678

Query  1558  TSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTT  1379
                V       P + +     A    R +  +  +  H M  R  +     +F  + V  
Sbjct  679   MDNVVSTHPHAPNSXDTTPAPAHNVTRRI-AKDVDNTHPMITRTKSGIFKPKFFIVAV-R  736

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +P+  + A+    W+ AM  E++AL  N+TW LV                          
Sbjct  737   EPSSVATALQQDEWKKAMVVEYDALQRNNTWSLV--------------------------  770

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
                                      VVKP+T+R++F++ +S NW ++ LDV+N FLNG L
Sbjct  771   ---------------------PLPAVVKPSTIRVVFTIALSXNWAIKXLDVNNVFLNGDL  809

Query  1018  AETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              E V+M+QP G+ D  +P+ V      ALYGL+      +PRA
Sbjct  810   QEEVFMQQPQGFIDEQNPNLV-CXLHKALYGLKQ-----APRA  846


 Score = 45.8 bits (107),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -1

Query  2364  DLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             D  +    GPAPV+S SG+RY++ FVD +SRF W +
Sbjct  402   DSCFVKDQGPAPVLSNSGYRYYIHFVDVFSRFSWIF  437


 Score = 63.5 bits (153),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 61/115 (53%), Gaps = 11/115 (10%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSE--SKLLHLSNVLYVPKLSVPLFS  2716
             A+MM +S E+   + + VGNG GL I  +G     S   SK L L+++LYVP ++  L S
Sbjct  327   ANMM-KSAEFARQNQVHVGNGIGLSIKHIGQFEFLSHFSSKPLLLNHLLYVPSITKNLLS  385

Query  2715  VYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR  2551
             V +   +N VFFEFH D   VKD     VL   S SG  Y +     HF  + SR
Sbjct  386   VSKFAKDNKVFFEFHSDSCFVKDQGPAPVL---SNSGYRYYI-----HFVDVFSR  432



>emb|CAN67076.1| hypothetical protein VITISV_042382 [Vitis vinifera]
Length=1236

 Score =   209 bits (533),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 146/442 (33%), Positives = 215/442 (49%), Gaps = 43/442 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI  ++ D   EY     T  ++  GI H+ SCAYT +Q
Sbjct  458   RAELFSIFQKFYAEIQTQFNISICVLRSDNVREYFSTPFTSFMSHHGILHQSSCAYTPQQ  517

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH VET   +L   +V  ++W  A   A  LIN +P+SV   + P+  L   
Sbjct  518   NGVAERKNRHFVETTRTILLHSNVHFRFWGDAVLTACYLINRMPSSVFHDQIPHFLLFLD  577

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C  ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  578   QPLY-FLPPRVFGCTCIVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHRYFIS  636

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIP-----------------WASEPVVTRAPCNTHA  1589
               V F++    FS +T  S PV   +P                 +   P V  AP     
Sbjct  637   ADVTFFKDSPFFS-TTSESLPVSEVLPIPIVSPPDAMPPRPLQVYHRRPXVV-APLPFPE  694

Query  1588  APTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTS  1409
             AP DS       P+P A   P L     +  A  +            + +    ++   S
Sbjct  695   APADSL------PIPSASPAPALPSPNDLPIAVRKGTRSTXNPHPIYNFLSYHRLSXPYS  748

Query  1408  EQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFR  1229
                 A++  + P    +A+ H  WR AMD             LV+     + VGC+WV+ 
Sbjct  749   AFVSAISSVSLPKSTHEALSHPGWRQAMD-------------LVVLPSGKSTVGCRWVYA  795

Query  1228  TKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
              K   DG +++ KARLVAKG+ QV G D+ DTFS + K  +VRLL S+    +W L QLD
Sbjct  796   VKVGPDGQVDRLKARLVAKGYTQVYGSDYGDTFSPIAKIASVRLLLSMAAMWSWPLYQLD  855

Query  1048  VHNAFLNGHLAETVYMKQPPGY  983
             + N FL+G LAE VYM+QP G+
Sbjct  856   IKNVFLHGDLAEEVYMEQPSGF  877


 Score = 83.2 bits (204),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 14/197 (7%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHA-SIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDC  2662
             + NG+  +   +G A  +PS    L  ++VLY P+    L S+ ++T   N    F    
Sbjct  268   LANGSQTVAKGIGLALPLPS----LPFTSVLYTPECPFNLISISKITRTLNCSITFSDKF  323

Query  2661  FIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQ  2482
               ++D  T  ++  G  S GLY L  S S  A   S     + H RLGHP      +++ 
Sbjct  324   VTLQDQSTGKMIGIGGESQGLYHL-TSDSSPAVCISTDAPLLIHNRLGHPTLSKFQKMVP  382

Query  2481  SCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGF  2308
                   + + SL S  SC L K +R  FP   ++  +K+  +L++TD+WGP    S  GF
Sbjct  383   RF----STLSSL-SCESCQLGKHTRVSFP-KHLNNRAKSPFELVHTDVWGPCRTASILGF  436

Query  2307  RYFLLFVDDYSRFCWFY  2257
             +YF+ F+DDYS+  W +
Sbjct  437   QYFVTFIDDYSQCTWLF  453



>gb|ABW74566.1| integrase [Boechera divaricarpa]
Length=1165

 Score =   222 bits (565),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/425 (33%), Positives = 208/425 (49%), Gaps = 24/425 (6%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYR--KIHHTLTKLGITHRKSCAYTH  2078
             + K + +  F++F+  VE+Q  + +K ++ D GGE+   K +    K GI H  + AYT 
Sbjct  378   KSKGEAFDMFKNFKALVEKQSEQQVKVLRTDRGGEFTSTKFNQFCEKEGIHHELTTAYTP  437

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNG  ERK   +VE   ++L E ++  Q+W  +   A  L+N  PT  +   +PY    
Sbjct  438   EQNGVAERKNTTVVEMARSMLKERNLPNQFWAESVRTAVYLLNISPTKAVLNRTPYEAWC  497

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P  + LRVFG  CY  +  +NR K++ +S  C+FL Y    +GYR  N  SGKI   
Sbjct  498   GRKPGVSHLRVFGSVCYSLIDAHNRKKLDEKSEKCIFLGYCSQSKGYRLYNPVSGKIVES  557

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
             R+V F E            + V   +    E      P   ++A    A  + +SP P  
Sbjct  558   RNVTFDEEAVWTWREGDNGELVEIFVNDEQE----ENPSPANSATNTPASSAPSSPGPNN  613

Query  1537  RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQ  1358
                          + P + R++                 R+  E+ HA   + DP   ++
Sbjct  614   GNGSSDGEGSSSISPPQKFRSL-----------------REIYEEQHAF-FSADPVTVNE  655

Query  1357  AVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLV  1178
             A     WR AM++E  ++  N TW+LV      + +G KWVF+TK  AD +I++YKARLV
Sbjct  656   AATKEEWRKAMEEEIASIEKNQTWQLVELPEEKHSIGVKWVFKTKYQADDNIQKYKARLV  715

Query  1177  AKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMK  998
              KG+ Q  G D+  TFS V +  T+R L +L    +W + Q DV +AFLNG L E VY+ 
Sbjct  716   VKGYAQEYGVDYEKTFSPVARFDTLRTLLALGAYMHWPIYQFDVKSAFLNGELREEVYVD  775

Query  997   QPPGY  983
             QP G+
Sbjct  776   QPEGF  780


 Score = 70.1 bits (170),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 100/207 (48%), Gaps = 16/207 (8%)
 Frame = -1

Query  2856  GSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNEN-NVFF  2680
             G+D      G G++    GH ++    KL++   V Y+P L+  L SV ++   N +V F
Sbjct  178   GNDKEVQVEGRGVVAVHNGHGNL----KLIY--GVYYIPDLAHNLLSVGQMVENNCSVLF  231

Query  2679  EFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT--STVWHRRLGHPNA  2506
             + + +C I +      + +   TS  LY L +S      L ++ +  S + H R GH + 
Sbjct  232   DGN-ECVIKEKKSGVTLAMVKKTSNNLYPLEMSSVETKALVAKVSDISKLLHLRYGHLHE  290

Query  2505  HVQNRVL--QSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYTDIWG  2338
             +   RVL  +   +   K+ +L     C   K SR  FP+ R   +++  L++++ D+ G
Sbjct  291   NGL-RVLNQKDMVIGLPKIGALKLCEGCVYGKQSRRSFPVGRARRATQ-YLEIVHADLCG  348

Query  2337  PAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             P    S  G +YFL+  DDYSR  W Y
Sbjct  349   PMQTASLGGSKYFLMLTDDYSRMSWVY  375



>emb|CAN60452.1| hypothetical protein VITISV_011348 [Vitis vinifera]
Length=1074

 Score =   223 bits (567),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 221/449 (49%), Gaps = 53/449 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R KS++++TF  F   V+ QFS SIK+++ D GGEY   +    L   GI H++SC  T 
Sbjct  479   RSKSEVFRTFTEFLAYVDNQFSTSIKTLRIDSGGEYLSTEFQAFLASKGIIHQRSCLSTP  538

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG VE K  HI++    LL E S    +W  A + AT LIN LP+ VL  ES Y  L 
Sbjct  539   QQNGVVEHKNCHILDVVRTLLLESSAPSMFWVEALKTATHLINRLPSQVLHMESLYFCLF  598

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN--LTSGKIY  1724
                P Y  LR+FGC C+ +L P+ RHK+  +S  C FL Y    +G+ C +  L S +I 
Sbjct  599   AKQPSYDHLRIFGCVCFVHLPPHERHKLSAQSVRCAFLGYNMCQKGFVCYDPTLHSIRIV  658

Query  1723  ICRHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP  1544
               R  H       FS + L S P    I   + P    AP   H++            VP
Sbjct  659   YTRRSHPQS----FSVAHLISDPTTLQIQSVAAP---PAPSICHSSRVS---------VP  702

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
               R   P +  G   +A T                              AL+    PTCY
Sbjct  703   PNRYGFPSSSSGNFISAFTT-----------------------------ALSNFDIPTCY  733

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
             S A  H  W+ AM +E  AL  N TW +    P +  +G KWV+  K  +DGS+++YKAR
Sbjct  734   SHAAKHDCWQQAMQEEIAALEANHTWDIEPCPPTIVHLGYKWVYSVKVRSDGSLDRYKAR  793

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVY  1004
             LVA   NQ  G ++ +TF+ V K T V  + +L  S +W L Q+ V N FL+  L E +Y
Sbjct  794   LVALWNNQEYGVNYEETFAPVAKMTIVCTILALAASSDWPLHQMVVKNVFLHEDLKECIY  853

Query  1003  MKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             MK PPG   P+   HV ++ SS  LYGL+
Sbjct  854   MKPPPGLF-PSPTSHVCKLRSS--LYGLK  879


 Score = 68.2 bits (165),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 18/185 (10%)
 Frame = -1

Query  2862  YTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVF  2683
             Y G   ++  NG+ L I+ +G AS    SK    ++V   P+LS  L  V +L + N   
Sbjct  292   YAGQSSIQTANGSSLPIAAIGDAS----SKF---TDVFLAPQLSTNLIFVGQLVDNNCAI  344

Query  2682  FEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT---------STVWH  2530
               F   C +V+D +    + +      L+ L +    F+ L+S  +         S VWH
Sbjct  345   NFFGNGC-VVQDQVMGKPIAKRPKVRHLFPLFLPVPDFSPLSSIKSFACNNVSDLSMVWH  403

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRT-SCHLSKASRFPLDRVSYSSKNVLDLLY  2353
             RRLGHPN  + + VL S         SL     SC L K+   P    +  + +  DL++
Sbjct  404   RRLGHPNTQILSHVLNSDLPGNKDHSSLSLECDSCKLGKSKTLPFLLHASRASHCFDLIH  463

Query  2352  TDIWG  2338
             +D+WG
Sbjct  464   SDVWG  468



>emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera]
Length=2655

 Score =   220 bits (560),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 157/479 (33%), Positives = 232/479 (48%), Gaps = 69/479 (14%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRK--IHHTLTKLGITHRKSCAYTH  2078
             + +S+I   + +F   VE QFS+ IK+ + D   EY +      L   G  H  +C  T 
Sbjct  1868  KSRSEILPIYSNFAKMVETQFSKRIKTFRSDNALEYTQYVFQALLHSYGTIHHLTCPGTS  1927

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNGR   K RHI++T  ALL    V   +W  A       IN +P++V+  ++PY RL 
Sbjct  1928  QQNGRAXXKLRHILDTVRALLLSAKVPAPFWGEASLHXVHAINXIPSAVIHNQTPYERLF  1987

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              +PP Y  LR FG  C+  L+P+  +K+E RS  C FL Y  + +GYRC +  S ++++ 
Sbjct  1988  GSPPDYHHLRSFGSXCFVLLQPHEHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLHVS  2047

Query  1717  RHVHFYE------------------SIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTH  1592
             R+V F+E                   + +F D +L    VP T  +  +P +  +P    
Sbjct  2048  RNVVFWEHRLFVELSHFRSSLTNSSVLEIFLDESL----VPSTNTF--DPPLDFSPDIFD  2101

Query  1591  AAPTDSAHMSLTSPVPLAR--GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTR  1418
             A+P   A   +   +P      L P  +E P Q  P R            H  R+R +  
Sbjct  2102  ASPRQVADEQIDDELPHFEPGSLAPALLEDPPQNIPPR------------HSTRVRSIPS  2149

Query  1417  DTSEQ--FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGC  1244
                +   + AL    +P  Y +A     W+ AM +E +AL  N TW LV   P  +VVGC
Sbjct  2150  HLLDYHCYTALATLHEPQTYREAFTDPLWQIAMKEELDALTKNHTWDLVTLPPGHSVVGC  2209

Query  1243  KWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWT  1064
             KW+++ K  +DGS+E+YKARLVAKGF Q    D+ +TF+ V +                 
Sbjct  2210  KWIYKIKTRSDGSVERYKARLVAKGFTQEYEIDYEETFAPVTR-----------------  2252

Query  1063  LRQLDVHNAFLNGHLAETVYMKQPPGYE-DPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             +  +DV NAFLNG L+E VYM+ P G   +     H++     ALYGL+      +PRA
Sbjct  2253  ISSMDVKNAFLNGDLSEEVYMQPPLGLSVESNKVCHLQ----RALYGLKQ-----APRA  2302


 Score = 70.5 bits (171),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 59/123 (48%), Gaps = 28/123 (23%)
 Frame = -1

Query  2622  RGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLG  2443
             RG T     +L V  + F+ L S A   +W  RLGH               AP       
Sbjct  1772  RGKTCAKWTKLRVYTAAFSSLPSLA---LWDSRLGH---------------AP-------  1806

Query  2442  SRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCW  2263
                S  L K    P +     S ++ +L+++D+WGP+PV S  G RYF++F+DDYSR+ W
Sbjct  1807  ---SSRLGKQPALPFNNSESISNSIFELIHSDVWGPSPVASIGGSRYFVVFIDDYSRYSW  1863

Query  2262  FYP  2254
              +P
Sbjct  1864  IFP  1866



>emb|CAN59949.1| hypothetical protein VITISV_043423 [Vitis vinifera]
Length=1059

 Score =   205 bits (521),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 207/425 (49%), Gaps = 37/425 (9%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             KS+       F   V+ QF  SI +I+ D GGE+  +     + G T++ SC YT +QNG
Sbjct  612   KSETQHLLVKFFSFVQTQFHVSIANIRVDNGGEFFSMREFFKQKGTTYQHSCVYTSQQNG  671

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
              VERK+RHI+E+  A   +  +   +W      A  +IN LPT +L  ++P+ RL+   P
Sbjct  672   VVERKHRHILESTRAFRFQAHLPLPFWAECVSTAVHIINRLPTPLLSRQTPFERLYGKLP  731

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
              Y+ +RVFGC  Y     +  HK   R+  C+FL YP   + Y+  +L + +++  R V 
Sbjct  732   SYSHIRVFGCLAYA-TNVHVPHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVV  790

Query  1705  FYESIFLFSDSTLCSQPVPPTIPWASEPV--------------VTRAPCNTHAAPTDSAH  1568
             F+E+IF +      S    P IP +   +                + P   ++  T  + 
Sbjct  791   FHETIFPYESIPSPSSNSDPVIPLSISDLSPPVPQPSPPEPISPIQQPSLPNSVSTQPSP  850

Query  1567  MSLTSPVPLARGL----PPLAIEG-------------PVQTAPTRARAV*TQHQERGHVM  1439
              S      L R      PP+A+               P+ ++P ++      +    H  
Sbjct  851   ASPPPEPILRRSQRPHHPPMALRDYVCNQVTSPNHLLPLSSSPQKSTCYPLCNFVSYHHY  910

Query  1438  RLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHM  1259
               +H +  T     A++   +PT Y++A  H  W++AM  E  AL  N TW L    P  
Sbjct  911   SPQHRSFTT-----AVSQDIEPTSYAEAASHSHWQEAMQSELAALEANHTWSLTSLPPGK  965

Query  1258  NVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
               +GC+WV++ KR++DG+IE++K RLVAKG+ Q+ G D+ DTFS   K  TVR L +L  
Sbjct  966   KPIGCRWVYKIKRHSDGTIERFKDRLVAKGYTQLEGIDYHDTFSPTAKMITVRCLLALAA  1025

Query  1078  SHNWT  1064
             + NW+
Sbjct  1026  AQNWS  1030


 Score = 85.5 bits (210),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 95/210 (45%), Gaps = 26/210 (12%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
             +G    I+ +G+  + S + L    NVL VP   V L SV R+T + N    F     I+
Sbjct  406   SGEQAPITSIGNLPLNSAATL---KNVLGVPSFKVDLMSVSRVTKDLNCSVTFFPHWCIL  462

Query  2652  KDSITRAVLLRGSTSGGLYRL-------PVSRSHFAYLTS--------RATSTVWHRRLG  2518
             +D  TR  +  G    GLY L       P +++     TS         +++ +WH RLG
Sbjct  463   QDLTTRTTIGLGEQRDGLYYLVALASEKPKTQTPSXXATSCRSPSSQVTSSTALWHXRLG  522

Query  2517  HPNA---HVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTD  2347
             H ++       + L + P   N    +     C L+K  R P    S SS    +L++ D
Sbjct  523   HLSSSRLDFMAKHLLNFPFQSNNACDV-----CXLAKQRRLPFSVSSISSVRPFELIHCD  577

Query  2346  IWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              WGP  + S SG + FL  VDDYSRF W +
Sbjct  578   XWGPYKIASLSGAKXFLTIVDDYSRFTWVF  607



>emb|CAN70029.1| hypothetical protein VITISV_010388 [Vitis vinifera]
Length=1222

 Score =   221 bits (563),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 148/427 (35%), Positives = 219/427 (51%), Gaps = 42/427 (10%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  477   RAELFSIFQKFYAEIQTQFNISIRVLRSDNAREYFSAPFTSFMSHNGILHQSSCAHTPQQ  536

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  E K RH+VET   +L   +V   +W      A  LIN++P+SVL  + P+  L   
Sbjct  537   NGVAEHKNRHLVETARTILLHSNVPFHFWGDVVLTACYLINHMPSSVLHDQIPHFLLFPD  596

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  597   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRCYSLETHQYFIS  655

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
               V F+E    FS +T  S PV   +P    P+V+         P D     +  P PL 
Sbjct  656   ADVTFFEDSPFFS-TTSESLPVSEVLPL---PIVS---------PFD-----VVPPRPLQ  697

Query  1537  --RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
                  P +A   P   AP  +  + +                 TS     L+    P   
Sbjct  698   VYHRRPRVAAPLPFAEAPADSLPIPS-----------------TSPAPALLSPDDLPIAI  740

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
              +A+ H  WR AM  E +AL  N TW LV+     + + C+WV+  K   +G +++ KA 
Sbjct  741   RKALSHPGWRQAMVDEMDALHSNGTWDLVVLPSGKSTIDCRWVYAVKVGPNGQVDRLKAC  800

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVY  1004
             LVAKG+ QV G D+ DTFS V K  +VRLL S+ V  +W L QLD+ N FL+G LAE VY
Sbjct  801   LVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAVMCSWPLYQLDIKNVFLHGDLAEEVY  860

Query  1003  MKQPPGY  983
             M+QPPG+
Sbjct  861   MEQPPGF  867


 Score = 67.8 bits (164),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 79/170 (46%), Gaps = 31/170 (18%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY     
Sbjct  332   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLY-----  386

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASR--  2407
                  +LTS ++ T                  Q      + + SL S  SC L K +R  
Sbjct  387   -----HLTSNSSPT-----------------FQKMVPRFSTLSSL-SCESCQLGKHTRVS  423

Query  2406  FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  424   FP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  472



>ref|XP_004228785.1| PREDICTED: uncharacterized protein LOC101255821 [Solanum lycopersicum]
Length=1125

 Score =   228 bits (580),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 146/428 (34%), Positives = 223/428 (52%), Gaps = 43/428 (10%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY---RKIHHTLTKLGITHRKSCAYT  2081
             R KS+  +T ++F   +E +F   +K+I+ D G E+     +H   TK GI H+K+C YT
Sbjct  701   RCKSNALQTIKAFVSLIENEFQTKLKAIRSDNGLEFTSSEAVHFFQTK-GIIHQKTCPYT  759

Query  2080  HEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRL  1901
              +QNG VERK+++++ET  ALL +  +  +YW      A  +IN LPT +LQ +SPY  L
Sbjct  760   PQQNGVVERKHKYLLETARALLFQSKLPLRYWGECVLTAIYIINRLPTKLLQNKSPYETL  819

Query  1900  HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
             +   P Y+ L+ FGC C+P +   ++ K E R  P VF+ YP + +GY+ +NL + K++I
Sbjct  820   YLKQPTYSHLKSFGCLCFPTVLKTHKDKFEPRGIPHVFVGYPFNTKGYKVLNLATKKVHI  879

Query  1720  CRHVHFYESIFLF-----SDSTLCS-------------QPVPPTIPWASEPVVTRAPCN-  1598
              R V F+E +F F      DS+  S              P    I    E +    P   
Sbjct  880   SRDVVFHERMFPFVHVPDDDSSFSSVLKLLTHSVKISCMPGKTNIFATDEMLDNLTPHEV  939

Query  1597  THAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPT---------------RARAV*TQ  1463
             T    T++ ++  T+       +P    + P +T+ T               +  ++ T 
Sbjct  940   TEDQVTNTTNIHETTSADFTTQVP----QEPRRTSRTINTPSYLKDYTYNLPKLHSLNTF  995

Query  1462  HQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWK  1283
                  HV     +  D+ +    ++   +P  + +A+ H  W+ AM  EF AL  NDTW+
Sbjct  996   VSHNNHVC-FNSLCSDSQQLVTTISHECEPNTFEEAILHPAWQQAMTHEFEALHANDTWE  1054

Query  1282  LVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTV  1103
             +V+       +GCKWV++ K  ADGSIE++KARLV KG+ Q AG D+ +TFS VVK TTV
Sbjct  1055  MVMLPDEKKAIGCKWVYKIKHKADGSIERFKARLVVKGYTQQAGVDYNETFSPVVKMTTV  1114

Query  1102  RLLFSLVV  1079
             R L SL V
Sbjct  1115  RTLISLAV  1122


 Score = 60.8 bits (146),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -1

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             +WH RLGH    V+ R + S PV  +  +       C +++ +R P    +  +  + +L
Sbjct  607   LWHTRLGHV-PFVKMRNITSIPVNVSPKQPFTCNI-CPMARQTRMPFQESTSITTKIFEL  664

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSR  2272
             L+ D+WGP  + +  G+ YFL  VDDYSR
Sbjct  665   LHVDLWGPYHIPTHDGYHYFLTMVDDYSR  693



>gb|AIC77183.1| polyprotein [Gossypium barbadense]
Length=1369

 Score =   224 bits (570),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 225/463 (49%), Gaps = 42/463 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY-RKIHHTLTKL-GITHRKSCAYTH  2078
             + KS+  + F+ F+  VE+Q  R +K ++ D GGEY  K++ +  K  GI H+ +   T 
Sbjct  583   KAKSEALEKFKEFKAMVEKQSGRYLKILRSDRGGEYTAKLYESFCKDHGIIHQLTARRTP  642

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK R I++   +++    + + +W  A E A  L+N  PT  ++ ++P     
Sbjct  643   QQNGVAERKNRTILDMARSMIKGKHLPRTFWAEAVECAVYLLNQCPTKSVRHKTPEEAWS  702

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P    L++FGC  Y ++    R K++ R   C+F+ Y    + YR  N  + K+ I 
Sbjct  703   GHKPRVGHLKIFGCIAYAHVPEQQRKKLDDRGEKCIFIGYDKRSKAYRLYNPLTKKLIIS  762

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSP-VPL  1541
             R V F E+ +                 W+ E                       SP    
Sbjct  763   RDVEFDEADYW---------------RWSEEEKKVEGLFFNEDDNNQEEQGDDQSPGTTA  807

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFH----ALNVTTDP  1373
                    +    +  APTR R++            + + T     QF      L    DP
Sbjct  808   PSSPTSSSGSSSLDEAPTRTRSL----------NDIYNSTEPVETQFDYSLFCLMTECDP  857

Query  1372  TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLV-LDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
               Y +A+ +  W+ AMD+E  A+  NDTW+L  L E H + +G KWV++TK N +G +E+
Sbjct  858   VTYEEAIENNKWKKAMDEEIAAIRRNDTWELTSLPEGH-SPIGVKWVYKTKTNKEGKVEK  916

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             YKARLVAKG+ Q  G D+ + F+ V +  T+RLL ++   + W + Q+DV +AFLNG+L 
Sbjct  917   YKARLVAKGYKQRQGVDYDEIFAPVARIDTIRLLIAVAAQYKWKIYQMDVKSAFLNGYLE  976

Query  1015  ETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             E VY++QPPGY      D V R+  S  LYGL+      +PRA
Sbjct  977   EEVYIEQPPGYSIQGKEDKVYRLKKS--LYGLKQ-----APRA  1012


 Score = 63.9 bits (154),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 91/215 (42%), Gaps = 48/215 (22%)
 Frame = -1

Query  2835  GNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFH-KD-C  2662
             G G  +I  R G           ++S+V YVP L   L S+ +L  +    +E H KD  
Sbjct  392   GKGKVVITQRNGEKK--------YISDVYYVPALKSNLISLGQLLEKG---YEVHMKDRS  440

Query  2661  FIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTS--RATSTVWHRRLGH---------  2515
               +++     V+    T   L+ L +       + +  +  S +WH R GH         
Sbjct  441   LAIRNKSGELVVRVDMTRNRLFTLDIESGEVKCMKTDLKNESWLWHLRYGHLGFSGLKLL  500

Query  2514  ---------PNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLD  2362
                      P+ +  +++ ++C      VK    R    + K+ R         ++  L+
Sbjct  501   SKTNMVNGLPSINHPDQLCEAC------VKGKQHRQKFEVGKSRR---------ARRPLE  545

Query  2361  LLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +++TDI GP  + S  G RY+L F+DDYSR CW Y
Sbjct  546   IVHTDISGPYDIESLGGNRYYLTFIDDYSRKCWVY  580



>emb|CAN69607.1| hypothetical protein VITISV_009561 [Vitis vinifera]
Length=1207

 Score =   196 bits (497),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 159/458 (35%), Positives = 214/458 (47%), Gaps = 81/458 (18%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYR----KIHHTLTKLGITHRKSCAY  2084
             + KSD +  F  F+  VE Q S  IK  Q D   E+     K H  L   GI H+ S  Y
Sbjct  488   KFKSDFFDIFLQFQKFVENQHSARIKVFQSDGVVEFTNTCFKAH--LHTSGIHHQLSYPY  545

Query  2083  THEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTR  1904
             T  QNGR ERK+RH+ ETGLALL    +S ++W                    F++    
Sbjct  546   TPAQNGRAERKHRHVTETGLALLFHSHISPRFW--------------------FDA----  581

Query  1903  LHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIY  1724
                              C  Y +P   H   +   PC+FL Y PS +G+RC+  T+ ++Y
Sbjct  582   -----------------CNLYHQPV-AHSTSW-CIPCIFLGYSPSHKGFRCLEPTTSRLY  622

Query  1723  ICRHVHFYESIFLFSDSTLCSQPVPPT-IPWASEPVVTRAPCNTHAAPTDSAHMSLTSPV  1547
             I RH  F E+ F    S+  +QP+    I    EP +     +  +    S H+  ++  
Sbjct  623   ITRHAQFDETHFPTVPSSQ-AQPLSSLHISNFLEPRLHHIDPSPPSXTFPSPHIPRSNSS  681

Query  1546  PLARGLPPLA-----IEGPVQTAPTRARAV*TQHQERGHVMRLRHMTR----DTSEQFHA  1394
             P +  LPPLA     IE  V ++ +          + G + + RH         S    A
Sbjct  682   PCS-SLPPLASSPHSIELDVDSSSSLGSHPMITRAKAG-IFKTRHPVNLGVLGFSGLLSA  739

Query  1393  LNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNA  1214
                +T+P  +  A  +  W  AMD+E  AL  N TW LV    + N+             
Sbjct  740   FLASTEPKGFKSAAKNPTWLAAMDEEVQALQQNGTWILVSRPVNTNI-------------  786

Query  1213  DGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAF  1034
                  + KARLVAKG+ QV G D+ DTFS VVK TTVR++ SL V++ W LRQLDV N F
Sbjct  787   -----RLKARLVAKGYTQVLGLDYTDTFSPVVKATTVRVVLSLAVTNKWPLRQLDVKNTF  841

Query  1033  LNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             LNG L E VYM+QPPGY D   P HV +    ALYGL+
Sbjct  842   LNGTLTEHVYMEQPPGYIDSRFPTHVCLLKK-ALYGLK  878


 Score = 92.0 bits (227),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 78/152 (51%), Gaps = 15/152 (10%)
 Frame = -1

Query  2670  KDCFIVKDSI------TRAVLLRGSTSGGLYRLPVSRSHFAYLTS----RATSTVWHRRL  2521
             KD  IV +        T  V+  G   GGLY L    S F  +      RA+  +WH RL
Sbjct  337   KDSVIVGNGASLPITHTGRVVATGKRDGGLYVLERDNSAFISVLKNKSLRASYDLWHARL  396

Query  2520  GHPNAHV---QNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYT  2350
             GH N  V    N+  Q    +     SL S  +C  +K  R P  R  + S +VLDL++ 
Sbjct  397   GHVNYSVISFLNKKXQLSLTSLLPSPSLCS--TCQFAKNHRLPYSRNEHRSSHVLDLIHC  454

Query  2349  DIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             D+WGP+P+ S S F Y+++F+DDYSRF W YP
Sbjct  455   DLWGPSPIKSNSSFLYYVIFIDDYSRFTWLYP  486


 Score = 69.7 bits (169),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 79/156 (51%), Gaps = 13/156 (8%)
 Frame = -2

Query  3602  HFVSIKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaa  3423
             H ++I+L+  N++ W++QL+P L  Q+LLGYVD  T  P P   P++++  S        
Sbjct  16    HMITIELSSSNYLLWKSQLLPLLESQDLLGYVDG-TLVPLPRFEPVTSTILST-------  67

Query  3422  ptpnpAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLS  3243
                   Y AW   DQ +L LL+SSL++E +   VG +T+R VW ++       S+AR L 
Sbjct  68    -----KYLAWKAADQRLLCLLLSSLTEEAIATVVGLSTAREVWLALENTFSHHSKARELR  122

Query  3242  PLGQFHYLRQGNSSAVEYLGRAQLLVEDLAHAGHPI  3135
                    +++      E+    + L + L   G P+
Sbjct  123   LKDDLQLMKRSTKPVAEHARTFKTLCDQLHAIGRPV  158



>emb|CAN73234.1| hypothetical protein VITISV_033857 [Vitis vinifera]
Length=1402

 Score =   204 bits (518),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/471 (32%), Positives = 222/471 (47%), Gaps = 79/471 (17%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  636   RAELFSIFQKFYAEIQTQFNISIRVLRSDNAREYFSAPFTSFMSHHGILHQSSCAHTPQQ  695

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  RH+VET   +L   +V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  696   NGVAERXNRHLVETARTILLHSNVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  755

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++   V +V P      R ++      +I 
Sbjct  756   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKRVIVVIP-----LRLID-----TFIS  804

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS-PVPL  1541
               V F+E                                       DS   S TS  +P+
Sbjct  805   ADVTFFE---------------------------------------DSPFFSTTSESLPV  825

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQER-------------GHVMRLRHMTRDTSEQF  1400
             +  L PL I  P    P R   V   +  R              + +    ++   S   
Sbjct  826   SESLDPLPIVSPPDAMPPRPLQV---YHRRPPVLALLVILILFNNFLSYHRLSSPYSAFV  882

Query  1399  HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKR  1220
              A++  + P    +A+ H  WR AM  E  AL  N TW LV+     + VGC+ V+  K 
Sbjct  883   SAISSVSLPKSTHEALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRXVYAVKV  942

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
               DG +++ KARLVAKG+ QV G D+ DTFS V K   VRLL S+    +W L QLD+ N
Sbjct  943   GPDGQVDRLKARLVAKGYTQVYGSDYXDTFSXVXKIAYVRLLLSMAAMCSWPLYQLDIKN  1002

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             AFL+G LAE VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  1003  AFLHGDLAEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  1046


 Score = 83.2 bits (204),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 84/176 (48%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  469   TSVLYTPECPFNLISISKITRTLNYSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  527

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  528   DSSXAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  576

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L+ TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  577   KHTRVSFP-KRLNNRAKSPFELVXTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  631



>emb|CAN69307.1| hypothetical protein VITISV_001120 [Vitis vinifera]
Length=1215

 Score =   205 bits (522),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/442 (34%), Positives = 214/442 (48%), Gaps = 68/442 (15%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             +++++  F+ F   ++ QF+ SI+S                         SCA+T +QNG
Sbjct  481   RAELFSIFQKFYAEIQAQFNISIRS-------------------------SCAHTPQQNG  515

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK RH+VET   +L   +V  ++W  A   A  LIN +P+SVL  + P+  L    P
Sbjct  516   VAERKNRHLVETTRTILLHSNVPFRFWGDAVLTACYLINRMPSSVLHDQIPHFLLFPDQP  575

Query  1885  PYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYR  +L + + +I   
Sbjct  576   LY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRYYSLETHRYFISAD  634

Query  1711  VHFYESIFLFS---DSTLCSQPVPPTIPWASEPVVTR------------APCNTHAAPTD  1577
             V F+E +  FS   +S   S+ +P  I   S+ V  R            AP     APTD
Sbjct  635   VTFFEDLPFFSTTSESLPVSEVLPLPIVSPSDVVPPRPLQVYHRRPRVAAPLPFVEAPTD  694

Query  1576  SAHMSLTSPVPLARGLP-----PLAIEGPVQTA--PTRARAV*TQHQ-ERGHVMRLRHMT  1421
             S  +   SP P    LP     P+AI    ++   P       + HQ  +    R     
Sbjct  695   SLPIPSASPAP---ALPFPDDLPIAIRKGTRSTRNPHPIYNFLSYHQCFKNRTGRSNRFN  751

Query  1420  RDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCK  1241
             R  S                +A+ HL WR AM  E +AL  N TW LV+     + VGC 
Sbjct  752   RRPSTH--------------EALSHLGWRQAMVDEMDALHSNGTWDLVVLPSSKSTVGCH  797

Query  1240  WVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTL  1061
             WV+  K   DG +++ KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L
Sbjct  798   WVYTVKVGPDGQVDRLKARLVAKGYTQVYGFDYGDTFSPVAKIASVRLLLSMAAMCSWPL  857

Query  1060  RQLDVHNAFLNGHLAETVYMKQ  995
              QLD+ N FL+G LAE VYM+Q
Sbjct  858   YQLDIKNVFLHGDLAEEVYMEQ  879


 Score = 81.6 bits (200),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 88/170 (52%), Gaps = 9/170 (5%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L   
Sbjct  314   TSVLYTPECPFNLISINKITRTLNYSITFFDKFVTLQDRSTGKTIGIGRESQGLYHLTSD  373

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASR--  2407
              S    +++ A   + H RLGHPN    ++  +  P   + + SL S  SC L K +R  
Sbjct  374   SSPTVCISTDAPLLI-HSRLGHPNL---SKFQKMVPYF-STLSSL-SCESCQLGKHTRVS  427

Query  2406  FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             FP  R++  +K+  +L++TD+W P    ST GF+YF+ F+DDYSR  W +
Sbjct  428   FP-KRLNNQAKSPFELVHTDVWDPCRTASTLGFQYFVTFIDDYSRCTWLF  476



>emb|CAN66596.1| hypothetical protein VITISV_019893 [Vitis vinifera]
Length=1430

 Score =   222 bits (566),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 157/490 (32%), Positives = 232/490 (47%), Gaps = 65/490 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++   F++F + V+ QF+  I+ ++ D   EY    +   L    I H  SC  T 
Sbjct  597   KEKSEVGHIFQTFNLMVQNQFNSKIQVLKSDNAKEYFTSSLSTYLQNHSIIHISSCVDTP  656

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK RH++E    L+   +V   +W  A  +AT LIN +P+ VL F+SP     
Sbjct  657   QQNGVAERKNRHLLEVAQCLMFSSNVPNYFWGEAILIATYLINRMPSRVLTFQSPRQLFL  716

Query  1897  KTPP------PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTS  1736
             K  P          L+VFGC  + ++ P NR K   R+  C+FL Y P+ +GY+C + T+
Sbjct  717   KQFPHTRATSSDLLLKVFGCTAFVHVYPQNRSKFAPRANKCIFLGYSPTQKGYKCYSPTN  776

Query  1735  GKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWAS--EPV---VTRAPCNTHAAPTDSA  1571
              + Y    V F+E +F +  S +    +     W S  E V    + +P  +  APT+ +
Sbjct  777   KRFYTTMDVSFFEHVFFYPKSHVQGDSMNEHQVWESLLEGVPSFHSESPNPSQFAPTELS  836

Query  1570  HMSLTSPVPLAR-GLP-PLAIEGPV---QTAPTRARAV*TQHQERGHVMRLRHMTRDTSE  1406
                L+S  P     +P P+ I+ P+     AP  A      +  R     L H ++ T  
Sbjct  837   TPMLSSVQPTQHTNVPSPVTIQSPMPIQPIAPQLANENLQVYIRRRKRQELEHGSQSTCG  896

Query  1405  QFHALNVT-------------------TDPT-----------CYSQAVGH----------  1346
             Q+   N +                    D T           C    +G+          
Sbjct  897   QYIDSNSSLPEENIGEDRAGEVLIPNIBDSTLPIALRKGVRRCTDHPIGNYVTYEGLSPS  956

Query  1345  -------L*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
                    L    A+  E +AL  N TW +         VGCKW+F  K  ADGS+E++KA
Sbjct  957   YRAXATSLDDTQAVQDEIDALEKNGTWTITDFPIGKRPVGCKWIFTIKYKADGSVERFKA  1016

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLVAKGF Q  G D+ +TF+LV K  T+R+L SL V+ +W L+QLD+ NA LNG L E V
Sbjct  1017  RLVAKGFTQSYGIDYQETFALVAKLNTIRILLSLAVNQDWCLQQLDIKNAILNGDLEEEV  1076

Query  1006  YMKQPPGYED  977
             YM+  PG+E+
Sbjct  1077  YMEILPGFEE  1086


 Score = 64.3 bits (155),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 101/233 (43%), Gaps = 27/233 (12%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++       G   + + NG+   I  VG  SI   +K L+L +VL+VP L   L S+ 
Sbjct  367   AAILQNYKPSNGHSSVHIANGSKSKI--VGTGSI-KLTKDLYLDSVLHVPNLDCNLLSIS  423

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV--------------SRSH  2572
             +L  +     +F+ +  + +D  +  ++       GLY L                S+S 
Sbjct  424   KLARDLQCVTKFYPNLCVFQDLKSGKMIGSVELCSGLYLLSCGQFSNQVSQASCVQSQSM  483

Query  2571  FAYLTSRATSTV--------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSK  2416
                  S + S V         H RLGHP+     ++     +  NK  +      C  +K
Sbjct  484   LESFNSVSNSKVNKDSEIIMLHYRLGHPSFVYLAKLFPKLFI--NKNPASYHCEICQFAK  541

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              ++    ++ Y    V  L++ D+WG + + + SG R+F+ FVDD++R  W +
Sbjct  542   HTQTVYPQIPYKPSTVFSLVHNDVWGLSRIKNISGTRWFVTFVDDHTRVIWVF  594



>emb|CAN81712.1| hypothetical protein VITISV_038973 [Vitis vinifera]
Length=1615

 Score =   206 bits (524),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 156/518 (30%), Positives = 235/518 (45%), Gaps = 96/518 (19%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS++   F++F + V+ QF+  I+ ++ D   EY    +   L    I H  SC  T +Q
Sbjct  772   KSEVGHIFQTFNLMVQNQFNSKIQVLKSDNAKEYFTSSLSTYLQNHDIIHISSCVDTPQQ  831

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFES--------  1916
             NG  ERK  H++E                  A   AT LIN +P+ VL F+S        
Sbjct  832   NGVAERKNXHLLEVAPXE-------------AILXATYLINRMPSGVLTFQSXRQLLLKK  878

Query  1915  -PYTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLT  1739
              P+TR   +  P   L+VFGC  + ++ P NR K   R+  C+FL Y P+ +GY+C + T
Sbjct  879   FPHTRATSSDLP---LKVFGCTAFVHVYPQNRSKFAPRANKCIFLRYSPTQKGYKCYSPT  935

Query  1738  SGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWAS--EPVV---TRAPCNTHAAPTDS  1574
             + + Y    V F+E IF +  S +  + +     W S  E V    + +P  + +APT+ 
Sbjct  936   NKRFYTTMDVSFFEHIFFYPKSHVQEESMNEHQVWESLLEAVPFSHSESPNRSQSAPTE-  994

Query  1573  AHMSLTSPVP-LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQF-  1400
                 L++P+P L +   P  +  P    P  A      +  R     L H ++ T +Q+ 
Sbjct  995   ----LSTPMPSLVQPAQPTNVPSP---PPQLANENLQVYIRRRKRQELEHGSQPTCDQYI  1047

Query  1399  ---------------------HALNVTTDPTCYSQAVGHL*-------------------  1340
                                   ++N +T P    + V                       
Sbjct  1048  DSISSLPEENIDEDRAGEVLIPSINDSTLPIALRKGVRRRTDHPIGNYVTYEGLSPSYRA  1107

Query  1339  --------WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKAR  1184
                      + A+  E +AL  N TW +         VGCKW+F  K  ADG + ++KA 
Sbjct  1108  FATSLDDTQKKAVQDEIDALEKNGTWTITNLPVGKRPVGCKWIFTIKYKADGXVXRFKAL  1167

Query  1183  LVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVY  1004
             LVA+GF Q  G D+ +TF+ V K  T+R+L SL V+ +W L+QLD+ NAFLNG L E VY
Sbjct  1168  LVARGFTQSYGIDYQETFAPVAKLNTIRILLSLAVNQDWCLQQLDIKNAFLNGDLEEEVY  1227

Query  1003  MKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             M+ PPG+E     + V      +LYGL+      SPR+
Sbjct  1228  MEIPPGFEGSMAKNQV-CKLQKSLYGLKQ-----SPRS  1259


 Score = 80.9 bits (198),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/233 (25%), Positives = 104/233 (45%), Gaps = 27/233 (12%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++       G   + + + + L I+ +G   +   +K L L +VL+VP L   L S+ 
Sbjct  540   AAILQNYKPSNGHSSVHIADSSKLKIAGIGSIKL---TKDLFLDSVLHVPNLDCNLLSIS  596

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV--------------SRSH  2572
             +L  +     +F+ +  + +D  +R ++       GLY LP               S+S 
Sbjct  597   KLARDLQCVTKFYPNSCVFQDLKSRKMIGSAELCSGLYLLPCGQFSNQVSQENCVQSQSM  656

Query  2571  FAYLTSRATSTV--------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSK  2416
                  S + S V         H RLGHPN     ++     +  NK  +      C  +K
Sbjct  657   LESFNSVSNSKVNKDSEIIMLHYRLGHPNFVYLAKLFXKLFI--NKNPASYXCEICQFAK  714

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +R    ++ Y    V  L+++D+WGP+ + + SG R+F+ FVDD++R  W +
Sbjct  715   HTRTVYPQIPYKPXTVFSLVHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVF  767



>gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1353

 Score =   217 bits (552),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/498 (31%), Positives = 226/498 (45%), Gaps = 64/498 (13%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S++   F SF   +E QF  +I+  + D   EY        L+  GI H+ +C +T +Q
Sbjct  523   RSELLPIFMSFLNEIENQFKTTIQVFRSDNAKEYFSHDFSSLLSSKGILHQSTCPHTPQQ  582

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYT-----  1907
             NG  ERK RH+++   +L+    V   +W  A   A  LIN +P+S L+ + P++     
Sbjct  583   NGIAERKNRHLLDIARSLMLASHVPTHHWGDAVLTACFLINRMPSSSLENQIPHSIIFPH  642

Query  1906  -RLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGK  1730
               L   PP     +VFGC C+ +       K+  R+  CVFL Y    +GY+C + ++ +
Sbjct  643   DHLFHVPP-----KVFGCTCFVHNLSPGLDKLSARAIKCVFLGYSRLQKGYKCFSPSTRR  697

Query  1729  IYICRHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSP  1550
              Y+   V F+E    +  ST  S  +   +P  S       PC    +  D + +  + P
Sbjct  698   YYMSADVTFFEDTPFYPSSTDHSSSIQNVLPIPS-------PCPLDTSNPDVSEVPSSPP  750

Query  1549  VPLARGLPPLAI-------------------EGPVQTAPTRARAV*TQHQERGHVMRLRH  1427
              P     PPL                       P    P       +   +    + +R 
Sbjct  751   HPTEVASPPLLTNQCRIQPVGPSVPEASPHDSPPFSINPQAVDPATSHPSDSDWPIVIRK  810

Query  1426  MTRDTSE--------QFHALNVTTD-----------PTCYSQAVGHL*WRDAMDQEFNAL  1304
              TR +           +H L+               P+   +A+ H  WR AM  E  AL
Sbjct  811   GTRSSRNPHPIYNFLNYHRLSPLYSSFVFSLSSHFVPSNIHEALSHPGWRQAMIDEMQAL  870

Query  1303  LHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSL  1124
              +N TW+LV   P    VGC+WV+  K   +G I++ KARLVAKG+ Q+ G D+ DTFS 
Sbjct  871   ENNGTWELVPLPPGKKTVGCRWVYAVKVGPNGEIDRLKARLVAKGYTQIYGLDYCDTFSP  930

Query  1123  VVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSS  944
             V K TTVRL  ++    +W L QLD+ NAFL+G L E +YM+QPPG+        V    
Sbjct  931   VAKITTVRLFLAMAAMRHWPLHQLDIKNAFLHGDLEEEIYMEQPPGFVAQGEYGLV-CKL  989

Query  943   STALYGLRGVKMG*SPRA  890
               +LYGL+      SPRA
Sbjct  990   RRSLYGLKQ-----SPRA  1002


 Score = 69.7 bits (169),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 100/199 (50%), Gaps = 15/199 (8%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             ++ V NG+ +     GH S+   S  L L +VL++P+    L S+ +LT   N    F  
Sbjct  333   LVTVANGSKVAAQGSGHVSL---SSSLKLDSVLFIPQCPYNLISLSQLTRSLNCSVTFTA  389

Query  2667  DCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATST--VWHRRLGHPNAHVQN  2494
             + F++++  T  ++  G  S GLY L   + +F+ ++  ATS   + H RLGHP+     
Sbjct  390   NSFVIQEHGTGRLIGEGRESRGLYYL---KPNFS-VSCSATSNPKLLHDRLGHPSLPKLK  445

Query  2493  RVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTS  2314
              ++ S      K   +     C L K  R    +      +   ++++DIWGP+ V S+ 
Sbjct  446   MMIPSL-----KNLRVLECEPCQLGKHVRSSFPKTVQRCNSAFSIIHSDIWGPSRV-SSF  499

Query  2313  GFRYFLLFVDDYSRFCWFY  2257
             GFRYF+ F+D++SR  W Y
Sbjct  500   GFRYFVTFIDEFSRCTWVY  518



>emb|CAN60829.1| hypothetical protein VITISV_012059 [Vitis vinifera]
Length=1128

 Score =   258 bits (658),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 158/464 (34%), Positives = 237/464 (51%), Gaps = 38/464 (8%)
 Frame = -3

Query  2215  FRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNGRVERKYRHIV  2036
             F   V   F+ +I++++ D G E+  +     + GI H+ SC  T EQNGRVERK++H++
Sbjct  308   FLAYVHTHFNTNIQTLRSDNGQEF-NMPTFYQEHGIIHQLSCVETPEQNGRVERKHQHLL  366

Query  2035  ETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGC  1856
                 +L+ +  +   +W      AT LIN+ P+ +L  ++PY  L + PP Y +  VF C
Sbjct  367   NVARSLMFQSKLPLSHWTNYVLTATHLINHTPSYILNNQTPYQLLFQKPPNYNYFEVFDC  426

Query  1855  RCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSD  1676
              C+      NR K   R+  C+FL YPP+ +GY+ ++LT+ K ++  +V  +ES F    
Sbjct  427   LCFASTITNNRGKFHPRATKCIFLGYPPNIKGYKVLDLTTLKTFVSXNVLLHESTFPSIP  486

Query  1675  STLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQT  1496
             +T+    V P  P   E    + P N+ +  + S +   T P  +     P         
Sbjct  487   NTIHXPFVFPDFPQIYESKSYK-PNNSVSITSGSTNS--TDPTSVIESSIPENTIHANND  543

Query  1495  APTRARAV*TQHQER-------GHVMRLRHMTRDTSEQ----------------------  1403
             A +  R+  T+H  +       G++ ++   T+  S                        
Sbjct  544   ANSLRRSERTKHLPKYLQNYYCGNMTKIDSATQAPSSCSSSGKPYCIFSFLSDSRLSSKH  603

Query  1402  ---FHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVF  1232
                 + ++ T +P  Y Q V    W+ AM  E  AL HN TW L +  P+   +GCKWV+
Sbjct  604   KAFIYVISSTFEPKTYKQXVSIPHWQTAMTDEIKALKHNKTWDLAILPPNKTAIGCKWVY  663

Query  1231  RTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQL  1052
             R K  ADGS+E+YKARLVAKG+ Q  G DFFDT+S V K TTVR+L ++  +  W L QL
Sbjct  664   RVKFKADGSVERYKARLVAKGYTQQEGLDFFDTYSPVAKMTTVRVLLAIAAAKQWYLHQL  723

Query  1051  DVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             DV+NAFL+G L E VYM+ P G+  P  P   ++  S  LYGLR
Sbjct  724   DVNNAFLHGDLNEEVYMQLPLGFSTPNDPRVCKLKKS--LYGLR  765



>emb|CAN80771.1| hypothetical protein VITISV_027574 [Vitis vinifera]
Length=1193

 Score =   201 bits (512),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/461 (34%), Positives = 222/461 (48%), Gaps = 63/461 (14%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  456   RAELFSIFQKFYXEIQTQFNISIRVLRSDNAREYFSAPFTSFMSHHGILHQSSCAHTPQQ  515

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   +L   +V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  516   NGVAERKNRHLVETARTILLHSNVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLF--  573

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRH--KIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
             P P T      C     L  Y+       +R +           +GYRC +L + + +I 
Sbjct  574   PEPTTLFPSSSCLWLYLLCSYSHSWTGQAFRQS---------HEKGYRCYSLETHRYFIS  624

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHM--SLTSPVP  1544
               V F+E    FS +T  S PV   +P    P+V+  P      P    H    + +P+P
Sbjct  625   ADVTFFEDSPFFS-TTSESLPVSEVLPI---PIVS-PPDAMPPRPLQVYHRRPXVXAPLP  679

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
              A        E P  + P                         ++    AL    D    
Sbjct  680   FA--------EAPADSLPI-----------------------PSASPAPALPSPNDLPIA  708

Query  1363  S--QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYK  1190
             S  +A+ H  WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ K
Sbjct  709   STHEALSHPGWRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRLK  768

Query  1189  ARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAET  1010
             ARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ NAFL+G LAE 
Sbjct  769   ARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDLAEE  828

Query  1009  VYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  829   VYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  862


 Score = 84.7 bits (208),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 84/172 (49%), Gaps = 13/172 (8%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ + T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  289   TSVLYTPECPFNLISISKJTRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  347

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSR--TSCHLSKASR  2407
              S  A   S       H RLGHP+     +++        +  +L S    SC L K +R
Sbjct  348   DSSXAVCISXDAPLXIHNRLGHPSLSKFQKMVP-------RFSTLSSLPCESCQLGKHTR  400

Query  2406  --FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  401   VSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  451



>emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera]
Length=1636

 Score =   210 bits (535),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 152/480 (32%), Positives = 232/480 (48%), Gaps = 56/480 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS+  + F++F+  ++ QF   I+ ++ D   +Y    +   L + G+ H  SC  T 
Sbjct  613   KEKSETSQIFKNFKNMIQTQFQSKIQILKSDNARDYFNSILGEFLAQEGLVHLSSCVDTP  672

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPY----  1910
             +QNG  ERK RH++E   +L+   +V + +W  A   A  LIN +P+ VL+F++P     
Sbjct  673   QQNGIAERKNRHLLEVVRSLMFSMNVPKLFWGQAVLTAAYLINRMPSRVLKFQTPCQTLL  732

Query  1909  -----TRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN  1745
                  TRL  T PP    ++FGC  + ++   +R K++ RS  C+FL Y    +GY+C +
Sbjct  733   KSFPTTRLISTVPP----KIFGCSVFVHINQQHRSKLDPRSLKCIFLGYSSKQKGYKCYS  788

Query  1744  LTSGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHM  1565
               + K Y    V F+E+           QP  P      E        +T          
Sbjct  789   PVTRKFYNSMDVTFFET-----------QPYYPKNDIQGEN-------STQEYQFWDLES  830

Query  1564  SLTSPVPLARGLPPLAIEGP-----------VQTAPTRARAV*TQHQERGHVMRLRHMTR  1418
                SP+     +PP +   P           +Q   T  RA+  Q  E         +  
Sbjct  831   FSESPITTENHIPPKSFNQPEFIVDLWDKEHIQEE-TEERALSQQTHEAEPGPNPSKLPG  889

Query  1417  DTSEQFHALNVTTD---PTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVG  1247
             + +      +  T+   P    +A  +  W+  +++E  AL  N TW++        +VG
Sbjct  890   NNAPDGIVDSDITEIQVPQNIQEAFKYPKWKAVVNEEVRALEKNGTWEITDLPRGKKLVG  949

Query  1246  CKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNW  1067
             CKW+F  K  ADG++++YKARLVAKGF Q  G D+ +TF+ V K  TVR+L SL  + +W
Sbjct  950   CKWIFTVKYKADGNVDRYKARLVAKGFTQSYGIDYQETFAPVAKLNTVRVLLSLAANLDW  1009

Query  1066  TLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             +L QLDV NAFLNG L E VYM  P G E  ++ + V R+  S  LYGL+      SPRA
Sbjct  1010  SLHQLDVKNAFLNGDLEEEVYMDIPAGLETTSNFNKVCRLRKS--LYGLKQ-----SPRA  1062


 Score = 75.1 bits (183),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 92/213 (43%), Gaps = 24/213 (11%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
              +R+ +G+   +S+V        S+ L L+ VL VP L   L S+ +LT E      F  
Sbjct  406   TVRIADGS---LSKVAGTGSVVLSRDLTLNFVLLVPNLDCNLLSISKLTKEKRCITNFSS  462

Query  2667  DCFIVKDSITRAVLLRGSTSGGLY------------RLPVSRSHFAYLTSRATSTV--WH  2530
                  +D  +   +       GLY            ++ V  + F+       S +  WH
Sbjct  463   THCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTVGSNSFSVSCQNNDSAIRLWH  522

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLL  2356
              RLGHPN      +    P   NK         C LSK  R  FP+    Y   +   ++
Sbjct  523   YRLGHPNVMYLKHLF---PSLFNKNPKSFECEICQLSKQVRSHFPIQ--PYKESSPFSMI  577

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             ++DIWGP+ + + +G R+F+ F+DD++R  W +
Sbjct  578   HSDIWGPSRIKNVTGTRWFVSFIDDHTRLTWVF  610



>emb|CAN81385.1| hypothetical protein VITISV_012324 [Vitis vinifera]
Length=1369

 Score =   215 bits (548),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 152/464 (33%), Positives = 228/464 (49%), Gaps = 57/464 (12%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++   F++F   V+ QF+  I+ ++ D   EY    +   L   GI H  SC  T 
Sbjct  597   KEKSEVGHIFQTFNRMVQNQFNSKIQVLKSDNAKEYFTSSLSTYLQNHGIIHISSCVDTP  656

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK RH++E    L+   +V   +W  A   AT LIN +P+ VL F+SP  +L 
Sbjct  657   QQNGVAERKNRHLLEVARCLMFSSNVPNYFWGEAILTATYLINRMPSRVLTFQSP-RQLF  715

Query  1897  KTPPPYTF-------LRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRC-MNL  1742
                 P+T        L+VFGC  + ++ P NR K   R+  C+FL Y P+ +G R    L
Sbjct  716   LKQFPHTHAASSDLPLKVFGCTAFVHVYPQNRSKFAPRANKCIFLGYSPTQKGRRKRQEL  775

Query  1741  TSGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMS  1562
               G    C         ++ S+S+L  + +      A E ++         +  DS    
Sbjct  776   EHGSQSTCGQ-------YIDSNSSLPEENIGED--RAGEVLI--------PSIDDS----  814

Query  1561  LTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVT  1382
              T P+ L +G+     + P+                 G+ +    ++        +L+ T
Sbjct  815   -TLPIALRKGVR-RCTDHPI-----------------GNYVTYEGLSPSYRAFATSLDDT  855

Query  1381  TDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSI  1202
               P    +A+    W+ A+  E +AL  N TW +         VGCKW+F  K  ADGS+
Sbjct  856   QVPNTIQEALKISEWKKAVQDEIDALEKNGTWTITDLPVGKRPVGCKWIFTIKYKADGSV  915

Query  1201  EQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGH  1022
             E++KARLVA+GF Q  G D+ +TF+ V K  T+R+L SL V+ +W L+QLD+ NAFLNG 
Sbjct  916   ERFKARLVARGFTQSYGIDYQETFAPVAKLNTIRILLSLAVNQDWCLQQLDIKNAFLNGD  975

Query  1021  LAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             L E VYM+ PPG+E+    + V      +LYGL+      SPRA
Sbjct  976   LEEEVYMEIPPGFEESMAKNQV-CKLQKSLYGLKQ-----SPRA  1013


 Score = 70.1 bits (170),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 53/233 (23%), Positives = 105/233 (45%), Gaps = 27/233 (12%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++       G   + + +G+   I+  G   +   +K L+L +VL+VP L   L S+ 
Sbjct  367   AAILQNYKPSNGHSSVHIADGSKSKIAGTGSIKL---TKDLYLDSVLHVPNLDCNLLSIS  423

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSR-----SHFAYLTSRAT  2545
             +L ++     +F+ +  + +D  +  ++       GLY L   +     S  + + S++ 
Sbjct  424   KLAHDLQCVTKFYPNLCVFQDLKSGKMIGSAELCSGLYLLSCGQFSNQVSQASCVQSQSM  483

Query  2544  ST-----------------VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSK  2416
             S                  + H RLGHP+     ++     +  NK  +      C  +K
Sbjct  484   SESFNSVSNSKVNKDSEIIMLHYRLGHPSFVYLAKLFPRLFI--NKNPASYHCEICQFAK  541

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +R    ++ Y    V  L+++D+WGP+ + + SG R+F+ FVDD++R  W +
Sbjct  542   HTRTVYPQIPYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFVDDHTRVTWVF  594



>emb|CAN78451.1| hypothetical protein VITISV_005945 [Vitis vinifera]
Length=773

 Score =   252 bits (644),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 149/376 (40%), Positives = 217/376 (58%), Gaps = 15/376 (4%)
 Frame = -3

Query  2017  LAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPPPYTFLRVFGCRCYPYL  1838
             +A+  +  +YW +AF+ A  LIN LP  +L F+SP   L    P Y  LRVFGC C+P L
Sbjct  1     MAQSFLPSKYWTYAFQTAVYLINLLPAKLLHFQSPTQTLFHKLPNYHHLRVFGCLCFPSL  60

Query  1837  RPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVHFYESIFLFSDSTLCSQ  1658
             RPY +HK+ YRS  CVFL Y P+ +GY C+++++ +IYI R+V       +F +S+   Q
Sbjct  61    RPYTQHKLCYRSTACVFLGYAPAHKGYLCLDVSTNRIYISRNV-------IFHESSFPFQ  113

Query  1657  PVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRAR  1478
                P    +     +        + +  +  +++SP+  +  +PPL I  P  T+   A 
Sbjct  114   SSSPPSSPSPHLPSSTPALINSPSLSAPSSPAVSSPIITSDSIPPL-IPVPFATSSPAAP  172

Query  1477  AV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLH  1298
             +         H M  R  +    ++   +  TT+P  YSQA  +  W  AM+ E+ ALL 
Sbjct  173   SP-PPLPLNTHPMVTRAKSGIHKKRSFIVQHTTEPRTYSQAFKNDSWVQAMNSEYQALLR  231

Query  1297  NDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVV  1118
             N+TW LV      ++VGC+W+++ K   DGSI+++KARLVA+GF Q  G D+FDTFS VV
Sbjct  232   NNTWSLVPPPSSAHIVGCRWIYKLKYRPDGSIDRHKARLVAQGFTQTPGIDYFDTFSPVV  291

Query  1117  KPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSST  938
             KP T+RL+ +L VS  W++RQLDV N FLNG L E V+M QP G+ +PT+P +V      
Sbjct  292   KPCTIRLILALAVSFQWSVRQLDVENGFLNGDLEEEVFMTQPQGFVNPTYPTYV-CKLHK  350

Query  937   ALYGLRGVKMG*SPRA  890
             ALYGL+      +PRA
Sbjct  351   ALYGLKQ-----APRA  361



>ref|XP_007024187.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY26809.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1255

 Score =   257 bits (656),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 160/459 (35%), Positives = 233/459 (51%), Gaps = 74/459 (16%)
 Frame = -3

Query  2104  HRKSCAYTHEQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQ  1925
             H+ SC  T +QNG VERK++HI+    ALL + S+   +W  A   A  +IN +PT +L+
Sbjct  445   HQLSCVETLQQNGVVERKHQHILVVARALLFQSSLPTHFWGDAVMTAVHIINRVPTRLLK  504

Query  1924  FESPYTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN  1745
              +S +  L+K  P Y  LRVFG  C+      +R K++ R+  C+FL YP + +GYR  +
Sbjct  505   NKSLFELLYKRQPSYEHLRVFGSLCFVSTLSQHRKKLDQRATKCIFLGYPNNTKGYRVYD  564

Query  1744  LTSGKIYICRHVHFYESIFLFSDSTLCSQPVP----------------------------  1649
             L + +I I R++ F+E  F F      + P P                            
Sbjct  565   LNANRIIISRNIVFHEGTFPFQSKQHTTWPEPFCQTLGMHTKYSPQIDSKLPNFHCQDYI  624

Query  1648  PTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARGLPPLAIEG----------PVQ  1499
             P   ++SEP       NT A    ++ ++   P  L     P A             P +
Sbjct  625   PADTYSSEP-------NTSAQTPSTSQINDFEPNSLDTVSMPTATNNENVTSSNEHDPNE  677

Query  1498  TAPTRARAV*TQHQERGHVMRLRHM-------------------TRDTSEQFH----ALN  1388
               P R     T+H+     M   H+                   T++ S  +     +L+
Sbjct  678   NLPVRKS---TRHKHAPKYMDAYHLDMPSKSHNVTAHPITKFLSTKNLSPAYKTFTTSLS  734

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
              T +P+ Y QA  +  WRDAM  E  AL  N+TW ++    + +V+GCKWV++ K NADG
Sbjct  735   YTFEPSTYHQAASYSHWRDAMSAELKALQDNETWSIIPRPLNSHVIGCKWVYKVKLNADG  794

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
              IE+YKARLVAKG+NQ+AG D+ +TFS V K TTVR+ F++  + NW L QLDV+NAFLN
Sbjct  795   QIERYKARLVAKGYNQIAGFDYKETFSPVAKQTTVRVFFAIATAFNWHLTQLDVNNAFLN  854

Query  1027  GHLAETVYMKQPPGYE-DPTHPDHVRVSSS--TALYGLR  920
             G L E VYM  PPGYE    +P++V++      +LYGL+
Sbjct  855   GDLKEEVYMDIPPGYEIQGEYPENVKLVCKLHKSLYGLK  893



>emb|CAN60274.1| hypothetical protein VITISV_024841 [Vitis vinifera]
Length=1573

 Score =   199 bits (506),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/418 (34%), Positives = 208/418 (50%), Gaps = 49/418 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  364   QAELFSIFQKFYAEIQTQFNISIRVLRSDNAREYFSTPFTSFMSHHGILHQSSCAHTPQQ  423

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   +L   +V   +W  A   A  LIN +P+SVL  + P++ L   
Sbjct  424   NGVAERKNRHLVETARTILLHSNVPFHFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  483

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y F+  RVFGC C+ ++    + K+  ++  C+FL Y    +GYR  +L + + +I 
Sbjct  484   QPLY-FIPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYRYYSLETHRYFIS  542

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHM--SLTSPVP  1544
               V F+E    FS +T  S PV   +P    P+V+  P      P    H    + +P+P
Sbjct  543   ADVTFFEDSPFFS-TTSESLPVFEVLPI---PIVS-PPDAMPPRPLQVYHRRPRVVAPLP  597

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTD-PTC  1367
              A        E P  + P                         ++    AL    D P  
Sbjct  598   FA--------EAPADSLPI-----------------------PSASPAPALPSPNDLPIA  626

Query  1366  YSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
               +      WR AM  E  AL  N TW LV+     + VGC+WV+  K   DG +++ KA
Sbjct  627   VRKG-----WRQAMVDEMAALHSNGTWDLVVLPSGKSTVGCRWVYAIKVGPDGQVDRLKA  681

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             RLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ NAFL+G LAE
Sbjct  682   RLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLHGDLAE  739


 Score = 85.1 bits (209),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 95/208 (46%), Gaps = 33/208 (16%)
 Frame = -1

Query  2856  GSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFE  2677
             GS  +  G G  L +S + H S            VLY P+    L S+ ++T   N    
Sbjct  177   GSQTVAKGIGLTLPLSSLPHTS------------VLYTPECPFNLISISKITRTLNCSIT  224

Query  2676  FHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPN-AHV  2500
             F      ++D  T   +  G  S GLY L  S S  A   S     + H RLG+P+ +  
Sbjct  225   FSDKFVTLQDRSTGKTIGIGRESQGLYHL-TSDSFPAVCISTDAPLLIHNRLGYPSLSKF  283

Query  2499  QNRV-----LQSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYTDIW  2341
             Q  V     L S P             SC L K +R  FP  R++  +K+ L+L++TD+W
Sbjct  284   QKMVPRFSTLSSLPCE-----------SCQLGKHTRVSFP-KRLNNRAKSPLELVHTDVW  331

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             GP    ST GF+YF+ F+DDYSR  W +
Sbjct  332   GPCRTASTLGFQYFVTFIDDYSRCTWLF  359



>ref|XP_008237766.1| PREDICTED: uncharacterized protein LOC103336496 [Prunus mume]
Length=3764

 Score =   211 bits (538),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 143/461 (31%), Positives = 226/461 (49%), Gaps = 37/461 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             R KS+ ++ F+ F+   E Q    +KS++ D GGE+   +     ++ GI  + + AY+ 
Sbjct  274   RNKSNAFECFKKFKAMTELQSGHKVKSLRSDRGGEFMSNEFLTYCSEAGIQRQLTVAYSP  333

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG VERK R ++E   ++L E  +  ++W  A   A  L+N  P+  L+  +P+    
Sbjct  334   QQNGVVERKNRTVIEMAKSMLHEKRLPYEFWAEAVHTAVYLLNRCPSKSLKKMTPFEAFT  393

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P    L+VFGC C+  +    RHK+E  S  C+F+ Y    +GYR  +  + KI + 
Sbjct  394   GRKPGIAHLKVFGCLCHVLIPSVLRHKLEENSHKCIFVGYGLCEKGYRLYDPKTIKIILS  453

Query  1717  RHVHF-YESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             R V+F  E+ + + + +     +P        P   +    T     D     L + + +
Sbjct  454   RDVYFDEEASWTWENPSNADVRMP-------MPDGNQGTAETEQKVLDEQSQFLDTQMQM  506

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNV-TTDPTCY  1364
                          + AP     +     E   V    H  R  ++     N+   +P  +
Sbjct  507   EEE----------EIAPQGEEML----DETQRVDHTPHKWRSINDIMTQCNMCIVEPDSF  552

Query  1363  SQAVGHL*WRDAMDQEFNALLHNDTWKLV---LDEPHMNVVGCKWVFRTKRNADGSIEQY  1193
              +A     WR AM+ EF  +  N+TWKLV    D+P   V+G KWV++ K N DG++++ 
Sbjct  553   EEADLDESWRSAMEAEFKMIKKNNTWKLVDRPFDKP---VIGVKWVYKVKLNLDGTVQKN  609

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             KARLVAKG++Q  G D+ +TF+ V +  T+R L +L     W L QLDV +AFLNG L E
Sbjct  610   KARLVAKGYSQKPGIDYNETFAPVARLDTIRTLIALAAQKEWNLFQLDVKSAFLNGILKE  669

Query  1012  TVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              VY++QP GY   +    V    + ALYGL+      +PRA
Sbjct  670   EVYVEQPQGYVQESKETKV-YRLNKALYGLKQ-----APRA  704


 Score = 72.4 bits (176),  Expect(2) = 2e-66, Method: Composition-based stats.
 Identities = 61/206 (30%), Positives = 97/206 (47%), Gaps = 14/206 (7%)
 Frame = -1

Query  2841  RVGNGAGLIISRVGHASIPSESKL--LHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             +V  G G  +  VG  ++  E+K    H+  V+ VP L   L SV ++  E+     F K
Sbjct  69    KVKMGTGETVQVVGKGTLVIETKTGRKHIQEVMLVPGLEENLLSVGQMM-EHGYCLVFGK  127

Query  2667  DCFIVKD--SITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTV--WHRRLGHPNAHV  2500
                 + D  S+   +     T    + L +  +    L +  T ++  WH+RLGH N   
Sbjct  128   GMVTIFDDWSLQNPIAKVPMTINRCFSLTMVPATQLVLRASVTHSLQTWHKRLGHLNDQ-  186

Query  2499  QNRVLQSCPVA---PNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYTDIWGP  2335
               R+L +  +    P+  K       C L K  R  FP +  ++ ++  L+L++TDI GP
Sbjct  187   SIRMLANQDMVHGLPSLEKDFAVCEGCKLGKQHRDSFPAES-TWRAQFPLELVHTDICGP  245

Query  2334  APVISTSGFRYFLLFVDDYSRFCWFY  2257
               + S S  RYF+LF+DDY+R  W Y
Sbjct  246   MQIASISENRYFMLFIDDYTRMAWVY  271



>emb|CAN79061.1| hypothetical protein VITISV_024577 [Vitis vinifera]
Length=1424

 Score =   211 bits (538),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 137/461 (30%), Positives = 227/461 (49%), Gaps = 38/461 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS+++  F+ F+  VE+Q    IK+++ D G EY   +  +     G+  + + AYT +Q
Sbjct  633   KSEVFSIFKKFKSFVEKQSGCYIKTLRSDRGMEYTSSQFGNFCEDEGVERQLTVAYTPQQ  692

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VERK + ++E   A+L E  + + +W  A   A  L+N  PT  L  ++P       
Sbjct  693   NGVVERKNQTVMEMAKAMLYEKGLPKIFWAEAVNTAVYLLNRCPTKALLNKTPIEAWSGR  752

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P     +VFGC CY  +    R K++  S  C+F+ Y    +GYR  NL + K+ I R 
Sbjct  753   KPSVRHFKVFGCLCYSQVPKQRRSKLDETSEKCIFMGYSSQSKGYRLYNLKTXKLIISRD  812

Query  1711  VHFYESI-FLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLAR  1535
             V F E + + + +  +  + +        + + T+AP  T    T     S +SP    R
Sbjct  813   VIFDEKVAWNWEEGKILKKTI------LVDELQTKAPVETGNGST-----STSSPQESPR  861

Query  1534  GLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQA  1355
              +P         +  +   +            ++R +T D  E+ +   V  +P  + +A
Sbjct  862   SVPLSPSIESPTSXSSSPSS---------TPRKMRSLT-DVYERCNLCIV--EPQSFEEA  909

Query  1354  VGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTK------RNADGSIEQY  1193
             +    WR AM++E + +  N+TW+LV       ++G KW+FR K       ++DG +++ 
Sbjct  910   IKDEDWRKAMEKEIDVIEKNETWQLVEKPKDKEIIGVKWIFRVKWIFRXKYHSDGRVQRL  969

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             KARLVAKG++Q  G DF +TF+ V +  T+R + ++     W L QLD+ +AFLNG L  
Sbjct  970   KARLVAKGYSQQPGXDFHETFAPVARLDTIRTIIAVAAQKGWLLYQLDIKSAFLNGKLEX  1029

Query  1012  TVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              +Y++QP G+      + V      ALYGL+      +PRA
Sbjct  1030  EIYVEQPQGFVVDGEENKV-YKLKKALYGLKQ-----APRA  1064


 Score = 70.1 bits (170),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 86/200 (43%), Gaps = 23/200 (12%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKD  2665
             +++GNG  + +   G   I  +    ++ +VL VP L   L SV +L  E+     F  +
Sbjct  448   VKMGNGDLVNVKGKGTVGIQXKVGTKYIRDVLLVPALEQXLLSVGQLV-EHGYKLHFENN  506

Query  2664  CFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATST----VWHRRLGHPNAHVQ  2497
                + D   R  L++          P+   +   +  R        +WHRR GH N    
Sbjct  507   ECTIYDKEQRRNLVKKIKMEKNRSFPIVFKYVENVALRMEDVEEAWLWHRRFGHLNF---  563

Query  2496  NRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVIST  2317
                        N +K L  R   H      FP   V++ +K VL+L++TDI GP    S 
Sbjct  564   -----------NSLKMLCQRKMHH---RQSFP-KGVAWRAKKVLELVHTDICGPMSTPSQ  608

Query  2316  SGFRYFLLFVDDYSRFCWFY  2257
                +YF+LF+DD++R  W +
Sbjct  609   GNNKYFVLFIDDFTRMTWVF  628



>emb|CAN60238.1| hypothetical protein VITISV_032906 [Vitis vinifera]
Length=1430

 Score =   219 bits (558),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 222/454 (49%), Gaps = 31/454 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTL--TKLGITHRKSCAYTHEQ  2072
             K++ ++TF+ F+  VE+Q  + IK ++ D  GE+      +   + G+    +  Y+ EQ
Sbjct  650   KAETFETFKKFKAFVEKQSGKCIKVLRTDRXGEFLSNDFKVFCEEEGLHRELTTPYSPEQ  709

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK R +VE   +++   ++S  +W      A  L+N  PT  +   +PY   +  
Sbjct  710   NGVAERKNRTVVEMARSMMXAKNLSNHFWAEGVATAVYLLNISPTKAVLNRTPYEAWYGR  769

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P  + L+VFG   Y     +NR K++ +S  C+F+ Y    +GY+  N  SGKI + R+
Sbjct  770   KPWVSHLKVFGSVAYTLXBSHNRSKLDEKSVKCIFIGYCSQSKGYKLYNPVSGKIIVSRN  829

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLARG  1532
             V F E     +  T         +  +SE  + ++  +   +       + +        
Sbjct  830   VVFDEK----ASXTWRVSEDGALVEISSESEMAQSE-DQQPSVQIPXSPTPSHSPSSPNL  884

Query  1531  LPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQAV  1352
                 + +   +T P + R++                 RD  E    L V  DPT + +AV
Sbjct  885   SXSSSSQSSEETPPRKFRSL-----------------RDIYETTQVLFVA-DPTTFEEAV  926

Query  1351  GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAK  1172
                 W  AM +E  A+  N+TW+LV      NV+G KWVFRTK  ADGSI+++KARLVAK
Sbjct  927   EKEEWCSAMKEEIAAIEKNETWELVELPEDKNVIGVKWVFRTKYLADGSIQKHKARLVAK  986

Query  1171  GFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQP  992
             G+ Q  G D+ DTFS V +  TVR L +L    +W + Q DV +AFLNG L E VY  QP
Sbjct  987   GYAQQHGVDYDDTFSPVARFETVRTLLALAAHMHWCVYQFDVKSAFLNGELVEEVYXSQP  1046

Query  991   PGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              G+  P   +HV      ALYGL+      +PRA
Sbjct  1047  EGFIVPDKEEHV-YRLKXALYGLKQ-----APRA  1074


 Score = 61.6 bits (148),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 86/209 (41%), Gaps = 36/209 (17%)
 Frame = -1

Query  2856  GSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFE  2677
             G D      G G +    GH ++    KLL+  NV ++P L+  L             ++
Sbjct  464   GDDXQVQVEGKGTVAVNNGHGNV----KLLY--NVYFIPSLTEKLVKC-------GATYD  510

Query  2676  FHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS--RSHFAYLTSRATSTVWHRRLGHPNAH  2503
                D  IV   +          +  L+ L VS    H   +   + S +WH R GH N  
Sbjct  511   KKSDQIIVDVRMA---------ANKLFPLEVSSIEKHALVVKETSESNLWHLRYGHLNVK  561

Query  2502  -----VQNRVLQSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYTDI  2344
                   +  ++   P    K+ S+     C   K S+  FP  R S  + + L++++ D+
Sbjct  562   GLKLLSKKEMVFELP----KIDSVNVCEGCIYGKQSKKPFPKGR-SRRASSCLEIIHADL  616

Query  2343  WGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              GP    S  G RYFLLF DD+SR  W Y
Sbjct  617   CGPMQTASFGGSRYFLLFTDDHSRMSWVY  645



>emb|CAN64452.1| hypothetical protein VITISV_009528 [Vitis vinifera]
Length=2220

 Score =   210 bits (535),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 154/506 (30%), Positives = 235/506 (46%), Gaps = 72/506 (14%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++   F++F + V+ QF+  I+ ++ D   EY    +   L   GI H  SC  T 
Sbjct  1379  KEKSEVGHIFQTFNLMVQNQFNSKIQVLKSDNAKEYFTSSLSTYLQNHGIIHISSCVDTP  1438

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESP-----  1913
             +QNG  ERK RH++E    L+   +V    W  A   AT LIN + + VL F+SP     
Sbjct  1439  QQNGVAERKNRHLLEVVWCLMFSSNVPNYLWGEAILTATYLINRMSSRVLTFQSPRQLLL  1498

Query  1912  ----YTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN  1745
                 +TR   +  P   L+VFGC  + ++ P NR K   R+  C+FL Y P+ +GY+C +
Sbjct  1499  KKFPHTRAASSDLP---LKVFGCTTFVHVYPQNRSKFAPRANKCIFLGYSPTQKGYKCYS  1555

Query  1744  LTSGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWAS--EPV---VTRAPCNTHAAPT  1580
              T+ + Y    V F+E +F +  S +  + +     W S  E V    + +P  + +APT
Sbjct  1556  PTNKRFYTTMDVSFFEHVFFYPKSHVQGESMNEHQVWESLLEAVPFSHSESPNPSQSAPT  1615

Query  1579  DSAH-----------------MSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQER  1451
             + +                  +++ SP+P+      LA E        RA  V     + 
Sbjct  1616  ELSTPMXSSVQSXQPTNVPSPVTIQSPMPIQPIAXQLANENLXNIGEDRAGEVLIPSIDD  1675

Query  1450  GHV-MRLRHMTRDTSEQ------------------FHALNVTTDPTCYSQAVGHL*WRDA  1328
               + + LR   R  ++                     +L+ T  P    +A     W+ A
Sbjct  1676  STLPIALRKGVRRCTDHPIGNYVXYEGLSPSYRAFATSLDDTQVPNTIQEAFKISEWKKA  1735

Query  1327  MDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGD  1148
             +  E +AL  N TW +         VGCKW+F  K   DGS+E++KARL  +        
Sbjct  1736  VQDEIDALEKNGTWTITDLPVGKRPVGCKWIFTIKYKVDGSVERFKARLTIQ--------  1787

Query  1147  DFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTH  968
                +TF+ V K  T+R+L SL V+ +W L+QLD+ NAFLNG L E VYM+ P G+E    
Sbjct  1788  ---ETFAPVAKLNTIRILLSLAVNQDWCLQQLDIKNAFLNGDLEEEVYMEIPLGFEGSMA  1844

Query  967   PDHVRVSSSTALYGLRGVKMG*SPRA  890
              + V      +LYGL+      SPRA
Sbjct  1845  KNQV-CKLQKSLYGLKQ-----SPRA  1864


 Score = 70.1 bits (170),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 55/233 (24%), Positives = 102/233 (44%), Gaps = 27/233 (12%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++       G   + + +G+   I+ +G   +   +K L L +VL+VP L   L S+ 
Sbjct  1149  AAILQNYKPXNGHSSVHIVDGSKSKIAGIGSIKL---TKDLFLDSVLHVPNLDCNLLSIS  1205

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV--------------SRSH  2572
             +L  +     +F+ +  + +D  +  ++     S  LY LP               S+S 
Sbjct  1206  KLARDLQCVTKFYPNLCVFQDLKSGKMIGSVEQSSELYLLPCGQFSNQVSQASCVQSQSM  1265

Query  2571  FAYLTSRATSTV--------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSK  2416
                  S + S V         H RLGHPN     ++     +  NK  +      C  +K
Sbjct  1266  LESFNSVSNSKVNKDSEIIMLHYRLGHPNFVYLAKLFPKLFI--NKNPASYHXEICQFAK  1323

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +     ++ Y    V  L+++D+WGP+ + + SG ++F+ FVDD++R  W +
Sbjct  1324  HTXTVYPQIPYKPXTVFSLVHSDVWGPSRIKNISGTQWFVTFVDDHTRVTWVF  1376



>ref|XP_008367623.1| PREDICTED: uncharacterized protein LOC103431265 [Malus domestica]
Length=1110

 Score =   152 bits (383),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 111/192 (58%), Gaps = 4/192 (2%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTH  2078
             + KSD+  TF  ++  VE      I +++ D G EY     +  L   GI H+ +C +T 
Sbjct  799   KCKSDVLSTFMEYKSLVENSLCTKIXTLRSDSGXEYLSTSFSQFLATHGIHHQLTCPHTP  858

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             EQNG  ERK+RH+VET   LL    V   YW  AF  A  LIN LPT+  Q  SP+  L+
Sbjct  859   EQNGCAERKHRHLVETARTLLTASKVPHIYWVEAFNTAIYLINRLPTASRQ--SPWESLY  916

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P Y  L+VFGC C+P+L+PY   K++ +S  CVFL Y  + +GYRC++  + ++YI 
Sbjct  917   HRAPNYDLLKVFGCACFPWLKPYTSSKLDPKSRACVFLGYSLNHKGYRCLDPATHRVYIS  976

Query  1717  RHVHFYESIFLF  1682
             RHV F ES F F
Sbjct  977   RHVIFNESSFPF  988


 Score =   128 bits (321),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 117/208 (56%), Gaps = 9/208 (4%)
 Frame = -1

Query  2856  GSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFE  2677
             G + + +G+G GL I+  G  ++ + +   +L  VLYVP L   L S  +   +N+    
Sbjct  592   GPEQVYIGDGKGLPITHSGSTTLHTSTSAFNLHKVLYVPALKHNLLSANQFLLDNHCSLH  651

Query  2676  FHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRS----HFAYL-TSRATSTVWHRRLGHP  2512
              +   F VKD  +     +G    G Y    S S    H A   T++A++ VWH+RLGHP
Sbjct  652   LYPSHFTVKDLSSGRXRFKGPVQQGFYPFHFSSSATGNHKALTATAKASTDVWHQRLGHP  711

Query  2511  NAHVQNRVL-QSC-PVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWG  2338
             +  + +++  QSC PV  +  KS  S   C L+K+S+ P    S ++   L+L++TD+WG
Sbjct  712   SVKILHKLASQSCIPVLAHVTKSFCS--DCALAKSSKLPFVFSSCTTSKPLELVHTDVWG  769

Query  2337  PAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             P+P  S+ GF Y+++FVDD++R+ WFYP
Sbjct  770   PSPQXSSQGFXYYIIFVDDFTRYSWFYP  797



>gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa]
Length=1297

 Score =   204 bits (520),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 217/456 (48%), Gaps = 23/456 (5%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYR--KIHHTLTKLGITHRKSCAYTH  2078
             + K++++  F+ ++  V  Q  R IK ++ D GGEYR  K        GIT   +   + 
Sbjct  492   KTKNEVFTKFKEWKAEVGNQTGRKIKCLRSDNGGEYRDKKFLQLCKDEGITRHFTVKKSP  551

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ER  R ++E   ++     + +++W  A   A  LIN  P+  + F+       
Sbjct  552   QQNGVAERMNRTLMEKERSMRFHAGLPEEFWAEAANHACYLINRSPSRAINFKCAEEVWS  611

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
               P  Y+ LRVFGC  Y ++    R K+E +S  C+F+ +    +GY+  ++ + K  I 
Sbjct  612   GKPVDYSNLRVFGCSAYAHIPKDERTKLEPKSLECLFIGFEKGVKGYKLWDIVNEKKVIS  671

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
             R V F E         +      P++  +   V      N   A  +  H    + +   
Sbjct  672   RDVVFDER------EAISISLAKPSVADSEAQVEQNEQGNDEVAIEEPEHQQQPTVMAQV  725

Query  1537  RGLPPLAIEGPVQTAP---TRARAV*TQHQERGHVMRLRHM-TRDTSEQFHALNVTT-DP  1373
                P      P+  AP    R+ A+    + R  + R       D S    AL+++  DP
Sbjct  726   EQSPQRGQNSPIPQAPESFKRSIALDKPKRNRKPIQRFGFEPEEDVS---RALSISQGDP  782

Query  1372  TCYSQAVGHL*---WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRN--ADG  1208
             T Y  A+  +    W  AM +E  +L  N  W+LV       +VGCKWVFR K     D 
Sbjct  783   TTYEDAIESVESAGWIGAMTEEMESLHKNSVWELVPKPKERKLVGCKWVFRKKEGIHEDD  842

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             +I  YKARLVAKG++Q  G D+ + FS VVK T++RLL S+   ++  + Q+DV  AFL+
Sbjct  843   AI-TYKARLVAKGYSQKEGVDYDEIFSPVVKHTSIRLLLSIAAQYDMEIEQMDVKTAFLH  901

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             G L E +YM QP G+ + T  +++      +LYGL+
Sbjct  902   GDLEEDIYMSQPEGFVE-TGKENLVCRLKKSLYGLK  936


 Score = 75.1 bits (183),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 93/208 (45%), Gaps = 25/208 (12%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHASIPSESKLLH-LSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDC  2662
             +GN +   I  +G   I     ++  L NV + P L+  L S   L+  + V F      
Sbjct  293   MGNDSPSRIMGIGMVKIRMHDGIVRALGNVRHTPGLNRNLIS---LSTMDRVGFWHKGQN  349

Query  2661  FIVKDSITRAVLLRGSTS-GGLYRLPVS--RSHFAYLTSRATSTVWHRRLGHPNAHVQNR  2491
              ++K    + V ++G+     +Y+L  S         T    + +W RRLGH    +  R
Sbjct  350   GVLKVGKGQMVYMKGAIQPDNMYKLTGSTVEGGAGVCTEEDKTELWRRRLGH----MSQR  405

Query  2490  VLQSCPVAPNKVKSLGSRTS--------CHLSKASR--FPLDRVSYSSKNVLDLLYTDIW  2341
              LQ      +K + L    S        C L K +R  F L      SK VLD ++TD+W
Sbjct  406   GLQEL----HKKEQLDGVMSAALEFCRYCTLGKQTRVSFNLSSSENKSKGVLDYIHTDVW  461

Query  2340  GPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             GP+  IS  G RYF+ F+DD+SR  W +
Sbjct  462   GPSATISKGGARYFVSFIDDFSRKVWIF  489



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score =   212 bits (540),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 210/425 (49%), Gaps = 17/425 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  +++ GI H+ SCA+T +Q
Sbjct  465   RAELFSIFQKFYAEIQTQFNISIRVLRSDNAREYFSAPFTSFMSQYGIIHQSSCAHTPQQ  524

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  525   NGVAERKNRHFVETARTLLLHSHVPFRFWGDAILTACYLINRMPSSVLHDQIPHSLLFPD  584

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  R+F C C+ ++      K+  R+  C+FL Y    +GYRC +  + + ++ 
Sbjct  585   QPLY-FLPPRIFCCTCFVHILTPGHDKLSVRATKCIFLGYSRLQKGYRCYSSKTHRYFLS  643

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWA---------SEPVVTRAPCNTHAAPTDSAHM  1565
               V F+E    FS S   S PV   +P           S P+      +  A P   A +
Sbjct  644   ADVTFFEDSPFFSTSK--SLPVSEVLPLPIISPLDAVPSRPLQVYYRRHRVAVPPSLAEV  701

Query  1564  SLTS-PVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALN  1388
                S P+P A   P L     +  A  +            + +    ++   S    A++
Sbjct  702   PADSLPIPSASLAPALPPSADLPIALRKGNRSTRNPHPIYNFLSYHQLSSPYSTFVSAIS  761

Query  1387  VTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
               + P    + + H  WR AM  E   L  N TW LV+     + VGC+WV+  K + DG
Sbjct  762   FVSLPKSTPEVLSHPSWRQAMVDEMVVLHSNGTWDLVVLPSGKSTVGCRWVYTVKVSPDG  821

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
              +++ KARLVAKG+ QV G D+ DTFS V K   VRLL S+    +W L QLD+ N FL+
Sbjct  822   QVDRLKARLVAKGYTQVYGSDYGDTFSPVAKIAYVRLLLSMAAMLSWPLYQLDIKNVFLH  881

Query  1027  GHLAE  1013
             G LAE
Sbjct  882   GDLAE  886


 Score = 66.6 bits (161),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 78/171 (46%), Gaps = 25/171 (15%)
 Frame = -1

Query  2763  LSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV  2584
             L +VLY P+    L S+ ++    N    F      ++D  T   +  G           
Sbjct  313   LHSVLYAPECPFNLISISKIARTLNCSITFSNKFVTLQDRSTGKTISIG-----------  361

Query  2583  SRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASR-  2407
                   +  S     + H  LGHP+     +++ S     + + SL    SC L K +R 
Sbjct  362   ------FCISTDAPLLIHSCLGHPSLSKFQKMVPSF----SSLSSLACE-SCQLGKHTRV  410

Query  2406  -FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  411   SFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  460



>emb|CAN70669.1| hypothetical protein VITISV_037506 [Vitis vinifera]
Length=2825

 Score =   209 bits (531),  Expect(2) = 6e-65, Method: Composition-based stats.
 Identities = 147/495 (30%), Positives = 226/495 (46%), Gaps = 78/495 (16%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             KS++   F++F + V+ QF+  I+ ++ +   EY    +   L   GI H  SC  T +Q
Sbjct  2039  KSEVGHIFQTFNLMVQNQFNSKIQVLKSNNAKEYFTSSLSTYLQNHGIIHISSCVDTPQQ  2098

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH++E    L+   +V   +W  A   AT LIN  P+S L            
Sbjct  2099  NGVAERKNRHLLEVARCLMFSSNVPNYFWGEAILTATYLIN--PSSDLP-----------  2145

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
                   L+VFGC  + ++ P NR K   R+  C+FL Y P+ +GY+C + T+ + Y    
Sbjct  2146  ------LKVFGCTAFVHVYPQNRSKFAPRANKCIFLGYSPTQKGYKCYSPTNKRFYTTMD  2199

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA--  1538
             V F++ +F +    +  + +     W S         +    P+ S    L++P+P +  
Sbjct  2200  VSFFKHVFFYPKFHVQGESMNEHQVWKSLLEAVPFSHSESPNPSQSLRTELSTPMPSSIQ  2259

Query  1537  ----RGLPPL-AIEGPVQTAPTRARAV*TQHQERGH----------------VMRLRHMT  1421
                   +P L  I+ P+   P   +      Q  G                  + LR   
Sbjct  2260  PAQPTNVPSLVTIQSPMPIQPIAPQLANENLQNIGEDRAGEVLIPSIDDSTLPIALRKGV  2319

Query  1420  RDTSEQ--------------FHALNVTTD----PTCYSQAVGHL*WRDAMDQEFNALLHN  1295
             R  ++               + A   + D    P    +A     W+ A+  E +AL  N
Sbjct  2320  RRCTDHPIGNYVTYEGQSPSYRAFATSLDDTQVPNTIQEAFKISEWKKAVQDEIDALEKN  2379

Query  1294  DTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVK  1115
              TW ++ D P         +F  K  ADGS+E++KARLVA+GF Q  G D+ +TF+ + K
Sbjct  2380  GTWTII-DLP---------IFTIKYKADGSVERFKARLVARGFTQSYGIDYQETFAPIAK  2429

Query  1114  PTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTA  935
               T+R+L SL V+ +W L+QLD+ N FLNG L E VYM+ PPG+E     + V      +
Sbjct  2430  LNTIRILLSLAVNQDWCLQQLDIKNVFLNGDLEEEVYMEIPPGFEGSMAKNQV-CKLQKS  2488

Query  934   LYGLRGVKMG*SPRA  890
             LYGL+      SPRA
Sbjct  2489  LYGLKQ-----SPRA  2498


 Score = 69.7 bits (169),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 27/233 (12%)
 Frame = -1

Query  2889  ASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVY  2710
             A+++       G     + NG+   I  VG  SI   +K L L +VL+VP L   L S+ 
Sbjct  1807  AAILQNYKPSNGHSSFHIANGSKSKI--VGTGSI-KLTKDLFLDSVLHVPNLDCNLLSIS  1863

Query  2709  RLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPV--------------SRSH  2572
             +L  +     +F+ +  + +D  +  ++       GLY LP               S+S 
Sbjct  1864  KLARDLQCVTKFYPNSCVFQDLKSGKIIGNAELCSGLYLLPCGQFSNQVSQASCIQSQSM  1923

Query  2571  FAYLTSRATSTV--------WHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSK  2416
                  S + S V         H  LGHP+     ++     +  NK  +      C  +K
Sbjct  1924  LESFNSVSNSKVNKDSEIIMLHYCLGHPSFVYLAKLFPKLFI--NKNPTSYHCEICQYAK  1981

Query  2415  ASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +R    ++ Y    V  L+++D+WGP+ + + SG R+F+ FVDD++R  W +
Sbjct  1982  HTRTVYPQIPYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFVDDHTRGTWVF  2034



>emb|CAN77046.1| hypothetical protein VITISV_035257 [Vitis vinifera]
Length=1478

 Score =   219 bits (558),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 157/471 (33%), Positives = 231/471 (49%), Gaps = 32/471 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  665   RAELFSIFQKFYAEIQTQFNISIRVLRSDNAREYFSAPFTSFMSHHGILHQSSCAHTPQQ  724

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  +RK RH+VET   +L   +V  ++W      A  LIN +P+SVL  + P++ L   
Sbjct  725   NGVAKRKNRHLVETARTILLHSNVPFRFWGDVVLTACYLINRMPSSVLHDQIPHSLLFPD  784

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GY C +L   + +I 
Sbjct  785   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSRLQKGYXCYSLEIHRYFIS  843

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMS--LTSPVP  1544
               V F+E    FS +T  S PV   +P    P+V+ A       P    H    + +P+P
Sbjct  844   ADVTFFEDSPFFS-TTSESLPVSEVLPL---PIVSPADV-VPPRPLQVYHRRPRVATPLP  898

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH------------MTRDTSEQF  1400
              A               P            R      R+            ++   S   
Sbjct  899   FAEAPADSLPXPSASPXPXLPSPBDLPIXXRKGTRSTRNPHPIYNFLSYHRLSSPYSAFX  958

Query  1399  HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKR  1220
              A++  + P    +A+ H  WR AM  E  AL  N TW LV+       VGC+WV+  K 
Sbjct  959   SAISSVSLPKSTHEALSHPGWRQAMVDEMAALHXNGTWDLVVLPSGKXXVGCRWVYAVKV  1018

Query  1219  NADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHN  1040
               DG +++ K RLVAKG+ QV G ++ DTFS V K  +VRLL S+V   +W L QLD+ N
Sbjct  1019  XPDGQVBRLKXRLVAKGYTQVYGSBYGDTFSPVAKIASVRLLLSMVAMCSWPLYQLDIKN  1078

Query  1039  AFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
              FL+G L E VYM+QPPG+        V R+  S  LYGL+      SPRA
Sbjct  1079  VFLHGDLVEEVYMEQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  1122


 Score = 59.7 bits (143),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 80/203 (39%), Gaps = 43/203 (21%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             ++ + NG+  +   +G A        L L++VLY P+    L  + +LT   N    F  
Sbjct  495   IVTLANGSQTVAKGIGLAL---PLPSLPLTSVLYTPECPFNLICISKLTRTLNCSITFSD  551

Query  2667  DCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPN-AHVQNR  2491
                 ++D  TR  +  G  S  LY L  S S  A   S     + H RLGHP+ +  Q  
Sbjct  552   KFVTLQDRSTRKTIGIGRESQVLYHL-TSDSFAAVCISTDAPLLIHNRLGHPSLSKFQKM  610

Query  2490  V-----LQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPV  2326
             V     L S P             SC L K +R                      GP   
Sbjct  611   VPRFSTLSSLPCE-----------SCQLGKHTR----------------------GPCQT  637

Query  2325  ISTSGFRYFLLFVDDYSRFCWFY  2257
              ST GF+YF+ F+DDYSR  W +
Sbjct  638   ASTLGFQYFVTFIDDYSRCTWLF  660



>sp|P10978.1|POLX_TOBAC RecName: Full=Retrovirus-related Pol polyprotein from transposon 
TNT 1-94; Includes: RecName: Full=Protease; Includes: RecName: 
Full=Reverse transcriptase; Includes: RecName: Full=Endonuclease 
[Nicotiana tabacum]
 emb|CAA32025.1| unnamed protein product [Nicotiana tabacum]
Length=1328

 Score =   205 bits (522),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 143/452 (32%), Positives = 219/452 (48%), Gaps = 15/452 (3%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + K  +++ F+ F   VER+  R +K ++ D GGEY  R+     +  GI H K+   T 
Sbjct  520   KTKDQVFQVFQKFHALVERETGRKLKRLRSDNGGEYTSREFEEYCSSHGIRHEKTVPGTP  579

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             + NG  ER  R IVE   ++L    + + +W  A + A  LIN  P+  L FE P     
Sbjct  580   QHNGVAERMNRTIVEKVRSMLRMAKLPKSFWGEAVQTACYLINRSPSVPLAFEIPERVWT  639

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                  Y+ L+VFGCR + ++    R K++ +S PC+F+ Y     GYR  +    K+   
Sbjct  640   NKEVSYSHLKVFGCRAFAHVPKEQRTKLDDKSIPCIFIGYGDEEFGYRLWDPVKKKVIRS  699

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIP-WASEPVVTRAPCNTHAAPTDSAHMSLTSPVPL  1541
             R V F ES  + + + +  +     IP + + P  +  P +  +  TD        P  +
Sbjct  700   RDVVFRES-EVRTAADMSEKVKNGIIPNFVTIPSTSNNPTSAEST-TDEVSEQGEQPGEV  757

Query  1540  ARGLPPLAIEGPVQTA-PTRARAV*TQHQERGHVMRLRHMTRD-TSEQFHALNVTTDPTC  1367
                   L  EG  +   PT+      QHQ      R R  +R   S ++  ++   +P  
Sbjct  758   IEQGEQLD-EGVEEVEHPTQGEE---QHQPLRRSERPRVESRRYPSTEYVLISDDREPES  813

Query  1366  YSQAVGHL*WRD---AMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQ  1196
               + + H        AM +E  +L  N T+KLV        + CKWVF+ K++ D  + +
Sbjct  814   LKEVLSHPEKNQLMKAMQEEMESLQKNGTYKLVELPKGKRPLKCKWVFKLKKDGDCKLVR  873

Query  1195  YKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLA  1016
             YKARLV KGF Q  G DF + FS VVK T++R + SL  S +  + QLDV  AFL+G L 
Sbjct  874   YKARLVVKGFEQKKGIDFDEIFSPVVKMTSIRTILSLAASLDLEVEQLDVKTAFLHGDLE  933

Query  1015  ETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             E +YM+QP G+E      H+    + +LYGL+
Sbjct  934   EEIYMEQPEGFE-VAGKKHMVCKLNKSLYGLK  964


 Score = 73.2 bits (178),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 51/200 (26%), Positives = 90/200 (45%), Gaps = 6/200 (3%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSE-SKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFH  2671
              +++GN +   I+ +G   I +     L L +V +VP L + L S   L  +    +  +
Sbjct  321   TVKMGNTSYSKIAGIGDICIKTNVGCTLVLKDVRHVPDLRMNLISGIALDRDGYESYFAN  380

Query  2670  KDCFIVKDSITRAVLLRGSTSGGLYRL--PVSRSHFAYLTSRATSTVWHRRLGHPNAHVQ  2497
             +   + K S+   V+ +G   G LYR    + +          +  +WH+R+GH +    
Sbjct  381   QKWRLTKGSL---VIAKGVARGTLYRTNAEICQGELNAAQDEISVDLWHKRMGHMSEKGL  437

Query  2496  NRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVIST  2317
               + +   ++  K  ++     C   K  R      S    N+LDL+Y+D+ GP  + S 
Sbjct  438   QILAKKSLISYAKGTTVKPCDYCLFGKQHRVSFQTSSERKLNILDLVYSDVCGPMEIESM  497

Query  2316  SGFRYFLLFVDDYSRFCWFY  2257
              G +YF+ F+DD SR  W Y
Sbjct  498   GGNKYFVTFIDDASRKLWVY  517



>emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera]
Length=731

 Score =   188 bits (477),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/355 (33%), Positives = 175/355 (49%), Gaps = 33/355 (9%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQ  2072
             + KS +   F  F+  VE+ F+++I ++  D GGEY  + + L   GI+H  +  +T E 
Sbjct  384   KQKSQVKDIFIRFKAIVEKHFNQNIHTLYSDNGGEYISLSNFLALHGISHLTTPPHTPEH  443

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER + HIVETGL LL+  S+   YW  AF +A  LIN +PT  L   SPY ++  T
Sbjct  444   NGFSERCHLHIVETGLTLLSHASIPLPYWSNAFAIAIYLINRMPTPTLNLLSPYEKIFGT  503

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             P  Y+ L++FGC CYP+LRPY+ HK++  S PC+FL Y  +   Y C + ++ K ++ RH
Sbjct  504   PSNYSKLKIFGCLCYPWLRPYSSHKLDSSSKPCIFLGYSLTQSAYFCYDPSTSKNFVSRH  563

Query  1711  VHFYESIFLFSDS-----------------------TLCSQPVPPTI--PWASEPVVTRA  1607
             V F ESIF F  S                       T  S  VPP++  P         A
Sbjct  564   VRFVESIFPFKSSLPQAPRLESTSVSTWIPPLIHINTTTSALVPPSVVHPQQQLQCEASA  623

Query  1606  PCNTHAAPTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRH  1427
             P  +H +P ++ +      +P    LPP        T    +     ++  R  + +L  
Sbjct  624   PVTSHLSPANNQNQP--HQLPSTNSLPPTTQPDHRTTNSNHSMQTRAKNNIRKPIQKLNL  681

Query  1426  MTRDTSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPH  1262
               + +        +  +PT  +QA+    WR AM +E++AL+ N TW+LV    H
Sbjct  682   HIQLSKP------LDLEPTTPTQALKDPKWRKAMSEEYDALVRNGTWELVPSNRH  730


 Score = 90.5 bits (223),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 77/128 (60%), Gaps = 2/128 (2%)
 Frame = -1

Query  2634  AVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKV  2455
             A LL+G T  G+Y  PVS    A+ + + +S+ WH RLGHP   +   V+ +  +A +  
Sbjct  256   ATLLKGKTKDGVYEWPVSSPLLAFSSVKTSSSEWHHRLGHPAFPILKHVISTNNLALSSS  315

Query  2454  KSLG-SRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDY  2278
               L  S  +CH +K+ +      + +S + L +LY+D+W  +P+IS  GF+Y+++FVD +
Sbjct  316   SLLHFSCNACHCNKSHKLSFSNSTINSSHPLQILYSDVWT-SPIISYDGFKYYVIFVDHF  374

Query  2277  SRFCWFYP  2254
             +++ WFYP
Sbjct  375   TKYIWFYP  382


 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 67/149 (45%), Gaps = 14/149 (9%)
 Frame = -2

Query  3590  IKLTYRNFIFWRTQLVPFLRGQELLGYVDDETPCPPPTIAPLSASGDSVpdattaaptpn  3411
             +KLT  N++ W+ Q      G +LLG++D   PC P TI P + + +             
Sbjct  30    LKLTSTNYVSWKLQFQTLFIGYDLLGFIDGSYPC-PTTILPGTTTPNPA-----------  77

Query  3410  pAYRAWIKQDQsilsllisslSDEVMHLAVGRTTSRVVWESIGAALGSSSRARCLSPLGQ  3231
               +  WI+QDQ +L+ ++ SLS  ++       T+R  W  +       SR R      Q
Sbjct  78    --HTLWIRQDQLLLNAILGSLSPTIIPFIARAKTAREAWTILANTYAKPSRGRIKQVKNQ  135

Query  3230  FHYLRQGNSSAVEYLGRAQLLVEDLAHAG  3144
                + +G+    E+L   +  V++LA  G
Sbjct  136   LKQITKGSMGVFEFLQTIKARVDELAILG  164



>emb|CAN70357.1| hypothetical protein VITISV_013713 [Vitis vinifera]
Length=1568

 Score =   228 bits (581),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 169/527 (32%), Positives = 243/527 (46%), Gaps = 95/527 (18%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS++   F++F + V+ QF+  I+ ++ D   EY    +       GI H  SC  T 
Sbjct  708   KEKSEVGHIFQTFNLMVQNQFNSKIQVLKSDNAKEYFTSSLSTYFQNHGIIHISSCVDTS  767

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFES------  1916
             +QNG  ERK RH++E    L+   +V   +W  A   AT LIN +P+ VL F+S      
Sbjct  768   QQNGVAERKNRHLLEVARCLMFSSNVPNYFWGEAILTATYLINRMPSRVLTFQSPRQLLL  827

Query  1915  ---PYTRLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMN  1745
                P+TR   +  P   L+VFGC  + ++ P NR K   R+  C+FL Y P+ +GY+C +
Sbjct  828   NQFPHTRAASSDLP---LKVFGCTTFVHVYPQNRSKFAPRANKCIFLGYSPTQKGYKCYS  884

Query  1744  LTSGKIYICRHVHFYESIFLFSDSTLCSQPVPPTIPWA----------SEPVVTRAPCNT  1595
              T+ K Y    V F+E +F +  S +  + +     W           SE      P  +
Sbjct  885   PTNKKFYTTMDVSFFEHVFFYPKSHVQGKSMNEHQVWESLLDAVPFSHSESPELSTPMLS  944

Query  1594  HAAPTDSAH----MSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQER--------  1451
                P  S +    M++ SP+P+    P LA E  +Q    R +    +H  +        
Sbjct  945   SVQPAQSTNVPSPMTIQSPMPIQPIAPQLANEN-LQVYIRRRKRQELEHGSQPTCGQYID  1003

Query  1450  ---------------GHVM-----------RLRHMTR--------------DTSEQFHAL  1391
                            G V+            LR   R                S  + A 
Sbjct  1004  SISSLPEENIGEDRAGEVLIPSIDDSTLPIALRKGVRRCIDHPIGNYVTYEGLSPSYRAF  1063

Query  1390  NVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNAD  1211
               + D T   QAV     +D +D    AL  N TW +         VGCKW+F  K  AD
Sbjct  1064  ATSLDDT---QAV-----QDEID----ALEKNGTWTITDLPVGKRPVGCKWIFTIKYKAD  1111

Query  1210  GSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFL  1031
             GS+E++KARLVA+GF Q  G D+ +TF+ V K  T+R+L SL V+ NW L+QLD+ NAFL
Sbjct  1112  GSVERFKARLVARGFTQSYGIDYQETFAPVAKLNTIRILLSLAVNQNWCLQQLDIKNAFL  1171

Query  1030  NGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             NG L E VYM+ PPG+E     + V      +LYGL+      SPRA
Sbjct  1172  NGDLEEEVYMEIPPGFEGSMAKNQV-CKLQKSLYGLKQ-----SPRA  1212


 Score = 50.4 bits (119),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  2394  RVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             ++ Y    V  L+++D+WGP+ + S SG R+F+ FVDD++R  W +
Sbjct  660   QIPYKPSTVFSLVHSDVWGPSRIKSISGTRWFVTFVDDHTRVTWVF  705



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score =   194 bits (494),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 141/432 (33%), Positives = 207/432 (48%), Gaps = 53/432 (12%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             +++++  F+ F  +++ QF+ SI+            +   ++  G  H+ SCA+T +QNG
Sbjct  515   RAELFSIFQKFYTQIQTQFNISIRP----------NLSSFMSHHGTLHQSSCAHTPQQNG  564

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
               ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L    P
Sbjct  565   VAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPDQP  624

Query  1885  PYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              Y FL  RVFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I   
Sbjct  625   LY-FLPPRVFGCTCFIHILTPGQDKLSAKAIKCLFLGYSRLQKGYRCYSLETHRYFISAD  683

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVT-------------------RAPCNTHA  1589
             V F+E    FS +T  S PV   +P    P+V+                    AP     
Sbjct  684   VTFFEDSPFFS-TTSESLPVSEVLPI---PIVSPPDAMPPRPLQVYHRRPRVVAPLTFPE  739

Query  1588  APTDSAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTS  1409
             AP DS  +   SP P       L I     T  TR            + +    ++   S
Sbjct  740   APADSLPIPSASPAPALPSPNDLPIAVRKGTRSTR------NPHPIYNFLSYHRLSSPYS  793

Query  1408  EQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFR  1229
                 A++  + P    +A+ H  WR AM  E +AL  N TW LV+     + VGC+WV+ 
Sbjct  794   AFVSAISSVSLPKSTHEALSHPGWRQAMVDEMDALHSNGTWDLVVLPSSKSTVGCRWVYA  853

Query  1228  TKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
              K           ARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD
Sbjct  854   VK-----------ARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLD  902

Query  1048  VHNAFLNGHLAE  1013
             + N FL+G LA+
Sbjct  903   IKNVFLHGDLAK  914


 Score = 83.6 bits (205),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  348   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  406

Query  2580  RSHFAYLTSRATSTVWHRRLGHPN-AHVQNRV-----LQSCPVAPNKVKSLGSRTSCHLS  2419
              S  A   S     + H RLGHP+ +  Q  V     L S P             SC L 
Sbjct  407   DSSPAVCISTDAPLLIHNRLGHPSLSKFQKMVPRFSTLSSLPCE-----------SCQLG  455

Query  2418  KASR--FPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             K +R  FP  R++  +K+  +L++TD+WGP    ST GF+YF+ F+DDYSR  W +
Sbjct  456   KHTRVSFP-KRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTWLF  510



>ref|XP_010325686.1| PREDICTED: uncharacterized protein LOC104649000 [Solanum lycopersicum]
Length=1041

 Score =   220 bits (561),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 145/398 (36%), Positives = 212/398 (53%), Gaps = 9/398 (2%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTL--TKLGITHRKSCAYTHEQ  2072
             KS+     +SF   VE QF  S+++I+ D G E+      L     GI H++SC YT +Q
Sbjct  641   KSNALHIVKSFVNMVENQFKTSVQTIRSDNGLEFVNQESVLYFQSKGILHQRSCPYTPQQ  700

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG VERK+++++ET  ALL +  +  +YW      AT +IN LP++ L  + P+T L+  
Sbjct  701   NGVVERKHKYLLETARALLFQSKLPTKYWGECILTATYIINRLPSTYLHNKCPFTILYNQ  760

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P Y+ +R FGC C+P    + R K E R+ P VFL YP   +GY+ ++L+S K++I R 
Sbjct  761   EPQYSHMRSFGCLCFPTTHKHQRTKFEPRATPHVFLGYPFGVKGYKVLSLSSNKVHISRD  820

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCN-THAAPTDSAHMSLTSPVP-LA  1538
             V F+E++F FS  T  S   P +        +     N T   P     +  TS  P L 
Sbjct  821   VVFHETVFPFSKITNLSTSNPSSSSTFDSVFLDNNDINLTSLEPEQCDPIETTSLSPNLT  880

Query  1537  RGLPPLAIEGP--VQTAPTRARAV*TQ-HQERGHVMRLRHMTRDTSEQFHALNVTTD--P  1373
                  L+I     +   P   +   T  H    H   +   +     Q   L+V+ D  P
Sbjct  881   PSEYDLSIRKSTRIHKPPVYLKDYMTSLHASFSHHHHIASTSLYPDSQSLILSVSHDCEP  940

Query  1372  TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQY  1193
             + +++A  +  W+DAM QE  AL  NDTW+L+       VVGC+WV++ K  AD SIE+Y
Sbjct  941   SSFNEAAMNPAWQDAMTQELTALHDNDTWELMSLPAGKKVVGCRWVYKIKHKADESIERY  1000

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
             KARLV KG+ Q  G D+ +TFS V+K TTVR+L +  V
Sbjct  1001  KARLVVKGYTQHYGVDYTETFSPVIKMTTVRVLIATAV  1038


 Score = 57.8 bits (138),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = -1

Query  2538  VWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDL  2359
             +WH RLGH    ++ + + S PV  +  +S      C + + +R      ++++  V +L
Sbjct  545   LWHYRLGHV-PFIKMKGITSIPVNFSSKQSFTCNI-CPMVRQTRLSFPPKTHNTSKVFEL  602

Query  2358  LYTDIWGPAPVISTSGFRYFLLFVDDYSRFCW  2263
             L+ D+WGP  V +   F+YF+  VDD+SR  W
Sbjct  603   LHVDLWGPYHVSTHDNFKYFITLVDDFSRTTW  634



>emb|CAN82171.1| hypothetical protein VITISV_040546 [Vitis vinifera]
Length=1129

 Score =   193 bits (491),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 136/466 (29%), Positives = 219/466 (47%), Gaps = 78/466 (17%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHTLTKLGITHRKSCAYTHEQNG  2066
             K+++++ F SF   V+RQFS+++K +Q D G E++ +    +  GI  + SC  T +QNG
Sbjct  358   KTEVFRMFMSFIAMVDRQFSQTVKVVQSDNGTEFKCLLDYFSATGILFQTSCVGTPQQNG  417

Query  2065  RVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKTPP  1886
             RVERK++HI+  G AL  + ++   +W  + + A+                         
Sbjct  418   RVERKHKHILNVGRALRFQANLPIYFWGESDKFAS-------------------------  452

Query  1885  PYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRHVH  1706
                                       RS  CVFL YP   +G++  +L + ++++ R V 
Sbjct  453   --------------------------RSRKCVFLGYPFGKKGWKLFDLDTKELFVSRDVK  486

Query  1705  FYESIFLFSDSTLCSQPVPPTIPW-------ASEPVVTRAPCNTHAAPTDSAHMSLTS--  1553
             F+E +F F +    +      +P        AS   ++  P        DS  +  TS  
Sbjct  487   FFEDVFPFGNPGAVNIIPDNIVPMGGVAHTEASSATLSPGPEVVPTVGLDSLGLDNTSNG  546

Query  1552  -PVPLARGL----PPLAIEGPVQ---TAPTRARAV*TQHQERG------HVMRLRHMTRD  1415
                P+ +G+    P + +   V     A + + A  +     G      H +   + +  
Sbjct  547   QSAPMGKGMRDKFPSVLLRDFVTHTVVAESPSPATPSPQHPSGTPYPIAHYINCDNFSVH  606

Query  1414  TSEQFHALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWV  1235
               +   A+  + DP  + +A+  + W+ +M +E  AL  N  W L         +G +WV
Sbjct  607   YRKFLAAIISSNDPKSFKEAMKDVGWQKSMHEEIQALEENGMWTLEPLPKGKRALGSQWV  666

Query  1234  FRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQ  1055
             +RTK  ++G IE+ K+RLV  G +Q AG D+ +TFS V K TTVR   ++  S NW L Q
Sbjct  667   YRTKYFSNGDIERLKSRLVVLGNHQEAGIDYHETFSPVAKMTTVRAFLAIAASKNWELHQ  726

Query  1054  LDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             +DVHNAFL+G L E VYMK PPG+E  + P+ V R+  S  LYGL+
Sbjct  727   MDVHNAFLHGDLEEEVYMKLPPGFES-SDPNLVCRLWKS--LYGLK  769


 Score = 83.6 bits (205),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 98/199 (49%), Gaps = 17/199 (9%)
 Frame = -1

Query  2832  NGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIV  2653
             NG  ++ ++ G   + +    + L NVLYV KL+  L SV +LT++ +   +F+     +
Sbjct  165   NGESVVATQSGSVRLLNN---ITLKNVLYVSKLNCNLLSVSQLTDDLHCIVQFNSYMCAI  221

Query  2652  KDSITRAVLLRGSTSGGLYRLPVSR----SHFAYLTSRATSTVWHRRLGHPNAHVQNRVL  2485
             +D  TR ++  G    GLY    +      H +   + +T  +WH R+GHP+     +V+
Sbjct  222   QDH-TRELIGTGVRRDGLYYFGGAEGDSVQHVSVHNAASTLELWHNRMGHPS----EKVV  276

Query  2484  QSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKN---VLDLLYTDIWGPAPVISTS  2314
             +  P+  N   SL    +C +   ++ P D+   S      + + ++ D+W     +S+ 
Sbjct  277   KLLPLVSNIKGSLNK--ACEICFRAKHPRDKFPLSDNKATRIFEKIHCDLWASYKHVSSC  334

Query  2313  GFRYFLLFVDDYSRFCWFY  2257
             G RYFL  VDD+SR  W Y
Sbjct  335   GARYFLTIVDDFSRAVWIY  353



>gb|ACL97384.1| Gag-Pol polyprotein [Medicago truncatula]
Length=1305

 Score =   195 bits (496),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/450 (28%), Positives = 221/450 (49%), Gaps = 34/450 (8%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KSD++  F++F+ ++E +  + IK ++ D GGEY   +      + GI  + + A+T 
Sbjct  520   KKKSDVFPVFKAFKAQIELETGKKIKCLRTDNGGEYVDGEFLAFCKQEGIVRQFTVAHTP  579

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ER  R ++E   A+L    +++ +W  A + A  +IN  P++ +  ++P     
Sbjct  580   QQNGVAERMNRTLLERTRAMLKTAGMAKSFWAEAVKTACYVINRSPSTAIDLKTPMEMWK  639

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
               P  Y+ L VFGC  Y       R K++ +S  C+FL Y  + +GYR  + T+ K+ + 
Sbjct  640   GKPVDYSSLHVFGCPVYVMYNSQERTKLDPKSRKCIFLGYADNVKGYRLWDPTARKVVVS  699

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
             R V F E+           Q        + E  + +    +  + +  A        P+ 
Sbjct  700   RDVVFAENEL---------QSKQKNDSTSKETAIVQMEEKSKESDSSEAE-------PVH  743

Query  1537  RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYSQ  1358
                 P  +   V+ +    R       +  +VM        + + +  +    +P+ + +
Sbjct  744   EEQEPDDVNNGVRRS---TRQTQKPSWQSDYVM-------TSHDAYCLITEEGEPSTFHE  793

Query  1357  AVG---HL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKA  1187
             A+       W  AM +E  AL  N TW+LV        +G KWV++ KR+ +  +E+Y+A
Sbjct  794   ALNGSDASQWMTAMHEEMEALHRNKTWELVELPKGRKAIGNKWVYKIKRDGNDQVERYRA  853

Query  1186  RLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETV  1007
             RLV KG+ Q  G DF + FS VV+ TT+R++ ++  + +  L QLDV  AFL+G L E +
Sbjct  854   RLVVKGYAQKEGIDFNEIFSPVVRLTTIRVVLAMCAALDLHLEQLDVKTAFLHGELEEEI  913

Query  1006  YMKQPPGYEDPTHPDHV-RVSSSTALYGLR  920
             YM QP G+++    + V R++ S  LYGL+
Sbjct  914   YMLQPEGFKEQGKENLVCRLTKS--LYGLK  941


 Score = 81.3 bits (199),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 100/202 (50%), Gaps = 11/202 (5%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHASIP-SESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDC  2662
             +GN   L I+ VG   +   +  +  +  V +V  L   L SV +L   +++  + H + 
Sbjct  321   MGNDHALEIAGVGTIRLKMHDGTVRKIQGVRHVKGLKKNLLSVGQL---DDLGCKIHTES  377

Query  2661  FIVKDSITRAVLLRGST-SGGLYRL-----PVSRSHFAYLTSRATSTVWHRRLGHPNAHV  2500
              I+K      V+++    +  LY L       + +  A  +   T+ +WH+RLGH +   
Sbjct  378   GILKVVKGNLVVMKAEKITSNLYMLLGDTLQEADASVAAASQEETTMMWHQRLGHMSERG  437

Query  2499  QNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVIS  2320
                +++   +   K  +L     C +SK  R    RV+  SK++LDL+++D+W  +P +S
Sbjct  438   LKVLVERNLLHGLKTVNLPFCEHCVISKQHRLKFARVTTRSKHILDLIHSDVW-ESPELS  496

Query  2319  TSGFRYFLLFVDDYSRFCWFYP  2254
               G RYF+ F+DDYSR  W YP
Sbjct  497   LGGARYFVSFIDDYSRRLWVYP  518



>ref|XP_003376336.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella 
spiralis]
 gb|EFV58419.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella 
spiralis]
Length=1003

 Score =   192 bits (487),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 133/451 (29%), Positives = 214/451 (47%), Gaps = 20/451 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             K+++   F+ F   VERQ S+ +K ++ D G EY        L + GI H ++   T +Q
Sbjct  216   KNEVLSKFKDFIAMVERQTSKRVKCLRTDNGREYVNNMFAEFLVRKGIRHERTIPETPQQ  275

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  R +VE    +L + ++S   W  A   A  L N  PT  L+  +P       
Sbjct  276   NGVAERMNRTLVEKARTMLIDANLSPDLWAEAVGTANYLRNRCPTKALRKVTPEEAWSGR  335

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    L+VFGC    ++    R K + +S   +F+ Y  + +GYR ++  + K+Y+ R 
Sbjct  336   KPNLAHLKVFGCLAMVHVPSGQRKKWDLKSEERIFVGYCETSKGYRTVDRKTKKMYVTRD  395

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVV----TRAPCNTHAAPTDSAHMSLTSPVP  1544
             V F ES F  + ++          P   E  V    ++   +T   P  SA + + +   
Sbjct  396   VKFLESQFPGTQASKEGSTNSLMSPDVGEEAVIVWTSQDSGSTEMDPNPSAPLKVDTDSD  455

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCY  1364
              + G  P   +   +T+P   R     H    ++     +      + H     +DP  Y
Sbjct  456   KSIGQNP---QPSAKTSPEELRRPLRNHFPNRNIFNSDFLLFQAQVREH-----SDPISY  507

Query  1363  SQAVGH---L*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQY  1193
              +AV       W  A+++E  +   N +W+  +  PH   +  KWVF+TK   DG+I + 
Sbjct  508   EEAVNRPDAKEWLKAINEELASHRENQSWEPAVLPPHKKAIKSKWVFKTKYKEDGTIGKR  567

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             KARLVAKG++Q+ G DF DTF+  +  +++R L SL   +N  + Q+DV  AFLN  L E
Sbjct  568   KARLVAKGYSQLQGIDFEDTFAPTLGYSSLRYLLSLAAKYNLEVDQMDVVTAFLNPSLNE  627

Query  1012  TVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
              +YM+ P G  D  +  + R+  S  +YGL+
Sbjct  628   EIYMELPSGVGDGNNK-YCRLRKS--IYGLK  655


 Score = 84.7 bits (208),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 95/201 (47%), Gaps = 10/201 (5%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHASIP-SESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDC  2662
             + NG  +    +G   IP +  K +   +V + P+L++ L SV R+  +          C
Sbjct  14    IANGTNITTKGIGVVKIPLATEKTMVAHDVRHAPELALNLLSVSRIAAQKKTLIFDENGC  73

Query  2661  FIVKDSIT---RAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNR  2491
              IV  +I    + +L   +   GLYRL  +R     +T      +WHR+LGH  +    +
Sbjct  74    RIVDLAIEVPRQHILGTATQYNGLYRL--NRCDQWAMTVHDVPDLWHRQLGHL-SRGSMK  130

Query  2490  VLQSCPVA--PNKVKSLGSRTSCHLSKASRFPLDR-VSYSSKNVLDLLYTDIWGPAPVIS  2320
             +LQ       P+   +     +C   K  R P  +  +  SK VL+L+++DI GP  V S
Sbjct  131   LLQDGQATGIPSDAITKTDCVTCLKGKQCRLPFPKSATKRSKEVLELVHSDICGPMQVAS  190

Query  2319  TSGFRYFLLFVDDYSRFCWFY  2257
               G RYFL F+DD+SR  + Y
Sbjct  191   VGGARYFLSFIDDFSRKSFVY  211



>ref|XP_003376808.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella 
spiralis]
 gb|EFV57947.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella 
spiralis]
Length=1324

 Score =   189 bits (480),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 136/456 (30%), Positives = 217/456 (48%), Gaps = 30/456 (7%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             K+++   F+ F   VERQ S+ +K ++ D G EY        L + GI H ++   T +Q
Sbjct  523   KNEVLPKFKDFIAMVERQTSKRVKCLRTDNGREYVNNMFAEFLVRKGIRHERTIPETPQQ  582

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  R +VE    +L + ++S   W  A   A  L N  PT  L+  +P       
Sbjct  583   NGVAERMNRTLVEKARTMLIDANLSPDLWAEAVGTANYLRNRCPTKALRKVTPEEAWSGR  642

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
              P    L+VFGC    ++    R K + +S   +F+ Y  + +GYR ++  + K+Y+ R 
Sbjct  643   KPNLAHLKVFGCLAMVHVPSGQRKKWDPKSEERIFVGYCETSKGYRTVDRKTKKMYVTRD  702

Query  1711  VHFYESIFLFSDSTLCSQPVPPTIPWASEPVV----TRAPCNTHAAPTDSAHMSLTSPVP  1544
             V F ES F  + ++          P   E  V    ++   +T   P  +A + + +   
Sbjct  703   VKFLESQFPGTQASKEGSTNSLMNPDVGEETVIVWTSQDSGSTEMDPNPTAPLKVDTDSD  762

Query  1543  LARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQ----FHA-LNVTT  1379
              + G  P   +   +T+P   R            +R R   R+        F A +   +
Sbjct  763   KSIGQNP---QPSTKTSPEELR----------RPLRNRFPNRNIFNSDFLLFQAQVREHS  809

Query  1378  DPTCYSQAVGH---L*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADG  1208
             DP  Y +AV       W  A+++E  +   N +W+  +  PH   +  KWVF+TK   DG
Sbjct  810   DPISYEEAVNRPDAKEWLKAINEELASHRENQSWEPAVLPPHKKAIKSKWVFKTKYKEDG  869

Query  1207  SIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLN  1028
             +IE+ KARLVAKG++Q+ G DF DTF+  +  +++R L SL   +N  + Q+DV  AFLN
Sbjct  870   TIEKRKARLVAKGYSQLQGIDFEDTFAPTLGYSSLRYLLSLAAKYNLEVDQMDVVTAFLN  929

Query  1027  GHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
               L E +YM+ P G  D  +  + R+  S  +YGL+
Sbjct  930   PSLNEEIYMELPSGVGDENN-KYCRLRKS--IYGLK  962


 Score = 87.4 bits (215),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 100/213 (47%), Gaps = 12/213 (6%)
 Frame = -1

Query  2868  DEYTG--SDVLRVGNGAGLIISRVGHASIP-SESKLLHLSNVLYVPKLSVPLFSVYRLTN  2698
             +EY G  +  + + NG  +     G   IP +  K +   +V + P+L++ L SV R+  
Sbjct  309   EEYNGHTTHTVAIANGTNITTKGCGVVKIPLATKKTMVAHDVRHAPELALNLLSVSRIAA  368

Query  2697  ENNVFFEFHKDCFIVKDSIT---RAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHR  2527
             +          C IV  +I    + +L   +   GLYRL  +R     +T      +WHR
Sbjct  369   QKKTLIFDENGCRIVDLAIEVPRQHILGTATQYNGLYRL--NRCDQWAMTVHDVPDLWHR  426

Query  2526  RLGHPNAHVQNRVLQSCPVA--PNKVKSLGSRTSCHLSKASRFPLDR-VSYSSKNVLDLL  2356
             RLGH  +    ++LQ       P+   +     +C   K  R P  +  +  SK VL+L+
Sbjct  427   RLGHL-SRGSMKLLQDGQATGIPSDAITKTDCVTCLKGKQCRLPFPKSATKRSKEVLELV  485

Query  2355  YTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             ++DI GP  V S  G RYFL F+DD+SR  + Y
Sbjct  486   HSDICGPMQVASVGGARYFLSFIDDFSRKSFVY  518



>emb|CAA19715.1| putative protein [Arabidopsis thaliana]
 emb|CAB79576.1| putative protein [Arabidopsis thaliana]
Length=1318

 Score =   159 bits (402),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 119/206 (58%), Gaps = 3/206 (1%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             ++KSD Y  F +F   VE Q S+ I   Q D GGE+   K    L   GI  + SC +T 
Sbjct  366   KLKSDFYNIFLAFHKLVENQLSQKISVFQCDGGGEFVSHKFLQHLQSHGIQQQLSCPHTP  425

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFE-SPYTRL  1901
             +QNG  ERK+RH+VE GL++L +  V  ++W  AF  A  LIN LPTS L+   SPY +L
Sbjct  426   QQNGLAERKHRHLVELGLSMLFQSHVPHKFWVEAFFTANFLINLLPTSALKESISPYEKL  485

Query  1900  HKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYI  1721
             +   P YT LR FG  C+P LR Y  +K    S  CVFL Y   ++GYRC+   +G++YI
Sbjct  486   YDKKPDYTSLRSFGSACFPTLRDYAENKFNPCSLKCVFLGYNEKYKGYRCLYPPTGRLYI  545

Query  1720  CRHVHFYESIFLFSDSTLCSQPVPPT  1643
              RHV F ES++ FS +     P P T
Sbjct  546   SRHVIFDESVYPFSHTYKHLHPQPRT  571


 Score =   116 bits (291),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 102/212 (48%), Gaps = 44/212 (21%)
 Frame = -1

Query  2880  MSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLT  2701
             + QS  Y G+D + V +G  L I+  G  ++ S S  + L++VL  P ++  L S+ +LT
Sbjct  194   LQQSQPYHGTDAIMVDDGNYLPITHTGSTNLASSSGTVPLTDVLVCPSITKSLLSMSKLT  253

Query  2700  NENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSR---ATSTVWH  2530
              +     EF  D   V D  T+ +LL GS   GLY L   +   A+ ++R   A+  VWH
Sbjct  254   QDFPCTVEFEYDGVRVNDKATKKLLLMGSNRDGLYCLKDDKQFQAFFSTRQRSASDEVWH  313

Query  2529  RRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYT  2350
             RRLGHP+     ++LQ                          PL+RV           + 
Sbjct  314   RRLGHPHP----QILQ--------------------------PLERV-----------HC  332

Query  2349  DIWGPAPVISTSGFRYFLLFVDDYSRFCWFYP  2254
             D+WGP  + S  GFRY+ +F+D YSRF W YP
Sbjct  333   DLWGPTTITSVQGFRYYAVFIDHYSRFSWIYP  364


 Score =   148 bits (373),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 6/163 (4%)
 Frame = -3

Query  1378  DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIE  1199
             +P   + A+ H  W  AM +E        TW LV  +  M+V+G KWVFRTK +ADG++ 
Sbjct  713   EPKTVTAALKHPGWTGAMTEEIGNCSETQTWSLVPYKSDMHVLGSKWVFRTKLHADGTLN  772

Query  1198  QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHL  1019
             + KAR+VAKGF Q  G D+ +T+S VV+  TVRL+  L  + NW ++Q+DV NAFL+G L
Sbjct  773   KLKARIVAKGFLQEEGIDYLETYSPVVRTPTVRLVLHLATALNWDIKQMDVKNAFLHGDL  832

Query  1018  AETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
              ETVYM QP G+ DP+ PDHV +    ++YGL+      SPRA
Sbjct  833   KETVYMTQPAGFVDPSKPDHVCLLHK-SIYGLKQ-----SPRA  869



>emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera]
Length=1224

 Score =   203 bits (516),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 215/458 (47%), Gaps = 89/458 (19%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             +++++  F+ F   ++ QF+ SI+ ++ D   EY     T  ++  GI H+ SCA+T +Q
Sbjct  536   RAELFSIFQKFYTEIQTQFNISIRVLRSDNAREYFSAQFTSFMSHHGILHQSSCAHTPQQ  595

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK RH+VET   LL    V  ++W  A   A  LIN +P+SVL  + P++ L   
Sbjct  596   NGVAERKNRHLVETARTLLLHSHVPFRFWGDAVLTACYLINRMPSSVLHDQIPHSLLFPD  655

Query  1891  PPPYTFL--RVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL  RVFGC C+ ++    + K+  ++  C+       F GY  +     K Y C
Sbjct  656   QPLY-FLPPRVFGCTCFVHILTPGQDKLSAKAMKCL-------FLGYSRLQ----KGYRC  703

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTS-PVPL  1541
               +  +   F+ +D T                              DS   S TS  +P+
Sbjct  704   YSLETHR-YFISADVTFFE---------------------------DSPFFSTTSESLPV  735

Query  1540  ARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDPTCYS  1361
             +  LP + I  P +  P R                     + T E F             
Sbjct  736   SEVLP-IPIVSPPEAMPPRP-------------------LQSTHEAF-------------  762

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
                 H  WR AM  E   L  N TW LV+  P  + VGC+WV+  K   DG +++ KARL
Sbjct  763   ---SHPSWRQAMVDEMATLHSNGTWDLVVLPPGKSTVGCRWVYAVKVGPDGQVDRLKARL  819

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             VAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ N FL+G LAE VYM
Sbjct  820   VAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNVFLHGDLAEEVYM  879

Query  1000  KQPPGYEDPTHPDHV-RVSSSTALYGLRGVKMG*SPRA  890
             +QPPG+        V R+  S  LYGL+      SPRA
Sbjct  880   EQPPGFVAQGESGLVCRLRRS--LYGLKQ-----SPRA  910


 Score = 73.2 bits (178),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 74/168 (44%), Gaps = 21/168 (13%)
 Frame = -1

Query  2760  SNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGSTSGGLYRLPVS  2581
             ++VLY P+    L S+ ++T   N    F      ++D  T   +  G  S GLY L  S
Sbjct  385   TSVLYTPECPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHL-TS  443

Query  2580  RSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFP  2401
              S  A   S     + H RLGHP+                  K LG  T     K     
Sbjct  444   DSSPAVCISTDAPLLIHNRLGHPSLS-------------KFQKMLGKHTRVSFPK-----  485

Query  2400  LDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
               R++  +K+  +L++ D+W P    ST GF+YF+ F+DDYSR  W +
Sbjct  486   --RLNNRAKSXFELVHXDVWXPCRTASTLGFQYFVTFIDDYSRCTWLF  531



>gb|AAP46257.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF99717.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1335

 Score =   218 bits (554),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 146/480 (30%), Positives = 221/480 (46%), Gaps = 60/480 (13%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KS   + F+ F+  VE Q +R IK ++ D G EY  ++        GI  + +  Y+ 
Sbjct  556   KEKSAALEIFKKFKAMVENQSNRKIKVLRSDQGREYISKEFEKYCENAGIRRQLTAGYSA  615

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ERK R I +   ++L +  + + +W  A   A  ++N  PT  +   +P+   +
Sbjct  616   QQNGVAERKNRTINDMANSMLQDKGMPKSFWAEAVNTAVYILNRSPTKAVTNRTPFEAWY  675

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
                P    +RVFGC CY  +    R K + +S  C+F+ Y    +GYR  NL   KI I 
Sbjct  676   GKKPVIGHMRVFGCICYAQVPAQKRVKFDNKSDRCIFVGYADGIKGYRLYNLEKKKIIIS  735

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVP--  1544
             R   F ES                T  W S    +     T        HM  T  V   
Sbjct  736   RDAIFDES---------------ATWNWKSPEASSTPLLPTTTITLGQPHMHGTHEVEDH  780

Query  1543  -----------------LARGLPPLAIEGPVQTAPTRARA----V*TQHQERGHVMRLRH  1427
                               +       I  P ++AP R R+    + +  Q+RG       
Sbjct  781   TPSPQPSSPMSSSSASSDSSPSSEEQISTP-ESAPRRVRSMVELLESTSQQRG-------  832

Query  1426  MTRDTSEQFHALNVTT-DPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVV  1250
                  SEQ    N +  +P  + +A  H  W  AM+ E + +  N+TW+LV       V+
Sbjct  833   -----SEQHEFCNYSVVEPQSFQEAEKHDNWIKAMEDEIHMIEKNNTWELVDRPRDREVI  887

Query  1249  GCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHN  1070
             G KWV++TK N DGS+++YKARLVAKGF Q  G D+++T++ V +  T+R + +L     
Sbjct  888   GVKWVYKTKLNPDGSVQKYKARLVAKGFKQKPGIDYYETYAPVARLETIRTIIALAAQKR  947

Query  1069  WTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*SPRA  890
             W + QLDV +AFLNG+L E +Y++QP G+      + V      ALYGL+      +PRA
Sbjct  948   WKIYQLDVKSAFLNGYLDEEIYVEQPEGFSVQGGENKV-FRLKKALYGLKQ-----APRA  1001


 Score = 58.2 bits (139),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 85/205 (41%), Gaps = 14/205 (7%)
 Frame = -1

Query  2844  LRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNEN-NVFFEFHK  2668
             + +GNG+       G  ++ +      + +VL VP L   L S+ +L      V+FE   
Sbjct  354   IHMGNGSIAQSEGKGTVAVQTADGPKFIKDVLLVPDLKQNLLSIGQLLEHGYAVYFEDF-  412

Query  2667  DCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRAT-STVWHRRLGHPNAHV---  2500
              C I+     R V          + L ++ +    L S    S +WH+R+GH N      
Sbjct  413   SCKILDRKNNRLVAKINMEKNRNFLLRMNHTTQMALRSEVDISDLWHKRMGHLNYRALKL  472

Query  2499  --QNRVLQSCPVAPNKVKSLGSRTSCHLSKASR--FPLDRVSYSSKNVLDLLYTDIWGPA  2332
                  ++Q  P    K         C   K  R  FP    ++ +   L+L++ DI G  
Sbjct  473   LRTKGMVQGLPFITLKSDPC---EGCVFGKQIRASFP-HSGAWRASAPLELVHADIVGKV  528

Query  2331  PVISTSGFRYFLLFVDDYSRFCWFY  2257
             P IS  G  YF+ F+DDY+R  W Y
Sbjct  529   PTISEGGNWYFITFIDDYTRMIWVY  553



>gb|ABI34342.1| Polyprotein, putative [Solanum demissum]
Length=1054

 Score =   203 bits (517),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 152/483 (31%), Positives = 230/483 (48%), Gaps = 64/483 (13%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             +S+++  F+SF   ++ QF  SI++ + D   EY   +    ++  GI H+ SC YT +Q
Sbjct  342   RSELFSIFKSFFAEIQNQFGVSIRTFRSDNALEYLSSQFQEFMSHQGIIHQTSCPYTPQQ  401

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYT-----  1907
             NG  ERK RH++ET   LL E  V  ++W  A   +  LIN +P+S +Q + P++     
Sbjct  402   NGVAERKNRHLIETARTLLIESHVPLRFWGDAVLSSCYLINRMPSSSIQNQVPHSILFPQ  461

Query  1906  -RLHKTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGK  1730
               L+  PP     RVFG  C+ +     + K+  R+  CVFL Y    +GYRC +    +
Sbjct  462   SHLYPIPP-----RVFGSTCFVHNLAPGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHR  516

Query  1729  IYICRHVHFYES--IFLFSDSTLCSQ--PVPPTIP---------WASEPVVTRAPCNTH-  1592
               +   V F+ES   +  SD    S   P+P  +P          ++ PVV       H 
Sbjct  517   YLMSADVTFFESQPYYTSSDHPDVSMVLPIPQVLPVPTFEESTITSTSPVVVPPLLTYHR  576

Query  1591  -----AAPTDSAHMSLTSPVPLARGLPP---LAIEGPVQTAPTRARAV*TQHQERGHVMR  1436
                    P DS H     P P A   PP   LA++  +++         T++    +   
Sbjct  577   RPRPTLVPDDSCHA--PDPAPTADLPPPSQPLALQKGIRS---------TRNTNPHYTFL  625

Query  1435  LRHMTRDTSEQF-HALNVTTDPTCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHM  1259
               H        F  +L+  + P    +A+ H  WR AM  E +AL  + TW+LV   P +
Sbjct  626   SYHRLSSPHYAFVSSLSSISIPKTTGEALSHSGWRQAMVDEMSALHKSGTWELV-SLPAV  684

Query  1258  NVVGCKWVFRTKRNADGSIEQYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVV  1079
              +             DG +++ KARLVAKG+ Q+ G D+ DTF+ V K  ++RL  S+  
Sbjct  685   KI-----------GPDGQVDRLKARLVAKGYTQIFGLDYSDTFAPVAKIASIRLFLSMAA  733

Query  1078  SHNWTLRQLDVHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLRGVKMG*S  899
               +W L QLD+ NAFL+G L E VYM+QPPG+        +      +LYGL+      S
Sbjct  734   VRHWPLHQLDIKNAFLHGDLEEEVYMEQPPGFVAQGESSSLVCRLRRSLYGLKQ-----S  788

Query  898   PRA  890
             PRA
Sbjct  789   PRA  791


 Score = 72.4 bits (176),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 73/135 (54%), Gaps = 7/135 (5%)
 Frame = -1

Query  2658  IVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRVLQS  2479
             +  D  T  ++  G  S GLY L  S S  A   + +   + H+RLGHP+     +++ S
Sbjct  209   LASDRNTGQMIGTGHESQGLYYLTSSNSLTACSITDSPDLI-HKRLGHPSLSKLQKMVPS  267

Query  2478  CPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYS-SKNVLDLLYTDIWGPAPVISTSGFRY  2302
                  + + +L    SC L K +R    R +   S+++  L+++DIWGP+ V ST GFRY
Sbjct  268   L----SSLSTLDCE-SCQLGKHTRATFSRSTEGRSESIFSLVHSDIWGPSRVSSTLGFRY  322

Query  2301  FLLFVDDYSRFCWFY  2257
             F+ F+DDYSR  W +
Sbjct  323   FVSFIDDYSRCTWVF  337



>gb|AAX92861.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92739.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1373

 Score =   199 bits (507),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/463 (31%), Positives = 225/463 (49%), Gaps = 37/463 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             K D +  F++++V +ERQ  R +K ++ D GGE+     +    + GI    +  +T +Q
Sbjct  525   KDDTFTAFKNWKVMIERQTERKVKLLRTDNGGEFCSHAFNDYCRQEGIVRHHTIPHTPQQ  584

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  R I+     +L+   +++++W  A   A  LIN  P+  L  ++P      T
Sbjct  585   NGVAERMNRTIISRARCMLSHARMNKRFWAEAASTACYLINRSPSIPLNKKTPIEVWSGT  644

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             P  Y+ L+VFGC  Y ++   +  K+E R+  C+FL Y    +GY+  N  +GK ++ R 
Sbjct  645   PADYSQLKVFGCTAYAHV---DNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSRS  701

Query  1711  VHFYESIFLFSDSTLCSQPVPPT---------------IPWASEPVVTRAPCNTHAAPTD  1577
             V F ES+ +F++S L S+ VP                      EPV  +   N   A  D
Sbjct  702   VVFNESV-MFTNS-LPSEHVPEKELQRMHMQVEHVDDDTGVQVEPVHEQDDHNNDVADDD  759

Query  1576  SAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFH  1397
             +      +P       P L +E  +  A  +++      +       L +     +EQ  
Sbjct  760   AHDDVQQTP-------PILQLEEELPIAQRKSKRTTKPPKRLIEECNLSYYALSCAEQVE  812

Query  1396  ALNVTTDPTCYSQAV---GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRT  1226
              ++   +P  Y +AV       W  AM +E  +L  N TW++V        + CKW+F+ 
Sbjct  813   NVH---EPATYKEAVRCGDSENWISAMHEEMQSLEKNSTWEVVPLPKKKKTISCKWIFKR  869

Query  1225  KRNADGSIE-QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
             K     S   +YKARLVA+G++Q+ G D+ D FS VVK +++R   S+V SH+  L QLD
Sbjct  870   KEGLSSSEPPKYKARLVARGYSQIPGVDYNDVFSPVVKHSSIRTFLSIVASHDLELEQLD  929

Query  1048  VHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V  AFL+G L E +YM QP G+  P    +V      +LYGL+
Sbjct  930   VKTAFLHGELEEDIYMDQPEGFIVPGKEKYV-CKLKRSLYGLK  971


 Score = 75.9 bits (185),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 65/228 (29%), Positives = 101/228 (44%), Gaps = 22/228 (10%)
 Frame = -1

Query  2898  CVTASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLH-LSNVLYVPKLSVPL  2722
             C   +  S        DV+R+G+     I  +G   I ++  +   L NV Y+P +S  L
Sbjct  301   CTKRNWFSSYKPVQKGDVVRMGDDNPCAIVGIGSVQIKTDDGMTRTLKNVRYIPGMSRNL  360

Query  2721  FSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGS-TSGGLY-----RLPVSRSHFAYL  2560
              S+  L  E    +++     ++K S    V L+G   S  LY      L  S S  A +
Sbjct  361   ISLSTLDAEG---YKYSGSDGVLKVSKGSLVCLKGDVNSAKLYVLRGCTLTGSDSAAAAI  417

Query  2559  TSRATS--TVWHRRLGHPN-----AHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFP  2401
             T+   S   +WH RLGH +       ++  +L+ C    +K+K       C   K  R  
Sbjct  418   TNDEPSKTNLWHMRLGHMSHLGMTELMKRNLLKGC--TSSKIKFC---EHCIFGKHKRVQ  472

Query  2400  LDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +   +++K  LD ++ D+WGP+   S  G RY L  +DDYSR  W Y
Sbjct  473   FNTSVHTTKGTLDYVHADLWGPSKKPSLGGARYMLTIIDDYSRKVWPY  520



>emb|CAH66122.1| OSIGBa0146N20.7 [Oryza sativa Indica Group]
Length=1335

 Score =   197 bits (502),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/463 (31%), Positives = 224/463 (48%), Gaps = 37/463 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             K D +  F++++V +ERQ  R +K +  D GGE+     +    + GI    +  +T +Q
Sbjct  527   KDDTFTAFKNWKVMIERQTERKVKLLCTDNGGEFCSHAFNDYCRQEGIVRHHTIPHTPQQ  586

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  R I+     +L+   +++++W  A   A  LIN  P+  L  ++P      T
Sbjct  587   NGVAERMNRTIISRARCMLSHARMNKRFWAEAASTACYLINRSPSIPLNKKTPIEVWSGT  646

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             P  Y+ L+VFGC  Y ++   +  K+E R+  C+FL Y    +GY+  N  +GK ++ R 
Sbjct  647   PADYSQLKVFGCTAYAHV---DNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSRS  703

Query  1711  VHFYESIFLFSDSTLCSQPVPPT---------------IPWASEPVVTRAPCNTHAAPTD  1577
             V F ES+ +F++S L S+ VP                      EPV  +   N   A  D
Sbjct  704   VVFNESV-MFTNS-LPSEHVPEKELQRMHMQVEHVDDDTGVQVEPVDEQDDHNNDVADDD  761

Query  1576  SAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFH  1397
             +      +P       P L +E  +  A  +++      +       L +     +EQ  
Sbjct  762   AHDDVQQTP-------PILQLEEDLSIAQRKSKRTTKPPKRLIEECNLSYYALSCAEQVE  814

Query  1396  ALNVTTDPTCYSQAV---GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRT  1226
              ++   +P  Y +AV       W  AM +E  +L  N TW++V        + CKW+F+ 
Sbjct  815   NVH---EPATYKEAVRCGDSENWISAMHEEMQSLEKNSTWEVVPLPKKKKTISCKWIFKR  871

Query  1225  KRNADGSIE-QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
             K     S   +YKARLVA+G++Q+ G D+ D FS VVK +++R   S+V SH+  L QLD
Sbjct  872   KEALSLSEPPKYKARLVARGYSQIPGVDYNDVFSPVVKHSSIRTFLSIVASHDLELEQLD  931

Query  1048  VHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V  AFL+G L E +YM QP G+  P    +V      +LYGL+
Sbjct  932   VKTAFLHGELEEDIYMDQPEGFIVPGKEKYV-CKLKRSLYGLK  973


 Score = 77.8 bits (190),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 97/223 (43%), Gaps = 12/223 (5%)
 Frame = -1

Query  2898  CVTASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLH-LSNVLYVPKLSVPL  2722
             C   +  S        DV+R+G+     I  +G   I ++  +   L NV Y+P +S  L
Sbjct  303   CTKRNWFSSYKPVQKGDVVRMGDDNPCAIVGIGSVQIKTDDGMTRTLKNVRYIPGMSRNL  362

Query  2721  FSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGS-TSGGLY-----RLPVSRSHFAYL  2560
              S+  L  E    +++     ++K S    V L+G   S  LY      LP S S  A +
Sbjct  363   ISLSTLDAEG---YKYSGSDGVLKVSKGSLVCLKGDLNSAKLYVLRGCTLPGSDSAAAAV  419

Query  2559  TSRATS--TVWHRRLGHPNAHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVS  2386
             T+   S   +WH RLGH +      +++   +       +     C   K  R   +   
Sbjct  420   TNDEPSKTNLWHMRLGHMSHLGMTELMKRNLLKGYTSSKIKFCEHCIFGKHKRVQFNTSV  479

Query  2385  YSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
             +++K  LD ++ D+WGP+   S  G RY L  +DDYSR  W Y
Sbjct  480   HTTKGTLDYVHADLWGPSKKPSLGGARYMLTIIDDYSRKVWPY  522



>gb|ABA98804.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1333

 Score =   199 bits (507),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 142/463 (31%), Positives = 225/463 (49%), Gaps = 37/463 (8%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTHEQ  2072
             K D +  F++++V +ERQ  R +K ++ D GGE+     +    + GI    +  +T +Q
Sbjct  525   KDDTFTAFKNWKVMIERQTERKVKLLRTDNGGEFCSHAFNDYCRQEGIVRHHTIPHTPQQ  584

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ER  R I+     +L+   +++++W  A   A  LIN  P+  L  ++P      T
Sbjct  585   NGVAERMNRTIISRARCMLSHARMNKRFWAEAASTACYLINRSPSIPLNKKTPIEVWSGT  644

Query  1891  PPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYICRH  1712
             P  Y+ L+VFGC  Y ++   +  K+E R+  C+FL Y    +GY+  N  +GK ++ R 
Sbjct  645   PADYSQLKVFGCTAYAHV---DNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSRS  701

Query  1711  VHFYESIFLFSDSTLCSQPVPPT---------------IPWASEPVVTRAPCNTHAAPTD  1577
             V F ES+ +F++S L S+ VP                      EPV  +   N   A  D
Sbjct  702   VVFNESV-MFTNS-LPSEHVPEKELQRMHMQVEHVDDYTGVQVEPVHEQDDHNNDVADDD  759

Query  1576  SAHMSLTSPVPLARGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFH  1397
             +      +P       P L +E  +  A  +++      +       L +     +EQ  
Sbjct  760   AHDDVQQTP-------PILQLEEELPIAQRKSKRTTKPPKRLIEECNLSYYALSCAEQVE  812

Query  1396  ALNVTTDPTCYSQAV---GHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRT  1226
              ++   +P  Y +AV       W  AM +E  +L  N TW++V        + CKW+F+ 
Sbjct  813   NVH---EPATYKEAVRCGDSENWISAMHEEMQSLEKNSTWEVVPLPKKKKTISCKWIFKR  869

Query  1225  KRNADGSIE-QYKARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLD  1049
             K     S   +YKARLVA+G++Q+ G D+ D FS VVK +++R   S+V SH+  L QLD
Sbjct  870   KEGLSSSEPPKYKARLVARGYSQIPGVDYNDVFSPVVKHSSIRTFLSIVASHDLELEQLD  929

Query  1048  VHNAFLNGHLAETVYMKQPPGYEDPTHPDHVRVSSSTALYGLR  920
             V  AFL+G L E +YM QP G+  P    +V      +LYGL+
Sbjct  930   VKTAFLHGELEEDIYMDQPEGFIVPGKEKYV-CKLKRSLYGLK  971


 Score = 75.5 bits (184),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 65/228 (29%), Positives = 101/228 (44%), Gaps = 22/228 (10%)
 Frame = -1

Query  2898  CVTASMMSQSDEYTGSDVLRVGNGAGLIISRVGHASIPSESKLLH-LSNVLYVPKLSVPL  2722
             C   +  S        DV+R+G+     I  +G   I ++  +   L NV Y+P +S  L
Sbjct  301   CTKRNWFSSYKPVQKGDVVRMGDDNPCAIVGIGSVQIKTDDGMTRTLKNVRYIPGMSRNL  360

Query  2721  FSVYRLTNENNVFFEFHKDCFIVKDSITRAVLLRGS-TSGGLY-----RLPVSRSHFAYL  2560
              S+  L  E    +++     ++K S    V L+G   S  LY      L  S S  A +
Sbjct  361   ISLSTLDAEG---YKYSGSDGVLKVSKGSLVCLKGDLNSAKLYVLRGCTLTGSDSAAAAV  417

Query  2559  TSRATS--TVWHRRLGHPN-----AHVQNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFP  2401
             T+   S   +WH RLGH +       ++  +L+ C    +K+K       C   K  R  
Sbjct  418   TNDEPSKTNLWHMRLGHMSHLGMTELMKRNLLKGC--TSSKIKFC---EHCIFGKHKRVQ  472

Query  2400  LDRVSYSSKNVLDLLYTDIWGPAPVISTSGFRYFLLFVDDYSRFCWFY  2257
              +   +++K  LD ++ D+WGP+   S  G RY L  +DDYSR  W Y
Sbjct  473   FNTSVHTTKGTLDYVHADLWGPSKKPSLGGARYMLTIIDDYSRKVWPY  520



>gb|ACL97385.1| Gag-Pol polyprotein [Medicago truncatula]
Length=1305

 Score =   193 bits (491),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 130/448 (29%), Positives = 217/448 (48%), Gaps = 30/448 (7%)
 Frame = -3

Query  2251  RVKSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEY--RKIHHTLTKLGITHRKSCAYTH  2078
             + KSD++  F++F+ ++E +  + IK ++ D GGEY   +      + GI  + + A+T 
Sbjct  520   KKKSDVFPVFKAFKAQIELETGKKIKCLRTDNGGEYVDGEFLAFCKQEGIVRQFTVAHTP  579

Query  2077  EQNGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLH  1898
             +QNG  ER  R ++E   A+L    +++ +W  A + A  +IN  P++ +  ++P     
Sbjct  580   QQNGVAERMNRTLLERTRAMLKTAEMAKSFWAEAVKTACYVINRSPSTTIDLKTPMEMWK  639

Query  1897  KTPPPYTFLRVFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
               P  Y+ L VFGC  Y       R K++ +S  C+FL Y  + +GYR  + T+ K+ + 
Sbjct  640   GKPVDYSSLHVFGCPVYVMYNSQERTKLDPKSRKCIFLGYADNVKGYRLWDPTARKVVVS  699

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPWASEPVVTRAPCNTHAAPTDSAHMSLTSPVPLA  1538
             R V F E      +     Q    T    +   +      + ++  +S H     P  + 
Sbjct  700   RDVVFAE------NELQSEQKNDSTFKETAILQIEEKSKESDSSEAESVHEE-QEPDDVN  752

Query  1537  RGLPPLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFH-ALNVTTDPTCYS  1361
              G+          T  T+  +  + +   GH              FH ALN +       
Sbjct  753   NGVRR-------STRQTQKPSWQSDYVMTGHDAYCLIAEEGEPSTFHEALNGSDASQ---  802

Query  1360  QAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQYKARL  1181
                    W  A+ +E  AL  N TW+LV        +G KWV++ KR+ +  +E+Y+ARL
Sbjct  803   -------WMTAIHEEMEALRKNKTWELVELPKGRKAIGNKWVYKIKRDGNDQVERYRARL  855

Query  1180  VAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAETVYM  1001
             V KG+ Q  G DF + FS VV+ TT+R++ ++  + +  L QLDV  AFL+G L E +YM
Sbjct  856   VVKGYAQKEGIDFNEIFSPVVRLTTIRVVLAMCAALDLHLEQLDVKTAFLHGELEEEIYM  915

Query  1000  KQPPGYEDPTHPDHV-RVSSSTALYGLR  920
              QP G+++    + V R++ S  LYGL+
Sbjct  916   LQPEGFKEQGKENLVCRLTKS--LYGLK  941


 Score = 81.3 bits (199),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 100/202 (50%), Gaps = 11/202 (5%)
 Frame = -1

Query  2838  VGNGAGLIISRVGHASIPS-ESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHKDC  2662
             +GN   L I+ VG   +   +  +  +  V +V  L   L SV +L   +++  + H + 
Sbjct  321   MGNDHALEIAGVGTIRLKMHDGTVRKIQGVRHVKGLKKNLLSVGQL---DDLGCKIHSES  377

Query  2661  FIVKDSITRAVLLRGST-SGGLYRL-----PVSRSHFAYLTSRATSTVWHRRLGHPNAHV  2500
              I+K      V+++    +  LY L       + +  A  +   T+ +WH+RLGH +   
Sbjct  378   GILKVVKGNLVVMKAEKITSNLYMLLGDTLQEADASVAAASQEETTMMWHQRLGHMSERG  437

Query  2499  QNRVLQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVIS  2320
                +++   +   K  +L     C +SK  R    RV+  SK++LDL+++D+W  +P +S
Sbjct  438   LKVLVERNLLHGLKTVNLPFCEHCVISKQHRLKFARVTTRSKHILDLIHSDVW-ESPKLS  496

Query  2319  TSGFRYFLLFVDDYSRFCWFYP  2254
               G RYF+ F+DDYSR  W YP
Sbjct  497   LGGARYFVSFIDDYSRRLWVYP  518



>emb|CAN74064.1| hypothetical protein VITISV_028146 [Vitis vinifera]
Length=1203

 Score =   231 bits (590),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 153/430 (36%), Positives = 222/430 (52%), Gaps = 17/430 (4%)
 Frame = -3

Query  2245  KSDIYKTFESFRVRVERQFSRSIKSIQFDLGGEYRKIHHT--LTKLGITHRKSCAYTHEQ  2072
             ++ ++  F+ F   ++ QF+ SI  ++ D   EY     T  ++  GI H  SCA+T +Q
Sbjct  401   RAKLFSIFQKFYAEIQTQFNISIXVLRSDNAXEYFSXPFTSFMSHNGILHXSSCAHTPQQ  460

Query  2071  NGRVERKYRHIVETGLALLAEGSVSQQYWDFAFEMATCLINYLPTSVLQFESPYTRLHKT  1892
             NG  ERK R +VET   +L   +V  ++W  A   A  LIN +P+SVL  + P+  L   
Sbjct  461   NGVAERKNRXLVETARTILLHXNVPFRFWGDAVLTACYLINRMPSSVLHDQIPHFLLFPD  520

Query  1891  PPPYTFLR--VFGCRCYPYLRPYNRHKIEYRSAPCVFLVYPPSFRGYRCMNLTSGKIYIC  1718
              P Y FL   VFGC C+ ++    + K+  ++  C+FL Y    +GYRC +L + + +I 
Sbjct  521   QPLY-FLXPCVFGCTCFVHILTPGQDKLSAKAMKCLFLGYSKLQKGYRCYSLETHRYFIS  579

Query  1717  RHVHFYESIFLFSDSTLCSQPVPPTIPW---ASEPVVTRAPCNT-HAAPTDSAHMSLTSP  1550
               V F+E    FS S+  S PV   +P    +   VV   P    H  P  +A +S    
Sbjct  580   ADVTFFEDSPFFSTSSE-SLPVSEVLPLPIVSPSDVVPPRPLQVYHRHPRVAAPLSFAEA  638

Query  1549  VPLARGLP-PLAIEGPVQTAPTRARAV*TQHQERGHVMRLRHMTRDTSEQFHALNVTTDP  1373
                A  LP P A   P   +P         + E+  +     ++   S    A++  + P
Sbjct  639   P--ADSLPIPSASPAPTLPSPDDTHC----YSEKYSLYSYHRLSSPYSAFVSAISSVSLP  692

Query  1372  TCYSQAVGHL*WRDAMDQEFNALLHNDTWKLVLDEPHMNVVGCKWVFRTKRNADGSIEQY  1193
                 +A+ H  WR AM  E +AL  N TW LV+     + VGC+WV+  K   DG +++ 
Sbjct  693   KSTHEALSHPGWRQAMVDEMDALHSNGTWDLVVLPSGKSTVGCRWVYAVKVGPDGQVDRL  752

Query  1192  KARLVAKGFNQVAGDDFFDTFSLVVKPTTVRLLFSLVVSHNWTLRQLDVHNAFLNGHLAE  1013
             KARLVAKG+ QV G D+ DTFS V K  +VRLL S+    +W L QLD+ NAFL G LAE
Sbjct  753   KARLVAKGYTQVYGSDYGDTFSPVAKIASVRLLLSMAAMCSWPLYQLDIKNAFLYGDLAE  812

Query  1012  TVYMKQPPGY  983
              VYM+QPP +
Sbjct  813   EVYMEQPPSF  822


 Score = 42.7 bits (99),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 71/197 (36%), Gaps = 53/197 (27%)
 Frame = -1

Query  2847  VLRVGNGAGLIISRVGHASIPSESKLLHLSNVLYVPKLSVPLFSVYRLTNENNVFFEFHK  2668
             ++ + NG+  +   +G A        L L++V Y  +    L S+ ++T   N    F  
Sbjct  253   IVTLANGSQTVAKGIGLAL---PLPSLPLTSVFYTLECPFNLISISKITRTLNCSITFSD  309

Query  2667  DCFIVKDSITRAVLLRGSTSGGLYRLPVSRSHFAYLTSRATSTVWHRRLGHPNAHVQNRV  2488
                 ++D  T   +  G  S GLY L    S    +++ A   + H  LGH N       
Sbjct  310   KFMTLQDRSTGKTIGIGRESQGLYHLTSDSSPTVCISTDAPLLI-HSHLGHSN-------  361

Query  2487  LQSCPVAPNKVKSLGSRTSCHLSKASRFPLDRVSYSSKNVLDLLYTDIWGPAPVISTSGF  2308
                                  LSK  +                      GP  + ST GF
Sbjct  362   ---------------------LSKFQKM---------------------GPCRIASTLGF  379

Query  2307  RYFLLFVDDYSRFCWFY  2257
             +YF+ F+DDYSR  W +
Sbjct  380   QYFVTFIDDYSRCTWLF  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12408623439324