BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23022_g1_i1 len=2476 path=[2477:0-51 6878:52-53 2531:54-235
2713:236-1483 6803:1484-1484 3961:1485-1585 @4062@!:1586-2102
4579:2103-2475]

Length=2476
                                                                      Score     E

ref|XP_004244024.1|  PREDICTED: protein transport protein SFT2          347   1e-109   
ref|XP_006346109.1|  PREDICTED: protein transport protein SFT2-like     345   8e-109   
ref|XP_009615072.1|  PREDICTED: protein transport protein SFT2-like     341   2e-107   
ref|XP_009771413.1|  PREDICTED: protein transport protein SFT2-like     341   2e-107   
ref|XP_008355031.1|  PREDICTED: protein transport protein SFT2-like     335   2e-105   
ref|XP_004294911.1|  PREDICTED: protein transport protein SFT2-like     335   3e-105   
ref|XP_008218785.1|  PREDICTED: protein transport protein SFT2          334   6e-105   
ref|XP_006474815.1|  PREDICTED: protein transport protein SFT2-like     334   8e-105   
ref|XP_010103962.1|  Protein transport protein SFT2                     334   1e-104   
ref|XP_011095587.1|  PREDICTED: protein transport protein SFT2-like     333   1e-104   
ref|XP_002532175.1|  Protein transport protein SFT2, putative           333   2e-104   Ricinus communis
ref|XP_006452669.1|  hypothetical protein CICLE_v10009371mg             333   2e-104   
ref|XP_007205830.1|  hypothetical protein PRUPE_ppa010971mg             332   3e-104   
ref|XP_009367271.1|  PREDICTED: protein transport protein SFT2-like     332   5e-104   
gb|EYU27468.1|  hypothetical protein MIMGU_mgv1a013063mg                331   1e-103   
ref|XP_009362087.1|  PREDICTED: protein transport protein SFT2-like     330   3e-103   
gb|KDP32614.1|  hypothetical protein JCGZ_13164                         329   6e-103   
ref|XP_010252849.1|  PREDICTED: protein transport protein SFT2          328   1e-102   
ref|XP_008384611.1|  PREDICTED: protein transport protein SFT2-like     327   3e-102   
ref|XP_010928050.1|  PREDICTED: protein transport protein SFT2-like     327   6e-102   
ref|XP_007020403.1|  Got1/Sft2-like vescicle transport protein fa...    326   1e-101   
gb|KHG22762.1|  Protein transport SFT2                                  325   1e-101   
gb|KHG24787.1|  Protein transport SFT2                                  324   4e-101   
ref|XP_009407929.1|  PREDICTED: protein transport protein SFT2-like     324   5e-101   
ref|XP_004139775.1|  PREDICTED: protein transport protein SFT2-like     324   5e-101   
ref|XP_008809612.1|  PREDICTED: protein transport protein SFT2-like     323   1e-100   
emb|CDP13677.1|  unnamed protein product                                321   1e-99    
ref|XP_011037762.1|  PREDICTED: protein transport protein SFT2-like     320   1e-99    
ref|XP_006377965.1|  hypothetical protein POPTR_0011s16770g             320   1e-99    
ref|XP_008782994.1|  PREDICTED: protein transport protein SFT2          319   3e-99    
ref|XP_007049426.1|  Got1/Sft2-like vescicle transport protein fa...    318   5e-99    
ref|XP_003600409.1|  Protein transport protein SFT2                     318   7e-99    
ref|XP_006584495.1|  PREDICTED: uncharacterized protein LOC100306...    317   3e-98    
ref|XP_002273570.1|  PREDICTED: protein transport protein SFT2          317   3e-98    Vitis vinifera
ref|XP_004251550.1|  PREDICTED: protein transport protein SFT2          317   4e-98    
ref|XP_006857699.1|  hypothetical protein AMTR_s00061p00168700          317   4e-98    
ref|XP_007140128.1|  hypothetical protein PHAVU_008G086300g             316   4e-98    
ref|NP_001238452.1|  uncharacterized protein LOC100306412               316   5e-98    
ref|XP_010539341.1|  PREDICTED: protein transport protein SFT2-like     316   7e-98    
gb|EPS59015.1|  hypothetical protein M569_15796                         315   8e-98    
ref|XP_010246549.1|  PREDICTED: protein transport protein SFT2-like     315   1e-97    
ref|XP_003551395.1|  PREDICTED: protein transport protein SFT2-like     315   1e-97    
gb|AGV54819.1|  transport protein SFT2-like protein                     314   2e-97    
ref|XP_010448254.1|  PREDICTED: protein transport protein SFT2-like     314   3e-97    
ref|XP_006282707.1|  hypothetical protein CARUB_v10005677mg             313   7e-97    
ref|XP_006352003.1|  PREDICTED: protein transport protein SFT2-like     312   1e-96    
ref|NP_567749.1|  Got1/Sft2-like vescicle transport protein             312   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413168.1|  hypothetical protein EUTSA_v10026146mg             312   2e-96    
ref|XP_010536761.1|  PREDICTED: protein transport protein SFT2-like     311   2e-96    
ref|XP_002264182.1|  PREDICTED: protein transport protein SFT2 is...    311   3e-96    Vitis vinifera
ref|XP_002867560.1|  hypothetical protein ARALYDRAFT_492154             311   3e-96    
gb|KDP22999.1|  hypothetical protein JCGZ_01721                         311   5e-96    
ref|XP_011097723.1|  PREDICTED: protein transport protein SFT2-like     311   5e-96    
ref|XP_010929017.1|  PREDICTED: protein transport protein SFT2-like     310   8e-96    
gb|AGV54804.1|  transport protein SFT2-like protein                     310   8e-96    
ref|XP_010676101.1|  PREDICTED: protein transport protein SFT2          310   1e-95    
dbj|BAD94047.1|  hypothetical protein                                   310   1e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDP13671.1|  unnamed protein product                                313   2e-95    
emb|CDX89326.1|  BnaA01g15670D                                          310   2e-95    
ref|XP_009142455.1|  PREDICTED: protein transport protein sft2          309   2e-95    
emb|CDX94317.1|  BnaC01g18670D                                          309   2e-95    
ref|XP_010657500.1|  PREDICTED: protein transport protein SFT2 is...    309   3e-95    
gb|KFK27173.1|  hypothetical protein AALP_AA8G345000                    308   4e-95    
emb|CDP13674.1|  unnamed protein product                                310   9e-95    
ref|XP_010433484.1|  PREDICTED: protein transport protein SFT2-like     307   2e-94    
ref|XP_004500156.1|  PREDICTED: protein transport protein SFT2-like     306   2e-94    
gb|EYU43172.1|  hypothetical protein MIMGU_mgv1a013448mg                306   4e-94    
ref|XP_004491532.1|  PREDICTED: protein transport protein SFT2-like     306   5e-94    
ref|XP_009798045.1|  PREDICTED: protein transport protein SFT2-like     305   1e-93    
ref|XP_010063238.1|  PREDICTED: protein transport protein sft2-li...    305   2e-93    
ref|XP_009605080.1|  PREDICTED: protein transport protein SFT2-like     303   4e-93    
ref|XP_010314094.1|  PREDICTED: uncharacterized protein LOC101244061    306   4e-93    
ref|XP_009137600.1|  PREDICTED: protein transport protein sft2-like     303   8e-93    
ref|XP_004965916.1|  PREDICTED: protein transport protein SFT2-like     301   3e-92    
ref|XP_002524595.1|  Protein transport protein SFT2, putative           300   4e-92    Ricinus communis
ref|XP_002437264.1|  hypothetical protein SORBIDRAFT_10g023840          300   5e-92    Sorghum bicolor [broomcorn]
emb|CDX92816.1|  BnaC07g40740D                                          300   5e-92    
ref|XP_004958522.1|  PREDICTED: protein transport protein SFT2-like     300   6e-92    
emb|CDY42730.1|  BnaA03g48090D                                          300   6e-92    
ref|XP_010450575.1|  PREDICTED: protein transport protein SFT2-like     300   7e-92    
ref|XP_003617877.1|  Protein transport protein SFT2                     301   7e-92    
dbj|BAJ93024.1|  predicted protein                                      300   8e-92    
ref|XP_002320536.2|  hypothetical protein POPTR_0014s16880g             300   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011009811.1|  PREDICTED: protein transport protein SFT2-like     299   2e-91    
dbj|BAK05482.1|  predicted protein                                      299   2e-91    
gb|ACN85266.1|  putative SFT2 protein                                   298   3e-91    Oryza alta
ref|NP_200413.1|  Got1/Sft2-like vescicle transport protein             298   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAT41731.1|  At5g56020                                               298   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864425.1|  hypothetical protein ARALYDRAFT_495689             298   5e-91    
dbj|BAJ93185.1|  predicted protein                                      297   7e-91    
gb|ACR36108.1|  unknown                                                 297   1e-90    Zea mays [maize]
ref|XP_010445112.1|  PREDICTED: protein transport protein SFT2-like     298   2e-90    
ref|NP_001149600.1|  protein SFT2                                       296   2e-90    Zea mays [maize]
ref|NP_001150517.1|  protein SFT2                                       296   2e-90    Zea mays [maize]
gb|ACN28608.1|  unknown                                                 296   2e-90    Zea mays [maize]
ref|XP_009763291.1|  PREDICTED: uncharacterized protein LOC104215233    299   2e-90    
ref|XP_006281046.1|  hypothetical protein CARUB_v10027062mg             294   1e-89    
emb|CDP20579.1|  unnamed protein product                                294   1e-89    
ref|XP_006656231.1|  PREDICTED: protein transport protein SFT2-like     293   2e-89    
ref|XP_003563640.1|  PREDICTED: protein transport protein SFT2-like     292   8e-89    
ref|XP_009390596.1|  PREDICTED: protein transport protein SFT2-like     290   3e-88    
ref|XP_002461133.1|  hypothetical protein SORBIDRAFT_02g041270          289   1e-87    Sorghum bicolor [broomcorn]
ref|XP_010446136.1|  PREDICTED: protein transport protein sft2-like     288   1e-87    
ref|XP_006447853.1|  hypothetical protein CICLE_v10016561mg             287   6e-87    
ref|NP_001057449.1|  Os06g0300300                                       286   2e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EYU33727.1|  hypothetical protein MIMGU_mgv1a0262881mg               288   2e-86    
ref|XP_006469408.1|  PREDICTED: protein transport protein SFT2-like     285   4e-86    
ref|XP_003563934.1|  PREDICTED: protein transport protein SFT2          284   1e-85    
emb|CAA18215.1|  putative protein                                       286   1e-84    Arabidopsis thaliana [mouse-ear cress]
gb|ACN85162.1|  putative SFT2 protein                                   280   4e-84    Oryza nivara
gb|KDO59217.1|  hypothetical protein CISIN_1g026818mg                   278   7e-84    
ref|NP_001058041.1|  Os06g0608600                                       278   9e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EMS58711.1|  Protein transport protein SFT2                          277   3e-83    
ref|XP_011085422.1|  PREDICTED: protein transport protein SFT2-like     277   3e-83    
gb|KGN44129.1|  hypothetical protein Csa_7G200820                       270   1e-81    
ref|XP_011097721.1|  PREDICTED: uncharacterized protein LOC105176569    275   2e-81    
gb|ABK21723.1|  unknown                                                 273   2e-81    Picea sitchensis
ref|XP_007049427.1|  Got1/Sft2-like vescicle transport protein fa...    265   3e-79    
ref|XP_010063237.1|  PREDICTED: protein transport protein SFT2-li...    263   5e-78    
ref|XP_006656028.1|  PREDICTED: protein transport protein SFT2-like     261   3e-77    
ref|XP_010445111.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    258   2e-76    
ref|XP_002863234.1|  hypothetical protein ARALYDRAFT_497148             256   1e-74    
ref|XP_002975940.1|  hypothetical protein SELMODRAFT_232666             252   4e-74    
ref|XP_006284280.1|  hypothetical protein CARUB_v10005449mg             254   4e-74    
ref|XP_010496357.1|  PREDICTED: uncharacterized protein LOC104773443    253   1e-73    
ref|XP_002968545.1|  hypothetical protein SELMODRAFT_231162             251   2e-73    
ref|XP_010435360.1|  PREDICTED: uncharacterized protein LOC104719196    251   9e-73    
ref|XP_010450329.1|  PREDICTED: uncharacterized protein LOC104732477    250   2e-72    
tpg|DAA41613.1|  TPA: hypothetical protein ZEAMMB73_556884              248   4e-72    
ref|XP_010929447.1|  PREDICTED: uncharacterized protein LOC105050916    250   4e-72    
ref|XP_001753580.1|  predicted protein                                  246   6e-72    
ref|XP_010253022.1|  PREDICTED: uncharacterized protein LOC104594441    250   7e-72    
ref|XP_008668011.1|  PREDICTED: protein SFT2 isoform X1                 249   7e-72    
ref|XP_007206363.1|  hypothetical protein PRUPE_ppa017788mg             248   8e-72    
ref|NP_193005.1|  uncharacterized protein                               248   9e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CDY00849.1|  BnaCnng00490D                                          248   2e-71    
ref|XP_006418603.1|  hypothetical protein EUTSA_v10002618mg             248   3e-71    
ref|XP_008783101.1|  PREDICTED: uncharacterized protein LOC103702440    246   5e-71    
emb|CDY27882.1|  BnaA07g04720D                                          246   6e-71    
ref|XP_007020399.1|  Uncharacterized protein TCM_030574                 247   6e-71    
gb|EPS70677.1|  hypothetical protein M569_04081                         244   3e-70    
ref|XP_009102402.1|  PREDICTED: uncharacterized protein LOC103828543    244   5e-70    
ref|XP_002883629.1|  hypothetical protein ARALYDRAFT_480071             244   8e-70    
ref|XP_006452672.1|  hypothetical protein CICLE_v10010821mg             243   8e-70    
ref|XP_010644630.1|  PREDICTED: uncharacterized protein LOC100852612    243   1e-69    
ref|XP_003615564.1|  hypothetical protein MTR_5g069570                  243   2e-69    
ref|XP_011072457.1|  PREDICTED: uncharacterized protein LOC105157708    243   3e-69    
gb|ABK28164.1|  unknown                                                 242   3e-69    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178505.1|  uncharacterized protein                               242   3e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380035.1|  PREDICTED: uncharacterized protein LOC103443030    241   5e-69    
ref|XP_008229762.1|  PREDICTED: uncharacterized protein LOC103329112    241   6e-69    
gb|KFK31798.1|  hypothetical protein AALP_AA6G160300                    241   7e-69    
gb|KDO59224.1|  hypothetical protein CISIN_1g036500mg                   241   8e-69    
ref|XP_007217278.1|  hypothetical protein PRUPE_ppa017616mg             241   8e-69    
ref|XP_008353192.1|  PREDICTED: uncharacterized protein LOC103416744    241   9e-69    
emb|CDO97954.1|  unnamed protein product                                241   1e-68    
ref|XP_010514327.1|  PREDICTED: uncharacterized protein LOC104790300    239   3e-68    
ref|XP_010488665.1|  PREDICTED: uncharacterized protein LOC104766470    239   3e-68    
ref|XP_010532946.1|  PREDICTED: uncharacterized protein LOC104808831    239   4e-68    
ref|XP_007142451.1|  hypothetical protein PHAVU_008G281700g             239   4e-68    
ref|XP_007142239.1|  hypothetical protein PHAVU_008G264000g             239   5e-68    
ref|XP_010107360.1|  hypothetical protein L484_006875                   237   1e-67    
gb|EYU21422.1|  hypothetical protein MIMGU_mgv1a022950mg                238   2e-67    
ref|XP_010466979.1|  PREDICTED: uncharacterized protein LOC104747105    237   2e-67    
ref|XP_003518296.1|  PREDICTED: uncharacterized protein LOC100796483    237   3e-67    
ref|XP_003544282.1|  PREDICTED: uncharacterized protein LOC100810973    236   4e-67    
ref|XP_006299727.1|  hypothetical protein CARUB_v10015920mg             236   4e-67    
ref|XP_002307050.1|  hypothetical protein POPTR_0005s06920g             236   5e-67    Populus trichocarpa [western balsam poplar]
ref|XP_004490568.1|  PREDICTED: uncharacterized protein LOC101492045    236   6e-67    
ref|XP_008353616.1|  PREDICTED: uncharacterized protein LOC103417205    236   7e-67    
gb|KDP32618.1|  hypothetical protein JCGZ_13168                         236   7e-67    
ref|XP_011031123.1|  PREDICTED: uncharacterized protein LOC105130358    236   9e-67    
ref|XP_008342273.1|  PREDICTED: uncharacterized protein LOC103405081    235   1e-66    
ref|XP_004252365.1|  PREDICTED: uncharacterized protein LOC101249896    235   1e-66    
ref|XP_010542041.1|  PREDICTED: uncharacterized protein LOC104815373    234   2e-66    
ref|XP_010103965.1|  hypothetical protein L484_020218                   252   2e-66    
ref|XP_007146005.1|  hypothetical protein PHAVU_006G004800g             234   2e-66    
ref|XP_006366122.1|  PREDICTED: uncharacterized protein LOC102584925    234   2e-66    
gb|AET00846.2|  kinesin heavy chain, putative                           252   3e-66    
ref|XP_003617887.1|  Kinesin-4                                          252   3e-66    
ref|XP_010038753.1|  PREDICTED: uncharacterized protein LOC104427347    234   4e-66    
ref|XP_011039823.1|  PREDICTED: uncharacterized protein LOC105136253    234   4e-66    
gb|EYU45840.1|  hypothetical protein MIMGU_mgv1a019714mg                234   5e-66    
ref|XP_009592922.1|  PREDICTED: uncharacterized protein LOC104089679    233   6e-66    
ref|XP_011016815.1|  PREDICTED: uncharacterized protein LOC105120349    233   7e-66    
ref|XP_002266988.1|  PREDICTED: uncharacterized protein LOC100249414    233   7e-66    Vitis vinifera
ref|XP_009778863.1|  PREDICTED: uncharacterized protein LOC104228156    233   8e-66    
ref|XP_006469407.1|  PREDICTED: uncharacterized protein LOC102629245    233   1e-65    
ref|XP_002300574.2|  hypothetical protein POPTR_0001s47170g             232   1e-65    Populus trichocarpa [western balsam poplar]
ref|XP_007049429.1|  Uncharacterized protein TCM_002465                 232   1e-65    
ref|XP_011080356.1|  PREDICTED: uncharacterized protein LOC105163627    232   2e-65    
ref|XP_006447854.1|  hypothetical protein CICLE_v10017488mg             232   2e-65    
gb|KHN23821.1|  hypothetical protein glysoja_028114                     231   3e-65    
ref|XP_009777340.1|  PREDICTED: uncharacterized protein LOC104226933    229   1e-64    
emb|CBI28480.3|  unnamed protein product                                228   1e-64    
ref|XP_002532169.1|  conserved hypothetical protein                     229   2e-64    Ricinus communis
ref|XP_004305864.1|  PREDICTED: uncharacterized protein LOC101301230    229   2e-64    
ref|XP_008444827.1|  PREDICTED: uncharacterized protein LOC103488057    229   3e-64    
ref|XP_004502142.1|  PREDICTED: uncharacterized protein LOC101513281    229   3e-64    
ref|XP_003556772.1|  PREDICTED: uncharacterized protein LOC100806502    227   1e-63    
ref|XP_009622577.1|  PREDICTED: uncharacterized protein LOC104113961    226   3e-63    
ref|XP_001781081.1|  predicted protein                                  223   3e-63    
ref|XP_006857698.1|  hypothetical protein AMTR_s00061p00168530          223   1e-62    
ref|XP_002524594.1|  conserved hypothetical protein                     224   2e-62    Ricinus communis
ref|XP_006343140.1|  PREDICTED: uncharacterized protein LOC102583919    223   2e-62    
ref|XP_004235628.1|  PREDICTED: uncharacterized protein LOC101250288    223   3e-62    
ref|XP_004135720.1|  PREDICTED: uncharacterized protein LOC101212848    223   4e-62    
ref|XP_009392096.1|  PREDICTED: uncharacterized protein LOC103978120    221   1e-61    
ref|XP_006407245.1|  hypothetical protein EUTSA_v10022027mg             219   3e-61    
ref|XP_011022881.1|  PREDICTED: uncharacterized protein LOC105124530    220   3e-61    
ref|XP_002310533.1|  hypothetical protein POPTR_0007s04630g             220   4e-61    Populus trichocarpa [western balsam poplar]
ref|NP_199638.1|  uncharacterized protein                               219   7e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676107.1|  PREDICTED: uncharacterized protein LOC104892001    219   9e-61    
ref|XP_006281899.1|  hypothetical protein CARUB_v10028103mg             218   2e-60    
ref|XP_010552345.1|  PREDICTED: uncharacterized protein LOC104822...    216   2e-60    
emb|CDY48744.1|  BnaA02g30050D                                          218   2e-60    
ref|XP_010484925.1|  PREDICTED: uncharacterized protein LOC104763219    218   3e-60    
emb|CDX86317.1|  BnaA06g30340D                                          217   5e-60    
ref|XP_002865625.1|  hypothetical protein ARALYDRAFT_917720             217   5e-60    
gb|KHN46178.1|  hypothetical protein glysoja_022820                     213   1e-59    
ref|XP_010495442.1|  PREDICTED: uncharacterized protein LOC104772538    216   2e-59    
gb|EEE65995.1|  hypothetical protein OsJ_21934                          222   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006395202.1|  hypothetical protein EUTSA_v10005686mg             216   2e-59    
ref|XP_002884958.1|  hypothetical protein ARALYDRAFT_478708             214   3e-59    
gb|KFK31309.1|  hypothetical protein AALP_AA6G096000                    215   4e-59    
gb|KHN43917.1|  hypothetical protein glysoja_025956                     212   4e-59    
ref|XP_010465151.1|  PREDICTED: uncharacterized protein LOC104745569    213   5e-59    
ref|XP_010445941.1|  PREDICTED: uncharacterized protein LOC104728686    214   7e-59    
ref|XP_003601505.1|  hypothetical protein MTR_3g082430                  213   1e-58    
ref|XP_006299636.1|  hypothetical protein CARUB_v10015817mg             211   2e-58    
emb|CDY05690.1|  BnaC02g38470D                                          211   3e-58    
ref|NP_683561.1|  uncharacterized protein                               211   4e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500251.1|  PREDICTED: uncharacterized protein LOC104777658    208   2e-57    
ref|XP_009151627.1|  PREDICTED: uncharacterized protein LOC103874...    209   4e-57    
ref|XP_009151628.1|  PREDICTED: uncharacterized protein LOC103874...    209   4e-57    
ref|XP_009129718.1|  PREDICTED: uncharacterized protein LOC103854529    208   6e-57    
ref|XP_010487075.1|  PREDICTED: uncharacterized protein LOC104765...    207   7e-57    
ref|XP_009387555.1|  PREDICTED: uncharacterized protein LOC103974443    207   7e-57    
ref|XP_010487076.1|  PREDICTED: uncharacterized protein LOC104765...    206   1e-56    
gb|EPS70399.1|  hypothetical protein M569_04363                         204   4e-56    
ref|XP_009135291.1|  PREDICTED: uncharacterized protein LOC103859505    205   5e-56    
gb|KHN09942.1|  hypothetical protein glysoja_043621                     203   7e-56    
ref|XP_010552346.1|  PREDICTED: uncharacterized protein LOC104822...    202   1e-55    
emb|CDY66553.1|  BnaCnng51410D                                          203   1e-55    
emb|CDX82547.1|  BnaA03g32740D                                          202   5e-55    
gb|KDP22998.1|  hypothetical protein JCGZ_01720                         205   2e-52    
ref|XP_010689671.1|  PREDICTED: uncharacterized protein LOC104903342    193   9e-52    
ref|XP_005650126.1|  tetraspanning membrane protein                     191   1e-51    
ref|XP_002989475.1|  hypothetical protein SELMODRAFT_129941             186   6e-51    
gb|EMT16711.1|  hypothetical protein F775_12417                         190   1e-50    
dbj|BAK07193.1|  predicted protein                                      190   1e-50    
gb|EMT05998.1|  hypothetical protein F775_18938                         186   2e-50    
gb|EMS50536.1|  hypothetical protein TRIUR3_22811                       189   4e-50    
ref|XP_010551974.1|  PREDICTED: uncharacterized protein LOC104822...    190   4e-50    
gb|ACF81406.1|  unknown                                                 186   2e-49    Zea mays [maize]
ref|NP_001131873.1|  hypothetical protein                               186   4e-49    Zea mays [maize]
gb|EAY84891.1|  hypothetical protein OsI_06256                          185   1e-48    Oryza sativa Indica Group [Indian rice]
ref|NP_001046211.1|  Os02g0198800                                       184   2e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002964671.1|  hypothetical protein SELMODRAFT_81074              177   7e-48    
gb|KDO82205.1|  hypothetical protein CISIN_1g020915mg                   182   9e-48    
emb|CDY19961.1|  BnaA09g02900D                                          181   2e-47    
ref|XP_006438240.1|  hypothetical protein CICLE_v10033962mg             181   3e-47    
ref|XP_004951552.1|  PREDICTED: uncharacterized protein LOC101772581    180   4e-47    
ref|XP_004515862.1|  PREDICTED: uncharacterized protein LOC101502004    179   6e-47    
ref|XP_007224142.1|  hypothetical protein PRUPE_ppa016161mg             179   7e-47    
ref|XP_002951376.1|  hypothetical protein VOLCADRAFT_61248              177   1e-46    
ref|XP_002451729.1|  hypothetical protein SORBIDRAFT_04g006760          179   2e-46    Sorghum bicolor [broomcorn]
ref|XP_008340356.1|  PREDICTED: uncharacterized protein LOC103403320    177   3e-46    
ref|XP_006848668.1|  hypothetical protein AMTR_s00305p00015080          177   3e-46    
ref|XP_009359202.1|  PREDICTED: uncharacterized protein LOC103949811    177   5e-46    
emb|CDY00069.1|  BnaC09g02320D                                          176   1e-45    
ref|XP_009111832.1|  PREDICTED: uncharacterized protein LOC103837244    176   1e-45    
ref|XP_002977922.1|  hypothetical protein SELMODRAFT_107811             175   2e-45    
ref|XP_008221896.1|  PREDICTED: uncharacterized protein LOC103321834    184   2e-45    
gb|KDP31019.1|  hypothetical protein JCGZ_11395                         176   2e-45    
ref|XP_003571347.2|  PREDICTED: uncharacterized protein LOC100832869    176   2e-45    
ref|XP_003525519.1|  PREDICTED: uncharacterized protein LOC100779755    176   3e-45    
emb|CDX85324.1|  BnaC07g26350D                                          174   3e-45    
gb|KEH31766.1|  protein phosphatase 2c, putative                        175   3e-45    
ref|XP_007155488.1|  hypothetical protein PHAVU_003G205700g             175   4e-45    
ref|XP_010929912.1|  PREDICTED: uncharacterized protein LOC105051269    174   6e-45    
ref|XP_010039142.1|  PREDICTED: uncharacterized protein LOC104427810    174   7e-45    
ref|XP_002986948.1|  hypothetical protein SELMODRAFT_158336             173   8e-45    
ref|XP_008793736.1|  PREDICTED: uncharacterized protein LOC103709963    174   1e-44    
ref|XP_007199466.1|  hypothetical protein PRUPE_ppa027061mg             166   1e-44    
ref|XP_006484324.1|  PREDICTED: uncharacterized protein LOC102618638    181   1e-44    
emb|CBI14939.3|  unnamed protein product                                172   3e-44    
ref|XP_007044827.1|  Uncharacterized protein TCM_010569                 171   7e-44    
ref|XP_008239343.1|  PREDICTED: uncharacterized protein LOC103337946    171   1e-43    
ref|XP_007208899.1|  hypothetical protein PRUPE_ppa026898mg             171   1e-43    
ref|XP_006395009.1|  hypothetical protein EUTSA_v10004720mg             170   1e-43    
ref|XP_010912954.1|  PREDICTED: uncharacterized protein LOC105038765    170   1e-43    
ref|XP_001772274.1|  predicted protein                                  169   2e-43    
ref|XP_002511308.1|  conserved hypothetical protein                     170   2e-43    
ref|XP_006344483.1|  PREDICTED: uncharacterized protein LOC102586788    170   3e-43    
ref|XP_004159590.1|  PREDICTED: uncharacterized protein LOC101232142    170   3e-43    
ref|XP_010102967.1|  hypothetical protein L484_018986                   170   3e-43    
ref|XP_008811744.1|  PREDICTED: uncharacterized protein LOC103722827    169   5e-43    
ref|XP_009628338.1|  PREDICTED: uncharacterized protein LOC104118721    169   5e-43    
ref|XP_002872306.1|  hypothetical protein ARALYDRAFT_489643             168   7e-43    
gb|AFW70716.1|  hypothetical protein ZEAMMB73_330752                    173   1e-42    
gb|KHN10445.1|  hypothetical protein glysoja_030881                     169   1e-42    
ref|XP_003549823.1|  PREDICTED: uncharacterized protein LOC100802...    168   1e-42    
ref|XP_010932250.1|  PREDICTED: uncharacterized protein LOC105052962    168   1e-42    
ref|XP_004236272.1|  PREDICTED: uncharacterized protein LOC101245536    168   1e-42    
ref|XP_008372607.1|  PREDICTED: uncharacterized protein LOC103435955    171   2e-42    
ref|XP_009798084.1|  PREDICTED: uncharacterized protein LOC104244370    169   2e-42    
gb|AFK39419.1|  unknown                                                 167   2e-42    
ref|XP_010455167.1|  PREDICTED: uncharacterized protein LOC104736806    166   2e-42    
ref|XP_011046236.1|  PREDICTED: uncharacterized protein LOC105140891    167   3e-42    
ref|XP_003601156.1|  hypothetical protein MTR_3g076610                  167   3e-42    
ref|NP_198167.1|  uncharacterized protein                               166   3e-42    
ref|XP_007037767.1|  Uncharacterized protein TCM_014486                 167   3e-42    
ref|XP_011042397.1|  PREDICTED: uncharacterized protein LOC105138...    166   5e-42    
ref|XP_011071966.1|  PREDICTED: uncharacterized protein LOC105157288    166   5e-42    
ref|XP_010546610.1|  PREDICTED: uncharacterized protein LOC104818644    165   7e-42    
ref|XP_010248684.1|  PREDICTED: uncharacterized protein LOC104591523    173   9e-42    
ref|XP_006288375.1|  hypothetical protein CARUB_v10001626mg             164   1e-41    
ref|XP_002530041.1|  protein phosphatase 2c, putative                   172   1e-41    
ref|XP_010494083.1|  PREDICTED: uncharacterized protein LOC104771271    164   1e-41    
ref|XP_010421680.1|  PREDICTED: uncharacterized protein LOC104707100    164   1e-41    
ref|XP_008390094.1|  PREDICTED: uncharacterized protein LOC103452380    172   1e-41    
ref|XP_010256015.1|  PREDICTED: uncharacterized protein LOC104596517    164   2e-41    
ref|XP_008351057.1|  PREDICTED: probable protein phosphatase 2C 14      172   2e-41    
ref|XP_002315660.1|  hypothetical protein POPTR_0010s05770g             164   2e-41    
ref|XP_004970997.1|  PREDICTED: uncharacterized protein LOC101768022    164   2e-41    
gb|ACU18448.1|  unknown                                                 164   2e-41    
ref|XP_011042396.1|  PREDICTED: uncharacterized protein LOC105138...    164   2e-41    
ref|XP_010663087.1|  PREDICTED: uncharacterized protein LOC100243254    164   3e-41    
ref|XP_006645201.1|  PREDICTED: uncharacterized protein LOC102718506    164   4e-41    
gb|ABR17303.1|  unknown                                                 162   4e-41    
ref|XP_003521743.1|  PREDICTED: uncharacterized protein LOC100791607    163   4e-41    
ref|NP_001045150.1|  Os01g0909400                                       164   4e-41    
ref|XP_004301059.1|  PREDICTED: uncharacterized protein LOC101305476    171   4e-41    
ref|XP_007138005.1|  hypothetical protein PHAVU_009G173000g             164   5e-41    
ref|XP_002318087.2|  hypothetical protein POPTR_0012s09090g             164   6e-41    
ref|XP_002322201.2|  hypothetical protein POPTR_0015s09600g             166   6e-41    
ref|XP_010682310.1|  PREDICTED: uncharacterized protein LOC104897184    171   7e-41    
ref|XP_004143059.1|  PREDICTED: uncharacterized protein LOC101209288    170   7e-41    
gb|EEC72003.1|  hypothetical protein OsI_04864                          163   9e-41    
emb|CDP12711.1|  unnamed protein product                                163   9e-41    
ref|XP_002458958.1|  hypothetical protein SORBIDRAFT_03g043380          163   9e-41    
ref|XP_008444373.1|  PREDICTED: uncharacterized protein LOC103487722    170   1e-40    
ref|XP_004301015.1|  PREDICTED: uncharacterized protein LOC101312836    162   2e-40    
ref|XP_009588422.1|  PREDICTED: uncharacterized protein LOC104085995    161   2e-40    
ref|XP_010277409.1|  PREDICTED: uncharacterized protein LOC104611862    161   3e-40    
ref|XP_001770719.1|  predicted protein                                  160   3e-40    
ref|XP_009805050.1|  PREDICTED: uncharacterized protein LOC104250176    160   3e-40    
ref|XP_008807465.1|  PREDICTED: uncharacterized protein LOC103719825    161   4e-40    
ref|NP_001132137.1|  hypothetical protein                               160   4e-40    
ref|XP_008218232.1|  PREDICTED: uncharacterized protein LOC103318613    160   4e-40    
ref|XP_010251033.1|  PREDICTED: uncharacterized protein LOC104593063    161   5e-40    
ref|XP_007207341.1|  hypothetical protein PRUPE_ppa009272mg             160   5e-40    
ref|XP_009362927.1|  PREDICTED: uncharacterized protein LOC103952942    160   7e-40    
gb|AAM65821.1|  unknown                                                 159   9e-40    
gb|EYU30508.1|  hypothetical protein MIMGU_mgv1a010362mg                160   9e-40    
ref|XP_002282388.2|  PREDICTED: probable protein phosphatase 2C 14      167   9e-40    
ref|XP_009151242.1|  PREDICTED: uncharacterized protein LOC103874571    159   1e-39    
gb|EPS71408.1|  hypothetical protein M569_03349                         159   1e-39    
ref|XP_009364535.1|  PREDICTED: uncharacterized protein LOC103954432    159   1e-39    
ref|XP_008360800.1|  PREDICTED: uncharacterized protein LOC103424495    160   1e-39    
ref|XP_006433029.1|  hypothetical protein CICLE_v10001999mg             159   1e-39    
ref|XP_006439940.1|  hypothetical protein CICLE_v10023489mg             159   2e-39    
ref|NP_566240.1|  uncharacterized protein                               158   3e-39    
emb|CDY52485.1|  BnaC07g49460D                                          157   3e-39    
ref|XP_002884475.1|  hypothetical protein ARALYDRAFT_477757             157   3e-39    
dbj|BAK05996.1|  predicted protein                                      158   3e-39    
ref|XP_001691687.1|  tetraspanning membrane protein, SFT2-like pr...    155   4e-39    
ref|XP_006581901.1|  PREDICTED: uncharacterized protein LOC100816323    158   6e-39    
ref|XP_003632331.1|  PREDICTED: uncharacterized protein LOC100853449    157   6e-39    
ref|XP_010419519.1|  PREDICTED: uncharacterized protein LOC104705248    156   8e-39    
gb|KHN30960.1|  hypothetical protein glysoja_017497                     157   8e-39    
ref|XP_003522405.1|  PREDICTED: uncharacterized protein LOC100813254    157   8e-39    
ref|XP_007147151.1|  hypothetical protein PHAVU_006G100000g             156   1e-38    
ref|XP_008802684.1|  PREDICTED: uncharacterized protein LOC103716457    156   1e-38    
ref|XP_004501866.1|  PREDICTED: uncharacterized protein LOC101507...    157   1e-38    
ref|XP_010910592.1|  PREDICTED: uncharacterized protein LOC105036529    156   1e-38    
ref|XP_003554710.1|  PREDICTED: uncharacterized protein LOC100806479    156   1e-38    
ref|XP_006408140.1|  hypothetical protein EUTSA_v10021255mg             155   1e-38    
ref|XP_010090262.1|  hypothetical protein L484_006168                   155   2e-38    
ref|XP_008388659.1|  PREDICTED: uncharacterized protein LOC103451015    155   2e-38    
ref|XP_007030623.1|  Uncharacterized protein TCM_026394                 155   3e-38    
ref|XP_006298244.1|  hypothetical protein CARUB_v10014305mg             155   3e-38    
ref|XP_008345708.1|  PREDICTED: uncharacterized protein LOC103408652    155   3e-38    
ref|XP_011040513.1|  PREDICTED: uncharacterized protein LOC105136753    155   4e-38    
ref|XP_010463974.1|  PREDICTED: uncharacterized protein LOC104744596    154   5e-38    
gb|KDP21447.1|  hypothetical protein JCGZ_21918                         154   6e-38    
ref|XP_009111920.1|  PREDICTED: uncharacterized protein LOC103837313    154   8e-38    
ref|XP_006347793.1|  PREDICTED: uncharacterized protein LOC102597851    154   8e-38    
ref|XP_004230118.1|  PREDICTED: uncharacterized protein LOC101268432    154   8e-38    
gb|KDP23639.1|  hypothetical protein JCGZ_23472                         154   9e-38    
ref|XP_010550936.1|  PREDICTED: uncharacterized protein LOC104821683    154   9e-38    
ref|XP_011005698.1|  PREDICTED: uncharacterized protein LOC105111908    154   1e-37    
ref|XP_006838233.1|  hypothetical protein AMTR_s00103p00021650          153   1e-37    
ref|XP_009402136.1|  PREDICTED: uncharacterized protein LOC103986002    153   1e-37    
ref|XP_010674843.1|  PREDICTED: uncharacterized protein LOC104890923    153   2e-37    
ref|XP_004302026.1|  PREDICTED: uncharacterized protein LOC101296394    153   2e-37    
emb|CDY00013.1|  BnaC09g02880D                                          152   2e-37    
ref|XP_006382769.1|  hypothetical protein POPTR_0005s05250g             152   2e-37    
ref|XP_010923391.1|  PREDICTED: uncharacterized protein LOC105046501    152   2e-37    
gb|EMT06649.1|  hypothetical protein F775_13550                         152   3e-37    
ref|XP_011032437.1|  PREDICTED: uncharacterized protein LOC105131255    152   3e-37    
ref|XP_010485871.1|  PREDICTED: uncharacterized protein LOC104764117    152   4e-37    
ref|XP_010649892.1|  PREDICTED: uncharacterized protein LOC100246068    152   4e-37    
ref|XP_002319062.1|  hypothetical protein POPTR_0013s03440g             152   5e-37    
gb|KDP26687.1|  hypothetical protein JCGZ_17845                         152   5e-37    
emb|CDM85597.1|  unnamed protein product                                152   5e-37    
ref|XP_002520723.1|  conserved hypothetical protein                     152   5e-37    
ref|XP_009333930.1|  PREDICTED: uncharacterized protein LOC103926780    153   5e-37    
emb|CAN68226.1|  hypothetical protein VITISV_040533                     151   6e-37    
emb|CAN61445.1|  hypothetical protein VITISV_024138                     154   7e-37    
ref|XP_008455804.1|  PREDICTED: uncharacterized protein LOC103495897    151   9e-37    
ref|XP_004139223.1|  PREDICTED: uncharacterized protein LOC101220430    151   1e-36    
ref|XP_009385461.1|  PREDICTED: uncharacterized protein LOC103972819    150   1e-36    
ref|XP_003564890.1|  PREDICTED: uncharacterized protein LOC100831420    151   1e-36    
emb|CDP21506.1|  unnamed protein product                                150   1e-36    
gb|EAZ04414.1|  hypothetical protein OsI_26558                          150   2e-36    
ref|XP_008804337.1|  PREDICTED: uncharacterized protein LOC103717650    150   2e-36    
emb|CDY50761.1|  BnaAnng10680D                                          150   2e-36    
gb|KGN60826.1|  hypothetical protein Csa_2G011590                       151   2e-36    
ref|XP_008380651.1|  PREDICTED: uncharacterized protein LOC103443554    151   2e-36    
ref|XP_002512236.1|  conserved hypothetical protein                     149   4e-36    
gb|EMS45281.1|  hypothetical protein TRIUR3_16464                       149   4e-36    
emb|CDY30020.1|  BnaC01g39880D                                          149   4e-36    
ref|XP_004981359.1|  PREDICTED: uncharacterized protein LOC101774579    149   4e-36    
ref|XP_009124203.1|  PREDICTED: uncharacterized protein LOC103849150    149   4e-36    
dbj|BAJ95878.1|  predicted protein                                      149   4e-36    
emb|CDY21108.1|  BnaA01g33390D                                          148   5e-36    
ref|XP_010041438.1|  PREDICTED: uncharacterized protein LOC104430401    149   5e-36    
ref|XP_004247361.1|  PREDICTED: uncharacterized protein LOC101254730    149   6e-36    
emb|CAN64151.1|  hypothetical protein VITISV_041021                     149   7e-36    
ref|XP_002277386.1|  PREDICTED: uncharacterized protein LOC100267457    148   8e-36    
ref|XP_010100416.1|  hypothetical protein L484_027727                   148   9e-36    
ref|XP_003536115.1|  PREDICTED: uncharacterized protein LOC100778089    148   1e-35    
emb|CDO99050.1|  unnamed protein product                                148   1e-35    
ref|XP_011090719.1|  PREDICTED: uncharacterized protein LOC105171...    147   2e-35    
ref|XP_003564146.1|  PREDICTED: uncharacterized protein LOC100837549    147   2e-35    
ref|NP_001060057.1|  Os07g0572300                                       147   2e-35    
ref|XP_002466252.1|  hypothetical protein SORBIDRAFT_01g004400          147   2e-35    
ref|XP_007144817.1|  hypothetical protein PHAVU_007G186400g             147   2e-35    
ref|XP_009379950.1|  PREDICTED: uncharacterized protein LOC103968448    147   2e-35    
ref|XP_010090415.1|  hypothetical protein L484_025081                   147   2e-35    
ref|XP_003536564.1|  PREDICTED: uncharacterized protein LOC100796685    147   3e-35    
ref|XP_006360806.1|  PREDICTED: uncharacterized protein LOC102583145    147   3e-35    
gb|AFW67285.1|  hypothetical protein ZEAMMB73_929047                    146   3e-35    
ref|XP_009124977.1|  PREDICTED: uncharacterized protein LOC103850026    146   3e-35    
ref|XP_011090718.1|  PREDICTED: uncharacterized protein LOC105171...    147   4e-35    
ref|XP_005850358.1|  hypothetical protein CHLNCDRAFT_142195             144   4e-35    
gb|ACU19762.1|  unknown                                                 145   5e-35    
gb|KHN03804.1|  hypothetical protein glysoja_011033                     146   5e-35    
ref|XP_006657868.1|  PREDICTED: uncharacterized protein LOC102710887    145   5e-35    
ref|XP_006851632.1|  hypothetical protein AMTR_s00040p00202330          145   6e-35    
ref|XP_006650760.1|  PREDICTED: uncharacterized protein LOC102720690    145   6e-35    
ref|NP_001051637.1|  Os03g0806700                                       145   7e-35    
ref|XP_003626413.1|  hypothetical protein MTR_7g114790                  145   7e-35    
ref|XP_006444048.1|  hypothetical protein CICLE_v10021341mg             145   8e-35    
ref|XP_004495197.1|  PREDICTED: uncharacterized protein LOC101503605    145   9e-35    
ref|XP_006600794.1|  PREDICTED: uncharacterized protein LOC100802...    144   9e-35    
gb|EMT25403.1|  hypothetical protein F775_31443                         145   1e-34    
ref|XP_002987520.1|  hypothetical protein SELMODRAFT_126257             145   1e-34    
ref|XP_002987739.1|  hypothetical protein SELMODRAFT_126470             145   1e-34    
gb|EYU22191.1|  hypothetical protein MIMGU_mgv1a010634mg                144   2e-34    
gb|ACU20214.1|  unknown                                                 144   2e-34    
ref|XP_009407751.1|  PREDICTED: uncharacterized protein LOC103990370    144   2e-34    
ref|XP_011026156.1|  PREDICTED: uncharacterized protein LOC105126841    144   2e-34    
emb|CDY59819.1|  BnaA09g51660D                                          147   2e-34    
ref|XP_008466890.1|  PREDICTED: uncharacterized protein LOC103504220    138   3e-34    
ref|XP_009408456.1|  PREDICTED: uncharacterized protein LOC103990890    144   3e-34    
gb|AFK40643.1|  unknown                                                 144   3e-34    
ref|XP_007162443.1|  hypothetical protein PHAVU_001G152600g             144   3e-34    
ref|XP_006604441.1|  PREDICTED: uncharacterized protein LOC100786850    144   3e-34    
gb|AES61262.2|  plant/T24G3-80 protein                                  144   4e-34    
ref|XP_007050577.1|  Uncharacterized protein isoform 1                  144   4e-34    
ref|XP_011071576.1|  PREDICTED: uncharacterized protein LOC105156990    143   5e-34    
ref|XP_007144641.1|  hypothetical protein PHAVU_007G172700g             143   5e-34    
gb|KFM28186.1|  hypothetical protein F751_6953                          142   6e-34    
ref|XP_008235299.1|  PREDICTED: uncharacterized protein LOC103334...    143   6e-34    
ref|XP_002300838.1|  hypothetical protein POPTR_0002s05250g             142   1e-33    
gb|EEE56506.1|  hypothetical protein OsJ_05776                          143   1e-33    
gb|EEE55858.1|  hypothetical protein OsJ_04487                          142   2e-33    
ref|NP_001143196.1|  uncharacterized protein LOC100275698               141   2e-33    
ref|XP_009792059.1|  PREDICTED: uncharacterized protein LOC104239187    141   2e-33    
ref|XP_007199427.1|  hypothetical protein PRUPE_ppa026525mg             141   3e-33    
ref|XP_008651185.1|  PREDICTED: uncharacterized protein LOC100275...    140   4e-33    
gb|KHN10674.1|  hypothetical protein glysoja_019105                     140   4e-33    
ref|XP_003521248.2|  PREDICTED: uncharacterized protein LOC100799355    140   4e-33    
ref|XP_003518919.1|  PREDICTED: uncharacterized protein LOC100793503    140   5e-33    
ref|XP_004494682.1|  PREDICTED: uncharacterized protein LOC101496846    140   6e-33    
emb|CDY72112.1|  BnaC05g52260D                                          139   6e-33    
ref|NP_001167908.1|  hypothetical protein                               140   6e-33    
ref|XP_002307590.1|  hypothetical protein POPTR_0005s23240g             139   1e-32    
ref|XP_009601952.1|  PREDICTED: uncharacterized protein LOC104097132    139   1e-32    
ref|XP_011092005.1|  PREDICTED: uncharacterized protein LOC105172319    139   1e-32    
ref|XP_011032694.1|  PREDICTED: uncharacterized protein LOC105131425    138   2e-32    
gb|KEH23778.1|  plant/T24G3-80 protein                                  139   2e-32    
ref|XP_003556459.1|  PREDICTED: uncharacterized protein LOC100802...    138   2e-32    
ref|XP_004495789.1|  PREDICTED: uncharacterized protein LOC101494890    137   5e-32    
ref|XP_004290606.1|  PREDICTED: uncharacterized protein LOC101299...    137   8e-32    
ref|XP_003562863.1|  PREDICTED: uncharacterized protein LOC100826732    136   9e-32    
ref|XP_003591011.1|  hypothetical protein MTR_1g081260                  137   9e-32    



>ref|XP_004244024.1| PREDICTED: protein transport protein SFT2 [Solanum lycopersicum]
Length=233

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQKWFS  S G D R  +QQ  ++S+PSLLADWNSYAS K+SD   +S++ I +FDLE+A
Sbjct  1     MQKWFSAGSGGGDDRYVEQQQASSSTPSLLADWNSYASAKSSDES-SSTAFIGSFDLESA  59

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVRDIPG+LQSATSNIPSGKALMYFGLF+A+GV FIFMAF LF
Sbjct  60    VRSANDTVSGTFNVVSKGVRDIPGNLQSATSNIPSGKALMYFGLFMATGVFFIFMAFTLF  119

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFTLGC FIIGSFFAL+G K QFAHM S ERLPFTLGF+GSMIGTLY
Sbjct  120   LPVIVLVPQKFAICFTLGCSFIIGSFFALKGPKTQFAHMFSMERLPFTLGFMGSMIGTLY  179

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSVLFSVIQV+AL YYA+SYFPGGSAGLKFLSSSM+SSVLKCFGR
Sbjct  180   VSMALHSYILSVLFSVIQVLALAYYAISYFPGGSAGLKFLSSSMISSVLKCFGR  233



>ref|XP_006346109.1| PREDICTED: protein transport protein SFT2-like [Solanum tuberosum]
Length=233

 Score =   345 bits (884),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 191/234 (82%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQKWFS  S G D R  +QQ  ++S+PSLLADWNSYAS K+S+   +S++ I +FDLE+A
Sbjct  1     MQKWFSAGSGGGDDRYVEQQQASSSTPSLLADWNSYASAKSSEES-SSTAFIGSFDLESA  59

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVRDIPG+LQSATSNIPSGKALMYFGLF+A+GV FIFMAF LF
Sbjct  60    VRSANDTVSGTFNVVSKGVRDIPGNLQSATSNIPSGKALMYFGLFMATGVFFIFMAFTLF  119

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFTLGC FIIGSFFAL+G K QFAHM S ERLPFTLGF+GSMIGTLY
Sbjct  120   LPVIVLVPQKFAICFTLGCSFIIGSFFALKGPKTQFAHMFSMERLPFTLGFMGSMIGTLY  179

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSVLFSVIQV+AL YYA+SYFPGGSAGLKFLSSSM+SSVLKCFGR
Sbjct  180   VSMALHSYILSVLFSVIQVLALAYYAISYFPGGSAGLKFLSSSMISSVLKCFGR  233



>ref|XP_009615072.1| PREDICTED: protein transport protein SFT2-like [Nicotiana tomentosiformis]
Length=233

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 208/234 (89%), Gaps = 1/234 (0%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQKWFS    G +    +QQ T++S+PSLLADWNSYAS K+S+   AS++ I +FDLE+A
Sbjct  1     MQKWFSAGGGGGEDPYIEQQQTSSSTPSLLADWNSYASAKSSEES-ASTAFIGSFDLESA  59

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVRDIPG+ QSATSNIPSGKALMYFGLF+A+GV FIFMAF LF
Sbjct  60    VRSANDTVSGTFNVVSKGVRDIPGNFQSATSNIPSGKALMYFGLFMATGVFFIFMAFTLF  119

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICF LGC FIIGSFFALRG KNQFAHM S ERLPFTLGF+GSM+GTLY
Sbjct  120   LPVIVLVPQKFAICFALGCSFIIGSFFALRGPKNQFAHMFSMERLPFTLGFIGSMMGTLY  179

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSVLFSV+QV+AL YYA+SYFPGGSAGLKFLSSSM+SSV+KCFGR
Sbjct  180   VSMALHSYILSVLFSVLQVLALAYYAISYFPGGSAGLKFLSSSMISSVMKCFGR  233



>ref|XP_009771413.1| PREDICTED: protein transport protein SFT2-like [Nicotiana sylvestris]
Length=233

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 189/234 (81%), Positives = 209/234 (89%), Gaps = 1/234 (0%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQKWFS    G D R  +QQ T++S+PSLLADWNSYAS K+S+   AS++ I +FDLE+A
Sbjct  1     MQKWFSAGGGGGDDRYVEQQQTSSSTPSLLADWNSYASAKSSEES-ASTAFIGSFDLESA  59

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVRDIPG+ QSATSNIPSGKALMYFGLF+A+GV FIFMAF LF
Sbjct  60    VRSANDTVSGTFNVVSKGVRDIPGNFQSATSNIPSGKALMYFGLFMATGVFFIFMAFTLF  119

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICF LGC FIIGSFFALRG KNQFAHM S ERLPFTLGF+GSM+GTLY
Sbjct  120   LPVIVLVPQKFAICFALGCSFIIGSFFALRGPKNQFAHMFSMERLPFTLGFIGSMMGTLY  179

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSVLFSV+QV+AL YYA+SYFPGGSAGLKFLSSSM+SSV+KCFGR
Sbjct  180   VSMALHSYILSVLFSVLQVLALAYYAISYFPGGSAGLKFLSSSMISSVMKCFGR  233



>ref|XP_008355031.1| PREDICTED: protein transport protein SFT2-like [Malus domestica]
 ref|XP_008363362.1| PREDICTED: protein transport protein SFT2-like [Malus domestica]
Length=229

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 189/206 (92%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++++D    SSSL   FDLE+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  27    LLADWNSYAASQSTD---ESSSLGLGFDLESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  83

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKALMYFGLFLA+GV F+F+AF +FLPV+VL+PQKFAICFTLGC FII SFFA
Sbjct  84    ATSNVPSGKALMYFGLFLATGVFFVFIAFTMFLPVMVLMPQKFAICFTLGCAFIIASFFA  143

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSSKERLPFT+GFLG+M+GT+YVSM LHSYILSV FSV+QV+AL YYAVS
Sbjct  144   LKGPKNQLAHMSSKERLPFTVGFLGTMVGTIYVSMVLHSYILSVFFSVLQVLALAYYAVS  203

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++ SSV++CFGR
Sbjct  204   YFPGGSAGMKFLSSALASSVMRCFGR  229



>ref|XP_004294911.1| PREDICTED: protein transport protein SFT2-like [Fragaria vesca 
subsp. vesca]
Length=229

 Score =   335 bits (859),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 203/233 (87%), Gaps = 9/233 (4%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q+WFSG S+G      +  ++      LLADWNSYA++++++    S+SL   FDLE+AV
Sbjct  6     QEWFSGGSSGAGDDSLKPASS------LLADWNSYAASQSAED---SASLGLGFDLESAV  56

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTF+VVSKGVRDIPG+LQSATS++PSGKALMYFGLFLA+GV F+F+AF +FL
Sbjct  57    RSANDTVSGTFSVVSKGVRDIPGNLQSATSSVPSGKALMYFGLFLATGVFFVFIAFTMFL  116

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC FIIGSFFAL+G +NQFAHMSSKERLPFTLGFLGSM+GT+YV
Sbjct  117   PVMVLMPQKFAICFTLGCAFIIGSFFALKGPQNQFAHMSSKERLPFTLGFLGSMVGTIYV  176

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SM LHSYILSV FSV+QV+AL YYAVSYFPGGSAGLKFLSS++ SSV+KCFGR
Sbjct  177   SMVLHSYILSVFFSVLQVLALAYYAVSYFPGGSAGLKFLSSALTSSVMKCFGR  229



>ref|XP_008218785.1| PREDICTED: protein transport protein SFT2 [Prunus mume]
Length=228

 Score =   334 bits (857),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 189/206 (92%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++++D    SSSL   FDLE+AVRSANDTVSGTF+VVSKGVRD+PG+LQS
Sbjct  26    LLADWNSYAASQSTD---ESSSLGLGFDLESAVRSANDTVSGTFSVVSKGVRDLPGNLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS +PSGKALMYFGLFLA+GV F+F+AF +FLPV+VL+PQKFAICFTLGC FII SFFA
Sbjct  83    ATSTVPSGKALMYFGLFLATGVFFVFLAFTMFLPVMVLMPQKFAICFTLGCAFIIASFFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSS+ERLPF+LGFLGSM+GT+YVSM LHSYILSVLFSVIQV+AL YYAVS
Sbjct  143   LKGPKNQLAHMSSRERLPFSLGFLGSMVGTIYVSMVLHSYILSVLFSVIQVLALAYYAVS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SSV++CFGR
Sbjct  203   YFPGGSAGLKFLSSALTSSVMRCFGR  228



>ref|XP_006474815.1| PREDICTED: protein transport protein SFT2-like [Citrus sinensis]
 gb|KDO59216.1| hypothetical protein CISIN_1g026818mg [Citrus sinensis]
Length=232

 Score =   334 bits (857),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 188/206 (91%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T+ +D DG  S L   FD+E+AVRSANDTVSGTFNVVSKGVRD+PG+LQS
Sbjct  30    LLADWNSYAATRDAD-DG--SGLAFGFDIESAVRSANDTVSGTFNVVSKGVRDLPGNLQS  86

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS +PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFA+CFT+GC FIIGSFFA
Sbjct  87    ATSTVPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFALCFTVGCGFIIGSFFA  146

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSSKERLPFTLGF+GSM GT+YVSM LHSYILSVLFSVIQV+AL YYA+S
Sbjct  147   LRGPKNQLAHMSSKERLPFTLGFIGSMAGTIYVSMVLHSYILSVLFSVIQVLALAYYAIS  206

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++ SSV++CFGR
Sbjct  207   YFPGGSAGMKFLSSALTSSVMRCFGR  232



>ref|XP_010103962.1| Protein transport protein SFT2 [Morus notabilis]
 gb|EXB97665.1| Protein transport protein SFT2 [Morus notabilis]
Length=228

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 188/206 (91%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++ + +    +SSL   FDLEAAVRSANDTVSGTF+VVSKGVRDIPG+LQS
Sbjct  27    LLADWNSYAASHSDE----NSSLPLGFDLEAAVRSANDTVSGTFSVVSKGVRDIPGNLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGLFLA+GV F+F+AF +FLPV+V++PQKFAICFTLGC FIIGSFFA
Sbjct  83    ATSSVPSGKALMYFGLFLATGVFFVFLAFTMFLPVMVIMPQKFAICFTLGCGFIIGSFFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSSKERLPFTLGFLGSM+GT+YVSM LHSYILSVLFSVIQV+AL YYA S
Sbjct  143   LKGPKNQLAHMSSKERLPFTLGFLGSMVGTIYVSMVLHSYILSVLFSVIQVLALAYYAFS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ S+VLKCFGR
Sbjct  203   YFPGGSAGLKFLSSTLTSTVLKCFGR  228



>ref|XP_011095587.1| PREDICTED: protein transport protein SFT2-like [Sesamum indicum]
Length=232

 Score =   333 bits (855),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 202/234 (86%), Gaps = 2/234 (1%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG    ++   Q+  ++++SS  LLADWNSYA+ ++S+   + +SL   FD+EAA
Sbjct  1     MQNWFSGGFGDNENSVQRTASSSSSS--LLADWNSYATARSSEESSSGASLGGVFDIEAA  58

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVV+KGV+D+PG+ QSATS+IPSGKALMYFGL L SGV FIF+AF LF
Sbjct  59    VRSANDTVSGTFNVVTKGVKDLPGNFQSATSSIPSGKALMYFGLLLGSGVFFIFIAFTLF  118

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFT+GC FIIGSFFALRG KNQF HM SKERLPFTLGF+GSMIGT+Y
Sbjct  119   LPVIVLVPQKFAICFTVGCAFIIGSFFALRGPKNQFNHMFSKERLPFTLGFIGSMIGTIY  178

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSY+LSVLFSV+QVMAL YYA+SYFPGGSAGLKFLS+S+ SS+LKCFGR
Sbjct  179   VSMVLHSYVLSVLFSVLQVMALAYYAISYFPGGSAGLKFLSASITSSILKCFGR  232



>ref|XP_002532175.1| Protein transport protein SFT2, putative [Ricinus communis]
 gb|EEF30212.1| Protein transport protein SFT2, putative [Ricinus communis]
Length=231

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 185/205 (90%), Gaps = 3/205 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++ +D    SS L   FDLEA VRSAND+VSGTFNVVSKGVRDIPGS QS
Sbjct  29    LLADWNSYAASQDAD---ESSGLGIGFDLEAVVRSANDSVSGTFNVVSKGVRDIPGSFQS  85

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSNIPSGKALMYFGLFLA+GV F+F+AFALFLPVIVL+PQKFAICFTLGC FII SF A
Sbjct  86    ATSNIPSGKALMYFGLFLATGVFFVFIAFALFLPVIVLMPQKFAICFTLGCVFIIASFVA  145

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQFAHM+SKERLPFTLGF+GSM GT+YVSM LHSYILSVLFSVIQV+AL YYA+S
Sbjct  146   LKGPKNQFAHMTSKERLPFTLGFIGSMAGTIYVSMVLHSYILSVLFSVIQVLALAYYAIS  205

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFG  1626
             YFPGGSAG+KFLSSS++SSV +CFG
Sbjct  206   YFPGGSAGMKFLSSSLISSVTRCFG  230



>ref|XP_006452669.1| hypothetical protein CICLE_v10009371mg [Citrus clementina]
 gb|ESR65909.1| hypothetical protein CICLE_v10009371mg [Citrus clementina]
Length=232

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 187/206 (91%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T+  D DG  S L   FD+E+AVRSANDTVSGTFNVVSKGVRD+PG+LQS
Sbjct  30    LLADWNSYAATRDPD-DG--SGLAFGFDIESAVRSANDTVSGTFNVVSKGVRDLPGNLQS  86

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS +PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFA+CFT+GC FIIGSFFA
Sbjct  87    ATSTVPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFALCFTVGCGFIIGSFFA  146

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSSKERLPFTLGF+GSM GT+YVSM LHSYILSVLFSVIQV+AL YYA+S
Sbjct  147   LRGPKNQLAHMSSKERLPFTLGFIGSMAGTIYVSMVLHSYILSVLFSVIQVLALAYYAIS  206

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++ SSV++CFGR
Sbjct  207   YFPGGSAGMKFLSSALTSSVMRCFGR  232



>ref|XP_007205830.1| hypothetical protein PRUPE_ppa010971mg [Prunus persica]
 gb|EMJ07029.1| hypothetical protein PRUPE_ppa010971mg [Prunus persica]
Length=228

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 187/206 (91%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++++D    SSSL   FDLE+AVRSANDTVSGTF+VVSKGVRD+PG+LQS
Sbjct  26    LLADWNSYAASQSTD---ESSSLGLGFDLESAVRSANDTVSGTFSVVSKGVRDLPGNLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS +PSGKALMYFGLFLA+GV F+F+AF +FLPV+VL+PQKFAICFTLGC FII SFFA
Sbjct  83    ATSTVPSGKALMYFGLFLATGVFFVFIAFTMFLPVMVLMPQKFAICFTLGCAFIIASFFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSS+ERLPFT GFLGSM GT+YVSM LHSYILSVLFSVIQV+AL YYAVS
Sbjct  143   LKGPKNQLAHMSSRERLPFTFGFLGSMAGTIYVSMVLHSYILSVLFSVIQVLALAYYAVS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SSV++CFGR
Sbjct  203   YFPGGSAGLKFLSSALTSSVMRCFGR  228



>ref|XP_009367271.1| PREDICTED: protein transport protein SFT2-like [Pyrus x bretschneideri]
Length=229

 Score =   332 bits (851),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 188/204 (92%), Gaps = 3/204 (1%)
 Frame = -3

Query  2234  ADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQSAT  2055
             ADWNSYA+++++D    SSSL   FDLE+AVRSANDTVSGTF+VVSKGVRDIPGSLQSAT
Sbjct  29    ADWNSYAASQSTD---ESSSLGLGFDLESAVRSANDTVSGTFSVVSKGVRDIPGSLQSAT  85

Query  2054  SNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFALR  1875
             SN+PSGKALMYFGLFLA+GV F+F+AF +FLPV+VL+PQKFAICFTLGC FII SFFAL+
Sbjct  86    SNLPSGKALMYFGLFLATGVFFVFIAFIMFLPVMVLMPQKFAICFTLGCAFIIASFFALK  145

Query  1874  GTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYF  1695
             G KNQ AHMSSKERLPFT+GFLGSM+GT+YVSM LH+YILSV+FSV+QV+AL YYAVSYF
Sbjct  146   GPKNQLAHMSSKERLPFTVGFLGSMVGTIYVSMVLHNYILSVVFSVLQVLALAYYAVSYF  205

Query  1694  PGGSAGLKFLSSSMVSSVLKCFGR  1623
             PGGSAGLKFLSS++ SSV++CFGR
Sbjct  206   PGGSAGLKFLSSALTSSVMRCFGR  229



>gb|EYU27468.1| hypothetical protein MIMGU_mgv1a013063mg [Erythranthe guttata]
Length=231

 Score =   331 bits (849),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 204/234 (87%), Gaps = 3/234 (1%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG    D+   QQ + +++SS  LLADWNSYA+ ++S+   +S SL+  FD+E+A
Sbjct  1     MQNWFSGGVGSDETSPQQPKLSSSSS--LLADWNSYAAARSSEES-SSGSLVGVFDIESA  57

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVRDIPG+ QSATS+IPSGKALMYFGL LASGV FIF+AF LF
Sbjct  58    VRSANDTVSGTFNVVSKGVRDIPGNFQSATSSIPSGKALMYFGLLLASGVFFIFIAFTLF  117

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFA+CFT GC FIIGSFFAL+G KNQF HMSSKERLPFTLGFLGSMIGT+Y
Sbjct  118   LPVIVLVPQKFALCFTAGCAFIIGSFFALKGPKNQFTHMSSKERLPFTLGFLGSMIGTIY  177

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSY+LSVLFSV+QVMAL YYA+SYFPGGSAGLKF+SSS+ SSVLKCFGR
Sbjct  178   VSMVLHSYVLSVLFSVLQVMALAYYAISYFPGGSAGLKFISSSLTSSVLKCFGR  231



>ref|XP_009362087.1| PREDICTED: protein transport protein SFT2-like [Pyrus x bretschneideri]
Length=229

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 187/204 (92%), Gaps = 3/204 (1%)
 Frame = -3

Query  2234  ADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQSAT  2055
             ADWNSYA+++++D    SSSL   FDLE+AVRSANDTVSGTF+VVSKGVRDIPGSLQSAT
Sbjct  29    ADWNSYAASQSTD---ESSSLGLGFDLESAVRSANDTVSGTFSVVSKGVRDIPGSLQSAT  85

Query  2054  SNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFALR  1875
             SN+PSGKALMYFGLFLA+G  F+F+AF +FLPV+VL+PQKFAICFTLGC FII SFFAL+
Sbjct  86    SNVPSGKALMYFGLFLATGGFFVFIAFTMFLPVMVLMPQKFAICFTLGCAFIIASFFALK  145

Query  1874  GTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYF  1695
             G KNQ AHMSSKERLPFT+GFLGSM+GT+YVSM LH+YILSV+FSV+QV+AL YYAVSYF
Sbjct  146   GPKNQLAHMSSKERLPFTVGFLGSMVGTIYVSMVLHNYILSVVFSVLQVLALAYYAVSYF  205

Query  1694  PGGSAGLKFLSSSMVSSVLKCFGR  1623
             PGGSAGLKFLSS++ SSV++CFGR
Sbjct  206   PGGSAGLKFLSSALTSSVMRCFGR  229



>gb|KDP32614.1| hypothetical protein JCGZ_13164 [Jatropha curcas]
Length=223

 Score =   329 bits (843),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G+       FDLE+AVRSANDTV+GTFNVVSKGVRDIPG+LQS
Sbjct  22    LLADWNSYAASRDDESTGSG----IGFDLESAVRSANDTVTGTFNVVSKGVRDIPGNLQS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSNIPSGK+LMYFGLFLA+GV F+F+AFA+FLPVIVL+PQKFAICFTLGC FII SF A
Sbjct  78    ATSNIPSGKSLMYFGLFLATGVFFVFIAFAMFLPVIVLMPQKFAICFTLGCGFIIASFVA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQFAHM+SKERLPFTLGFLGSM+GT+YVSM LHSYILSV FSVIQV+AL YYA+S
Sbjct  138   LKGPKNQFAHMTSKERLPFTLGFLGSMVGTIYVSMVLHSYILSVFFSVIQVLALAYYAIS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFL SS+VSSV +CF R
Sbjct  198   YFPGGSAGMKFLMSSLVSSVTRCFER  223



>ref|XP_010252849.1| PREDICTED: protein transport protein SFT2 [Nelumbo nucifera]
Length=226

 Score =   328 bits (842),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++KAS+  G+S+     FDLEAAVR+AND V+GTFNVVSKGVRD+PGS QS
Sbjct  24    LLADWNSYAASKASEDSGSSN---LGFDLEAAVRTANDKVTGTFNVVSKGVRDLPGSFQS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+LMYFGL LA+GV FIF+AF +FLPV+VL+PQKFAICFTLGC  IIGSFFA
Sbjct  81    ATSNVPSGKSLMYFGLLLATGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCALIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G +NQ +HMSSKERLPFTL F+GSM+GT+YVSM LHSYILSVLFSV+QV+AL YYA+S
Sbjct  141   LKGPRNQLSHMSSKERLPFTLVFIGSMVGTIYVSMVLHSYILSVLFSVLQVVALSYYAIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SS+LKCFGR
Sbjct  201   YFPGGSAGLKFLSSTLASSILKCFGR  226



>ref|XP_008384611.1| PREDICTED: protein transport protein SFT2-like [Malus domestica]
Length=229

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 186/206 (90%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LL+DWNSYA+++++D    SSSL   FDLE+AVRSANDTVSGTF+VVSK V DIPGSLQS
Sbjct  27    LLSDWNSYAASQSTD---ESSSLGLGFDLESAVRSANDTVSGTFSVVSKXVXDIPGSLQS  83

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKALMYFGLFLA+GV F+F+AF  FLPV+VL+PQKFAICFTLGC FII SFFA
Sbjct  84    ATSNVPSGKALMYFGLFLATGVFFVFIAFTXFLPVMVLMPQKFAICFTLGCAFIIASFFA  143

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSSKERLPFT+GFLGSM+GT+YVSM LH+YILSV FSV+QV+AL YYAVS
Sbjct  144   LKGPKNQLAHMSSKERLPFTVGFLGSMVGTIYVSMVLHNYILSVFFSVLQVLALAYYAVS  203

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SSV++CFGR
Sbjct  204   YFPGGSAGLKFLSSALTSSVMRCFGR  229



>ref|XP_010928050.1| PREDICTED: protein transport protein SFT2-like [Elaeis guineensis]
Length=226

 Score =   327 bits (837),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 186/206 (90%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++++++  G+++    AFDLEAAVR+AND V+GTFNVVSKGVR++PGS Q+
Sbjct  24    LLADWNSYAASRSTEASGSAA---LAFDLEAAVRTANDKVTGTFNVVSKGVRELPGSFQN  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC  IIGSFFA
Sbjct  81    ATSSVPSGKALMYFGLLLASGVFFIFVAFTMFLPVMVLMPQKFAICFTLGCILIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM SKERLPFTLGF GSM+GT+YVSM LHSYILSVLFSV+QV+AL YY+VS
Sbjct  141   LKGPKNQLAHMCSKERLPFTLGFTGSMVGTIYVSMVLHSYILSVLFSVLQVLALAYYSVS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SS+LKCFGR
Sbjct  201   YFPGGSAGLKFLSSTLTSSILKCFGR  226



>ref|XP_007020403.1| Got1/Sft2-like vescicle transport protein family, partial [Theobroma 
cacao]
 gb|EOY11928.1| Got1/Sft2-like vescicle transport protein family, partial [Theobroma 
cacao]
Length=224

 Score =   326 bits (835),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 200/234 (85%), Gaps = 10/234 (4%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSGSS+GD  + ++  +       LLADWNSYA+++ +D   A+      FDLE+A
Sbjct  1     MQAWFSGSSSGDGEQVKEGSS-------LLADWNSYAASREADESIATG---FGFDLESA  50

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVRD+PG+LQSATS++PSGKALMYFGL LA+GV F+F+AF +F
Sbjct  51    VRSANDTVSGTFNVVSKGVRDLPGNLQSATSSVPSGKALMYFGLLLATGVFFVFVAFTMF  110

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+VL+PQKFAICFTLGC FIIGSFFALRG KNQ AHMSSKERLPFTLGF+GSM+GT+Y
Sbjct  111   LPVMVLMPQKFAICFTLGCGFIIGSFFALRGPKNQCAHMSSKERLPFTLGFIGSMVGTIY  170

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSY+LSVLFSV+QV+AL YYA+SYFPGGSAGLKFL+S++ SSV +CF R
Sbjct  171   VSMVLHSYVLSVLFSVLQVLALAYYAISYFPGGSAGLKFLTSALTSSVTRCFRR  224



>gb|KHG22762.1| Protein transport SFT2 [Gossypium arboreum]
Length=225

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 202/234 (86%), Gaps = 9/234 (4%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             M+ WFSG S+G+D  Q ++ ++      LL+DWNSYA++K ++     ++ +  FDLE+A
Sbjct  1     MRAWFSGGSSGNDEEQGKEGSS------LLSDWNSYAASKEAE---EGTTTVFGFDLESA  51

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
              RSANDTV+GTFNVVSKGVRD+PG+LQSATS++PSGKA +YFGLFLA+GV F+F+AF +F
Sbjct  52    ARSANDTVTGTFNVVSKGVRDLPGNLQSATSSVPSGKAFIYFGLFLAAGVFFVFIAFTMF  111

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+VL+PQKFAICFTLGC FIIGSFFALRG KNQ AHMSSKERLPFTLGF+GSM+GT+Y
Sbjct  112   LPVMVLLPQKFAICFTLGCGFIIGSFFALRGPKNQLAHMSSKERLPFTLGFIGSMVGTMY  171

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSVLFSV+QV+AL YYAVSYFPGGSAGLKFL+S++ SSV +CFGR
Sbjct  172   VSMVLHSYILSVLFSVVQVLALAYYAVSYFPGGSAGLKFLTSALTSSVSRCFGR  225



>gb|KHG24787.1| Protein transport SFT2 [Gossypium arboreum]
Length=222

 Score =   324 bits (831),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 166/234 (71%), Positives = 200/234 (85%), Gaps = 12/234 (5%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSGSS+  D + ++  +       LLADWNSYA+++ S+ DG++      FDLE+A
Sbjct  1     MQAWFSGSSSVGDGQGKEGSS-------LLADWNSYAASRESE-DGSA----FGFDLESA  48

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             +RSANDTVSGTFNVVSKGVRDIPG+ QSAT ++PSGKAL+YFGLFLASG+ F+F+AF +F
Sbjct  49    MRSANDTVSGTFNVVSKGVRDIPGNFQSATISVPSGKALLYFGLFLASGIFFVFIAFTMF  108

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFTLGC FIIGSFFALRG KNQ AHMSSKERLPFTLGF+GSM+GT+Y
Sbjct  109   LPVMVIMPQKFAICFTLGCGFIIGSFFALRGPKNQLAHMSSKERLPFTLGFIGSMVGTIY  168

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSVLFSV+QV+AL YYA+SYFPGGSAGLKFL+S++ SS+  CFGR
Sbjct  169   VSMVLHSYILSVLFSVLQVLALSYYAISYFPGGSAGLKFLTSALTSSITSCFGR  222



>ref|XP_009407929.1| PREDICTED: protein transport protein SFT2-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 194/233 (83%), Gaps = 11/233 (5%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WFSG  +  DA              LLADWNSYA++KA +  G+SS  +A FDLEAAV
Sbjct  6     QAWFSGGPSERDAPPTTS---------LLADWNSYAASKAVEEGGSSS--LAGFDLEAAV  54

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             R+AND V+GTF+VVSKGVR++PGS Q+ATS++PSGK+LMYFGL LASGV  +F+AF +FL
Sbjct  55    RTANDKVAGTFSVVSKGVRELPGSFQTATSSVPSGKSLMYFGLLLASGVFLVFIAFTMFL  114

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC  I+GSFFAL+G +NQ AHMSS+ERLPFTLGF+GSM+GT+YV
Sbjct  115   PVMVLMPQKFAICFTLGCALIVGSFFALKGPRNQLAHMSSRERLPFTLGFVGSMVGTIYV  174

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SM LHSY+LSVLFSVIQV+AL YYA+SYFPGGSAGLKFLSS++ SSV +CFGR
Sbjct  175   SMVLHSYVLSVLFSVIQVLALAYYAISYFPGGSAGLKFLSSTLTSSVFRCFGR  227



>ref|XP_004139775.1| PREDICTED: protein transport protein SFT2-like [Cucumis sativus]
 ref|XP_004161769.1| PREDICTED: protein transport protein SFT2-like [Cucumis sativus]
Length=230

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 185/206 (90%), Gaps = 2/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA ++A+D   ++ +L    DLE+AVRSAN+TVSGTF+VVSKGVR++PG+ QS
Sbjct  27    LLADWNSYAESQAADD--STFNLGIGLDLESAVRSANETVSGTFSVVSKGVRELPGNFQS  84

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKALMYFGLFLA+GV FIF+AF +FLPV+VL+PQKFAICFTLGCCFIIGSFFA
Sbjct  85    ATSNVPSGKALMYFGLFLATGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCCFIIGSFFA  144

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM SKERLPFT+ F+GSM+GTLYVSMGLHSYILSV FSV+QV+AL YYAVS
Sbjct  145   LKGPKNQLAHMFSKERLPFTVIFIGSMLGTLYVSMGLHSYILSVFFSVLQVLALAYYAVS  204

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS G+KFLSS++ SSV KCFGR
Sbjct  205   YFPGGSTGMKFLSSALTSSVTKCFGR  230



>ref|XP_008809612.1| PREDICTED: protein transport protein SFT2-like [Phoenix dactylifera]
Length=226

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 183/206 (89%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LL+DWNSYA++++++  G+S      FDLEAAVR+AND V+GTFNVVSKGVR++PGS Q+
Sbjct  24    LLSDWNSYAASRSTEASGSSP---VGFDLEAAVRTANDKVTGTFNVVSKGVRELPGSFQN  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VLVPQKFAICFTLGC  IIGSFFA
Sbjct  81    ATSSVPSGKALMYFGLLLASGVFFIFVAFTMFLPVMVLVPQKFAICFTLGCILIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSSKERLPFTLGF GSM+GT+YVSM LHSYILSVLFS +QV+AL YY+VS
Sbjct  141   LKGPKNQLAHMSSKERLPFTLGFTGSMVGTIYVSMVLHSYILSVLFSGLQVLALAYYSVS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS GLKFLSS++ SS+LKCFGR
Sbjct  201   YFPGGSTGLKFLSSTLTSSILKCFGR  226



>emb|CDP13677.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 207/234 (88%), Gaps = 3/234 (1%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ+WFS  + G +A  QQ  ++++SSPSLL+DWNSYA+ +AS+    SSSL+  FDLE+A
Sbjct  1     MQQWFSAVTVGANANNQQTASSSSSSPSLLSDWNSYAAARASED---SSSLLPGFDLESA  57

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGVR++PG+ Q+ATSNIPSGK+L+YF L LA+GV F+FM+F LF
Sbjct  58    VRSANDTVSGTFNVVSKGVRELPGNFQTATSNIPSGKSLLYFSLLLATGVFFVFMSFTLF  117

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFTLGC  IIGSFFALRG KNQF+HMSSKERLPFTLGFLGSM+GT+Y
Sbjct  118   LPVIVLVPQKFAICFTLGCGLIIGSFFALRGPKNQFSHMSSKERLPFTLGFLGSMMGTIY  177

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV+FSV+QV+AL YYA+SYFPGGS GLKF+SSS+ SS+LKCFGR
Sbjct  178   VSMVLHSYILSVVFSVLQVLALSYYAISYFPGGSTGLKFISSSLTSSLLKCFGR  231



>ref|XP_011037762.1| PREDICTED: protein transport protein SFT2-like [Populus euphratica]
 ref|XP_011000315.1| PREDICTED: protein transport protein SFT2-like [Populus euphratica]
Length=223

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 187/233 (80%), Gaps = 11/233 (5%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFS           + Q     + SLLADWNSYA+T  S+        I +FDLEAA
Sbjct  1     MQSWFS--------SSGEDQQQEKPASSLLADWNSYAATSNSNESSTGLGSIGSFDLEAA  52

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGV    G+ QSATSNIPSGKALMYFGLFLA+GV F+F +FALF
Sbjct  53    VRSANDTVSGTFNVVSKGVS---GNFQSATSNIPSGKALMYFGLFLATGVFFVFTSFALF  109

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFTLGC FII SFFAL+G KNQ AHMSSKERLPFTLGF+GSM+GTLY
Sbjct  110   LPVIVLVPQKFAICFTLGCGFIIASFFALKGPKNQLAHMSSKERLPFTLGFIGSMVGTLY  169

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFG  1626
             VSM LHSYILSVLFSVIQV+AL YYA+SYFPGGS GLKFLSSS+ SSV++ FG
Sbjct  170   VSMVLHSYILSVLFSVIQVLALAYYAISYFPGGSTGLKFLSSSLTSSVMRRFG  222



>ref|XP_006377965.1| hypothetical protein POPTR_0011s16770g [Populus trichocarpa]
 gb|ERP55762.1| hypothetical protein POPTR_0011s16770g [Populus trichocarpa]
Length=223

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 188/233 (81%), Gaps = 11/233 (5%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFS           + Q     + SLLADWNSYA+T  S+      + I +FDLEAA
Sbjct  1     MQSWFS--------SSGEDQQQEKPASSLLADWNSYAATSNSNESSTGLASIGSFDLEAA  52

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGV    G+ QSATSNIPSGKALMYFGLFLA+GV F+F +FALF
Sbjct  53    VRSANDTVSGTFNVVSKGVS---GNFQSATSNIPSGKALMYFGLFLATGVFFVFTSFALF  109

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFTLGC FII SFFAL+G KNQ AHMSSKERLPFTLGF+GSM+GTLY
Sbjct  110   LPVIVLVPQKFAICFTLGCGFIIASFFALKGPKNQLAHMSSKERLPFTLGFIGSMVGTLY  169

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFG  1626
             VSM LHSY LSVLFSVIQV+AL YYA+SYFPGGSAGLKFLSSS+ SSV++ FG
Sbjct  170   VSMVLHSYFLSVLFSVIQVLALAYYAISYFPGGSAGLKFLSSSLTSSVMRRFG  222



>ref|XP_008782994.1| PREDICTED: protein transport protein SFT2 [Phoenix dactylifera]
Length=226

 Score =   319 bits (818),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 185/206 (90%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++++++ D +S+     FD+E+AVR+AND V+GTFNV SKGVR++PGS QS
Sbjct  24    LLADWNSYAASRSAEEDASSA---IGFDIESAVRTANDKVTGTFNVFSKGVRELPGSFQS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+L+YFGL LASG+  +F+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  81    ATSNVPSGKSLIYFGLLLASGIFLVFIAFTMFLPVMVLMPQKFAICFTLGCAFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM+SKERLPFTLGF+GSM+GT+YVSM LHSYILSV FSV+QV+AL YYA+S
Sbjct  141   LKGPKNQLAHMASKERLPFTLGFVGSMVGTIYVSMVLHSYILSVFFSVLQVLALAYYAIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++ SS+L+CFGR
Sbjct  201   YFPGGSAGMKFLSSALTSSILRCFGR  226



>ref|XP_007049426.1| Got1/Sft2-like vescicle transport protein family isoform 1 [Theobroma 
cacao]
 gb|EOX93583.1| Got1/Sft2-like vescicle transport protein family isoform 1 [Theobroma 
cacao]
Length=225

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 185/206 (90%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+++ +D    SS+L   FDLEAAVR+ +D VSGTFNVVSKGVRD+PGS QS
Sbjct  26    LLADWNAYAASQDAD----SSAL--GFDLEAAVRTTSDKVSGTFNVVSKGVRDLPGSFQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+LMYFG+FLA+G+ F+F+AF +FLPVIVLVPQKFAICFT+GC  I+GSFFA
Sbjct  80    ATSNVPSGKSLMYFGVFLAAGLFFVFIAFTMFLPVIVLVPQKFAICFTIGCALIVGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G +NQ AHMSSKERLPFTLGF+GSM+GT+YVSM LHSYILSVLFSV+QV+ L YYA+S
Sbjct  140   LKGPRNQLAHMSSKERLPFTLGFVGSMVGTIYVSMWLHSYILSVLFSVLQVITLSYYAMS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SSVL+CFGR
Sbjct  200   YFPGGSAGLKFLSSTLASSVLRCFGR  225



>ref|XP_003600409.1| Protein transport protein SFT2 [Medicago truncatula]
 gb|AES70660.1| Got1/SFT2-like vescicle transporter family protein [Medicago 
truncatula]
 gb|AFK38943.1| unknown [Medicago truncatula]
Length=221

 Score =   318 bits (815),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 192/234 (82%), Gaps = 13/234 (6%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSGSS  D                LLADWNSYAS ++S  D  S+     FD+E+A
Sbjct  1     MQNWFSGSSEDDLKPSSS----------LLADWNSYASAQSSQDDDPSN---FPFDIESA  47

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTF+VVSKGVRD+PGS QSATS++PSGKAL+YFGLFLASGV F+F+AF LF
Sbjct  48    VRSANDTVSGTFSVVSKGVRDLPGSFQSATSSVPSGKALVYFGLFLASGVFFVFIAFTLF  107

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFTLGC FIIGSFFAL+G KNQ AHM SKERLPFTL FLGSMIGT+Y
Sbjct  108   LPVMVVMPQKFAICFTLGCGFIIGSFFALKGPKNQLAHMLSKERLPFTLVFLGSMIGTIY  167

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSY LSV+FSV+QV++L YYA+SYFPGGSAG+ FL+S++ SSV++CFGR
Sbjct  168   VSMVLHSYFLSVIFSVVQVLSLGYYAISYFPGGSAGMTFLTSALTSSVMRCFGR  221



>ref|XP_006584495.1| PREDICTED: uncharacterized protein LOC100306412 isoform X1 [Glycine 
max]
 gb|KHN01776.1| Protein transport protein SFT2 [Glycine soja]
Length=220

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 194/234 (83%), Gaps = 14/234 (6%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG S+ ++A+             LLADWNSYAS + S+      S    FD+E+A
Sbjct  1     MQGWFSGQSSEEEAKPASS---------LLADWNSYASAQTSE-----DSSTFPFDIESA  46

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTF+VVSKGVRD+PG+ QSATSN+PSGKAL+YFGLFLASGV F+F+AF LF
Sbjct  47    VRSANDTVSGTFSVVSKGVRDLPGNFQSATSNVPSGKALVYFGLFLASGVFFVFIAFTLF  106

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFA+CFTLGC FIIGSFFAL+G K+Q AHM SKERLPFTL FLGSMIGT+Y
Sbjct  107   LPVMVVMPQKFALCFTLGCGFIIGSFFALKGPKSQLAHMLSKERLPFTLAFLGSMIGTIY  166

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV+FSV+QV++L YY++SYFPGGSAG+KFL+S+  SS++KCFGR
Sbjct  167   VSMVLHSYILSVVFSVVQVLSLGYYSISYFPGGSAGMKFLTSAFTSSIMKCFGR  220



>ref|XP_002273570.1| PREDICTED: protein transport protein SFT2 [Vitis vinifera]
 emb|CBI39795.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   317 bits (812),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLA WNSYA+   S  +  S  +   FDLE+AVRSANDTV+GTF+VVSKGVRD+PG++QS
Sbjct  27    LLAQWNSYAAESRSSEEEGSLGMGMGFDLESAVRSANDTVTGTFSVVSKGVRDLPGNIQS  86

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSG++LMYFG+ LA+GV F+F+AF +FLPV+VL+PQKFA+CFT+GC FIIGSFFA
Sbjct  87    ATSNVPSGRSLMYFGILLATGVFFVFIAFTMFLPVMVLMPQKFALCFTIGCSFIIGSFFA  146

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMS+KERLPFTLGF+GSM+GT+YVSM LHSYILSVLFSV+QV+AL YYA+S
Sbjct  147   LKGPKNQLAHMSTKERLPFTLGFIGSMVGTIYVSMVLHSYILSVLFSVLQVLALAYYAIS  206

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SS+LKCFGR
Sbjct  207   YFPGGSAGLKFLSSALTSSILKCFGR  232



>ref|XP_004251550.1| PREDICTED: protein transport protein SFT2 [Solanum lycopersicum]
Length=224

 Score =   317 bits (811),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 183/206 (89%), Gaps = 5/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YAST+    +G+SS L   FDLEAAVR+AND VSGTFNVV+KGV+++PGS QS
Sbjct  24    LLADWNAYASTQ---DEGSSSDL--GFDLEAAVRTANDKVSGTFNVVTKGVKNLPGSFQS  78

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+LMYFGLFLA+GV FIF+AF +FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  79    ATSNVPSGKSLMYFGLFLAAGVFFIFIAFTMFLPVMVLMPQKFAICFTIGCAFIIGSFFA  138

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM+SKERLPFT  F+GSM+GT+YVSM LHSYILSVLFSVIQV+AL YY +S
Sbjct  139   LKGPKNQLTHMTSKERLPFTALFIGSMVGTIYVSMVLHSYILSVLFSVIQVLALSYYVIS  198

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG++FLSS++ SS+ +CFGR
Sbjct  199   YFPGGSAGMRFLSSTLTSSIFRCFGR  224



>ref|XP_006857699.1| hypothetical protein AMTR_s00061p00168700 [Amborella trichopoda]
 gb|ERN19166.1| hypothetical protein AMTR_s00061p00168700 [Amborella trichopoda]
Length=234

 Score =   317 bits (811),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 187/214 (87%), Gaps = 11/214 (5%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAV--------RSANDTVSGTFNVVSKGVR  2085
             LLADWNSYA++++++ D +S      FDLEAAV        ++AN+ V+GTFNVVSKGVR
Sbjct  24    LLADWNSYAASRSAEEDASSG---MGFDLEAAVPGSFAPLLKTANERVTGTFNVVSKGVR  80

Query  2084  DIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCC  1905
             D+PG+LQSATS++PSGK+LMYFGLFLA+GV F+F+AF +FLPV+VLVPQKFAICFTLGC 
Sbjct  81    DLPGNLQSATSSVPSGKSLMYFGLFLATGVFFVFIAFTMFLPVMVLVPQKFAICFTLGCA  140

Query  1904  FIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVM  1725
             FIIGSFFAL+G +NQ AHMSS+ERLPFTLGF+GSM GT+YVSM LHSYILSVLFS +QV+
Sbjct  141   FIIGSFFALKGPRNQLAHMSSRERLPFTLGFIGSMAGTIYVSMVLHSYILSVLFSALQVL  200

Query  1724  ALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             AL YYA+SYFPGGSAGLKFLSS++ SS+L+CFGR
Sbjct  201   ALGYYAISYFPGGSAGLKFLSSTITSSILRCFGR  234



>ref|XP_007140128.1| hypothetical protein PHAVU_008G086300g [Phaseolus vulgaris]
 gb|ESW12122.1| hypothetical protein PHAVU_008G086300g [Phaseolus vulgaris]
Length=223

 Score =   316 bits (810),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YAS ++S  +   S+L  +FDLE+AVRSANDTVSGTF+VVSKGVRDIPG+ QS
Sbjct  21    LLADWNTYASAQSSQDN---SNLGLSFDLESAVRSANDTVSGTFSVVSKGVRDIPGNFQS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKAL+YFGL LASGV F+F+AF LFLPV+V++PQKFAICFTLGC FIIGSFFA
Sbjct  78    ATSNVPSGKALVYFGLLLASGVFFVFIAFTLFLPVMVVMPQKFAICFTLGCGFIIGSFFA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM S ERLPFTL FLGSM+GT+YVSM LHSYILSV+FSV+QV++L YY++S
Sbjct  138   LKGPKNQLTHMMSMERLPFTLAFLGSMVGTIYVSMVLHSYILSVVFSVVQVLSLGYYSIS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFL+S++ SS++KCFGR
Sbjct  198   YFPGGSAGMKFLTSALTSSIMKCFGR  223



>ref|NP_001238452.1| uncharacterized protein LOC100306412 [Glycine max]
 gb|ACU14572.1| unknown [Glycine max]
Length=220

 Score =   316 bits (809),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/234 (68%), Positives = 193/234 (82%), Gaps = 14/234 (6%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG  + ++A+             LLADWNSYAS + S+      S    FD+E+A
Sbjct  1     MQGWFSGQGSEEEAKPASS---------LLADWNSYASAQTSE-----DSSTFPFDIESA  46

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTF+VVSKGVRD+PG+ QSATSN+PSGKAL+YFGLFLASGV F+F+AF LF
Sbjct  47    VRSANDTVSGTFSVVSKGVRDLPGNFQSATSNVPSGKALVYFGLFLASGVFFVFIAFTLF  106

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFA+CFTLGC FIIGSFFAL+G K+Q AHM SKERLPFTL FLGSMIGT+Y
Sbjct  107   LPVMVVMPQKFALCFTLGCGFIIGSFFALKGPKSQLAHMLSKERLPFTLAFLGSMIGTIY  166

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV+FSV+QV++L YY++SYFPGGSAG+KFL+S+  SS++KCFGR
Sbjct  167   VSMVLHSYILSVVFSVVQVLSLGYYSISYFPGGSAGMKFLTSAFTSSIMKCFGR  220



>ref|XP_010539341.1| PREDICTED: protein transport protein SFT2-like [Tarenaya hassleriana]
 ref|XP_010539342.1| PREDICTED: protein transport protein SFT2-like [Tarenaya hassleriana]
Length=228

 Score =   316 bits (809),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 185/207 (89%), Gaps = 5/207 (2%)
 Frame = -3

Query  2240  LLADWNSYASTK-ASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQ  2064
             LLADWNSYA+++ A  G G S      FD+E+AVRSANDTVSGTF+VVSKGVRD+PG+LQ
Sbjct  26    LLADWNSYAASQDAEAGSGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDLPGNLQ  81

Query  2063  SATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFF  1884
             SATS++PSGKALMYFGLFLA+GV FIF+AF +FLPV+V++PQKFAICFTLGC FIIGSFF
Sbjct  82    SATSSMPSGKALMYFGLFLATGVFFIFLAFTMFLPVMVIMPQKFAICFTLGCGFIIGSFF  141

Query  1883  ALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAV  1704
             ALRG +NQ AHMSS+ERLP TLGF+G+M+GT+YVSM LHSYILSVLFSV+QV+AL YY +
Sbjct  142   ALRGPQNQLAHMSSRERLPLTLGFIGTMVGTIYVSMVLHSYILSVLFSVLQVLALAYYCI  201

Query  1703  SYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SYFPGGS+G+KFLSS++ SSVL+ FGR
Sbjct  202   SYFPGGSSGMKFLSSALTSSVLRVFGR  228



>gb|EPS59015.1| hypothetical protein M569_15796, partial [Genlisea aurea]
Length=223

 Score =   315 bits (808),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 182/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+ ++SD D  S +     D+E+AVR ANDTVSGTF+VVSKGVR +PG+LQS
Sbjct  19    LLADWNSYAADRSSD-DAGSGAFAGVIDIESAVRVANDTVSGTFDVVSKGVRGLPGNLQS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSNIPSGK+L+YFGL LA+G  F+F+AF++FLPVIVL+PQKFAICFTLGC  IIGSFFA
Sbjct  78    ATSNIPSGKSLLYFGLLLATGFFFVFLAFSMFLPVIVLMPQKFAICFTLGCSSIIGSFFA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQF HMSSKERLPFT+GF+GSMIGT+YVSM LHSY+LS+LFS++QV+AL YYA S
Sbjct  138   LRGPKNQFIHMSSKERLPFTVGFIGSMIGTIYVSMVLHSYVLSLLFSMLQVLALAYYAFS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKF+SSS+ S VL+CFGR
Sbjct  198   YFPGGSAGLKFISSSLTSFVLRCFGR  223



>ref|XP_010246549.1| PREDICTED: protein transport protein SFT2-like [Nelumbo nucifera]
Length=225

 Score =   315 bits (808),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 185/206 (90%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYAS+KAS+    S S    FDLE+AV+SAN+ V+GTFNVVSKGVRD+PGS QS
Sbjct  23    LLADWNSYASSKASE---ESGSSSLGFDLESAVKSANEKVTGTFNVVSKGVRDLPGSFQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+LMYFGL LA+GV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFF 
Sbjct  80    ATSNVPSGKSLMYFGLLLATGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCAFIIGSFFV  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ +HMSSKERLPFTLGF+GSM+GT+YVSM LHSY+LSVLFSV+QV AL+YYAVS
Sbjct  140   LKGPKNQLSHMSSKERLPFTLGFIGSMVGTIYVSMVLHSYVLSVLFSVLQVSALIYYAVS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+GLKFLSS++ SSVLKCFGR
Sbjct  200   YFPGGSSGLKFLSSTITSSVLKCFGR  225



>ref|XP_003551395.1| PREDICTED: protein transport protein SFT2-like [Glycine max]
Length=220

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 194/234 (83%), Gaps = 14/234 (6%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG S+ ++A+             LLADWNSYAS ++S+   A       FD+E+A
Sbjct  1     MQGWFSGQSSEEEAKPASS---------LLADWNSYASAQSSEDSSA-----FPFDIESA  46

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTF+VVSKGVRD+PG+ QSATSN+PSGKAL+YFGLFLASGV F+F+AF LF
Sbjct  47    VRSANDTVSGTFSVVSKGVRDLPGNFQSATSNVPSGKALVYFGLFLASGVFFVFIAFTLF  106

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LP++V++PQKFA+CFTLGC FIIGSFFAL+G KNQ AHM S ERLPFTL FLGSMIGT+Y
Sbjct  107   LPIMVVMPQKFALCFTLGCGFIIGSFFALKGPKNQLAHMLSMERLPFTLAFLGSMIGTIY  166

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV+FSV+QV++L YY++SYFPGGSAG+KFL+S+  SS++KCFG+
Sbjct  167   VSMVLHSYILSVVFSVVQVLSLGYYSISYFPGGSAGMKFLTSAFTSSIMKCFGQ  220



>gb|AGV54819.1| transport protein SFT2-like protein [Phaseolus vulgaris]
Length=223

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 183/206 (89%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YAS ++S  +   S+L  +FDLE+AVRSANDTVSGTF+VVSKGVRDIPG+ QS
Sbjct  21    LLADWNTYASAQSSQDN---SNLGLSFDLESAVRSANDTVSGTFSVVSKGVRDIPGNFQS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKAL+YFGL LASGV F+F+AF LFLP +V++PQKFAICFTLGC FIIGSFFA
Sbjct  78    ATSNVPSGKALVYFGLLLASGVFFVFIAFTLFLPAMVVMPQKFAICFTLGCGFIIGSFFA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM S ERLPFTL FLGSM+GT+YVSM LHSYILSV+FSV+QV++L YY++S
Sbjct  138   LKGPKNQLTHMMSMERLPFTLAFLGSMVGTIYVSMVLHSYILSVVFSVVQVLSLGYYSIS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFL+S++ SS++KCFGR
Sbjct  198   YFPGGSAGMKFLTSALTSSIMKCFGR  223



>ref|XP_010448254.1| PREDICTED: protein transport protein SFT2-like [Camelina sativa]
Length=228

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 183/206 (89%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  27    LLADWNSYAASRDFEESGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  83    ATSSMPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFAICFTIGCGFIIGSFFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  143   LRGPQNQLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALIYYCIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SSVL+ FGR
Sbjct  203   YFPGGSSGMRFLSSALTSSVLRVFGR  228



>ref|XP_006282707.1| hypothetical protein CARUB_v10005677mg [Capsella rubella]
 gb|EOA15605.1| hypothetical protein CARUB_v10005677mg [Capsella rubella]
Length=225

 Score =   313 bits (802),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 182/206 (88%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  24    LLADWNSYAASRDFEESGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  80    ATSSMPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  140   LRGPKNQLAHMSSMERLPSTLGFIATMVGTIYVSMILHSYILSVLFSVLQVLALIYYCIS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SSVL+  GR
Sbjct  200   YFPGGSSGMRFLSSTLTSSVLRVSGR  225



>ref|XP_006352003.1| PREDICTED: protein transport protein SFT2-like [Solanum tuberosum]
Length=224

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 180/206 (87%), Gaps = 5/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+T+    +G+SS L   FDLEAAVR+AND  SGTFNVV+KGVRD+PGS Q 
Sbjct  24    LLADWNAYAATQ---DEGSSSDL--GFDLEAAVRTANDKFSGTFNVVTKGVRDLPGSFQF  78

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+LMYFGLFLA+GV FIF+AF +FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  79    ATSNVPSGKSLMYFGLFLAAGVFFIFIAFTMFLPVMVLMPQKFAICFTIGCAFIIGSFFA  138

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM+SKERLPFT  F+GSM+GT+YVSM LHSYILSVLFSVIQV+AL YY +S
Sbjct  139   LKGPKNQLTHMTSKERLPFTALFIGSMVGTIYVSMVLHSYILSVLFSVIQVLALSYYVIS  198

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS G++FLSS++ SS+ +CFGR
Sbjct  199   YFPGGSVGMRFLSSTLTSSIFRCFGR  224



>ref|NP_567749.1| Got1/Sft2-like vescicle transport protein [Arabidopsis thaliana]
 gb|ABD43012.1| At4g26550 [Arabidopsis thaliana]
 gb|AEE85217.1| Got1/Sft2-like vescicle transport protein [Arabidopsis thaliana]
Length=225

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 181/206 (88%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  24    LLADWNSYAASRDFEESGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  80    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  140   LRGPKNQLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALVYYCIS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SS L+ FGR
Sbjct  200   YFPGGSSGMRFLSSALTSSALRVFGR  225



>ref|XP_006413168.1| hypothetical protein EUTSA_v10026146mg [Eutrema salsugineum]
 gb|ESQ54621.1| hypothetical protein EUTSA_v10026146mg [Eutrema salsugineum]
Length=233

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 182/206 (88%), Gaps = 2/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  D +    S    FD+E+AVRSANDTVSGTF+VVSKGVRDIPG+LQS
Sbjct  30    LLADWNSYAASR--DVEEGGGSGSFGFDIESAVRSANDTVSGTFSVVSKGVRDIPGNLQS  87

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  88    ATSNMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  147

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  148   LRGPQNQLAHMSSMERLPLTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALVYYCIS  207

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFLSS++ SSVL+ FGR
Sbjct  208   YFPGGSSGMKFLSSALTSSVLRVFGR  233



>ref|XP_010536761.1| PREDICTED: protein transport protein SFT2-like [Tarenaya hassleriana]
Length=220

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 183/206 (89%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++ +D  G  S     FD+E+AVRSANDTVSGTF+VVSKGVRD+PG+LQS
Sbjct  18    LLADWNSYAASQDADAGGGGS---FGFDIESAVRSANDTVSGTFSVVSKGVRDLPGNLQS  74

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++ SGKALMYFGLFLA+GV FIF+AF +FLPV+V++PQKFAICFTLGC FIIGSFFA
Sbjct  75    ATSSMSSGKALMYFGLFLATGVFFIFIAFTMFLPVMVIMPQKFAICFTLGCGFIIGSFFA  134

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ +HMSSKERLP TLGF+G+M+GT+YVSM LHSYILSVLFSV+QV+AL YY +S
Sbjct  135   LRGPQNQLSHMSSKERLPLTLGFIGTMVGTIYVSMVLHSYILSVLFSVLQVLALGYYCIS  194

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+ +KFLSS++ SSVL+ FGR
Sbjct  195   YFPGGSSSMKFLSSALTSSVLRVFGR  220



>ref|XP_002264182.1| PREDICTED: protein transport protein SFT2 isoform X2 [Vitis vinifera]
 emb|CBI28479.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 181/206 (88%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+++  D    SS+L   FDLEAAVR+AND VSG+FNVVSKGVRDIPGS QS
Sbjct  26    LLADWNAYAASQEPD----SSAL--GFDLEAAVRTANDKVSGSFNVVSKGVRDIPGSFQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             A +N+PSGK+LMYF L LA+G+ F+F+AFA+FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  80    AATNVPSGKSLMYFSLLLAAGIFFVFIAFAMFLPVMVLMPQKFAICFTIGCVFIIGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM S+ERLPFTLGF+ SM+GT+YVSM LHSY+ SVLFSV+QV+AL YYA+S
Sbjct  140   LKGPKNQLAHMFSRERLPFTLGFISSMVGTIYVSMVLHSYVFSVLFSVLQVLALSYYAIS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++ S +LKCFGR
Sbjct  200   YFPGGSAGMKFLSSTLTSLILKCFGR  225



>ref|XP_002867560.1| hypothetical protein ARALYDRAFT_492154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43819.1| hypothetical protein ARALYDRAFT_492154 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 183/206 (89%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  D + +S S    FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  25    LLADWNSYAASR--DFEESSGSF--GFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  81    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  141   LRGPKNQLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALVYYCIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SS L+ FGR
Sbjct  201   YFPGGSSGMRFLSSALTSSALRVFGR  226



>gb|KDP22999.1| hypothetical protein JCGZ_01721 [Jatropha curcas]
Length=233

 Score =   311 bits (797),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 181/205 (88%), Gaps = 6/205 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++ SD    SS+L   FDLEAAVR+ +D V+GTFNVVSKGVRD+PG+ QS
Sbjct  31    LLADWNSYAASQDSD----SSAL--GFDLEAAVRTTSDKVTGTFNVVSKGVRDLPGNFQS  84

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+L+YF + LA+GV F+F+AF +FLPV+VLVPQKFAICFT+GC FI+GSFFA
Sbjct  85    ATSNVPSGKSLVYFSMLLAAGVFFVFIAFTMFLPVMVLVPQKFAICFTIGCAFIVGSFFA  144

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHMSSKERLPFTLGF+ +M+GT+YVSM LHSYILSVLFS++QV+AL YYA+S
Sbjct  145   LKGPKNQLAHMSSKERLPFTLGFISTMVGTVYVSMVLHSYILSVLFSILQVLALSYYAIS  204

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFG  1626
             YFPGGS GLKF+SS+  SS+LKCFG
Sbjct  205   YFPGGSTGLKFISSTFTSSILKCFG  229



>ref|XP_011097723.1| PREDICTED: protein transport protein SFT2-like [Sesamum indicum]
Length=229

 Score =   311 bits (797),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 198/234 (85%), Gaps = 5/234 (2%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQKWFS  +   +   Q+  +++     LL+DWNSYA+ ++S+   +  SL   FD+E+A
Sbjct  1     MQKWFSAGADDGENSPQRTSSSS-----LLSDWNSYAAARSSEESSSGGSLAGIFDIESA  55

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTFNVVSKGV+D+PG+ QSATSNIPSGKALMYFGL LASGV F+F+AF LF
Sbjct  56    VRSANDTVSGTFNVVSKGVKDLPGNFQSATSNIPSGKALMYFGLLLASGVFFVFIAFTLF  115

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPVIVLVPQKFAICFT+GC FIIGSFFALRG KNQF HMSSKERLPFTLGFLGSMIGT+Y
Sbjct  116   LPVIVLVPQKFAICFTVGCAFIIGSFFALRGPKNQFNHMSSKERLPFTLGFLGSMIGTIY  175

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSY+LSVLFSV+QV+AL YYA+SYFPGGS GLK +SSS+ SS+LKCFGR
Sbjct  176   VSMVLHSYVLSVLFSVLQVLALAYYAISYFPGGSTGLKLISSSLTSSILKCFGR  229



>ref|XP_010929017.1| PREDICTED: protein transport protein SFT2-like [Elaeis guineensis]
 ref|XP_010929018.1| PREDICTED: protein transport protein SFT2-like [Elaeis guineensis]
Length=226

 Score =   310 bits (795),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 185/206 (90%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++++S+    ++S    FDLEAAVR+AND V+GTFNV SKGVR++PGS QS
Sbjct  24    LLADWNSYAASRSSE---EAASSALGFDLEAAVRTANDKVTGTFNVFSKGVRELPGSFQS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+L+YFGL LASG+  IF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  81    ATSNVPSGKSLLYFGLLLASGIFLIFIAFTMFLPVMVLMPQKFAICFTLGCAFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM+SKERLPFTLGF+GSM+GT+YVSM LHSYILSVLFSV+QV+AL YYA+S
Sbjct  141   LKGPKNQLAHMASKERLPFTLGFVGSMVGTIYVSMVLHSYILSVLFSVLQVLALGYYAIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++ SSVLKCFGR
Sbjct  201   YFPGGSAGMKFLSSALTSSVLKCFGR  226



>gb|AGV54804.1| transport protein SFT2-like protein [Phaseolus vulgaris]
Length=223

 Score =   310 bits (794),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 183/206 (89%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YAS ++S  +   S+L  +FDLE+AVRSANDTVSGTF+VVSKGVRDIPG+ QS
Sbjct  21    LLADWNTYASAQSSQDN---SNLGLSFDLESAVRSANDTVSGTFSVVSKGVRDIPGNFQS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGKAL+YFGL LASGV F+F+AF LFLPV+V++PQKFAICFTLGC FIIGSFFA
Sbjct  78    ATSNVPSGKALVYFGLLLASGVFFVFIAFTLFLPVMVVMPQKFAICFTLGCGFIIGSFFA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM S ERLPFTL FLGSM GT+YVSM LHSYILS++FSV+QV++L YY++S
Sbjct  138   LKGPKNQLTHMMSMERLPFTLAFLGSMGGTIYVSMVLHSYILSLVFSVVQVLSLGYYSIS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             +FPGGSAG+KFL+S++ SS++KCFGR
Sbjct  198   HFPGGSAGMKFLTSALTSSIMKCFGR  223



>ref|XP_010676101.1| PREDICTED: protein transport protein SFT2 [Beta vulgaris subsp. 
vulgaris]
Length=230

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 186/233 (80%), Gaps = 7/233 (3%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WF+G+        +   ++      LLADWNSYA+T+ S      SS +  FD+E+AV
Sbjct  5     QTWFTGTDESAQTSTKPSTSS------LLADWNSYAATQDSQTSADFSSTLG-FDIESAV  57

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTF VVSKGVR++PG+LQ+ATSN+P+GKALMYFGL LASGV F+F+AF +FL
Sbjct  58    RSANDTVSGTFGVVSKGVRELPGNLQTATSNVPTGKALMYFGLLLASGVFFVFIAFTMFL  117

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC FI+GSFFALRG  NQ AHMSSKERLPF+L  LG M GT+YV
Sbjct  118   PVMVLMPQKFAICFTLGCGFIVGSFFALRGPSNQLAHMSSKERLPFSLAILGCMFGTIYV  177

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SM +HSYILSVLFSV+QV AL YYA+SYFPGGS G+KFL+S++ SSV + FGR
Sbjct  178   SMVMHSYILSVLFSVLQVFALTYYAISYFPGGSTGMKFLTSALTSSVTRLFGR  230



>dbj|BAD94047.1| hypothetical protein [Arabidopsis thaliana]
Length=225

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  24    LLADWNSYAASRDFEESGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  80    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFS +QV+AL+YY +S
Sbjct  140   LRGPKNQLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSELQVLALVYYCIS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SS L+ FGR
Sbjct  200   YFPGGSSGMRFLSSALTSSALRVFGR  225



>emb|CDP13671.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/270 (60%), Positives = 203/270 (75%), Gaps = 15/270 (6%)
 Frame = +1

Query  229  IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLK  408
            + CI+ A++AGL R + V+WSK+L+ H+L I+VEN  EENH TCKIDLKTWQFWGKKGLK
Sbjct  35   VTCIHRARLAGLSRDIMVSWSKSLMGHSLHILVENPSEENHSTCKIDLKTWQFWGKKGLK  94

Query  409  TFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPS  588
            +FKV ++R+D++WD+++AKFSSSPE VS Y++AL    EL+LLLGDQ+ EA KRT+SKPS
Sbjct  95   SFKVGERRVDVFWDLRTAKFSSSPEPVSDYYVALVSEKELVLLLGDQKTEAYKRTRSKPS  154

Query  589  LVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGMECIRI  765
             + AALVHKKES  AK  F TRT+LG+ K+EH IIIESA+SG  +PEMWISVDG+E +RI
Sbjct  155  PMDAALVHKKESVFAKRCFCTRTMLGKGKREHHIIIESALSGPYDPEMWISVDGVESLRI  214

Query  766  VNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST-------------  906
             NLHWRFRGNET+ VDDVPV++FWDVHDWLY+S  +GPG FIF Q T             
Sbjct  215  PNLHWRFRGNETLLVDDVPVQIFWDVHDWLYNSNESGPGTFIFMQGTLECEFDNDYGGRN  274

Query  907  -NKDEASNSQTDETDEDYPSTDFCHIFYAW  993
             + D  S    D   E+   T+FCH  YAW
Sbjct  275  LDHDAPSGENCDLRPEELSCTEFCHFLYAW  304



>emb|CDX89326.1| BnaA01g15670D [Brassica napus]
Length=226

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 180/206 (87%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSL S
Sbjct  25    LLADWNSYAASRDVEEGGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLSS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  81    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHM+S ERLP T+GF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  141   LRGPQNQLAHMTSMERLPLTIGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALIYYCIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFL S++ SSVL+ FGR
Sbjct  201   YFPGGSSGMKFLGSALTSSVLRVFGR  226



>ref|XP_009142455.1| PREDICTED: protein transport protein sft2 [Brassica rapa]
Length=226

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 180/206 (87%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSL S
Sbjct  25    LLADWNSYAASRDVEEGGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLSS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  81    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHM+S ERLP T+GF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  141   LRGPQNQLAHMTSMERLPLTIGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALIYYCIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFL S++ SSVL+ FGR
Sbjct  201   YFPGGSSGMKFLGSALTSSVLRVFGR  226



>emb|CDX94317.1| BnaC01g18670D [Brassica napus]
Length=226

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 180/206 (87%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSL S
Sbjct  25    LLADWNSYAASRDVEEGGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLSS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  81    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHM+S ERLP T+GF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  141   LRGPQNQLAHMTSMERLPLTIGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALVYYCIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFL S++ SSVL+ FGR
Sbjct  201   YFPGGSSGMKFLGSALTSSVLRVFGR  226



>ref|XP_010657500.1| PREDICTED: protein transport protein SFT2 isoform X1 [Vitis vinifera]
Length=228

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 180/205 (88%), Gaps = 6/205 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+++  D    SS+L   FDLEAAVR+AND VSG+FNVVSKGVRDIPGS QS
Sbjct  26    LLADWNAYAASQEPD----SSAL--GFDLEAAVRTANDKVSGSFNVVSKGVRDIPGSFQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             A +N+PSGK+LMYF L LA+G+ F+F+AFA+FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  80    AATNVPSGKSLMYFSLLLAAGIFFVFIAFAMFLPVMVLMPQKFAICFTIGCVFIIGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM S+ERLPFTLGF+ SM+GT+YVSM LHSY+ SVLFSV+QV+AL YYA+S
Sbjct  140   LKGPKNQLAHMFSRERLPFTLGFISSMVGTIYVSMVLHSYVFSVLFSVLQVLALSYYAIS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFG  1626
             YFPGGSAG+KFLSS++ S +LKCFG
Sbjct  200   YFPGGSAGMKFLSSTLTSLILKCFG  224



>gb|KFK27173.1| hypothetical protein AALP_AA8G345000 [Arabis alpina]
Length=228

 Score =   308 bits (790),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 181/206 (88%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  + D    S I  FD+E+AVRSAN+TVSG+FNVVSKGVRD+PG+LQS
Sbjct  27    LLADWNSYAASRDFEED----SGILGFDIESAVRSANNTVSGSFNVVSKGVRDLPGNLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGK+LMYFGL LASGV F+F+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  83    ATSSMPSGKSLMYFGLLLASGVFFVFLAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSSKERLP TLGF+ +M+GT+YVSM LHSY+LSVLFS +QV+AL YY +S
Sbjct  143   LRGPQNQLAHMSSKERLPLTLGFIATMVGTIYVSMVLHSYVLSVLFSALQVIALAYYCIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFLSS++ SSV + FGR
Sbjct  203   YFPGGSSGMKFLSSALTSSVFRIFGR  228



>emb|CDP13674.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   310 bits (795),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/270 (60%), Positives = 202/270 (75%), Gaps = 15/270 (6%)
 Frame = +1

Query  229  IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLK  408
            + CI+ A++AGL R + V+WSK+L+ H+L ++VEN  EENH TCKIDLKTWQFWGKKGLK
Sbjct  35   VTCIHRARLAGLSRDIIVSWSKSLMGHSLHVLVENPSEENHSTCKIDLKTWQFWGKKGLK  94

Query  409  TFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPS  588
            +FKV ++R+D++WD ++AKFSSSPE VS Y++AL    EL+LLLGDQ+ EA KRT+SKPS
Sbjct  95   SFKVGERRVDVFWDSRTAKFSSSPEPVSDYYVALVSEKELVLLLGDQKTEAYKRTRSKPS  154

Query  589  LVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGMECIRI  765
             + AALVHKKES  AK  F TRT+LG+ K+EH IIIESA+SG  +PEMWISVDG+E +RI
Sbjct  155  PMDAALVHKKESVFAKRCFCTRTMLGKGKREHHIIIESALSGPYDPEMWISVDGVESLRI  214

Query  766  VNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST-------------  906
             NLHWRFRGNET+ VDDVPV++FWDVHDWLY+S  +GPG FIF Q T             
Sbjct  215  PNLHWRFRGNETLLVDDVPVQIFWDVHDWLYNSNESGPGTFIFMQGTLECEFDNDYGGRN  274

Query  907  -NKDEASNSQTDETDEDYPSTDFCHIFYAW  993
             + D  S    D   E+   T+FCH  YAW
Sbjct  275  LDHDAPSGENCDLRPEELSCTEFCHFLYAW  304



>ref|XP_010433484.1| PREDICTED: protein transport protein SFT2-like [Camelina sativa]
Length=228

 Score =   307 bits (786),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 181/206 (88%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  27    LLADWNSYAASRDFEESGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFA CFT+GC FIIGS FA
Sbjct  83    ATSSMPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFANCFTIGCGFIIGSVFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG ++Q AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +S
Sbjct  143   LRGPQHQLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALIYYCIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SSVL+ FGR
Sbjct  203   YFPGGSSGMRFLSSALTSSVLRVFGR  228



>ref|XP_004500156.1| PREDICTED: protein transport protein SFT2-like [Cicer arietinum]
Length=221

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 190/234 (81%), Gaps = 13/234 (6%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG++  D                LLADWNSYA+ ++S  D +S+     FD+E+A
Sbjct  1     MQSWFSGTNDDDLKPSSS----------LLADWNSYATAQSSQNDDSST---FPFDIESA  47

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSANDTVSGTF VVSKGV+D+ G+ QSA+S+IPSG+AL+YFGLFLASGV F+F+AF LF
Sbjct  48    VRSANDTVSGTFGVVSKGVKDMSGNFQSASSSIPSGQALVYFGLFLASGVFFVFIAFTLF  107

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFTLGC  IIGSFFAL+G KNQ AHM SKERLPFTL FLGSMIGT+Y
Sbjct  108   LPVMVVMPQKFAICFTLGCGLIIGSFFALKGPKNQLAHMLSKERLPFTLVFLGSMIGTIY  167

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM  HSYILSV+FSV+QV++L YYA+SYFPGGSAG+ FL+S++ SSV++CFGR
Sbjct  168   VSMVRHSYILSVVFSVVQVLSLGYYAISYFPGGSAGMTFLTSALTSSVMRCFGR  221



>gb|EYU43172.1| hypothetical protein MIMGU_mgv1a013448mg [Erythranthe guttata]
Length=220

 Score =   306 bits (783),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 179/206 (87%), Gaps = 5/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+   +D + +SS     FD+EAAVR+AND VS TF+VVSKGVR++PGS  S
Sbjct  20    LLADWNAYAAASNADDEDSSS-----FDIEAAVRTANDKVSSTFSVVSKGVRELPGSFNS  74

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             +TS++PSGK+LMYFG+FLA+G+ FIF+ F +FLPV+VL PQKFAICFT+GC FI+GSFFA
Sbjct  75    STSSVPSGKSLMYFGIFLATGIFFIFVGFTIFLPVMVLKPQKFAICFTIGCAFIVGSFFA  134

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM SKERLPFTLGF+GSM GT+YVSM LHSYILSVLFSV+QV+AL YYA+S
Sbjct  135   LKGPKNQLMHMLSKERLPFTLGFIGSMAGTIYVSMVLHSYILSVLFSVLQVLALSYYAIS  194

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++VSS+ +CFGR
Sbjct  195   YFPGGSAGLKFLSSTLVSSLFRCFGR  220



>ref|XP_004491532.1| PREDICTED: protein transport protein SFT2-like [Cicer arietinum]
Length=224

 Score =   306 bits (783),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 182/206 (88%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYAS++      ++ S    FDLE+AVRSAN+TV+GTF+VVSK VRDIPG+LQS
Sbjct  23    LLADWNSYASSQELQPSNSAIS----FDLESAVRSANNTVTGTFSVVSKSVRDIPGNLQS  78

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKAL+YFGLFLASGV FIF+AF LFLPV+V++PQKFAICFTLGC FIIGSFFA
Sbjct  79    ATSSVPSGKALLYFGLFLASGVFFIFIAFTLFLPVMVVMPQKFAICFTLGCGFIIGSFFA  138

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ +HM+SKERLPFTLGF+ SM+GT+YVSM  HSYILSV+FSV+QV++L YY++S
Sbjct  139   LKGPKNQLSHMTSKERLPFTLGFICSMVGTIYVSMVRHSYILSVVFSVVQVLSLGYYSIS  198

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG++FL+S++ S ++ CFGR
Sbjct  199   YFPGGSAGMRFLTSALTSRIMNCFGR  224



>ref|XP_009798045.1| PREDICTED: protein transport protein SFT2-like [Nicotiana sylvestris]
Length=223

 Score =   305 bits (780),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 177/206 (86%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+ +  +G   SSS    FDLEAAVR   D VSGTFNVVSKGVRD+PGS  S
Sbjct  24    LLADWNAYAAAQNEEG---SSSSDLGFDLEAAVR---DKVSGTFNVVSKGVRDLPGSFSS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSGK+LMYFGLFLA+GV FIF+AF +FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  78    ATSNVPSGKSLMYFGLFLAAGVFFIFIAFTMFLPVMVLMPQKFAICFTIGCAFIIGSFFA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM+SKERLPFT  F+GSM+GT+YVSM LHSYILSVLFSVIQV+AL YY +S
Sbjct  138   LKGPKNQLTHMTSKERLPFTGLFVGSMVGTIYVSMVLHSYILSVLFSVIQVLALSYYVIS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG++FLSS++ S++ +CFGR
Sbjct  198   YFPGGSAGMRFLSSTLTSTIFRCFGR  223



>ref|XP_010063238.1| PREDICTED: protein transport protein sft2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW70447.1| hypothetical protein EUGRSUZ_F03671 [Eucalyptus grandis]
Length=248

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 183/217 (84%), Gaps = 14/217 (6%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGT-----------FNVVSK  2094
             LLADWNSYAS++ + GD A   +   FD+E+AV+SAND+VSGT             VVSK
Sbjct  35    LLADWNSYASSREA-GDDAGFGI--GFDIESAVKSANDSVSGTLSLSLSLSLSLIRVVSK  91

Query  2093  GVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTL  1914
             GVR++PG+ QSA S +PSGKALMYFGLFLASGV FI +AF +FLPV+VL+PQKFAICFTL
Sbjct  92    GVRELPGNFQSAASTVPSGKALMYFGLFLASGVFFIVIAFTMFLPVMVLMPQKFAICFTL  151

Query  1913  GCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVI  1734
             GCCFIIGSFFAL+G  NQ +HMSSKERLPFT+GF+GSM+GT+YVSM LHSYILSVLFS++
Sbjct  152   GCCFIIGSFFALKGPMNQLSHMSSKERLPFTVGFVGSMVGTIYVSMVLHSYILSVLFSIL  211

Query  1733  QVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             QV+AL+YY +SYFPGGSAG+KFLSS++ SSV++CFGR
Sbjct  212   QVLALVYYVISYFPGGSAGMKFLSSTLTSSVMRCFGR  248



>ref|XP_009605080.1| PREDICTED: protein transport protein SFT2-like [Nicotiana tomentosiformis]
Length=223

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 176/206 (85%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+ K  +G   SSS    FDLEAAVR   D VSGTFNVVSKGVRD+PGS  S
Sbjct  24    LLADWNAYAAAKNEEG---SSSSDLGFDLEAAVR---DKVSGTFNVVSKGVRDLPGSFSS  77

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PSG++LMYFGLFLA+GV FIF+AF +FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  78    ATSNVPSGRSLMYFGLFLAAGVFFIFIAFTMFLPVMVLMPQKFAICFTIGCAFIIGSFFA  137

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM+SKERLPFT  F+GSM+GT+Y SM LHSYILSVLFSVIQV+AL YY +S
Sbjct  138   LKGPKNQLTHMTSKERLPFTGVFVGSMVGTIYFSMVLHSYILSVLFSVIQVLALSYYVIS  197

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG++FLSS++ S++ +CFGR
Sbjct  198   YFPGGSAGMRFLSSTLTSTIFRCFGR  223



>ref|XP_010314094.1| PREDICTED: uncharacterized protein LOC101244061 [Solanum lycopersicum]
Length=298

 Score =   306 bits (784),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 202/261 (77%), Gaps = 5/261 (2%)
 Frame = +1

Query  235   CIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLKTF  414
             CIYVAKIA +F ++T TWSKN+ SHTL I+VE+  EE H+TCKIDLK+WQFWGKKGLK+F
Sbjct  38    CIYVAKIAHIFHAITTTWSKNMTSHTLDIIVEHLSEERHFTCKIDLKSWQFWGKKGLKSF  97

Query  415   KVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPSLV  594
             +V +KR DIYWD++SAKFS+ PE VS Y++AL   G+++LL+GDQ KEA KRTKS P+++
Sbjct  98    RVGEKRTDIYWDLRSAKFSTRPEPVSDYYVALVSEGDMVLLIGDQNKEAFKRTKSLPAML  157

Query  595   AAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVN  771
              A+L+HKKE+  AK  F TRT+LGQ KK+H I IES +SG ++P M ISV+G   IRI N
Sbjct  158   DASLLHKKETIYAKKCFCTRTMLGQGKKQHDITIESVLSGPSDPAMQISVNGTVAIRIAN  217

Query  772   LHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDETDE  951
             LHWRFRGNE + +D+VPVE+FWDVHDWLY   N GPG FIFKQ   ++  S+S+T+  DE
Sbjct  218   LHWRFRGNEKVFLDNVPVEIFWDVHDWLYSGPNYGPGSFIFKQGKLEERYSDSETNINDE  277

Query  952   D----YPSTDFCHIFYAWKLQ  1002
             +     P T+FCH  YAWK +
Sbjct  278   NCDLQSPCTEFCHFLYAWKTE  298



>ref|XP_009137600.1| PREDICTED: protein transport protein sft2-like [Brassica rapa]
Length=232

 Score =   303 bits (775),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 181/206 (88%), Gaps = 1/206 (0%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T+    +G   S    FD+E+AVRSANDTVSGTF+VVSKGVRDIPG+L S
Sbjct  28    LLADWNSYAATR-DVEEGGGGSGSFGFDIESAVRSANDTVSGTFSVVSKGVRDIPGNLSS  86

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  87    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  146

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP T+GF+ +M+GT+YVSM LHSYILSV+FSV+QV+AL+YY +S
Sbjct  147   LRGPQNQLAHMSSMERLPLTIGFIATMVGTIYVSMVLHSYILSVVFSVLQVLALVYYCIS  206

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SSVL+ FGR
Sbjct  207   YFPGGSSGMRFLSSALTSSVLRVFGR  232



>ref|XP_004965916.1| PREDICTED: protein transport protein SFT2-like [Setaria italica]
Length=225

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 178/208 (86%), Gaps = 8/208 (4%)
 Frame = -3

Query  2240  LLADWNSYASTKASD--GDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSL  2067
             LLADWNSYA+ ++S+  GDG         D+EAAVRSAND V+GTF VVSKGV+ +PGS 
Sbjct  24    LLADWNSYAAARSSEDAGDGF------GIDIEAAVRSANDRVAGTFGVVSKGVKGLPGSF  77

Query  2066  QSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSF  1887
             +S TS++PSG++LMYFGLFLASGV  +F+AF +FLPV+V++PQKFAICFT GC FIIGSF
Sbjct  78    KSTTSSVPSGRSLMYFGLFLASGVFLVFIAFTIFLPVMVIMPQKFAICFTAGCAFIIGSF  137

Query  1886  FALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYA  1707
             FAL+G KNQ  HM SKERLPFT+GF+GSM+ T+YVSM LHSYILSV FSV+QV+AL YYA
Sbjct  138   FALKGPKNQLYHMISKERLPFTVGFVGSMVATIYVSMVLHSYILSVFFSVLQVLALAYYA  197

Query  1706  VSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             +SYFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  198   ISYFPGGSAGMKFLSSALVSSVLRCFGR  225



>ref|XP_002524595.1| Protein transport protein SFT2, putative [Ricinus communis]
 gb|EEF37803.1| Protein transport protein SFT2, putative [Ricinus communis]
Length=225

 Score =   300 bits (769),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 179/206 (87%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLA+WN+YA+++ S       S    FDLEAAVR+ +D  +GTFNVVSKGVRD+PG+ QS
Sbjct  26    LLANWNAYAASQDS------DSSSLGFDLEAAVRTTSDKFTGTFNVVSKGVRDLPGNFQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             AT+N+PSGK+LMYFG+ LA+GV FIF+AF +FLPV+VLVPQKFAICFT+GC FIIGSFFA
Sbjct  80    ATTNVPSGKSLMYFGVLLAAGVFFIFIAFTMFLPVMVLVPQKFAICFTVGCAFIIGSFFA  139

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G +NQ AHMSSKERLPFTLGF+G+M+GT+YVSM LHSY+LSVLFSV+QV+AL YYA+S
Sbjct  140   LKGPRNQLAHMSSKERLPFTLGFIGTMVGTVYVSMVLHSYVLSVLFSVLQVLALSYYAIS  199

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS GLKFLSS+  SS+L+CFGR
Sbjct  200   YFPGGSTGLKFLSSTFTSSLLRCFGR  225



>ref|XP_002437264.1| hypothetical protein SORBIDRAFT_10g023840 [Sorghum bicolor]
 gb|EER88631.1| hypothetical protein SORBIDRAFT_10g023840 [Sorghum bicolor]
Length=225

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 179/208 (86%), Gaps = 8/208 (4%)
 Frame = -3

Query  2240  LLADWNSYASTKASD--GDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSL  2067
             LLA+WNSYA+ ++++  GDG         D+EAAVRSAND V+GTF VVSKGV+ +PGS 
Sbjct  24    LLAEWNSYAAARSAEDAGDGF------GIDIEAAVRSANDRVAGTFGVVSKGVKGLPGSF  77

Query  2066  QSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSF  1887
             +S TS++PSGK+LMYFGLFLASGV  +F+AF +FLPV+V++PQKFAICFT+GC FIIGSF
Sbjct  78    KSTTSSVPSGKSLMYFGLFLASGVFLVFIAFTIFLPVMVIMPQKFAICFTVGCAFIIGSF  137

Query  1886  FALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYA  1707
             FAL+G KNQ  HM SKERLPFT+GF+GSM+ T+YVSM LHSYILSV FSV+QV+AL YYA
Sbjct  138   FALKGPKNQLYHMISKERLPFTVGFVGSMVATIYVSMVLHSYILSVFFSVLQVLALAYYA  197

Query  1706  VSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             +SYFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  198   ISYFPGGSAGMKFLSSALVSSVLRCFGR  225



>emb|CDX92816.1| BnaC07g40740D [Brassica napus]
Length=232

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+ +    +G   S    FD+E+AVRSANDTVSGTF+VVSKGVRDIPG+L S
Sbjct  28    LLADWNSYAAAR-DVEEGGGGSGSFGFDIESAVRSANDTVSGTFSVVSKGVRDIPGNLSS  86

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  87    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  146

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP T+GF+ +M+GT+YVSM LHSYILSV+FSV+QV+AL+YY +S
Sbjct  147   LRGPQNQLAHMSSMERLPLTIGFIATMVGTIYVSMVLHSYILSVVFSVLQVLALVYYCIS  206

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SSVL+ FGR
Sbjct  207   YFPGGSSGMRFLSSALTSSVLRVFGR  232



>ref|XP_004958522.1| PREDICTED: protein transport protein SFT2-like [Setaria italica]
Length=228

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 189/233 (81%), Gaps = 10/233 (4%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WF+G +A   A   + Q +      LLADWNSYA+T++   D +SSS +  FD+EAAV
Sbjct  6     QAWFTGGTAASSATAGESQPS------LLADWNSYAATRS---DASSSSPLP-FDIEAAV  55

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTF+ V+KGVR++PGS QSATS+ PSGKALMYFGLFLA+G+ F+F+AFALFL
Sbjct  56    RSANDTVSGTFSSVTKGVRELPGSFQSATSSFPSGKALMYFGLFLATGIFFVFIAFALFL  115

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAI FTLGC  II S FAL+G  NQ AHM+SKERLPF++GF+G M+GT+YV
Sbjct  116   PVMVLMPQKFAISFTLGCALIIASLFALKGPANQLAHMTSKERLPFSVGFVGCMVGTIYV  175

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SM LHSY LSV+FSV+QV+AL YY +SYFPGGS+GLKF+SS ++SS   CFGR
Sbjct  176   SMVLHSYFLSVIFSVLQVLALAYYTISYFPGGSSGLKFISSGLLSSATSCFGR  228



>emb|CDY42730.1| BnaA03g48090D [Brassica napus]
Length=233

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 180/206 (87%), Gaps = 1/206 (0%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+ +    +G   S    FD+E+AVRSANDTVSGTF+VVSKGVRDIPG+L S
Sbjct  29    LLADWNSYAAAR-DVEEGGGGSGSFGFDIESAVRSANDTVSGTFSVVSKGVRDIPGNLSS  87

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  88    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  147

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP T+GF+ +M+GT+YVSM LHSYILSV+FSV+QV+AL+YY +S
Sbjct  148   LRGPQNQLAHMSSMERLPLTIGFIATMVGTIYVSMVLHSYILSVVFSVLQVLALVYYCIS  207

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G++FLSS++ SSVL+ FGR
Sbjct  208   YFPGGSSGMRFLSSALTSSVLRVFGR  233



>ref|XP_010450575.1| PREDICTED: protein transport protein SFT2-like [Camelina sativa]
Length=234

 Score =   300 bits (769),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 178/206 (86%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  + D A +    +FD+E+AVRSANDTVSGTFNVVSKGVRD   +LQS
Sbjct  35    LLADWNSYAASRDFEEDTAGT---LSFDIESAVRSANDTVSGTFNVVSKGVRD---NLQS  88

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  89    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  148

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSV+FS +QV+AL YY +S
Sbjct  149   LRGPQNQLAHMSSTERLPLTLGFIATMVGTIYVSMVLHSYILSVIFSALQVVALAYYCIS  208

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFL+S++ SSV + FGR
Sbjct  209   YFPGGSSGMKFLTSTLTSSVFRMFGR  234



>ref|XP_003617877.1| Protein transport protein SFT2 [Medicago truncatula]
 gb|AET00836.1| Got1/SFT2-like vescicle transporter family protein [Medicago 
truncatula]
Length=245

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 182/203 (90%), Gaps = 3/203 (1%)
 Frame = -3

Query  2231  DWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQSATS  2052
             DWNSYAS++  D D ++S++  +FDLE+AVRSAN+TV+GTF+VVSK VRDIPG+ QSATS
Sbjct  30    DWNSYASSQ-QDQDPSNSAI--SFDLESAVRSANNTVTGTFSVVSKSVRDIPGNFQSATS  86

Query  2051  NIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFALRG  1872
             ++PSGKAL+YFGLFLASGV FIF+AF LFLPV+V++PQKFA+CFTLGC FIIGSFFAL+G
Sbjct  87    SVPSGKALLYFGLFLASGVFFIFIAFTLFLPVMVVMPQKFALCFTLGCGFIIGSFFALKG  146

Query  1871  TKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYFP  1692
              KNQ +HM SKERLPFTLGF+ SM GT+YVSM  HSYILSV+FSV+QV++L YYA+SYFP
Sbjct  147   PKNQLSHMFSKERLPFTLGFILSMFGTIYVSMVRHSYILSVVFSVVQVLSLGYYAISYFP  206

Query  1691  GGSAGLKFLSSSMVSSVLKCFGR  1623
             GGSAG++FL+S+++S ++ CFGR
Sbjct  207   GGSAGMRFLTSALMSRIMTCFGR  229



>dbj|BAJ93024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   300 bits (767),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 185/231 (80%), Gaps = 11/231 (5%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WF+G +A      + Q +       LLADWNSYA+T+    D +SSS +  FD+EAAV
Sbjct  6     QSWFTGGTASPSTAAESQPS-------LLADWNSYAATRP---DASSSSPLP-FDIEAAV  54

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTFNVV+KGVR++PGS Q ATS+ PSGKALMYFGLFLA+G+ F+F+AF LFL
Sbjct  55    RSANDTVSGTFNVVTKGVRELPGSFQGATSSFPSGKALMYFGLFLATGIFFVFIAFTLFL  114

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC  II S FAL+G  NQ AHM+SKERLPFT+GF G M+GT+YV
Sbjct  115   PVMVLMPQKFAICFTLGCALIIASLFALKGPANQLAHMTSKERLPFTVGFTGCMVGTIYV  174

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCF  1629
             SM LHSY LSV+FS++QV+AL YY +SYFPGGS+GLKFLSSS++S V + F
Sbjct  175   SMVLHSYFLSVIFSILQVLALAYYTISYFPGGSSGLKFLSSSLMSPVSRIF  225



>ref|XP_002320536.2| hypothetical protein POPTR_0014s16880g [Populus trichocarpa]
 gb|EEE98851.2| hypothetical protein POPTR_0014s16880g [Populus trichocarpa]
Length=227

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = -3

Query  2231  DWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQSATS  2052
             DWN+YA+++ SD           FDLEAAVR+ +D VSGTFNVVSKGVRDIPGS QS+T 
Sbjct  31    DWNAYAASQESDSSAP------VFDLEAAVRTTSDKVSGTFNVVSKGVRDIPGSFQSSTI  84

Query  2051  NIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFALRG  1872
             N+PSG++ +YFG+ LA+GV F+F+AF +FLPV+VLVPQKFAICFT+GC  I+ SFFAL+G
Sbjct  85    NVPSGQSFVYFGILLAAGVFFVFIAFTMFLPVMVLVPQKFAICFTIGCALIVASFFALKG  144

Query  1871  TKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYFP  1692
              KNQ AHM SKERLPFTLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL YYA+SYFP
Sbjct  145   PKNQLAHMISKERLPFTLGFISTMVGTVYVSMVLHSYILSVLFSVLQVLALSYYAISYFP  204

Query  1691  GGSAGLKFLSSSMVSSVLKCFGR  1623
             GGS GLKFLSS++ +S+L+CFGR
Sbjct  205   GGSTGLKFLSSTLTASILRCFGR  227



>ref|XP_011009811.1| PREDICTED: protein transport protein SFT2-like [Populus euphratica]
Length=226

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 172/203 (85%), Gaps = 6/203 (3%)
 Frame = -3

Query  2231  DWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQSATS  2052
             DWN+YA+++ SD           FDLEAAVR+ +D VSGTFNVVSKGVRDIPGS QS+T 
Sbjct  30    DWNAYAASQESDSSAP------VFDLEAAVRTTSDKVSGTFNVVSKGVRDIPGSFQSSTI  83

Query  2051  NIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFALRG  1872
             N+PSG++ +YFG+ LA+GV F+F+AF +FLPV+VLVPQKFAICFT+GC  I+ SFFAL+G
Sbjct  84    NVPSGQSFVYFGILLAAGVFFVFIAFTMFLPVMVLVPQKFAICFTIGCALIVASFFALKG  143

Query  1871  TKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYFP  1692
              KNQ AHM SKERLPFTLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL YYA+SYFP
Sbjct  144   PKNQLAHMFSKERLPFTLGFISTMVGTVYVSMVLHSYILSVLFSVLQVLALSYYAISYFP  203

Query  1691  GGSAGLKFLSSSMVSSVLKCFGR  1623
             GGS GLKFLSS++ +S+L+CFGR
Sbjct  204   GGSTGLKFLSSTLTASILRCFGR  226



>dbj|BAK05482.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=227

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 177/206 (86%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLA+WNSYA+ ++++ D      I   D+EAAVRSAND VSGTF VVSKGVR +PGS QS
Sbjct  25    LLAEWNSYAAARSAEEDVGGGFGI---DIEAAVRSANDRVSGTFGVVSKGVRGLPGSFQS  81

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             +TS+IPSGK+LMYFGLFLASG+  +F+AF +FLPV+V++PQKFAICFTLGC FIIGSFFA
Sbjct  82    STSSIPSGKSLMYFGLFLASGIFLVFIAFTIFLPVMVIMPQKFAICFTLGCAFIIGSFFA  141

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM S+ERLPFT+G +GSM  T+YVSM LHSYILSV FS +Q++AL+YYA+S
Sbjct  142   LKGPKNQLYHMISRERLPFTIGLVGSMFATIYVSMVLHSYILSVFFSCLQILALVYYAIS  201

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++V+SVL+CFGR
Sbjct  202   YFPGGSAGMKFLSSTLVASVLRCFGR  227



>gb|ACN85266.1| putative SFT2 protein [Oryza alta]
Length=228

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 183/234 (78%), Gaps = 6/234 (3%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG+     +      +  +    LLA+WNSYA+ ++++ D          D+EAA
Sbjct  1     MQAWFSGTGPSASSSSSSSSSQPS----LLAEWNSYAAARSAEED--GGGGGFGIDIEAA  54

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSAND VSGTF VVSKGV  +PGS +S TSN+PS K+LMYFGLFLASG+  +F+AF +F
Sbjct  55    VRSANDRVSGTFGVVSKGVLGLPGSFKSTTSNVPSSKSLMYFGLFLASGIFLVFIAFTIF  114

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFT GC FIIGSFFAL+G KNQ  HM SKERLPFT+GF+GSM+ T+Y
Sbjct  115   LPVMVIMPQKFAICFTAGCAFIIGSFFALKGPKNQLYHMISKERLPFTMGFVGSMVATIY  174

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV FS +QV+AL YYA+SYFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  175   VSMVLHSYILSVFFSCLQVLALAYYAISYFPGGSAGMKFLSSALVSSVLRCFGR  228



>ref|NP_200413.1| Got1/Sft2-like vescicle transport protein [Arabidopsis thaliana]
 dbj|BAB09284.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96710.1| Got1/Sft2-like vescicle transport protein [Arabidopsis thaliana]
Length=230

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 176/206 (85%), Gaps = 7/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  + D  +      FD+E+AVRSANDTVSGTFNVVSKGVRD   +LQS
Sbjct  32    LLADWNSYAASRDFEEDTGT----LGFDIESAVRSANDTVSGTFNVVSKGVRD---NLQS  84

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  85    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  144

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSV+FS +QV+AL YY +S
Sbjct  145   LRGPQNQLAHMSSAERLPLTLGFIATMVGTIYVSMVLHSYILSVIFSALQVIALAYYCIS  204

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFLSS++ SSV + FGR
Sbjct  205   YFPGGSSGMKFLSSTLTSSVFRMFGR  230



>gb|AAT41731.1| At5g56020 [Arabidopsis thaliana]
 gb|AAU05517.1| At5g56020 [Arabidopsis thaliana]
Length=227

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 176/206 (85%), Gaps = 7/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  + D  +      FD+E+AVRSANDTVSGTFNVVSKGVRD   +LQS
Sbjct  29    LLADWNSYAASRDFEEDTGT----LGFDIESAVRSANDTVSGTFNVVSKGVRD---NLQS  81

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  82    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  141

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSV+FS +QV+AL YY +S
Sbjct  142   LRGPQNQLAHMSSAERLPLTLGFIATMVGTIYVSMVLHSYILSVIFSALQVIALAYYCIS  201

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFLSS++ SSV + FGR
Sbjct  202   YFPGGSSGMKFLSSTLTSSVFRMFGR  227



>ref|XP_002864425.1| hypothetical protein ARALYDRAFT_495689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40684.1| hypothetical protein ARALYDRAFT_495689 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score =   298 bits (762),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 176/206 (85%), Gaps = 7/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  + D  +      FD+E+AVRSANDTVSGTFNVVSKGVRD   +LQS
Sbjct  32    LLADWNSYAASRDFEEDPGT----LGFDIESAVRSANDTVSGTFNVVSKGVRD---NLQS  84

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  85    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  144

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSV+FS +QV+AL YY +S
Sbjct  145   LRGPQNQLAHMSSAERLPLTLGFIATMVGTIYVSMVLHSYILSVIFSALQVVALAYYCIS  204

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFLSS++ SSV + FGR
Sbjct  205   YFPGGSSGMKFLSSTLTSSVFRMFGR  230



>dbj|BAJ93185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   297 bits (761),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 184/231 (80%), Gaps = 11/231 (5%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WF+G +A      + Q +       LLADW SYA+T+    D +SSS +  FD+EAAV
Sbjct  6     QSWFTGGTASPSTAAESQPS-------LLADWKSYAATRP---DASSSSPLP-FDIEAAV  54

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTFNVV+KGVR++PGS Q ATS+ PSGKALMYFGLFLA+G+ F+F+AF LFL
Sbjct  55    RSANDTVSGTFNVVTKGVRELPGSFQGATSSFPSGKALMYFGLFLATGIFFVFIAFTLFL  114

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC  II S FAL+G  NQ AHM+SKERLPFT+GF G M+GT+YV
Sbjct  115   PVMVLMPQKFAICFTLGCALIIASLFALKGPANQLAHMTSKERLPFTVGFTGCMVGTIYV  174

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCF  1629
             SM LHSY LSV+FS++QV+AL YY +SYFPGGS+GLKFLSSS++S V + F
Sbjct  175   SMVLHSYFLSVIFSILQVLALAYYTISYFPGGSSGLKFLSSSLMSPVSRIF  225



>gb|ACR36108.1| unknown [Zea mays]
 tpg|DAA41612.1| TPA: protein SFT2 [Zea mays]
Length=228

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T++   D +SSS +  FD+EAAVRSANDTVSGT + V+KGVR++PGS QS
Sbjct  27    LLADWNSYAATRS---DASSSSPLP-FDIEAAVRSANDTVSGTLSSVTKGVRELPGSFQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLA+G+ F+F+AFALFLPV+VL+PQKFAI FTLGC  II S FA
Sbjct  83    ATSSFPSGKALMYFGLFLATGIFFVFIAFALFLPVMVLMPQKFAISFTLGCALIIASLFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G  NQ AHM+SKERLPF++GF+G M+GT+YVSM LHSY LSV+FSV+QV+AL YY +S
Sbjct  143   LKGPANQLAHMTSKERLPFSVGFIGCMVGTIYVSMVLHSYFLSVIFSVLQVLALAYYTIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+GLKF+SS ++SS   CFGR
Sbjct  203   YFPGGSSGLKFISSGLLSSATSCFGR  228



>ref|XP_010445112.1| PREDICTED: protein transport protein SFT2-like [Camelina sativa]
Length=263

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 183/241 (76%), Gaps = 39/241 (16%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+VVSKGVRDIPGSLQS
Sbjct  27    LLADWNSYAASREFEESGGS----FGFDIESAVRSANDTVSGTFSVVSKGVRDIPGSLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFAICFT+GC FIIGSFFA
Sbjct  83    ATSSMPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFAICFTIGCGFIIGSFFA  142

Query  1880  LRGTKNQFAHMSSKE-----------------------------------RLPFTLGFLG  1806
             LRG +NQ AHMSS E                                   RLP TLGF+ 
Sbjct  143   LRGPQNQLAHMSSMERLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQRLPSTLGFIA  202

Query  1805  SMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFG  1626
             +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +SYFPGGS+G++FLSS++ SSVL+ FG
Sbjct  203   TMVGTIYVSMVLHSYILSVLFSVLQVLALIYYCISYFPGGSSGMRFLSSALTSSVLRVFG  262

Query  1625  R  1623
             R
Sbjct  263   R  263



>ref|NP_001149600.1| protein SFT2 [Zea mays]
 gb|ACG36013.1| protein SFT2 [Zea mays]
Length=228

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 176/206 (85%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA T++   D +SSS +  FD+EAAVRSANDTVSGT + V+KGVR++PGS QS
Sbjct  27    LLADWNSYAPTRS---DASSSSPLP-FDIEAAVRSANDTVSGTLSSVTKGVRELPGSFQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLA+G+ F+F+AFALFLPV+VL+PQKFAI FTLGC  II S FA
Sbjct  83    ATSSFPSGKALMYFGLFLATGIFFVFIAFALFLPVMVLMPQKFAISFTLGCALIIASLFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G  NQ AHM+SKERLPF++GF+G M+GT+YVSM LHSY LSV+FSV+QV+AL YY +S
Sbjct  143   LKGPANQLAHMTSKERLPFSVGFIGCMVGTIYVSMVLHSYFLSVIFSVLQVLALAYYTIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+GLKF+SS ++SS   CFGR
Sbjct  203   YFPGGSSGLKFISSGLLSSATSCFGR  228



>ref|NP_001150517.1| protein SFT2 [Zea mays]
 gb|ACG39380.1| protein SFT2 [Zea mays]
Length=225

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 177/208 (85%), Gaps = 8/208 (4%)
 Frame = -3

Query  2240  LLADWNSYASTKASD--GDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSL  2067
             LLA+WNSYA+ ++++  GDG         D+E AVRSAND V+GTF VVSKGV+ +PGS 
Sbjct  24    LLAEWNSYAAARSAEDAGDGF------GIDIETAVRSANDRVAGTFGVVSKGVKGLPGSF  77

Query  2066  QSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSF  1887
             +S TS++PSG++LMYFGLFL SGV  +F+AF +FLPV+V++PQKFAICFT+GC FIIGSF
Sbjct  78    KSTTSSVPSGRSLMYFGLFLGSGVFLVFIAFTIFLPVMVIMPQKFAICFTVGCAFIIGSF  137

Query  1886  FALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYA  1707
             FAL+G KNQ  HM SKERLPFT+GF+GSM+ T+YVSM LHSYILSV FSV+QV+AL YYA
Sbjct  138   FALKGPKNQLYHMISKERLPFTMGFVGSMVATIYVSMVLHSYILSVFFSVLQVLALAYYA  197

Query  1706  VSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             +SYFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  198   ISYFPGGSAGMKFLSSAVVSSVLRCFGR  225



>gb|ACN28608.1| unknown [Zea mays]
 gb|AFW87251.1| protein SFT2 [Zea mays]
Length=225

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 177/208 (85%), Gaps = 8/208 (4%)
 Frame = -3

Query  2240  LLADWNSYASTKASD--GDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSL  2067
             LLA+WNSYA+ ++++  GDG         D+EAAVRSAND V+GTF VVSKGV+  PGS 
Sbjct  24    LLAEWNSYAAARSAEDAGDGF------GIDIEAAVRSANDRVAGTFGVVSKGVKGFPGSF  77

Query  2066  QSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSF  1887
             +S TS++PSG++LMYFGLFL SGV  +F+AF +FLPV+V++PQKFAICFT+GC FIIGSF
Sbjct  78    KSTTSSVPSGRSLMYFGLFLGSGVFLVFIAFTIFLPVMVIMPQKFAICFTVGCAFIIGSF  137

Query  1886  FALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYA  1707
             FAL+G KNQ  HM SKERLPFT+GF+GSM+ T+YVSM LHSYILSV FSV+QV+AL YYA
Sbjct  138   FALKGPKNQLYHMISKERLPFTMGFVGSMVATIYVSMVLHSYILSVFFSVLQVLALAYYA  197

Query  1706  VSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             +SYFPGGSAG+KF+SS++VSSVL+CFGR
Sbjct  198   ISYFPGGSAGMKFISSAVVSSVLRCFGR  225



>ref|XP_009763291.1| PREDICTED: uncharacterized protein LOC104215233 [Nicotiana sylvestris]
Length=302

 Score =   299 bits (765),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 199/268 (74%), Gaps = 10/268 (4%)
 Frame = +1

Query  229   IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLK  408
             + CIYVAK+A  F ++T TWSKNL SHTL+IVVEN  EE H+TCKIDLK+WQFWGKKG K
Sbjct  35    VTCIYVAKVAKNFHAITTTWSKNLTSHTLYIVVENLSEETHFTCKIDLKSWQFWGKKGFK  94

Query  409   TFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPS  588
             +FKV +KR DIYWD++SAKFSS PE VS Y++AL   GE++LLLGDQ KEA KRTKS+P+
Sbjct  95    SFKVGEKRADIYWDLRSAKFSSRPEPVSDYYVALVSEGEMILLLGDQNKEAFKRTKSRPA  154

Query  589   LVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRI  765
             L+   LVHKKE+  AK  F TRT+LGQ KK+H I IE  +SG ++P MWISVDG   IRI
Sbjct  155   LMDVVLVHKKETVYAKKYFCTRTMLGQGKKQHDITIECVISGPSDPAMWISVDGTVSIRI  214

Query  766   VNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTN-----KDEASNS  930
              NLHWRFRGNET+ VD+VPVE+FWDVHDWLY   ++GPG FIFKQ  N     + + SN 
Sbjct  215   TNLHWRFRGNETVFVDNVPVEIFWDVHDWLYSGPHSGPGTFIFKQDNNGSGKLERKYSNF  274

Query  931   QT----DETDEDYPSTDFCHIFYAWKLQ  1002
             +       +D     T+F +  YAWK++
Sbjct  275   EGYISDGSSDLQSACTEFWYFLYAWKIE  302



>ref|XP_006281046.1| hypothetical protein CARUB_v10027062mg [Capsella rubella]
 gb|EOA13944.1| hypothetical protein CARUB_v10027062mg [Capsella rubella]
Length=228

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 175/206 (85%), Gaps = 7/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LL+DWNSYA+++  + D    S    FD+E+AVRSANDTVSGTFNV S+GVRD   +LQS
Sbjct  30    LLSDWNSYAASRDFEEDTGGLS----FDIESAVRSANDTVSGTFNVFSRGVRD---NLQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  83    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG KNQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSV+FS +QV+AL YY +S
Sbjct  143   LRGPKNQLAHMSSPERLPLTLGFIATMVGTIYVSMVLHSYILSVIFSALQVIALAYYCIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+G+KFL+S++ SSV + FGR
Sbjct  203   YFPGGSSGMKFLTSTLTSSVFRMFGR  228



>emb|CDP20579.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 189/233 (81%), Gaps = 11/233 (5%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WFSG  + D  +             LLADWN+YA+++ S+   +SS L   FDLEAAV
Sbjct  6     QAWFSGGPSSDLQKAPSS---------LLADWNAYATSRESEDAESSSGL--GFDLEAAV  54

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             R+AND VSGTFNVVSKGVRD+PG+ QSATS++PSGK+L+YFG+ LASGV FI +AF++FL
Sbjct  55    RTANDKVSGTFNVVSKGVRDLPGNFQSATSSVPSGKSLLYFGILLASGVFFIIIAFSIFL  114

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+V+ PQKFA+CFT+GC FIIGSFFAL+G K+Q  HMSSKERLPFTLGF+GS +GT+YV
Sbjct  115   PVMVIAPQKFALCFTIGCAFIIGSFFALKGPKDQLGHMSSKERLPFTLGFIGSTVGTIYV  174

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SM LHSYILSV FS++QV+AL YYA+SYFPGGS GLKFL S++ SS+L+CFGR
Sbjct  175   SMVLHSYILSVFFSLLQVIALSYYAISYFPGGSVGLKFLFSTLTSSLLRCFGR  227



>ref|XP_006656231.1| PREDICTED: protein transport protein SFT2-like [Oryza brachyantha]
 gb|ACN85312.1| putative SFT2 protein [Oryza brachyantha]
Length=229

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLA+WNSYA+ ++++ DG    +    D+EAAVRSAND V+GTF VVSKGV  +PGS +S
Sbjct  28    LLAEWNSYAAARSAEEDGGGFGI----DIEAAVRSANDRVAGTFGVVSKGVLGLPGSFKS  83

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
              TS++PS K+L+YFGLFLASG   +F+AF +FLPV+V++PQKFAICFT GC FIIGSFFA
Sbjct  84    TTSSVPSSKSLLYFGLFLASGTFLVFIAFTIFLPVMVIMPQKFAICFTAGCAFIIGSFFA  143

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM SKERLPFTLGF+GSM+ T+YVSM LHSYILSV FS +QV+AL YYA+S
Sbjct  144   LKGPKNQLYHMISKERLPFTLGFVGSMVATIYVSMVLHSYILSVFFSCLQVLALAYYAIS  203

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  204   YFPGGSAGMKFLSSALVSSVLRCFGR  229



>ref|XP_003563640.1| PREDICTED: protein transport protein SFT2-like [Brachypodium 
distachyon]
Length=226

 Score =   292 bits (747),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 175/206 (85%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLA+WNSYAS ++++ +      I   D+EAAVRSAND V+GTF VVSKGV+ +P S QS
Sbjct  25    LLAEWNSYASARSAEEEAGGGFGI---DIEAAVRSANDRVAGTFGVVSKGVKGLP-SFQS  80

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
              TS++PSGK+LMYFGLFLASG+  +F+AF +FLPV+V++PQKFAICFT+GC FIIGSFFA
Sbjct  81    TTSSVPSGKSLMYFGLFLASGIFLVFIAFTIFLPVMVIMPQKFAICFTIGCAFIIGSFFA  140

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ  HM SKERLPFT+GFLGSM  T+YVSM LHSYILSV FS +Q++AL YYA+S
Sbjct  141   LKGPKNQLYHMISKERLPFTIGFLGSMFATIYVSMVLHSYILSVFFSCLQILALAYYAIS  200

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAG+KFLSS++V+SVL+CFGR
Sbjct  201   YFPGGSAGMKFLSSALVASVLRCFGR  226



>ref|XP_009390596.1| PREDICTED: protein transport protein SFT2-like [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++++++  GAS+     FD+E+AV+SAND V+GTFNVVSKG+ ++PG  QS
Sbjct  28    LLADWNSYAASRSTEEGGASA---FGFDIESAVQSANDKVTGTFNVVSKGMTELPGIFQS  84

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGK+LMYFGL LASGV FI +AF +FLPV+VL+PQKFA+CFTLGC  IIGSFFA
Sbjct  85    ATSSVPSGKSLMYFGLLLASGVFFIVVAFTMFLPVMVLMPQKFALCFTLGCALIIGSFFA  144

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM S ERLPFTL F+GSM+GT+YVSM LHSYILSVLFSVIQV+AL YY+VS
Sbjct  145   LKGPKNQLAHMFSMERLPFTLVFIGSMVGTIYVSMVLHSYILSVLFSVIQVVALSYYSVS  204

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS GL+FLSSS+ SS+LKCFGR
Sbjct  205   YFPGGSTGLRFLSSSITSSILKCFGR  230



>ref|XP_002461133.1| hypothetical protein SORBIDRAFT_02g041270 [Sorghum bicolor]
 gb|EER97654.1| hypothetical protein SORBIDRAFT_02g041270 [Sorghum bicolor]
Length=228

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 187/233 (80%), Gaps = 10/233 (4%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WF+G +A       + Q +      LLADWNSYA+T++   D +SSS +  FD+EAAV
Sbjct  6     QAWFTGGTAASTGTAAESQPS------LLADWNSYAATRS---DASSSSPLP-FDIEAAV  55

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTF+ V+KGVR++PGS QSATS+ PSGKALMYFGLFLA+G+ F+F+AFALFL
Sbjct  56    RSANDTVSGTFSSVTKGVRELPGSFQSATSSFPSGKALMYFGLFLATGIFFVFIAFALFL  115

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC  II S FAL+G  NQ AHM+SKERLPF++GF+G M+GT+YV
Sbjct  116   PVMVLMPQKFAICFTLGCALIIASLFALKGPANQLAHMTSKERLPFSVGFIGCMVGTIYV  175

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SM LHSY LSV+FSV+QV+AL YY +SYFPGGS+GLKF+SS ++SS    F R
Sbjct  176   SMVLHSYFLSVIFSVLQVLALAYYTISYFPGGSSGLKFISSGLLSSAASLFSR  228



>ref|XP_010446136.1| PREDICTED: protein transport protein sft2-like, partial [Camelina 
sativa]
Length=224

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 170/194 (88%), Gaps = 5/194 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++  + D   ++L  +FD+E+AVRSANDTVSGTFNVVSKGVRD   +LQS
Sbjct  36    LLADWNSYAASRDFEEDTGGTTL--SFDIESAVRSANDTVSGTFNVVSKGVRD---NLQS  90

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS++PSGKALMYFGL LASGV FIF+AF +FLPV+VL+PQKFAICFTLGC FIIGSFFA
Sbjct  91    ATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSFFA  150

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             LRG +NQ AHMSS ERLP TLGF+ +M+GT+YVSM LHSYILSV+FS +QV+AL YY +S
Sbjct  151   LRGPQNQLAHMSSTERLPLTLGFIATMVGTIYVSMVLHSYILSVIFSALQVVALAYYCIS  210

Query  1700  YFPGGSAGLKFLSS  1659
             YFPGGS+G+KFL+S
Sbjct  211   YFPGGSSGMKFLTS  224



>ref|XP_006447853.1| hypothetical protein CICLE_v10016561mg [Citrus clementina]
 gb|ESR61093.1| hypothetical protein CICLE_v10016561mg [Citrus clementina]
 gb|KDO51011.1| hypothetical protein CISIN_1g027154mg [Citrus sinensis]
Length=227

 Score =   287 bits (734),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 176/206 (85%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++ S      SS  +AFDLEAAVR+ +D  +GTFNVVSKGVRD+PG+ Q+
Sbjct  28    LLADWNSYAASQES------SSDSSAFDLEAAVRTTSDKFTGTFNVVSKGVRDLPGNFQA  81

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             +TSN+PSGK+ +YFGLFLA G+ FIF+AF +FLPVIVLVPQKFAICFT+GC   +GSFFA
Sbjct  82    STSNVPSGKSFLYFGLFLAVGIFFIFIAFTMFLPVIVLVPQKFAICFTIGCALTVGSFFA  141

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM SKERLP TL  +GSM+GT+YVSM LHSYILSVLFSV+QV+AL YYA+S
Sbjct  142   LKGPKNQLAHMFSKERLPLTLISIGSMVGTVYVSMVLHSYILSVLFSVLQVLALAYYAIS  201

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
              FPGGS GLKFLSSS++S++L+CFGR
Sbjct  202   CFPGGSFGLKFLSSSLISTILRCFGR  227



>ref|NP_001057449.1| Os06g0300300 [Oryza sativa Japonica Group]
 dbj|BAD53485.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19363.1| Os06g0300300 [Oryza sativa Japonica Group]
 dbj|BAG91105.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98738.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80448.1| hypothetical protein OsI_22649 [Oryza sativa Indica Group]
 gb|EEE65570.1| hypothetical protein OsJ_21068 [Oryza sativa Japonica Group]
Length=228

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 177/206 (86%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA   AS  D +SSS +  FD+EAAVRSANDTVSGTF+VV+KGVR++PGS QS
Sbjct  27    LLADWNSYA---ASRPDASSSSPLP-FDIEAAVRSANDTVSGTFSVVTKGVRELPGSFQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLA+G+ F+F+AFALFLPV+V++PQKFAICFTLGC  II S FA
Sbjct  83    ATSSFPSGKALMYFGLFLATGIFFVFIAFALFLPVMVIMPQKFAICFTLGCGLIIASIFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G  +QFAHM+S ERLPFT   +G M+GT+YVSM LHSY LSV+FSV+QV++L YY +S
Sbjct  143   LKGPASQFAHMTSMERLPFTGALIGCMVGTIYVSMFLHSYFLSVIFSVLQVLSLAYYTIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+GLKF+SSS++SSV  CFGR
Sbjct  203   YFPGGSSGLKFISSSLLSSVTSCFGR  228



>gb|EYU33727.1| hypothetical protein MIMGU_mgv1a0262881mg, partial [Erythranthe 
guttata]
Length=302

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/250 (60%), Positives = 195/250 (78%), Gaps = 3/250 (1%)
 Frame = +1

Query  229  IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLK  408
            + CI+  K+      VTVTW+K L+SHTL+I VEN  +ENHYTCKIDLKTWQFWGKKGLK
Sbjct  38   VTCIHKVKLGETICHVTVTWAKTLISHTLYITVENPLDENHYTCKIDLKTWQFWGKKGLK  97

Query  409  TFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPS  588
            TF+V +KR+D++WD++SAKF++SPE  S Y++A+    E++LLLGDQ+ EAL+RTKS+PS
Sbjct  98   TFRVAEKRVDVFWDLRSAKFATSPEPNSDYYVAMVSDQEVVLLLGDQKNEALRRTKSRPS  157

Query  589  LVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGMECIRI  765
            L  ++LVHKKE   A+  F T+T LG+ KKEH IIIESA+ G  +PEMWISVDGME IR+
Sbjct  158  LQDSSLVHKKEIVFARKCFCTKTTLGKSKKEHSIIIESALCGPYDPEMWISVDGMESIRV  217

Query  766  VNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDET  945
             NLHWRFRGNETI VDD PV++ WDVHDWLY+  ++G GIF+F++  N+ E  ++  +E 
Sbjct  218  PNLHWRFRGNETIVVDDFPVQILWDVHDWLYNGTHSGVGIFVFRRGVNEGEFESAHLEE-  276

Query  946  DEDYPSTDFC  975
            DED+  + FC
Sbjct  277  DEDFGGS-FC  285



>ref|XP_006469408.1| PREDICTED: protein transport protein SFT2-like [Citrus sinensis]
Length=227

 Score =   285 bits (728),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 175/206 (85%), Gaps = 6/206 (3%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+++ S      SS  +AFDLEAAVR+ +D  +GTFNVVSKGVRD+PG+ Q+
Sbjct  28    LLADWNSYAASQES------SSDSSAFDLEAAVRTTSDKFTGTFNVVSKGVRDLPGNFQA  81

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             +TSN+PSGK+ +YFGLFLA G+ FIF+AF +FLPVIVLVPQKFAICFT+GC   +GSFFA
Sbjct  82    STSNVPSGKSFLYFGLFLAVGIFFIFIAFTMFLPVIVLVPQKFAICFTIGCALTVGSFFA  141

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G KNQ AHM SKERLP TL  +GSM+GT+YVSM LHSYILSVLFSV+QV+AL YYA+S
Sbjct  142   LKGPKNQLAHMFSKERLPLTLISIGSMVGTVYVSMVLHSYILSVLFSVLQVLALAYYAIS  201

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
              FPGGS GLKFLSSS++S++ +CFGR
Sbjct  202   CFPGGSFGLKFLSSSLISTIRRCFGR  227



>ref|XP_003563934.1| PREDICTED: protein transport protein SFT2 [Brachypodium distachyon]
Length=228

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 176/206 (85%), Gaps = 4/206 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSY+++++     ASSS    FD+EAAVRSANDTVSGTFNVV+KGVR++PGS Q 
Sbjct  27    LLADWNSYSASRSD----ASSSSPLPFDIEAAVRSANDTVSGTFNVVTKGVRELPGSFQG  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLA+G+ F+F+AF LFLPV+VL+PQKFAICFTLGC  II S FA
Sbjct  83    ATSSFPSGKALMYFGLFLATGIFFVFIAFTLFLPVMVLMPQKFAICFTLGCALIIASLFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G  NQ +HM+SKERLPFT+GF G M+GT+YVSM LHSY LSV+FS++QV+AL YY +S
Sbjct  143   LKGPANQLSHMTSKERLPFTVGFTGCMVGTIYVSMVLHSYFLSVIFSILQVLALAYYTIS  202

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+GLKF+SSS++S V + FGR
Sbjct  203   YFPGGSSGLKFISSSLLSPVTRIFGR  228



>emb|CAA18215.1| putative protein [Arabidopsis thaliana]
 emb|CAB79510.1| putative protein [Arabidopsis thaliana]
Length=385

 Score =   286 bits (732),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 181/251 (72%), Gaps = 49/251 (20%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNV--------------  2103
             LLADWNSYA+++  +  G S      FD+E+AVRSANDTVSGTF+V              
Sbjct  139   LLADWNSYAASRDFEESGGS----FGFDIESAVRSANDTVSGTFSVCFQESSFVSLIKFL  194

Query  2102  ---------------VSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFAL  1968
                            VSKGVRDIPGSLQSATS++PSGKALMYFGL LASGV FIF+AF +
Sbjct  195   FFCCFCNVPEFDDYRVSKGVRDIPGSLQSATSSMPSGKALMYFGLLLASGVFFIFIAFTM  254

Query  1967  FLPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKE----------------  1836
             FLPV+VL+PQKFAICFTLGC FIIGSFFALRG KNQ AHMSS E                
Sbjct  255   FLPVMVLMPQKFAICFTLGCGFIIGSFFALRGPKNQLAHMSSMEVCYTVLLCVCHALNPR  314

Query  1835  RLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSS  1656
             RLP TLGF+ +M+GT+YVSM LHSYILSVLFSV+QV+AL+YY +SYFPGGS+G++FLSS+
Sbjct  315   RLPSTLGFIATMVGTIYVSMVLHSYILSVLFSVLQVLALVYYCISYFPGGSSGMRFLSSA  374

Query  1655  MVSSVLKCFGR  1623
             + SS L+ FGR
Sbjct  375   LTSSALRVFGR  385



>gb|ACN85162.1| putative SFT2 protein [Oryza nivara]
Length=231

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 182/234 (78%), Gaps = 3/234 (1%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG+     +          S   LLA+WNSYA+ ++++ +          D+EAA
Sbjct  1     MQAWFSGTGPSASSASSSSSPPQPS---LLAEWNSYAAARSAEEEEDGGGGGFGIDIEAA  57

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSAND VSGTF VVSKGV  +PGS +S TS++PS K+L+YFGLFLASG+  +F+AF +F
Sbjct  58    VRSANDRVSGTFGVVSKGVLGLPGSFKSTTSSVPSSKSLVYFGLFLASGIFLVFIAFTIF  117

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFT+GC FIIGSFFAL+G KNQ  HM SKERLPFT+GF+GSM  T+Y
Sbjct  118   LPVMVIMPQKFAICFTVGCAFIIGSFFALKGPKNQLYHMISKERLPFTMGFVGSMAATIY  177

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV FS +QV+AL YYA+SYFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  178   VSMVLHSYILSVFFSCLQVLALAYYAISYFPGGSAGMKFLSSALVSSVLRCFGR  231



>gb|KDO59217.1| hypothetical protein CISIN_1g026818mg [Citrus sinensis]
Length=197

 Score =   278 bits (710),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 3/171 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T+ +D DG  S L   FD+E+AVRSANDTVSGTFNVVSKGVRD+PG+LQS
Sbjct  30    LLADWNSYAATRDAD-DG--SGLAFGFDIESAVRSANDTVSGTFNVVSKGVRDLPGNLQS  86

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS +PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFA+CFT+GC FIIGSFFA
Sbjct  87    ATSTVPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFALCFTVGCGFIIGSFFA  146

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQV  1728
             LRG KNQ AHMSSKERLPFTLGF+GSM GT+YVSM LHSYILSVLFSVIQV
Sbjct  147   LRGPKNQLAHMSSKERLPFTLGFIGSMAGTIYVSMVLHSYILSVLFSVIQV  197



>ref|NP_001058041.1| Os06g0608600 [Oryza sativa Japonica Group]
 dbj|BAD35620.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19955.1| Os06g0608600 [Oryza sativa Japonica Group]
 dbj|BAG87911.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96685.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80949.1| hypothetical protein OsI_23661 [Oryza sativa Indica Group]
Length=231

 Score =   278 bits (712),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 181/234 (77%), Gaps = 3/234 (1%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG+     +          S   LLA+WNSYA+ ++++ +          D+EAA
Sbjct  1     MQAWFSGTGPSASSASSSSSPPQPS---LLAEWNSYAAARSAEEEEDGGGGGFGIDIEAA  57

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSAND VSGTF VVSKGV  +PGS +S TS++PS K+L+YFGLFLASG+  +F+AF +F
Sbjct  58    VRSANDRVSGTFGVVSKGVLGLPGSFKSTTSSVPSSKSLVYFGLFLASGIFLVFIAFTIF  117

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFT GC FIIGSFFAL+G KNQ  HM SKERLPFT+GF+GSM  T+Y
Sbjct  118   LPVMVIMPQKFAICFTAGCAFIIGSFFALKGPKNQLYHMISKERLPFTMGFVGSMAATIY  177

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV FS +QV+AL YYA+SYFPGGSAG+KFLSS++VSSVL+CFGR
Sbjct  178   VSMVLHSYILSVFFSCLQVLALAYYAISYFPGGSAGMKFLSSALVSSVLRCFGR  231



>gb|EMS58711.1| Protein transport protein SFT2 [Triticum urartu]
Length=227

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 170/212 (80%), Gaps = 11/212 (5%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAAV  2142
             Q WF+G SA      + Q +       LLADWNSYA+T++   D +SSS +  FD+EAAV
Sbjct  6     QSWFTGGSASPSTAAESQPS-------LLADWNSYAATRS---DVSSSSPLP-FDIEAAV  54

Query  2141  RSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFL  1962
             RSANDTVSGTFNVVSKGVR++PGS Q ATS+ PSGKALMYFGLFLA+G+ F+F+AF LF+
Sbjct  55    RSANDTVSGTFNVVSKGVRELPGSFQGATSSFPSGKALMYFGLFLATGIFFVFIAFTLFV  114

Query  1961  PVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYV  1782
             PV+VL+PQKFAICFTLGC  II S FAL+G  NQ AHM+SKERLPFT+GF G M+GT+YV
Sbjct  115   PVMVLMPQKFAICFTLGCALIIASLFALKGPANQLAHMTSKERLPFTVGFTGCMVGTIYV  174

Query  1781  SMGLHSYILSVLFSVIQVMALLYYAVSYFPGG  1686
             SM LHSY LSV+FS++QV+AL YY +SYFPGG
Sbjct  175   SMVLHSYFLSVIFSILQVLALAYYTISYFPGG  206



>ref|XP_011085422.1| PREDICTED: protein transport protein SFT2-like [Sesamum indicum]
Length=224

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 188/234 (80%), Gaps = 16/234 (7%)
 Frame = -3

Query  2321  QKWFSGssagddarqqqqqttaasspSLLADWNSYASTKAS-DGDGASSSLIAAFDLEAA  2145
             Q WFSG  + D  +             LLADWN+YA++  + DGD +S      FDLEAA
Sbjct  6     QAWFSGGPSSDLDKTSSS---------LLADWNAYAASSNAADGDSSS------FDLEAA  50

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VR+AND V+ TF VVSKGV+++PGS  SATS++PSGK+LMYFG+FLASGV FIF+AF +F
Sbjct  51    VRTANDKVTSTFGVVSKGVKELPGSFNSATSSVPSGKSLMYFGIFLASGVFFIFIAFTIF  110

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+VL PQKFAICFT+GC FI+GSFFAL+G ++Q +HM SKERLPFT GF+GSM GT+Y
Sbjct  111   LPVMVLKPQKFAICFTIGCAFIVGSFFALKGPRSQLSHMLSKERLPFTFGFIGSMAGTIY  170

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             VSM LHSYILSV+FSV+QV+AL YYA+SYFPGGSAGLKFLSS++ SSVL+CFGR
Sbjct  171   VSMVLHSYILSVIFSVLQVLALSYYAISYFPGGSAGLKFLSSTLASSVLRCFGR  224



>gb|KGN44129.1| hypothetical protein Csa_7G200820 [Cucumis sativus]
Length=171

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  2102  VSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAIC  1923
             VSKGVR++PG+ QSATSN+PSGKALMYFGLFLA+GV FIF+AF +FLPV+VL+PQKFAIC
Sbjct  12    VSKGVRELPGNFQSATSNVPSGKALMYFGLFLATGVFFIFIAFTMFLPVMVLMPQKFAIC  71

Query  1922  FTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLF  1743
             FTLGCCFIIGSFFAL+G KNQ AHM SKERLPFT+ F+GSM+GTLYVSMGLHSYILSV F
Sbjct  72    FTLGCCFIIGSFFALKGPKNQLAHMFSKERLPFTVIFIGSMLGTLYVSMGLHSYILSVFF  131

Query  1742  SVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SV+QV+AL YYAVSYFPGGS G+KFLSS++ SSV KCFGR
Sbjct  132   SVLQVLALAYYAVSYFPGGSTGMKFLSSALTSSVTKCFGR  171



>ref|XP_011097721.1| PREDICTED: uncharacterized protein LOC105176569 [Sesamum indicum]
 ref|XP_011097722.1| PREDICTED: uncharacterized protein LOC105176569 [Sesamum indicum]
Length=295

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 199/269 (74%), Gaps = 12/269 (4%)
 Frame = +1

Query  229   IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLK  408
             + CI+ AK+  +  ++TVTW+K ++ H+L+I VEN  ++N+YTCKIDLKTWQFWGKKGLK
Sbjct  28    VTCIHKAKLVDIVCNITVTWAKTVIGHSLYITVENPQDDNYYTCKIDLKTWQFWGKKGLK  87

Query  409   TFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPS  588
             TF+V +KR+D++WD++SAKF+ SPE  S Y++A+    EL+LLLGDQ+KEAL+RTKS+  
Sbjct  88    TFRVAEKRIDVFWDLRSAKFTDSPEPDSDYYVAMVSREELILLLGDQQKEALRRTKSRLP  147

Query  589   LVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGMECIRI  765
                A+LV KKE   AK  F T+T LGQ  KEH IIIES++SG  +PEMWISVDGME IR+
Sbjct  148   SEDASLVQKKEIVFAKKCFCTKTTLGQ-DKEHSIIIESSLSGPYDPEMWISVDGMESIRV  206

Query  766   VNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDET  945
              NLHWRFRGNETI VD+ PV++ WDVHDWLY+  ++G GIF+F++  ++ E  +S  +  
Sbjct  207   PNLHWRFRGNETILVDNSPVQILWDVHDWLYNGNHSGVGIFVFRRDADEGEFHSSNIEAE  266

Query  946   D---------EDYPST-DFCHIFYAWKLQ  1002
             D         E+ PS+  FCH  YAWK +
Sbjct  267   DFGKSFWDVLEEQPSSVGFCHFLYAWKTE  295



>gb|ABK21723.1| unknown [Picea sitchensis]
Length=242

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 171/215 (80%), Gaps = 10/215 (5%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAA---------VRSANDTVSGTFNVVSKGV  2088
             LLA+W +Y    +S  DG++SS     DLEA+          RSAN+T+ GTFN+VSKGV
Sbjct  29    LLAEWKAYTGASSSRPDGSASSQ-TGLDLEASSVPESLAPLFRSANETLLGTFNIVSKGV  87

Query  2087  RDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGC  1908
             RD+PG++QSA S++PSGKAL+YFG+ LA+G+ FIF+A  +FLPV+V++P+KFAICFTLGC
Sbjct  88    RDLPGNVQSAASSLPSGKALLYFGMLLATGIFFIFIALIMFLPVMVVMPRKFAICFTLGC  147

Query  1907  CFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQV  1728
              FII SFFAL+G KNQ  HM+SKERLP T+GF+ SM  T+YVSM L SY+LSV+FS +QV
Sbjct  148   LFIILSFFALKGPKNQLLHMASKERLPLTIGFVASMAATIYVSMVLRSYLLSVIFSGVQV  207

Query  1727  MALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             +ALLYY VSYFPGGSAG+KFL S + SSV+KCFG+
Sbjct  208   LALLYYVVSYFPGGSAGMKFLLSRITSSVMKCFGQ  242



>ref|XP_007049427.1| Got1/Sft2-like vescicle transport protein family isoform 2 [Theobroma 
cacao]
 gb|EOX93584.1| Got1/Sft2-like vescicle transport protein family isoform 2 [Theobroma 
cacao]
Length=198

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 160/206 (78%), Gaps = 33/206 (16%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWN+YA+++ +D    SS+L   FDLEAAVR+ +D VSGTFNVVSKGVRD+PGS QS
Sbjct  26    LLADWNAYAASQDAD----SSAL--GFDLEAAVRTTSDKVSGTFNVVSKGVRDLPGSFQS  79

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATSN+PS                           VIVLVPQKFAICFT+GC  I+GSFFA
Sbjct  80    ATSNVPS---------------------------VIVLVPQKFAICFTIGCALIVGSFFA  112

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G +NQ AHMSSKERLPFTLGF+GSM+GT+YVSM LHSYILSVLFSV+QV+ L YYA+S
Sbjct  113   LKGPRNQLAHMSSKERLPFTLGFVGSMVGTIYVSMWLHSYILSVLFSVLQVITLSYYAMS  172

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGSAGLKFLSS++ SSVL+CFGR
Sbjct  173   YFPGGSAGLKFLSSTLASSVLRCFGR  198



>ref|XP_010063237.1| PREDICTED: protein transport protein SFT2-like isoform X1 [Eucalyptus 
grandis]
Length=212

 Score =   263 bits (671),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  2102  VSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAIC  1923
             VSKGVR++PG+ QSA S +PSGKALMYFGLFLASGV FI +AF +FLPV+VL+PQKFAIC
Sbjct  53    VSKGVRELPGNFQSAASTVPSGKALMYFGLFLASGVFFIVIAFTMFLPVMVLMPQKFAIC  112

Query  1922  FTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLF  1743
             FTLGCCFIIGSFFAL+G  NQ +HMSSKERLPFT+GF+GSM+GT+YVSM LHSYILSVLF
Sbjct  113   FTLGCCFIIGSFFALKGPMNQLSHMSSKERLPFTVGFVGSMVGTIYVSMVLHSYILSVLF  172

Query  1742  SVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             S++QV+AL+YY +SYFPGGSAG+KFLSS++ SSV++CFGR
Sbjct  173   SILQVLALVYYVISYFPGGSAGMKFLSSTLTSSVMRCFGR  212



>ref|XP_006656028.1| PREDICTED: protein transport protein SFT2-like [Oryza brachyantha]
Length=229

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 180/206 (87%), Gaps = 3/206 (1%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA++++     +SSS    FD+EAAVRSANDTVSGTF+VV+KGVR++PGS QS
Sbjct  27    LLADWNSYAASRSDA---SSSSSPLPFDIEAAVRSANDTVSGTFSVVTKGVRELPGSFQS  83

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLASG+ F+F+AFA FLPV+VL+PQKFAICFTLGC  II S FA
Sbjct  84    ATSSFPSGKALMYFGLFLASGIFFVFIAFAFFLPVMVLMPQKFAICFTLGCALIIASLFA  143

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYAVS  1701
             L+G  +QFAHM+SKERLPFT+GF+G M+GT+YVSM LHSY LSV+FS++QV+AL YY +S
Sbjct  144   LKGPASQFAHMTSKERLPFTVGFIGCMVGTIYVSMVLHSYFLSVIFSILQVLALGYYTIS  203

Query  1700  YFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             YFPGGS+GLKF+SSS++SSV  CFGR
Sbjct  204   YFPGGSSGLKFISSSLLSSVTSCFGR  229



>ref|XP_010445111.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein SFT2-like 
[Camelina sativa]
Length=209

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  2102  VSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAIC  1923
             VSKGVRDIPGSLQSATS++PSGKALMYFGLFLASGV FIF+AF +FLPV+VL+PQKFAIC
Sbjct  50    VSKGVRDIPGSLQSATSSMPSGKALMYFGLFLASGVFFIFIAFTMFLPVMVLMPQKFAIC  109

Query  1922  FTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLF  1743
             FT+GC FIIGSFFALRG +NQ AHMSS ERLP TLGF+ +M+GT+YVS+ LHSYILSVLF
Sbjct  110   FTIGCGFIIGSFFALRGPQNQLAHMSSMERLPSTLGFIATMVGTIYVSVVLHSYILSVLF  169

Query  1742  SVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             SV+QV+AL+YY +SYFPGGS+G++FLSS++ SSVL+ FGR
Sbjct  170   SVLQVLALIYYCISYFPGGSSGMRFLSSALTSSVLRVFGR  209



>ref|XP_002863234.1| hypothetical protein ARALYDRAFT_497148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39493.1| hypothetical protein ARALYDRAFT_497148 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 184/263 (70%), Gaps = 2/263 (1%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + S+ CIY A + G +R+V V WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++D+YWD +SAKF+  PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  141

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             KS+PSLV AAL +KKE+   K SFSTR     RK+EH I++ES+    +PEMWISVDG+ 
Sbjct  142   KSRPSLVDAALFYKKENVFGKKSFSTRAKFHDRKREHEIVVESSTGAKDPEMWISVDGIV  201

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ S   G G+FIFK  + + E SN  
Sbjct  202   LVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWLFSSPGTGHGLFIFKPESGESETSNGT  261

Query  934   TDETDEDYPSTDFCHIFYAWKLQ  1002
              D +     S+DFC   YAWKL+
Sbjct  262   KDSSVSS--SSDFCLFLYAWKLE  282



>ref|XP_002975940.1| hypothetical protein SELMODRAFT_232666 [Selaginella moellendorffii]
 gb|EFJ22845.1| hypothetical protein SELMODRAFT_232666 [Selaginella moellendorffii]
Length=222

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 157/207 (76%), Gaps = 10/207 (5%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAV--RSANDTVSGTFNVVSKGVRDIPGSL  2067
             LL+ WNSYA     +  G         D+EA    +SANDT+SG F+ +SKGVR++PGS+
Sbjct  23    LLSQWNSYAEVSRQEAGG--------LDVEAGALFKSANDTISGAFSTLSKGVRELPGSV  74

Query  2066  QSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSF  1887
             QSATS IPSGKA+ YF L L SGV F+F++F +FLPVIVLVPQKFA CFT+GC  ++GSF
Sbjct  75    QSATSGIPSGKAITYFALLLGSGVFFLFISFTMFLPVIVLVPQKFASCFTIGCLLVMGSF  134

Query  1886  FALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYA  1707
             FAL+G + QFAHM S+ERLPFT  F+GS++ T+Y SM LHSY+ SVLFSV+Q++ALLYY 
Sbjct  135   FALKGPRAQFAHMISQERLPFTAAFVGSIVATIYASMVLHSYLFSVLFSVVQLLALLYYV  194

Query  1706  VSYFPGGSAGLKFLSSSMVSSVLKCFG  1626
             +SYFPGGS+GL F+SS   SS  + FG
Sbjct  195   ISYFPGGSSGLTFISSMAKSSASRVFG  221



>ref|XP_006284280.1| hypothetical protein CARUB_v10005449mg [Capsella rubella]
 gb|EOA17178.1| hypothetical protein CARUB_v10005449mg [Capsella rubella]
Length=279

 Score =   254 bits (650),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 185/263 (70%), Gaps = 0/263 (0%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + S+ CIY A + G +R+V V WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  17    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWNFWN  76

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++D+YWD +SAKF+  PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  77    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  136

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             KS+PSLV AAL +KKE+   K SFSTR     RKKEH I++ES+    +PEM ISVDG+ 
Sbjct  137   KSRPSLVDAALFYKKENVFGKKSFSTRAKFHDRKKEHEIVVESSTGETDPEMLISVDGIL  196

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ S   G G+FIFK  + + ++SN  
Sbjct  197   LVKVRNLQWKFRGNQTVVVDKEPVQVFWDVYDWLFSSPGTGHGLFIFKPESGESDSSNGG  256

Query  934   TDETDEDYPSTDFCHIFYAWKLQ  1002
             T  ++    S++FC   YAWKL+
Sbjct  257   TKYSNASSSSSEFCLFLYAWKLE  279



>ref|XP_010496357.1| PREDICTED: uncharacterized protein LOC104773443 [Camelina sativa]
Length=284

 Score =   253 bits (647),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 184/263 (70%), Gaps = 0/263 (0%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + S+ CIY A + G +R+V V WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++D+YWD +SAKF+  PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSDEEVVLLLGDHKKKAFKRT  141

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             KS+P+LV AAL +KKE+   K SFSTR     RKKEH I++ES+    +PEMWISVDG+ 
Sbjct  142   KSRPTLVDAALFYKKENVFGKKSFSTRAKFNDRKKEHEIVVESSNGKKDPEMWISVDGII  201

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DW + +   G G+FIFK    + +AS+  
Sbjct  202   LVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWFFSTPGTGHGLFIFKPENGESDASDGG  261

Query  934   TDETDEDYPSTDFCHIFYAWKLQ  1002
             T ++     S++FC   YAWKL+
Sbjct  262   TKDSSSSSSSSEFCLFLYAWKLE  284



>ref|XP_002968545.1| hypothetical protein SELMODRAFT_231162 [Selaginella moellendorffii]
 gb|EFJ30799.1| hypothetical protein SELMODRAFT_231162 [Selaginella moellendorffii]
Length=222

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (76%), Gaps = 10/207 (5%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAV--RSANDTVSGTFNVVSKGVRDIPGSL  2067
             LL+ WNSYA     +  G         D+EA    +SAN+T+SG F+ +SKGVR++PGS+
Sbjct  23    LLSQWNSYAEVSRQEAGG--------LDVEAGALFKSANNTISGAFSTLSKGVRELPGSV  74

Query  2066  QSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSF  1887
             QSATS IPSGKA+ YF L L SGV F+F++F +FLPVIVLVPQKFA CFT+GC  ++GSF
Sbjct  75    QSATSGIPSGKAITYFALLLGSGVFFLFISFTMFLPVIVLVPQKFASCFTIGCLLVMGSF  134

Query  1886  FALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQVMALLYYA  1707
             FAL+G + QFAHM S+ERLPFT  F+GS++ T+Y SM LHSY+ SVLFSV+Q++ALLYY 
Sbjct  135   FALKGPRAQFAHMISQERLPFTAAFVGSIVATIYASMVLHSYLFSVLFSVVQLLALLYYV  194

Query  1706  VSYFPGGSAGLKFLSSSMVSSVLKCFG  1626
             +SYFPGGS+GL F+SS   SS  + FG
Sbjct  195   ISYFPGGSSGLTFISSMAKSSASRVFG  221



>ref|XP_010435360.1| PREDICTED: uncharacterized protein LOC104719196 [Camelina sativa]
Length=285

 Score =   251 bits (641),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 184/264 (70%), Gaps = 1/264 (0%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + S+ CIY A + G +R+V V WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++D+YWD +SAKF+  PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  141

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             KS+P+LV AAL +KKE+   K SFSTR     RKKEH I++ES+    +PEMWISVDG+ 
Sbjct  142   KSRPALVDAALFYKKENVFGKKSFSTRAKFNDRKKEHEIVVESSTGEKDPEMWISVDGII  201

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DW + +   G G+FIFK    + +AS+  
Sbjct  202   LVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWFFSTPGTGHGLFIFKPENGESDASDGG  261

Query  934   T-DETDEDYPSTDFCHIFYAWKLQ  1002
             T D +     S++FC   YAWKL+
Sbjct  262   TKDSSSSSSSSSEFCLFLYAWKLE  285



>ref|XP_010450329.1| PREDICTED: uncharacterized protein LOC104732477 [Camelina sativa]
Length=285

 Score =   250 bits (639),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 184/264 (70%), Gaps = 1/264 (0%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + S+ CIY A + G +R+V V WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWN  81

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++D YWD +SAKF+ SPE  S +++AL    E++LLLGD +K+A KRT
Sbjct  82    KKGYKSFEVEGNQVDAYWDFRSAKFNGSPEPSSDFYVALVSDEEVVLLLGDHKKKAFKRT  141

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             KS+P+LV AAL +KKE+   K SFSTR     RKKEH I++ES+    +PEMWISVDG+ 
Sbjct  142   KSRPALVDAALFYKKENVFGKKSFSTRAKFNDRKKEHEIVVESSTGEKDPEMWISVDGII  201

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DW + +   G G+FIFK    + +AS+  
Sbjct  202   LVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWFFSTPGTGHGLFIFKPENGESDASDGG  261

Query  934   T-DETDEDYPSTDFCHIFYAWKLQ  1002
             T D +     S++FC   YAWKL+
Sbjct  262   TKDSSSSSSSSSEFCLFLYAWKLE  285



>tpg|DAA41613.1| TPA: hypothetical protein ZEAMMB73_556884 [Zea mays]
Length=233

 Score =   248 bits (632),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T++   D +SSS +  FD+EAAVRSANDTVSGT + V+KGVR++PGS QS
Sbjct  27    LLADWNSYAATRS---DASSSSPLP-FDIEAAVRSANDTVSGTLSSVTKGVRELPGSFQS  82

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLA+G+ F+F+AFALFLPV+VL+PQKFAI FTLGC  II S FA
Sbjct  83    ATSSFPSGKALMYFGLFLATGIFFVFIAFALFLPVMVLMPQKFAISFTLGCALIIASLFA  142

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQV  1728
             L+G  NQ AHM+SKERLPF++GF+G M+GT+YVSM LHSY LSV+FSV+QV
Sbjct  143   LKGPANQLAHMTSKERLPFSVGFIGCMVGTIYVSMVLHSYFLSVIFSVLQV  193



>ref|XP_010929447.1| PREDICTED: uncharacterized protein LOC105050916 [Elaeis guineensis]
Length=299

 Score =   250 bits (638),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 188/275 (68%), Gaps = 12/275 (4%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T +CS+  IY A I GL R+VTV WSKNL++H+L + VE +  ++ +TCK+DLK W FW 
Sbjct  25    TAQCSVISIYQANILGLPRNVTVVWSKNLINHSLSVSVEKSNGDSPFTCKVDLKPWPFWS  84

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F++D KR+DIYWD++S KFS+ PE   GY++ALA   E++LLLGD +KEA KRT
Sbjct  85    KKGFKSFEIDGKRVDIYWDLRSVKFSNGPEPSGGYYVALACDEEVVLLLGDCKKEAYKRT  144

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRK-KEHIIIIESAMSG-NEPEMWISVDG  747
             K +P+L +AALV K+E+   K  F+TR    +RK KEH II+E+++SG  +PEMWIS+DG
Sbjct  145   KCRPALESAALVSKRENVFGKKCFTTRARFDERKTKEHDIIVENSISGAKDPEMWISIDG  204

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK---------Q  900
             +  I + NL W+FRGNET+ V+ VPV+VFWDVHDWL+ +   G  +FIFK         +
Sbjct  205   VVLIHVDNLQWKFRGNETVMVEKVPVQVFWDVHDWLFGAPGTGHALFIFKPGVPGAAAEE  264

Query  901   STNKDEASNSQTDETD-EDYPSTDFCHIFYAWKLQ  1002
               N  E  +S + +      P+ +FC    AWK +
Sbjct  265   DRNGTEGCSSSSGQNGTASSPAPEFCFFLCAWKTE  299



>ref|XP_001753580.1| predicted protein [Physcomitrella patens]
 gb|EDQ81803.1| predicted protein [Physcomitrella patens]
Length=226

 Score =   246 bits (629),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 170/235 (72%), Gaps = 10/235 (4%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASD-GDGASSSLIAAFDLEA  2148
             MQ WF+G S+    + +           +LADWNSYA+ K +D G  +S +  AA DLEA
Sbjct  1     MQGWFAGPSSKGQDKDEVS---------VLADWNSYAARKEADEGSLSSVASAAAMDLEA  51

Query  2147  AVRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFAL  1968
              + SA  T+ G F+ V+KG+RD+P S+ SA + +PS +++M F + + SGV FI +AF +
Sbjct  52    GLSSAGSTLVGAFSSVTKGMRDLPSSVSSAATYVPSRQSIMSFSVMIGSGVFFIMLAFTV  111

Query  1967  FLPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTL  1788
             FLP+I++ PQKFAICFTLGC FI+G+FFAL+G K+Q  HM SKERLPFTLGFLGSM  TL
Sbjct  112   FLPMIIVAPQKFAICFTLGCIFIMGAFFALKGPKSQALHMISKERLPFTLGFLGSMCATL  171

Query  1787  YVSMGLHSYILSVLFSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             Y SM LHSYI SV FS IQV+ALLYY +SYFPGGSAGL+F++S   S+V+KC  R
Sbjct  172   YASMVLHSYIFSVFFSGIQVLALLYYVISYFPGGSAGLQFITSFFTSAVMKCCSR  226



>ref|XP_010253022.1| PREDICTED: uncharacterized protein LOC104594441 [Nelumbo nucifera]
Length=326

 Score =   250 bits (639),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 192/292 (66%), Gaps = 28/292 (10%)
 Frame = +1

Query  211   TTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHY--TCKIDLKTWQ  384
             ++ +C++ C+Y A IAG+  +V V WSKNL++H L I V N   +NH   +CKIDLK W 
Sbjct  35    SSAQCTVMCVYQASIAGMCYNVHVIWSKNLMNHCLNISVNNPSSDNHQISSCKIDLKPWH  94

Query  385   FWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekeal  564
             FW KKGLK+F+V  KR+D++WD+++AKF SSPE  S Y++AL    E++LLLGD +KEA 
Sbjct  95    FWSKKGLKSFEVQGKRVDVFWDLRAAKFESSPEPCSDYYVALVSEEEVVLLLGDHKKEAY  154

Query  565   KRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISV  741
             KRTKS+PSL  A L++KK++   K  F+TR    +R+KEH I++E +++G  +PEMWIS+
Sbjct  155   KRTKSRPSLADATLIYKKDNVFGKKCFATRAKFDERRKEHDIVVEISITGPKDPEMWISI  214

Query  742   DGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST-----  906
             DG+  I + NL W+FRGNETI V+ +PV+VFWDVHDWL+     G G+FIFK +      
Sbjct  215   DGIVLIHVTNLQWKFRGNETIRVNTIPVQVFWDVHDWLFSGQPTGHGLFIFKPAPHDYDS  274

Query  907   ----NKDEASNS------QTDETDEDYPST----------DFCHIFYAWKLQ  1002
                 +KD  S+S       ++  D  Y ST          DFC   YAWKL+
Sbjct  275   DLDHDKDAGSDSGSQGAGGSESGDSGYYSTYSQSRPSSTSDFCLFLYAWKLE  326



>ref|XP_008668011.1| PREDICTED: protein SFT2 isoform X1 [Zea mays]
Length=285

 Score =   249 bits (635),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = -3

Query  2240  LLADWNSYASTKASDGDGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIPGSLQS  2061
             LLADWNSYA+T++   D +SSS +  FD+EAAVRSANDTVSGT + V+KGVR++PGS QS
Sbjct  79    LLADWNSYAATRS---DASSSSPLP-FDIEAAVRSANDTVSGTLSSVTKGVRELPGSFQS  134

Query  2060  ATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGCCFIIGSFFA  1881
             ATS+ PSGKALMYFGLFLA+G+ F+F+AFALFLPV+VL+PQKFAI FTLGC  II S FA
Sbjct  135   ATSSFPSGKALMYFGLFLATGIFFVFIAFALFLPVMVLMPQKFAISFTLGCALIIASLFA  194

Query  1880  LRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQV  1728
             L+G  NQ AHM+SKERLPF++GF+G M+GT+YVSM LHSY LSV+FSV+QV
Sbjct  195   LKGPANQLAHMTSKERLPFSVGFIGCMVGTIYVSMVLHSYFLSVIFSVLQV  245



>ref|XP_007206363.1| hypothetical protein PRUPE_ppa017788mg, partial [Prunus persica]
 gb|EMJ07562.1| hypothetical protein PRUPE_ppa017788mg, partial [Prunus persica]
Length=271

 Score =   248 bits (633),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 181/261 (69%), Gaps = 6/261 (2%)
 Frame = +1

Query  238   IYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHY-TCKIDLKTWQFWGKKGLKTF  414
             +Y  K+A L+ +VT TW KN  SH+L I +E   + N   TCK+DL + QFWGKKGLK+F
Sbjct  11    VYQVKLAELYCNVTATWCKNHTSHSLCITMEKPCQNNQCCTCKVDLNSCQFWGKKGLKSF  70

Query  415   KVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPSLV  594
             +VD +R+D+YWD + AKFSS+PE  S Y++AL    E++LLLGD  ++A KRT+S+ S  
Sbjct  71    EVDGRRVDVYWDFRQAKFSSTPEPCSDYYVALVSKQEVVLLLGDLMEDAYKRTRSRASSE  130

Query  595   AAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVN  771
              A L++KKE+   K  F T+ +L + KKEH I+IE+++SG +EPEMWIS+DG   I+I+N
Sbjct  131   DAKLMYKKENVSGKRLFCTKAMLEEGKKEHDIVIETSLSGPDEPEMWISIDGTVAIQIMN  190

Query  772   LHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST-NKDEASNSQTD---  939
             LHWRFRGNET+ ++DVPVE+FWDVHDWL+ S     G FIFK S  + D +S S +    
Sbjct  191   LHWRFRGNETVMLNDVPVEIFWDVHDWLFSSLGTSHGFFIFKPSRLDGDYSSGSPSQYNS  250

Query  940   ETDEDYPSTDFCHIFYAWKLQ  1002
                   P+T FCH  YAWK +
Sbjct  251   PKGSSSPTTGFCHFLYAWKTE  271



>ref|NP_193005.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190706.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB40986.1| putative protein [Arabidopsis thaliana]
 emb|CAB78311.1| putative protein [Arabidopsis thaliana]
 gb|AAM61648.1| unknown [Arabidopsis thaliana]
 gb|ABG48411.1| At4g12690 [Arabidopsis thaliana]
 dbj|BAF01198.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83163.1| uncharacterized protein AT4G12690 [Arabidopsis thaliana]
 gb|AEE83164.1| uncharacterized protein AT4G12690 [Arabidopsis thaliana]
Length=285

 Score =   248 bits (634),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 182/264 (69%), Gaps = 1/264 (0%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + S+ CIY A + G +R+V V WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  22    TAQSSVTCIYQAHMVGFWRNVRVLWSKNLMNHSLTVMVTSVQGDMNYCCKVDLKPWHFWY  81

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++D+YWD +SAKF+  PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  82    KKGYKSFEVEGNQVDVYWDFRSAKFNGGPEPSSDFYVALVSEEEVVLLLGDHKKKAFKRT  141

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             KS+PSLV AAL +KKE+   K  FSTR     RK+EH I++ES+    EPEMWISVDG+ 
Sbjct  142   KSRPSLVDAALFYKKENVFGKKIFSTRAKFHDRKREHEIVVESSTGAKEPEMWISVDGIV  201

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK  + + E SN  
Sbjct  202   LVQVRNLQWKFRGNQTVLVDKEPVQVFWDVYDWLFSTPGTGHGLFIFKPESGESETSNET  261

Query  934   TD-ETDEDYPSTDFCHIFYAWKLQ  1002
              +        S++FC   YAWKL+
Sbjct  262   KNCSASSSSSSSEFCLFLYAWKLE  285



>emb|CDY00849.1| BnaCnng00490D [Brassica napus]
Length=291

 Score =   248 bits (632),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 185/266 (70%), Gaps = 3/266 (1%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY   I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVAEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K SF+TR     RKKEH I +ES++SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST--NKDEAS  924
               +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK  T  + D   
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFKPGTAEDSDMEG  265

Query  925   NSQTDETDEDYPSTDFCHIFYAWKLQ  1002
              S+   T       +FC   YAWKL+
Sbjct  266   RSRYHSTKSGSWPPEFCLFLYAWKLE  291



>ref|XP_006418603.1| hypothetical protein EUTSA_v10002618mg [Eutrema salsugineum]
 gb|ESQ37039.1| hypothetical protein EUTSA_v10002618mg [Eutrema salsugineum]
Length=303

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 187/278 (67%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y   I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCMYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K  FSTR     RKKEH II+ES++SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFSTRARFYDRKKEHEIIVESSISGPKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
               +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ S   G G+FIFK  TN+D     
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSSPGTGHGLFIFKPGTNEDSDMEG  265

Query  919   ----------ASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                       +  S+   T       +FC   YAWKL+
Sbjct  266   SGHGGGESDTSIGSRYYSTKSSSWPPEFCLFLYAWKLE  303



>ref|XP_008783101.1| PREDICTED: uncharacterized protein LOC103702440 [Phoenix dactylifera]
Length=273

 Score =   246 bits (627),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 183/265 (69%), Gaps = 9/265 (3%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T +CS+  IY A I G+ R+VTV WSKNL++H+L + VE +  ++  TCK++LK W FW 
Sbjct  16    TAQCSVISIYQANIVGVPRNVTVVWSKNLMNHSLSVSVEKSNGDSPLTCKVELKPWPFWS  75

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYH-IalamggelllllgdqekealKR  570
             KKG K+ ++D +R+D+YWD++SAKFS+ PE   G+H +AL    E++LLLGD +KEA +R
Sbjct  76    KKGFKSLEIDGERVDLYWDLRSAKFSNGPEPSGGHHYVALVCNEEVVLLLGDGKKEAYRR  135

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDG  747
             TK +P+L +AALV ++E+   K  F+TR    +RKKEH I++E+++SG  +PEMWIS+DG
Sbjct  136   TKCRPALESAALVSRRENVFGKKCFTTRARFDERKKEHDIVVENSISGPQDPEMWISIDG  195

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASN  927
             +  I + NL W+FRGNET+ V+ VPV+VFWDVHDWL+ +   G  +FIFK +   D   N
Sbjct  196   VVLIHVSNLQWKFRGNETVLVEKVPVQVFWDVHDWLFGTPGTGHALFIFKPAAEGDRNGN  255

Query  928   SQTDETDEDYPSTDFCHIFYAWKLQ  1002
               +       P+ +FC    AWK +
Sbjct  256   PSS-------PAPEFCFFLCAWKTE  273



>emb|CDY27882.1| BnaA07g04720D [Brassica napus]
Length=291

 Score =   246 bits (629),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 185/266 (70%), Gaps = 3/266 (1%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY   I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVAEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K SF+TR     RKKEH I +ES++SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK--QSTNKDEAS  924
               +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK   + + D   
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFKPGNAEDSDMEG  265

Query  925   NSQTDETDEDYPSTDFCHIFYAWKLQ  1002
              S+   T       +FC   YAWKL+
Sbjct  266   RSRYHSTKSGSWPPEFCLFLYAWKLE  291



>ref|XP_007020399.1| Uncharacterized protein TCM_030574 [Theobroma cacao]
 gb|EOY11924.1| Uncharacterized protein TCM_030574 [Theobroma cacao]
Length=302

 Score =   247 bits (630),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 184/269 (68%), Gaps = 9/269 (3%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEEN-HYTCKIDLKTWQFWGK  396
             +CS+  IY A IA   R VT TW K+LV+H+  I VEN  ++    TCKIDLK WQFWG+
Sbjct  35    QCSVTSIYHAHIADSSRKVTATWCKSLVNHSFTINVENPSDDQCPCTCKIDLKAWQFWGR  94

Query  397   KGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTK  576
             KGLK+ +VD +R+D+YWD + AKFS SPE  S Y++A+    E+ L++GD + +A KRTK
Sbjct  95    KGLKSLEVDGQRVDVYWDFRQAKFSGSPEPCSDYYVAIVSEEEVALVVGDMKTDAFKRTK  154

Query  577   SKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGME  753
              +PSLV A L+ KKE  C K  F ++  L + K E+ I+IE+++SG ++PEMW+S+DG  
Sbjct  155   KRPSLVDAILLCKKEHICGKKLFCSKAKLNEGKHENDIMIENSLSGPDDPEMWVSIDGTA  214

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ  933
              IRI+NLHWRFRGNE +TV++ PV++FWDVHDWLY+++ +  G+FIF      D A++  
Sbjct  215   VIRIMNLHWRFRGNEIVTVNNTPVQIFWDVHDWLYNTSGSSHGLFIFTPGV-PDSAAHCD  273

Query  934   TDETDE-DYPSTD-----FCHIFYAWKLQ  1002
             +D  +  D P        FC++ YAWK +
Sbjct  274   SDGCNTYDSPRDSQSVPRFCYVLYAWKTE  302



>gb|EPS70677.1| hypothetical protein M569_04081, partial [Genlisea aurea]
Length=300

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 184/278 (66%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y A IAG  R+VTV W+KNL++H+L + V++   E   TCKIDLK W FW 
Sbjct  23    TPQTTVTCVYQAHIAGSLRNVTVLWAKNLMNHSLSLSVDSVDPEVVSTCKIDLKPWYFWA  82

Query  394   KKGLKTFKVD-QKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
             KKG +TF+VD   ++++YWD++SAKFS SPE  S Y++AL    E+ LLLGD +K+  KR
Sbjct  83    KKGYRTFEVDGSSQIEVYWDLRSAKFSGSPEPFSDYYVALVAEDEVALLLGDLKKKVFKR  142

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDG  747
             TK++P+LV A + +KKE+   K SFSTR    Q K++H I++ES++ G  EPEMWIS+DG
Sbjct  143   TKARPALVEAVIFYKKENVFGKKSFSTRAKFDQMKQDHDIVVESSILGPREPEMWISIDG  202

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASN  927
             +  I + NLHW+FRGN+T+ V+  P++VFWDVH WL+    +G G+FIFK S N+ E+ N
Sbjct  203   IVLIHVTNLHWKFRGNQTVIVNKQPIQVFWDVHSWLFCVPGSGHGVFIFKSSENEGESDN  262

Query  928   SQTDETD-------------EDYPSTDFCHIFYAWKLQ  1002
               +   D             + Y   DF    YAWK++
Sbjct  263   DSSSHCDDSECSNSSRYFSTQSYSKKDFSLFLYAWKIE  300



>ref|XP_009102402.1| PREDICTED: uncharacterized protein LOC103828543 [Brassica rapa]
Length=302

 Score =   244 bits (623),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 188/277 (68%), Gaps = 14/277 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY   I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHISGFWRNVTVLWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVAEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K SF+TR     RKKEH I +ES++SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKSFATRAKFYDRKKEHEINVESSISGTKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKD-----  915
               +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK    +D     
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFKPGNAEDSDMEG  265

Query  916   EASNSQTD-ETDEDYPST-------DFCHIFYAWKLQ  1002
                  ++D  T   Y ST       +FC   YAWKL+
Sbjct  266   SGHGGESDTSTGSRYHSTKSGSWPPEFCLFLYAWKLE  302



>ref|XP_002883629.1| hypothetical protein ARALYDRAFT_480071 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59888.1| hypothetical protein ARALYDRAFT_480071 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   244 bits (622),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 187/280 (67%), Gaps = 18/280 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY A I+G +R+VTV WSKN+++H+L ++V N   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNVMNHSLMVMVTNVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K  F+TR     RKKEH II+ES+ SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDRKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
               I++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK  T +D     
Sbjct  206   VLIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSTPGTGHGLFIFKPGTTEDSDMEG  265

Query  931   Q----------------TDETDEDYPSTDFCHIFYAWKLQ  1002
                              + ++   +P  +FC   +AWKL+
Sbjct  266   SGHGGGGSDTSTGSRYYSTKSSNPWPP-EFCLFLHAWKLE  304



>ref|XP_006452672.1| hypothetical protein CICLE_v10010821mg [Citrus clementina]
 gb|ESR65912.1| hypothetical protein CICLE_v10010821mg [Citrus clementina]
Length=292

 Score =   243 bits (621),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 179/259 (69%), Gaps = 6/259 (2%)
 Frame = +1

Query  229  IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENH-YTCKIDLKTWQFWGKKGL  405
            +  IY AKIA  FR +TVTWSKNLV+H L   VEN Y++ H YT K DLK  QFW KKGL
Sbjct  37   LILIYQAKIAHFFRKITVTWSKNLVNHYLCFNVENPYDDQHPYTFKTDLKASQFWNKKGL  96

Query  406  KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
            K F++D KR  +YWD + AKFSS+P   S Y++A+    E++LLLGD   +A KRTK +P
Sbjct  97   KNFEIDGKRAFVYWDFRQAKFSSNPAPSSDYYVAVVYEDEIVLLLGDSPNDAYKRTKKRP  156

Query  586  SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIR  762
            +   A L+ KKE+   K  F TR LLG  K+EH I+IE+++ G  +PEMWIS+DG+  IR
Sbjct  157  TFPEATLLCKKENVYGKKLFCTRALLGDGKEEHDIVIENSLFGPGDPEMWISIDGISTIR  216

Query  763  IVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDE  942
            I+NL+WRFRGNETI+++D  ++++WDVHDWL++ ++   G+FIFK +T   E ++S   E
Sbjct  217  ILNLNWRFRGNETISMNDTSIQIYWDVHDWLFNESSPSYGLFIFKPNT--IECASSANKE  274

Query  943  TDEDYPSTDFCHIFYAWKL  999
             D+      FCH+ YA K+
Sbjct  275  NDDSI--QGFCHVLYALKM  291



>ref|XP_010644630.1| PREDICTED: uncharacterized protein LOC100852612 [Vitis vinifera]
Length=308

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/271 (49%), Positives = 183/271 (68%), Gaps = 17/271 (6%)
 Frame = +1

Query  238   IYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLKTFK  417
             +Y AK+A L   V VTW K+L+ H+L I VEN   ENH+TCKIDL    FW KKGLK+F+
Sbjct  39    VYQAKVADLSCKVNVTWCKSLIDHSLSIHVENPSAENHHTCKIDLDILHFWNKKGLKSFE  98

Query  418   VDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPSLVA  597
             +D+KR+D +WD +  KFS+SPE  S Y++A+    E++LLLGD + EA KRT SKPSL  
Sbjct  99    IDEKRVDFFWDFREVKFSNSPEPCSDYYLAMVSNKEVVLLLGDLKNEAYKRTNSKPSLEE  158

Query  598   AALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVNL  774
             A LV+KKE+   K  F T+  LG+ KKEH I+IE+A+SG  +PE+WIS DG+  IR++NL
Sbjct  159   ATLVYKKENVYGKRLFCTKAKLGEGKKEHDIVIENAVSGFGDPEIWISADGIVLIRVMNL  218

Query  775   HWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDETDED  954
             HWRFRGNET+ ++++P+++FWDVHDWL++S + G  +FIFK     + +S+S  D T+  
Sbjct  219   HWRFRGNETVFLNNLPIQIFWDVHDWLFNSPSLGHALFIFKPGA-PEYSSDSDLDGTNHS  277

Query  955   --------YPS-------TDFCHIFYAWKLQ  1002
                     Y S        DFCH  YA ++ 
Sbjct  278   GEAVGSDIYDSLWTTTSAADFCHFLYARQID  308



>ref|XP_003615564.1| hypothetical protein MTR_5g069570 [Medicago truncatula]
 gb|AES98522.1| DUF868 family protein [Medicago truncatula]
Length=309

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 194/276 (70%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++ C+Y A +AG +R+V+V W KNL++HTL + V++   ++ ++CKID+K W FW KK
Sbjct  34    QSTVTCLYQANVAGFWRNVSVLWCKNLMNHTLHVTVDSVGGDSQFSCKIDVKPWPFWSKK  93

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+V+   +++YWD++SAKF+ SPE  S Y++AL +  E++LLLGD +K+A KRTKS
Sbjct  94    GYKTFEVEGNHVEVYWDLRSAKFTGSPEPSSDYYVALVLDEEVVLLLGDYKKKAYKRTKS  153

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIES--AMSGNEPEMWISVDGME  753
             +P+LV A L+ KKE+   K SFST+    +++KE+ I+++S    S N+PEMWIS+DG+ 
Sbjct  154   RPALVEAMLLVKKENVFGKKSFSTKARFDEKRKENEIVVDSLTGNSTNDPEMWISIDGIV  213

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKD----EA  921
              I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +GPG+FIFK    +D    E 
Sbjct  214   LIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGPGLFIFKPGPVEDESEKEG  273

Query  922   SNSQTDETDE---DYPST------DFCHIFYAWKLQ  1002
             S  Q+ E+D+    Y ST      +FC + YA+K++
Sbjct  274   SAVQSCESDDGSLGYHSTLNNATFEFCLVLYAYKIE  309



>ref|XP_011072457.1| PREDICTED: uncharacterized protein LOC105157708 [Sesamum indicum]
Length=309

 Score =   243 bits (619),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 183/278 (66%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T +  + C+Y   IAG +R+VT+ WSKNL++++L I VE+   +  Y CKI+LK W FW 
Sbjct  32    TAQSMVTCVYQTHIAGFWRNVTIVWSKNLMNYSLSISVESIDHDQPYMCKIELKPWHFWA  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             K+G +TF+VD  +LD YWD++SAKFS SPE  S +++AL    E++LLLGD +K+A KRT
Sbjct  92    KRGYRTFEVDGHQLDAYWDLRSAKFSGSPEPSSDFYVALVSEEEVVLLLGDSKKKAYKRT  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             K +P+LV A + +KKE    K SFSTR    Q+K+EH I++ES+ SG  EPEMWIS+DG+
Sbjct  152   KGRPALVEAVMFYKKEHVFGKKSFSTRAKFDQKKREHEIVVESSTSGPREPEMWISIDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS---TNKDEA  921
               I I NL W+FRGN+T+ V+  PV+VFWDVH WL+ +  +  G+FIFK      + D  
Sbjct  212   VLIHIKNLQWKFRGNQTVLVNKQPVQVFWDVHAWLFCAPGSSHGLFIFKPGEPEADSDVE  271

Query  922   SNSQTDETDEDYPS-----------TDFCHIFYAWKLQ  1002
               ++ DE+D   PS           + FC   YAWK++
Sbjct  272   DETRGDESDCSGPSKYYSTLSYSKASQFCLFLYAWKIE  309



>gb|ABK28164.1| unknown [Arabidopsis thaliana]
Length=308

 Score =   242 bits (618),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 186/282 (66%), Gaps = 19/282 (7%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY A I+G +R+VTV WSKNL++H+L ++V N   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTNVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFDVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K  F+TR     RKKEH II+ES+ SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDRKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
               I++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+     G G+FIFK  T +D     
Sbjct  206   VLIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSMPGTGHGLFIFKPGTTEDSDMEG  265

Query  919   -------------ASNSQTDETDEDYP-STDFCHIFYAWKLQ  1002
                          ++ S+   T    P   +FC   +A+KL+
Sbjct  266   SGHGGGGGGESDTSTGSRYYSTKSSNPWPPEFCLFLHAYKLE  307



>ref|NP_178505.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD27916.2| hypothetical protein [Arabidopsis thaliana]
 gb|AAM15482.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABE65426.1| hypothetical protein At2g04220 [Arabidopsis thaliana]
 gb|AEC05808.1| uncharacterized protein AT2G04220 [Arabidopsis thaliana]
Length=307

 Score =   242 bits (618),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 186/282 (66%), Gaps = 19/282 (7%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY A I+G +R+VTV WSKNL++H+L ++V N   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTNVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFDVEGNPVEVYWDFRSAKFTSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K  F+TR     RKKEH II+ES+ SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDRKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
               I++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+     G G+FIFK  T +D     
Sbjct  206   VLIQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSMPGTGHGLFIFKPGTTEDSDMEG  265

Query  919   -------------ASNSQTDETDEDYP-STDFCHIFYAWKLQ  1002
                          ++ S+   T    P   +FC   +A+KL+
Sbjct  266   SGHGGGGGGESDTSTGSRYYSTKSSNPWPPEFCLFLHAYKLE  307



>ref|XP_008380035.1| PREDICTED: uncharacterized protein LOC103443030 [Malus domestica]
 ref|XP_008365566.1| PREDICTED: uncharacterized protein LOC103429200 [Malus domestica]
Length=310

 Score =   241 bits (616),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 187/279 (67%), Gaps = 16/279 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+++A IA  +R VT+ W KNL++H+L I +++   E HYTCK DLK W FW 
Sbjct  32    TAQSTVTCVFLANIATFWRKVTIIWCKNLMNHSLSIRIDSLDGEFHYTCKFDLKPWHFWS  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+ +  ++++YWD++SAKF   PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  92    KKGYKSFEFEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDEEVVLLLGDMKKKAYKRT  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV A L +KKE+  AK SF+TR    +++KEH I++ES+ SG  +PEMWISVDG+
Sbjct  152   KSRPALVEALLYYKKENVFAKKSFATRVKFDEKRKEHDIVVESSTSGLKDPEMWISVDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQ----------  900
               I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+ S   G G+FIFK           
Sbjct  212   VLIHVKNLQWKFRGNQTVQVNMQPVQVFWDVHDWLFSSPGTGHGLFIFKPGAPESESDHD  271

Query  901   -----STNKDEASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                  S N D +S   + +T  +  S+DFC   +A+K++
Sbjct  272   RDGNGSINSDNSSAYYSTQTSNNSTSSDFCMFLHAYKIE  310



>ref|XP_008229762.1| PREDICTED: uncharacterized protein LOC103329112 [Prunus mume]
Length=309

 Score =   241 bits (616),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 189/278 (68%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y+A IA  +R VTV W KNL++H+L I V+    + HYTCKIDLK W FW 
Sbjct  32    TAQSTVTCVYLANIATNWRKVTVIWCKNLMNHSLSIRVDGLEGDFHYTCKIDLKPWHFWS  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++++YWD++SAKF   PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  92    KKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDEEVVLLLGDMKKKAYKRT  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P++V A L +K+E+  AK SF+TR    +++KEH I++ES+ +G  +PEMWIS+DG+
Sbjct  152   KSRPAIVEALLYYKRENVFAKKSFATRVRFDEKRKEHDIVVESSTAGPKDPEMWISIDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEA---  921
               I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+ S + G G+FIFK  T + E+   
Sbjct  212   VLIHVKNLQWKFRGNQTVLVNMEPVQVFWDVHDWLFTSPSTGHGLFIFKPGTPESESDRE  271

Query  922   SNSQTDETDEDYPS-----------TDFCHIFYAWKLQ  1002
             SN      D D+ S           +DFC   +A+K++
Sbjct  272   SNGNGGGVDSDHSSAYYSPQNNTTTSDFCLFLHAYKIE  309



>gb|KFK31798.1| hypothetical protein AALP_AA6G160300 [Arabis alpina]
Length=310

 Score =   241 bits (616),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/285 (46%), Positives = 185/285 (65%), Gaps = 22/285 (8%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY   IAG +R+VT+ WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQTHIAGFWRNVTILWSKNLMNHSLTVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG KTF+V+   +++YWD +SAKF+SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKTFEVEGNPVEVYWDFRSAKFASSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K  FSTR     +KKEH II+ES+ SG  EPEMWISVDG+
Sbjct  146   KSRPALVEAALFYKKETVFGKKCFSTRAKFYDKKKEHEIIVESSTSGPKEPEMWISVDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST--------  906
               +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK  T        
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSAPGTGHGLFIFKPGTVEENDMEG  265

Query  907   -------------NKDEASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                            D ++ S+   T       +FC   YAWKL+
Sbjct  266   SGHGGGGGGGGGGESDTSTWSRYYSTKSGSWPPEFCLFLYAWKLE  310



>gb|KDO59224.1| hypothetical protein CISIN_1g036500mg [Citrus sinensis]
Length=292

 Score =   241 bits (614),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 179/259 (69%), Gaps = 6/259 (2%)
 Frame = +1

Query  229  IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENH-YTCKIDLKTWQFWGKKGL  405
            +  IY AKIA  FR +TVTWSKNLV+H L   VEN Y++ H YT K DLK  QFW KKGL
Sbjct  37   LILIYQAKIADFFRKITVTWSKNLVNHYLCFNVENPYDDQHPYTFKTDLKASQFWNKKGL  96

Query  406  KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
            K F++D KR  +YWD + AKFSS+P   S Y++A+    E++LLLGD   +A KRTK +P
Sbjct  97   KNFEIDGKRAFVYWDFRQAKFSSNPAPSSDYYVAIVYEDEIVLLLGDSLNDAYKRTKKRP  156

Query  586  SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIR  762
            +   A L+ KK++   K  F TR LLG  K+EH I+IE+++ G  +PEMWIS+DG+  IR
Sbjct  157  TFPEATLLCKKQNVYGKKLFCTRALLGDGKEEHDIVIENSLFGPGDPEMWISIDGIWTIR  216

Query  763  IVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDE  942
            I+NL+WRFRGNETI+++D  ++++WDVHDWL++ ++   G+FIFK +T   E ++S   E
Sbjct  217  ILNLNWRFRGNETISMNDTSIQIYWDVHDWLFNESSPSYGLFIFKPNT--IECASSANKE  274

Query  943  TDEDYPSTDFCHIFYAWKL  999
             D+      FCH+ YA K+
Sbjct  275  NDDSI--QGFCHVLYALKM  291



>ref|XP_007217278.1| hypothetical protein PRUPE_ppa017616mg [Prunus persica]
 gb|EMJ18477.1| hypothetical protein PRUPE_ppa017616mg [Prunus persica]
Length=309

 Score =   241 bits (615),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 187/278 (67%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y+A IA  +R VTV W KNL++H+L I V+    + HYTCKIDLK W FW 
Sbjct  32    TAQSTVTCVYLANIATNWRKVTVIWCKNLMNHSLSIRVDGLEGDFHYTCKIDLKPWHFWS  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++++YWD++SAKF   PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  92    KKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDEEVVLLLGDMKKKAYKRT  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P++V A L +KKE+  AK SF+TR    +++KEH I++ES+ +G  +PEMWISVDG+
Sbjct  152   KSRPAIVEALLYYKKENVFAKKSFATRVRFDEKRKEHDIVVESSTAGPKDPEMWISVDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS---TNKDEA  921
               I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+ S + G G+FIFK     +  D  
Sbjct  212   VLIHVKNLQWKFRGNQTVLVNMEPVQVFWDVHDWLFTSPSTGHGLFIFKPGAPESESDRE  271

Query  922   SNSQTDETDEDYPS-----------TDFCHIFYAWKLQ  1002
             SN      D D+ S           +DFC   +A+K++
Sbjct  272   SNGNGGGLDSDHSSAYYSPQNNTTTSDFCLFLHAYKIE  309



>ref|XP_008353192.1| PREDICTED: uncharacterized protein LOC103416744 [Malus domestica]
Length=318

 Score =   241 bits (616),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 179/279 (64%), Gaps = 24/279 (9%)
 Frame = +1

Query  238   IYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHY-TCKIDLKTWQFWGKKGLKTF  414
             +Y AK+A L  +VT TW KNL SH+L I VE   ++N   TCKIDL + QFWGKKGLK+F
Sbjct  40    VYQAKVAELCCNVTATWCKNLTSHSLCITVEKPCQQNQCCTCKIDLSSTQFWGKKGLKSF  99

Query  415   KVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPSLV  594
             +VD +R+D+YWD + AKFS +PE  S Y++AL    E++LLLGD  ++A KRT+S+ S  
Sbjct  100   EVDGRRVDVYWDFRQAKFSCTPEPCSNYYVALVSKQEVVLLLGDLMEDAYKRTRSRSSSE  159

Query  595   AAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVN  771
              A L++KKE+ C K  F T+ +L + +KEH I+IE+ +SG  +PEMWISVDG   IRI+N
Sbjct  160   EARLMYKKENVCGKGLFCTKAMLEEGRKEHDIVIETLLSGPKDPEMWISVDGTVAIRIMN  219

Query  772   LHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDETDE  951
             L+WRFRGN+T+ ++D+PVE+FWDVHDWL+ S     G FIFK  T   E+SN   D    
Sbjct  220   LNWRFRGNKTVMLNDMPVEIFWDVHDWLFSSLGTSQGFFIFKAGTVDWESSNINYDYGSR  279

Query  952   DYPSTD----------------------FCHIFYAWKLQ  1002
             +   +                       FCH  YAWK +
Sbjct  280   NGNCSSCSLQHSPCNSPKGKGSSSNIGGFCHFLYAWKTE  318



>emb|CDO97954.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   241 bits (614),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 177/270 (66%), Gaps = 14/270 (5%)
 Frame = +1

Query  235   CIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLKTF  414
             C+Y   I G +R+VTV WSKNL++H+L I V++   + H TCKIDLK W FW KKG KTF
Sbjct  39    CVYQTHIGGYWRNVTVLWSKNLMNHSLSITVDSVETDYHQTCKIDLKPWHFWAKKGYKTF  98

Query  415   KVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKPSLV  594
             +VD  +LD YWD++SAKFS SPE  + +++AL    E++LL+GD +K+A KRTKS+P+LV
Sbjct  99    EVDGNQLDAYWDLRSAKFSGSPEPCTDFYVALVADEEVVLLIGDYKKKAYKRTKSRPALV  158

Query  595   AAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVN  771
              A L  KKE    K SFSTR     RKK+H I++ES+ SG  +PEMWIS+DG+  I I N
Sbjct  159   DAVLFFKKEHVFGKKSFSTRAKFDHRKKDHDIVVESSTSGPRDPEMWISIDGIVLIHIRN  218

Query  772   LHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNKDEASNSQT  936
             L W+FRGN+T+ V+  P++VFWDVH WL+ S     G+FIFK       ++KD      +
Sbjct  219   LQWKFRGNQTVLVNKQPIQVFWDVHSWLFCSPGTSHGLFIFKPGVPEAESDKDSNCTGDS  278

Query  937   D-ETDEDYPSTD-------FCHIFYAWKLQ  1002
             D   D  Y ST        FC   YAWK++
Sbjct  279   DCSADSRYYSTQSHSKSSPFCLFLYAWKIE  308



>ref|XP_010514327.1| PREDICTED: uncharacterized protein LOC104790300 [Camelina sativa]
Length=305

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 183/280 (65%), Gaps = 17/280 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY A I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFVSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
              S+P+LV AAL +KKE+  +K  F+TR     +KKEH II+ES  SG  EPEMWIS+DG+
Sbjct  146   NSRPALVEAALFYKKENVFSKKCFTTRAKFYDKKKEHEIIVESLTSGPKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
               +++ NL W+FRGN+T+ VD  PV+VFWDV DWL+ +   G G+FIFK    +D     
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVSDWLFSTPGTGHGMFIFKPGNGEDSDMEG  265

Query  919   ----ASNSQTDETDEDYPST--------DFCHIFYAWKLQ  1002
                    S T      Y ST        +FC   +AWKL+
Sbjct  266   SVHGGGESDTSTAGSRYYSTKSSNPWPPEFCLFLHAWKLE  305



>ref|XP_010488665.1| PREDICTED: uncharacterized protein LOC104766470 [Camelina sativa]
Length=308

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 185/284 (65%), Gaps = 22/284 (8%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY A I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFVSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K  F+TR     +KKEH II+ES+ SG  EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFYKKENVFGKKCFTTRAKFYDKKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
               +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+     G G+FIFK    +D     
Sbjct  206   VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSKPGTGHGMFIFKPGNGEDSDMEG  265

Query  919   ----------------ASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                              S   + +T   +P  +FC   +AWKL+
Sbjct  266   SGHGGGGGGESDTSTAGSRYYSTKTSNPWPP-EFCLFLHAWKLE  308



>ref|XP_010532946.1| PREDICTED: uncharacterized protein LOC104808831 [Tarenaya hassleriana]
Length=303

 Score =   239 bits (609),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 186/279 (67%), Gaps = 16/279 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY   IAG +R+VT+ WSKNL++H+L ++V +   +  Y CK+DLK W FW 
Sbjct  25    TAQSTVTCIYQTHIAGFWRNVTILWSKNLMNHSLTVMVTSVEGDMDYCCKVDLKPWHFWN  84

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF+  PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  85    KKGYKSFEVEGNPVEVYWDFRSAKFAGCPEPSSDFYVALVSDEEVVLLLGDCKKKAFKRT  144

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+   K SFSTR     RKKEH I++ES+ SG  EPEMWIS+DG+
Sbjct  145   KSRPALVDAALFYKKENVFGKKSFSTRAKFHDRKKEHEIVVESSASGPKEPEMWISIDGI  204

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKDE  918
               +++ NL W+FRGN+T+ VD  P++VFWDV DWL+ S   G G+FIFK    + ++ + 
Sbjct  205   VLVQVKNLQWKFRGNQTVLVDKQPIQVFWDVFDWLFSSPGTGHGLFIFKPGAVEESDHEG  264

Query  919   ASNSQTDETDEDYPS-----------TDFCHIFYAWKLQ  1002
             + +   +++D    S            +FC   YAWKL+
Sbjct  265   SGHGTGNDSDASNGSRYYSAKSSVWPPEFCLFLYAWKLE  303



>ref|XP_007142451.1| hypothetical protein PHAVU_008G281700g [Phaseolus vulgaris]
 gb|ESW14445.1| hypothetical protein PHAVU_008G281700g [Phaseolus vulgaris]
Length=309

 Score =   239 bits (610),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 184/271 (68%), Gaps = 14/271 (5%)
 Frame = +1

Query  226  SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGL  405
            S+  +Y  K+    RSVTV+W K+   H L + V+NT EEN ++CKIDL++ Q WGKKGL
Sbjct  37   SVTFVYQTKVGESLRSVTVSWCKDPTDHFLAMSVDNTLEENKFSCKIDLESGQSWGKKGL  96

Query  406  KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
            ++F++   R+DIYWD++ AKFS+SP+  SGY+IAL    E+LLLLGD E +AL RTKSKP
Sbjct  97   RSFEIAGARVDIYWDLRHAKFSTSPQPNSGYYIALVYKKEVLLLLGDLENDALVRTKSKP  156

Query  586  SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIR  762
            S   A LV K+++   K  F TR +L   K EH ++IE+++SG ++PEMWI +DGM   R
Sbjct  157  SPEEATLVCKRDNVYGKKMFCTRAILEDGKTEHDVVIETSLSGPDDPEMWIIIDGMLTSR  216

Query  763  IVNLHWRFRGNETITVDDVPVEVFWDVHDWLY-DSANAGPGIFIFKQS---TNKDEAS--  924
            I+NLHWRFRGNE + V+++PV++FWDVHDWL+ +    GP  F+FK     T+ D  S  
Sbjct  217  IMNLHWRFRGNEIVMVNNLPVQIFWDVHDWLFTNDLGPGPAFFVFKPGFLETSSDPISTE  276

Query  925  ------NSQTDE-TDEDYPSTDFCHIFYAWK  996
                  +S TDE  +E+  ST FCH  YAW+
Sbjct  277  CPERTGDSSTDELLEENSSSTGFCHFLYAWR  307



>ref|XP_007142239.1| hypothetical protein PHAVU_008G264000g [Phaseolus vulgaris]
 gb|ESW14233.1| hypothetical protein PHAVU_008G264000g [Phaseolus vulgaris]
Length=300

 Score =   239 bits (609),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 190/276 (69%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++ C Y A + G +R+V+V W KNL++H+L + V++   E  Y+CKID+K W FW KK
Sbjct  25    QSTVTCFYQANVTGYWRNVSVLWCKNLMNHSLHVTVDSVGGEVQYSCKIDVKPWHFWSKK  84

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KT +VD  ++D+YWD++SAKFS SPE  S +++AL    E++LLLGD +K+A KRTKS
Sbjct  85    GYKTIEVDGNQIDLYWDLRSAKFSGSPEPCSDFYVALVSDEEVVLLLGDYKKKAYKRTKS  144

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L+ KKE+  AK SFST+    + +K+  I++ES+  G N+PEMW+ +DG+  
Sbjct  145   RPALVDAMLLVKKENVFAKKSFSTKARFDENRKDSEIVVESSTGGPNDPEMWVIIDGIVL  204

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKDEAS  924
             I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +GPG+FIFK    +  ++ E S
Sbjct  205   INVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGPGLFIFKPGPPEPESEKEGS  264

Query  925   NSQTDETDED----YPST------DFCHIFYAWKLQ  1002
               +  E+D+D    Y ST      +FC + YA+K++
Sbjct  265   VMEGCESDDDGSVGYYSTMNIAAIEFCLVLYAYKIE  300



>ref|XP_010107360.1| hypothetical protein L484_006875 [Morus notabilis]
 gb|EXC15611.1| hypothetical protein L484_006875 [Morus notabilis]
Length=299

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/270 (47%), Positives = 184/270 (68%), Gaps = 7/270 (3%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y+A I+G +R VTVTW KNL++H   I V +   + H +CKIDLK W FW 
Sbjct  30    TAQSTVTCVYMANISGFWRKVTVTWCKNLMNHFFSITVHSLEGDFHCSCKIDLKPWHFWS  89

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+VD   ++++WD++SAKFS+ PE  S +++AL    E++LL+GD +K+A KRT
Sbjct  90    KKGYKSFEVDGNTVEVFWDIRSAKFSTGPEPCSDFYVALVCDEEVVLLIGDIKKKAYKRT  149

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV A + +KKE+  AK  FSTR  L +RKKE  I++ES+ SG  +PEMWISVDG+
Sbjct  150   KSRPALVEAIMFYKKENVFAKRCFSTRARLDERKKECDIVVESSTSGPRDPEMWISVDGI  209

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
               I + NL W+FRGN+T+ V++  V+VFWDVHDWL+ S   G G+FIFK    + E+   
Sbjct  210   VLIHVKNLQWKFRGNQTVLVNNQYVQVFWDVHDWLFGSPGNGRGLFIFKPGFTEPESEKE  269

Query  931   QTDE------TDEDYPSTDFCHIFYAWKLQ  1002
              ++       T  +  S +FC   +AWK++
Sbjct  270   GSENGSVYHSTISNSSSQEFCLFLHAWKIE  299



>gb|EYU21422.1| hypothetical protein MIMGU_mgv1a022950mg [Erythranthe guttata]
Length=311

 Score =   238 bits (606),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 186/280 (66%), Gaps = 17/280 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y A IAG +R+VTV WSKN+++++L I VE+  +E   TCKIDLK W FW 
Sbjct  32    TAQSTVTCVYQAHIAGFWRNVTVLWSKNVMNYSLCISVESVDDEQASTCKIDLKPWHFWA  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG KTF+VD  +LD YWD+KSAKFS SPE  + Y++ L    E++LLLGD +K+A KR 
Sbjct  92    KKGYKTFEVDGNQLDAYWDLKSAKFSGSPEPFAEYYVVLVSEEEVVLLLGDSKKKAYKRA  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             K++P LV A + +KKE    K SFSTR    Q+K+EH I++ES+ SG  EPEMWIS+DG+
Sbjct  152   KARPGLVDAVMFYKKEHVFGKKSFSTRAAFDQKKREHDIVVESSTSGPREPEMWISIDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNKD  915
               I + NL W+FRGN+T+ V+  PV+VFWDVH WL+ +  +  G+FIFK       ++ D
Sbjct  212   VLIHVRNLQWKFRGNQTVLVNKQPVQVFWDVHAWLFCAPGSNHGLFIFKPGAAECDSDLD  271

Query  916   EASNSQTDETDEDYPS-----------TDFCHIFYAWKLQ  1002
             E   ++ D +D   PS           +DFC   YAWK++
Sbjct  272   EEDENKGDGSDCSGPSRYYSTQSYSKASDFCLFLYAWKIE  311



>ref|XP_010466979.1| PREDICTED: uncharacterized protein LOC104747105 [Camelina sativa]
Length=308

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 183/282 (65%), Gaps = 20/282 (7%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
            T + ++ CIY A I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26   TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394  KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
            KKG K+F+V+   +++YWD +SAKF SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86   KKGYKSFEVEGNPVEVYWDFRSAKFVSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574  KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
            KS+P+LV AAL +KKE+   K  F+TR      KKEH II+ES+ SG  EPEMWIS+DG+
Sbjct  146  KSRPALVEAALFYKKENVFGKKCFTTRAKFYDEKKEHEIIVESSTSGPKEPEMWISIDGI  205

Query  751  ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
              +++ NL W+FRGN+T+ VD  PV+VFWDV+DWL+ +   G G+FIFK    +D     
Sbjct  206  VLVQVKNLQWKFRGNQTVLVDKQPVQVFWDVYDWLFSTPGTGHGMFIFKPGNGEDSDMEG  265

Query  919  -------ASNSQTDETDEDYPST--------DFCHIFYAWKL  999
                      S T      Y ST        +FC   +AWKL
Sbjct  266  SGHGGGGGGESDTSTAGSRYYSTKSSNPWPPEFCLFLHAWKL  307



>ref|XP_003518296.1| PREDICTED: uncharacterized protein LOC100796483 [Glycine max]
Length=307

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 189/275 (69%), Gaps = 14/275 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++ C Y A + G +R+V++ W K+L++H+L + V++   E  Y+CKID+K W FW KK
Sbjct  33    QSTVTCFYQANVVGFWRNVSILWCKHLMNHSLHVTVDSVGGEVQYSCKIDVKPWHFWSKK  92

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  ++++YWD++SAKF+ SPE  S Y++AL    E++LLLGD +K+A KRTKS
Sbjct  93    GYKTFEVDGNQVELYWDLRSAKFAGSPEPSSDYYVALVSDEEVVLLLGDYKKKAYKRTKS  152

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L+ KKE+  AK SFST+    +++K++ I+++S   G ++PEMWIS+DG+  
Sbjct  153   RPALVDAMLLVKKENVFAKKSFSTKARFDEKRKDNEIVVDSLTGGPSDPEMWISIDGIVL  212

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS--  930
             I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +GPG+FIFK    + E+     
Sbjct  213   IHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGPGLFIFKPGPPEAESEKEGS  272

Query  931   -----QTDETDEDYPST------DFCHIFYAWKLQ  1002
                  ++D+    Y ST      +FC + YA+K++
Sbjct  273   AVEGCESDDGSVGYFSTMNIATFEFCLVLYAYKIE  307



>ref|XP_003544282.1| PREDICTED: uncharacterized protein LOC100810973 [Glycine max]
 gb|KHN40039.1| hypothetical protein glysoja_009416 [Glycine soja]
Length=305

 Score =   236 bits (603),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 188/275 (68%), Gaps = 14/275 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++ C Y A + G +R+V+V W KNL++H+L I V++   E  Y+CKID+K W FW KK
Sbjct  31    QSTVTCFYQANVVGFWRNVSVLWCKNLMNHSLHITVDSVGGEVQYSCKIDVKPWHFWSKK  90

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  ++++YWD++SAKF+ SPE  S Y++AL    E++LLLGD +K+A KRTKS
Sbjct  91    GYKTFEVDGNQVELYWDLRSAKFTGSPEPSSDYYVALVSDEEVVLLLGDYKKKAYKRTKS  150

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A ++ KKE+  AK SFST+    +++K+  I+++S+  G ++PEMWIS+DG+  
Sbjct  151   RPALVDAMMLLKKENVLAKKSFSTKARFNEKRKDSEIVVDSSTGGPSDPEMWISIDGIVL  210

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS--  930
             I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +G G+FIFK    + E+     
Sbjct  211   IHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGHGLFIFKPGPPEAESEKEGS  270

Query  931   -----QTDETDEDYPST------DFCHIFYAWKLQ  1002
                  ++D+    Y ST      +FC + YA+K++
Sbjct  271   AVEGCESDDGSVGYFSTMNIATFEFCLVLYAYKIE  305



>ref|XP_006299727.1| hypothetical protein CARUB_v10015920mg [Capsella rubella]
 gb|EOA32625.1| hypothetical protein CARUB_v10015920mg [Capsella rubella]
Length=306

 Score =   236 bits (603),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/282 (45%), Positives = 187/282 (66%), Gaps = 20/282 (7%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ CIY A I+G +R+VTV WSKNL++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  26    TAQSTVTCIYQAHISGFWRNVTVLWSKNLMNHSLMVMVTSVEGDMNYCCKVDLKPWHFWN  85

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF SSPE  S +++AL    E++LL+GD +K+A KRT
Sbjct  86    KKGYKSFEVEGNPVEVYWDFRSAKFMSSPEPSSDFYVALVSEEEVVLLVGDYKKKAFKRT  145

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGM  750
             KS+P+LV AAL  KKE+   K  F+TR     +KKEH I +ES+ SG+ EPEMWIS+DG+
Sbjct  146   KSRPALVEAALFCKKENVFGKKCFTTRAKFYDKKKEHEINVESSTSGSKEPEMWISIDGI  205

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKD-----  915
               +++ NL W+FRGNET+ VD  PV+VFWDV+DWL+ +   G G+FIFK    +D     
Sbjct  206   VLVQVKNLQWKFRGNETVLVDKQPVQVFWDVYDWLFSTPGTGHGMFIFKPGNAEDIDMEG  265

Query  916   -------------EASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                           A+ + + ++   +P  +FC   +AWKL+
Sbjct  266   SGHGGGGGESDTSTANKNYSTKSSNPWPP-EFCLFLHAWKLE  306



>ref|XP_002307050.1| hypothetical protein POPTR_0005s06920g [Populus trichocarpa]
 gb|EEE94046.1| hypothetical protein POPTR_0005s06920g [Populus trichocarpa]
Length=294

 Score =   236 bits (601),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 181/268 (68%), Gaps = 3/268 (1%)
 Frame = +1

Query  202   SVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTW  381
             S   T + ++ C Y A +AG +R++TV W KNL++HTL +++ N   E  Y+CKIDLK W
Sbjct  29    STNKTPQSTVTCAYHAYVAGYWRTITVFWCKNLMNHTLNLIINNLEGEVCYSCKIDLKPW  88

Query  382   QFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekea  561
              FW KKG K+F+++  ++DI+WD +SAKFS SPE  S Y++A+    E++LLLGD +K+A
Sbjct  89    LFWSKKGGKSFELEGCQVDIHWDFRSAKFSGSPEPASDYYVAIVSDEEVVLLLGDYKKKA  148

Query  562   lKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWIS  738
              KRTK++P+LV A L  KKE+   + +FSTR    +RK EH II+ES+  G+ +PEMWIS
Sbjct  149   YKRTKARPALVEAILYLKKENVFHRKTFSTRAKFDERKNEHDIIVESSTGGSRDPEMWIS  208

Query  739   VDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE  918
             +DG+  I ++NL W+FRGN+T+ +   PV+VFWDVHDWL+ +   G G+FIFK    + E
Sbjct  209   IDGIVVIHVMNLQWKFRGNQTVMLSRQPVQVFWDVHDWLFSTPGTGHGLFIFKPGVPEPE  268

Query  919   ASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                  +    +   + +FC   YAWK++
Sbjct  269   DDKDGSSYGGQT--TAEFCLFLYAWKIE  294



>ref|XP_004490568.1| PREDICTED: uncharacterized protein LOC101492045 [Cicer arietinum]
Length=310

 Score =   236 bits (602),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 191/276 (69%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++ C Y A +AG +R+V+V W KNL++H+L I V++   E+ ++CKID+K W FW KK
Sbjct  35    QSTVTCFYQANVAGFWRNVSVLWCKNLMNHSLHITVDSVGGESQFSCKIDVKPWHFWSKK  94

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+V+  ++++YWD++SAKF+ SPE  S Y++AL    E++LLLGD +K+A KRTKS
Sbjct  95    GYKTFEVEGNQVEVYWDLRSAKFTGSPEPSSDYYVALVSDEEVMLLLGDYKKKAYKRTKS  154

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGMEC  756
             +P+LV A L+ KKE+  AK SF+T+    +++KE  II+ES      +PEMWIS+DG+  
Sbjct  155   RPALVDAMLLVKKENVFAKKSFATKARFDEKRKESEIIVESLTGATIDPEMWISIDGVVL  214

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKDEAS  924
             + + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +G G+FIFK    ++ N+ E  
Sbjct  215   LHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSGSGSGTGLFIFKPGPTEAENEKEGG  274

Query  925   NS----QTDETDEDYPST------DFCHIFYAWKLQ  1002
             ++    ++D+    Y ST      +FC + YA+K++
Sbjct  275   SAVEGCESDDGSVAYYSTLNIATFEFCLVLYAYKIE  310



>ref|XP_008353616.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
 ref|XP_008353617.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
 ref|XP_008353618.1| PREDICTED: uncharacterized protein LOC103417205 [Malus domestica]
Length=309

 Score =   236 bits (601),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 186/278 (67%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y+A IA  +R VT+ W KNL++H+L I +++     HYTCKIDLK W FW 
Sbjct  32    TAQSTVTCVYLANIATCWRKVTIIWCKNLMNHSLSIRIDSLDGGFHYTCKIDLKPWHFWS  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++++YWD++SAKF   PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  92    KKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDQEIVLLLGDMKKKAYKRT  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGM  750
             KS+P+LV A L +KKE+  AK SF+TR    + +KEH I++ES+ SG+ +PEMWIS+DG+
Sbjct  152   KSRPALVEALLYYKKENVFAKKSFATRVKFDENRKEHDIVVESSTSGSKDPEMWISIDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
               I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+ S   G G+FIFK    + E+ + 
Sbjct  212   VLIHVKNLQWKFRGNQTLQVNMQPVQVFWDVHDWLFSSPGTGHGLFIFKPGXPESESDHD  271

Query  931   QTDET--DEDYPST------------DFCHIFYAWKLQ  1002
             +      D D+ S             DFC   +A+K++
Sbjct  272   RDGNGGIDSDHSSPYYSTQTSNSTSSDFCLFLHAYKIE  309



>gb|KDP32618.1| hypothetical protein JCGZ_13168 [Jatropha curcas]
Length=307

 Score =   236 bits (601),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 182/273 (67%), Gaps = 13/273 (5%)
 Frame = +1

Query  223   CSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKG  402
              S+  +Y A +AG  R VTVTW+K L++++L I VEN   ENHY CKIDLK WQFWGKKG
Sbjct  35    ISVTHVYEAIVAGFSRHVTVTWNKTLMNYSLTISVENLSNENHYICKIDLKGWQFWGKKG  94

Query  403   LKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSK  582
             LK+  VD KR++IYWD +  KFS +PE VS Y++AL  G E++L LGD +K+A KRTK K
Sbjct  95    LKSLLVDGKRVEIYWDFRQVKFSRNPEPVSDYYVALVYGEEVVLTLGDLKKDAYKRTKRK  154

Query  583   PSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGMECIR  762
             PSL    L+ KKE+   K  F T+  L   K EH I+IE +   +EPE+WIS+D  E IR
Sbjct  155   PSLEEPILLCKKENVYGKRIFCTKAKLEDDKIEHDIVIEMSYGLDEPELWISIDSFEVIR  214

Query  763   IVNLHWRFRGNETITV-DDVPVEVFWDVHDWLY---DSANAGPGIFIFK---QSTNKDEA  921
             I+NLHW+FRGNE +T+ ++  VE+FWDVHDWLY    S ++  G+FIFK    S ++D+ 
Sbjct  215   IMNLHWKFRGNEKVTMRNNFEVEIFWDVHDWLYSSSLSTSSNHGLFIFKPINDSIDRDDT  274

Query  922   SNSQT------DETDEDYPSTDFCHIFYAWKLQ  1002
              + +       D   E  P++D+ H+ YAWK +
Sbjct  275   FHDKNNGLRYYDSPREILPTSDYFHVVYAWKFE  307



>ref|XP_011031123.1| PREDICTED: uncharacterized protein LOC105130358 [Populus euphratica]
Length=310

 Score =   236 bits (601),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 188/282 (67%), Gaps = 15/282 (5%)
 Frame = +1

Query  202   SVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTW  381
             S   T + ++ C Y A +AG +R++TV W KNL++HTL +++ N   E  Y CKIDLK W
Sbjct  29    STNKTPQSTVTCAYHAYVAGYWRTITVFWCKNLMNHTLNLIINNLEGEACYNCKIDLKPW  88

Query  382   QFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekea  561
              FW KKG K+F+++  ++DI+WD +SAKFS SPE  S Y++A+    E++LLLGD +K+A
Sbjct  89    LFWSKKGGKSFELEGCQVDIHWDFRSAKFSGSPEPASDYYVAIVSDEEVVLLLGDYKKKA  148

Query  562   lKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWIS  738
              KRTK++P+LV A L  KKE+   + +FSTR    +RK EH II+ES+  G+ +PEMWIS
Sbjct  149   YKRTKARPALVEAILYLKKENVFHRKTFSTRAKFDERKNEHDIIVESSAGGSRDPEMWIS  208

Query  739   VDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST----  906
             +DG+  I ++NL W+FRGN+T+ +   PV+VFWDVHDWL+ +   G G+FIFK       
Sbjct  209   IDGIVVIHVMNLQWKFRGNQTVMLSRQPVQVFWDVHDWLFSTPGTGHGLFIFKPGVPEPE  268

Query  907   -NKDEAS-NSQTDETDED-YPST-------DFCHIFYAWKLQ  1002
              +KD +S   Q+D +D   Y ST       +FC   YAWK++
Sbjct  269   DDKDGSSYGGQSDTSDGSMYFSTRSLSATAEFCLFLYAWKIE  310



>ref|XP_008342273.1| PREDICTED: uncharacterized protein LOC103405081 [Malus domestica]
Length=308

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 186/278 (67%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y+A IA  +R VT+ W KNL++H+L I +++     HYTCKIDLK W FW 
Sbjct  31    TAQSTVTCVYLANIATCWRKVTIIWCKNLMNHSLSIRIDSLDGGFHYTCKIDLKPWHFWS  90

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+  ++++YWD++SAKF   PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  91    KKGYKSFEVEGNQVEVYWDLRSAKFGGGPEPCSDFYVALVCDQEIVLLLGDMKKKAYKRT  150

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGM  750
             KS+P+LV A L +KKE+  AK SF+TR    + +KEH I++ES+ SG+ +PEMWIS+DG+
Sbjct  151   KSRPALVEALLYYKKENVFAKKSFATRVKFDENRKEHDIVVESSTSGSKDPEMWISIDGI  210

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
               I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+ S   G G+FIFK    + E+ + 
Sbjct  211   VLIHVKNLQWKFRGNQTLQVNMQPVQVFWDVHDWLFSSPGTGHGLFIFKPGPPESESDHD  270

Query  931   QTDET--DEDYPST------------DFCHIFYAWKLQ  1002
             +      D D+ S             DFC   +A+K++
Sbjct  271   RDGNGGIDSDHSSPYYSTQTSNSTSSDFCLFLHAYKIE  308



>ref|XP_004252365.1| PREDICTED: uncharacterized protein LOC101249896 [Solanum lycopersicum]
Length=308

 Score =   235 bits (599),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 186/276 (67%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + S+ C+Y + I G +R+VTV WSKNL++H++ + V++   + H TCKIDLK W FW KK
Sbjct  33    QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESDYHQTCKIDLKPWHFWAKK  92

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  +L+ YWD++SAKFS SPE  S +++AL    E++LLLGD +K+A K+TKS
Sbjct  93    GYKTFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEEVVLLLGDYKKKAYKKTKS  152

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE    K SFSTR    QRK+E  I++ES+ +G  +PEMWIS+DG+  
Sbjct  153   RPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESSTTGPRDPEMWISIDGIVL  212

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEAS----  924
             I I NL W+FRGNET+ V+  PV+VFWDVH WL+ S  +G G+FIFK   ++D++     
Sbjct  213   IHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLFCSPGSGHGLFIFKPGASEDDSDKEGS  272

Query  925   --NSQTDETDED--------YPSTDFCHIFYAWKLQ  1002
                  +D +D+           S+ FC   YAWK++
Sbjct  273   SVGGGSDCSDQSKYYSTLSYSKSSPFCLFLYAWKIE  308



>ref|XP_010542041.1| PREDICTED: uncharacterized protein LOC104815373 [Tarenaya hassleriana]
Length=303

 Score =   234 bits (598),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 187/279 (67%), Gaps = 16/279 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C Y   IAG +R+VT+ WSKN+++H+L ++V +   + +Y CK+DLK W FW 
Sbjct  25    TAQSTVTCTYQTHIAGFWRNVTILWSKNMLNHSLTVMVTSIEGDMNYCCKVDLKPWNFWN  84

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+   +++YWD +SAKF   PE  S +++A+    E++LLLGD +K+A KRT
Sbjct  85    KKGYKSFEVEGNPVEVYWDFRSAKFVGGPEPSSDFYVAVVSDEEVVLLLGDCKKKAFKRT  144

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+LV AAL +KKE+A  K SF+TR     RKKEH II+ES+ SG  +PEMWIS+DG+
Sbjct  145   KSRPALVEAALFYKKENAFGKKSFATRAKFNDRKKEHEIIVESSTSGPKDPEMWISIDGI  204

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKDE  918
               +++ NL W+FRGN+T+ VD   V+VFWDV+DWL+     G G FIFK    + ++K+ 
Sbjct  205   VLVQVRNLQWKFRGNQTVLVDKQSVQVFWDVYDWLFSPPGTGHGRFIFKPGAVEESDKEG  264

Query  919   ASNSQTDETDED----YPST-------DFCHIFYAWKLQ  1002
             + +   +++D      Y ST       +FC   YAWKL+
Sbjct  265   SGHFNGNDSDASIGSRYYSTASSVWPPEFCLFLYAWKLE  303



>ref|XP_010103965.1| hypothetical protein L484_020218 [Morus notabilis]
 gb|EXB97668.1| hypothetical protein L484_020218 [Morus notabilis]
Length=1381

 Score =   252 bits (643),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 189/275 (69%), Gaps = 17/275 (6%)
 Frame = +1

Query  229   IFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVEN-TYEENHYTCKIDLKTWQFWGKKGL  405
             I C Y AK+  +F +V+VTW K+L S++L I V+    +ENHYTCKIDLK  QFWGKKGL
Sbjct  1107  ITCFYQAKLGEIFCNVSVTWCKSLTSYSLTIKVDKKASKENHYTCKIDLKNNQFWGKKGL  1166

Query  406   KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
             K+F  D +R+D++WD +  KFSSSPE  S Y++AL    E++LLLGD E  A KRT+++P
Sbjct  1167  KSFAADGERVDLFWDFRLVKFSSSPEPCSDYYVALVCKEEMVLLLGDLEDVACKRTRARP  1226

Query  586   SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIR  762
             SL  A L+HKKE+ C K  F T  +L   KKE+ I+IE+++ G  +PEMWISV+G   IR
Sbjct  1227  SLEGATLLHKKENVCGKNLFCTNAMLNAGKKENEIVIENSLLGPGDPEMWISVEGAVAIR  1286

Query  763   IVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKD----E  918
             ++NL+WRFRGNET+  ++VP+++FWDVHDWL+ S  +G G+FIFK     STN D     
Sbjct  1287  VMNLNWRFRGNETLMANNVPIQIFWDVHDWLFTSPGSGHGLFIFKLGSPDSTNTDFYARN  1346

Query  919   ASNSQTDET--DEDYP-----STDFCHIFYAWKLQ  1002
              S  + +++  D D P     + ++CH  YAWK++
Sbjct  1347  CSEVRYNDSKYDNDSPQGSLSTNEYCHYLYAWKIE  1381



>ref|XP_007146005.1| hypothetical protein PHAVU_006G004800g [Phaseolus vulgaris]
 gb|ESW17999.1| hypothetical protein PHAVU_006G004800g [Phaseolus vulgaris]
Length=315

 Score =   234 bits (598),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/280 (44%), Positives = 190/280 (68%), Gaps = 17/280 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             + + ++ CIY   +AG +R+V+V W KNL++HTL + V++T  E  YTCKID+K W FW 
Sbjct  36    SSQSTVTCIYQTNVAGCWRNVSVLWCKNLMNHTLNLKVDSTGGEFSYTCKIDVKPWYFWN  95

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSS-SPEAVSGYHIalamggelllllgdqekealKR  570
             KKG K+F++D  ++++YWD++SA+FS  +PE +S Y++A+    E++LLLGD +K+A KR
Sbjct  96    KKGYKSFELDGHQVEVYWDLRSARFSGGAPEPISDYYVAMVSEEEVVLLLGDYKKKAYKR  155

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDG  747
              K +PS+V A L+ K+ES  AK SF+T+    ++++E+ I++ES+  GN EPEMWIS+DG
Sbjct  156   MKMRPSIVEAMLLVKRESVFAKKSFATKARFDEKRRENDIVVESSTFGNKEPEMWISIDG  215

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNK  912
             +  I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +GPG+FIFK       + +
Sbjct  216   LVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSMSGSGPGLFIFKPGPVEAESER  275

Query  913   DEASNSQTDETDE----------DYPSTDFCHIFYAWKLQ  1002
             +E  N   D  +            Y  ++ C + YA+KL+
Sbjct  276   EERGNEGCDSDNGSCASGYYSTLSYAHSESCLVLYAYKLE  315



>ref|XP_006366122.1| PREDICTED: uncharacterized protein LOC102584925 [Solanum tuberosum]
Length=308

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 187/276 (68%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + S+ C+Y + I G +R+VTV WSKNL++H++ + V++   + H TCKIDLK W FW KK
Sbjct  33    QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESDYHQTCKIDLKPWHFWAKK  92

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  +L+ YWD++SAKFS SPE  S +++AL    E++LLLGD +K+A K+TKS
Sbjct  93    GYKTFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEEVVLLLGDYKKKAYKKTKS  152

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE    K SFSTR    QRK+E  I++ES+ +G  +PEMWIS+DG+  
Sbjct  153   RPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESSTTGPRDPEMWISIDGIVL  212

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEAS----  924
             I I NL W+FRGNET+ V+  PV+VFWDVH WL+ S  +G G+FIFK   ++D++     
Sbjct  213   IHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLFCSPGSGHGLFIFKPGASEDDSDKEGS  272

Query  925   --NSQTDETDED-YPST-------DFCHIFYAWKLQ  1002
                  +D +D+  Y ST        FC   YAWK++
Sbjct  273   SVGGGSDCSDQSKYYSTLSYSKASPFCLFLYAWKIE  308



>gb|AET00846.2| kinesin heavy chain, putative [Medicago truncatula]
Length=1462

 Score =   252 bits (643),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 184/274 (67%), Gaps = 12/274 (4%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T   S+  +Y  K+   FR+V VTW KNL+ H+L + VE   EEN +TCKIDL + Q WG
Sbjct  1188  TPHSSVIYVYQTKLGDSFRNVAVTWCKNLIEHSLSMSVEEPSEENKFTCKIDLASGQSWG  1247

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKGLK+F+++  R+D+YWD + AKFS++P+  SGY++AL    E+LLLLGD   +A  RT
Sbjct  1248  KKGLKSFEIEGARVDVYWDFRHAKFSTNPQPCSGYYVALVYKKEVLLLLGDLTNDAYVRT  1307

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KSKPS   A L+ KKE+   K  F TR +L + K EH ++IE+++SG ++PEMWIS+DGM
Sbjct  1308  KSKPSSEEATLLCKKENVQGKKLFCTRAMLEEGKPEHDVVIETSLSGPDDPEMWISIDGM  1367

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
                RI+NL+W+FRGNE + V+++PV++FWDVHDWL++   +GP +FIFK    + + SNS
Sbjct  1368  LASRIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFNDLGSGPAVFIFKPGILETDDSNS  1427

Query  931   QT-----------DETDEDYPSTDFCHIFYAWKL  999
             +            D  DE+  +  F H  YAW++
Sbjct  1428  RECTERNEDSGSYDLVDENSSTKSFLHFLYAWRM  1461



>ref|XP_003617887.1| Kinesin-4 [Medicago truncatula]
Length=1503

 Score =   252 bits (643),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 184/274 (67%), Gaps = 12/274 (4%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T   S+  +Y  K+   FR+V VTW KNL+ H+L + VE   EEN +TCKIDL + Q WG
Sbjct  1229  TPHSSVIYVYQTKLGDSFRNVAVTWCKNLIEHSLSMSVEEPSEENKFTCKIDLASGQSWG  1288

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKGLK+F+++  R+D+YWD + AKFS++P+  SGY++AL    E+LLLLGD   +A  RT
Sbjct  1289  KKGLKSFEIEGARVDVYWDFRHAKFSTNPQPCSGYYVALVYKKEVLLLLGDLTNDAYVRT  1348

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KSKPS   A L+ KKE+   K  F TR +L + K EH ++IE+++SG ++PEMWIS+DGM
Sbjct  1349  KSKPSSEEATLLCKKENVQGKKLFCTRAMLEEGKPEHDVVIETSLSGPDDPEMWISIDGM  1408

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
                RI+NL+W+FRGNE + V+++PV++FWDVHDWL++   +GP +FIFK    + + SNS
Sbjct  1409  LASRIMNLNWKFRGNEIVMVNNLPVQIFWDVHDWLFNDLGSGPAVFIFKPGILETDDSNS  1468

Query  931   QT-----------DETDEDYPSTDFCHIFYAWKL  999
             +            D  DE+  +  F H  YAW++
Sbjct  1469  RECTERNEDSGSYDLVDENSSTKSFLHFLYAWRM  1502



>ref|XP_010038753.1| PREDICTED: uncharacterized protein LOC104427347 [Eucalyptus grandis]
 gb|KCW47641.1| hypothetical protein EUGRSUZ_K01385 [Eucalyptus grandis]
Length=310

 Score =   234 bits (596),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 125/278 (45%), Positives = 179/278 (64%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++   Y A I G + +V++TW KNL++H+L I V+    + HYTCKI LK W FW 
Sbjct  33    TAQSTVTLAYQANIGGYWHNVSITWCKNLMNHSLSITVDGLEGDFHYTCKIYLKPWHFWS  92

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F+V+ KR+D+YWD++SAKF+ SPE  + Y++AL    E++LLLGD +K+A KRT
Sbjct  93    KKGYKSFEVESKRVDVYWDLRSAKFAGSPEPCTDYYVALVSDEEVVLLLGDYKKKAYKRT  152

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGM  750
             KS+P+LV A L +KKE+   K +F+TR    +R KEH I +ES   G+ EPEMWI++DG 
Sbjct  153   KSRPALVDAMLFYKKENVFGKKTFATRAKFDERTKEHEITVESTTFGHREPEMWINIDGA  212

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK-----------  897
               I + NL W+FRGN+ I V+  PV+VFWDVHDW++ S   G G+FIFK           
Sbjct  213   VVIHVRNLDWKFRGNQNIVVNKKPVQVFWDVHDWMFKSPGTGHGLFIFKPGLVEPESDRD  272

Query  898   ---QSTNKDEASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                +  N D ++ ++         + DFC   YAWK++
Sbjct  273   GSSRGANSDSSTATKYYTARTGSTAPDFCLFLYAWKVE  310



>ref|XP_011039823.1| PREDICTED: uncharacterized protein LOC105136253 [Populus euphratica]
Length=307

 Score =   234 bits (596),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 184/275 (67%), Gaps = 14/275 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + S+  IY  ++A L  +VTVTW+KN+++ +L I VEN  +E+HYTCKID+KTWQFWGKK
Sbjct  33    QISVTYIYTVEVAELLSNVTVTWNKNVMNCSLSISVENPLDESHYTCKIDIKTWQFWGKK  92

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             GLK+F+VD KR+D+YWD + AKFS+  E +S Y++AL    E++L+LGD + +A KRTK 
Sbjct  93    GLKSFEVDGKRVDVYWDFRQAKFSNHAEPLSDYYVALVYNEEVVLMLGDMKMDAFKRTKK  152

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +PSL    L+ KKE+   K SF  + +  + K EH ++IE ++SG  +PEM I++DG E 
Sbjct  153   RPSLTEPILLCKKENVYGKRSFCAKAVFQKDKTEHDLVIEFSLSGLGDPEMGITIDGFEV  212

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNK---DEASN  927
             IR++NL+WRFRGNE + VDDV V++FWDVHDWL+  ++   G+FI K +  +   D+  +
Sbjct  213   IRVMNLNWRFRGNENMKVDDVGVQIFWDVHDWLFTGSSTSHGLFILKPAAEEGGDDKVGD  272

Query  928   SQ----TDETDEDYP------STDFCHIFYAWKLQ  1002
              +     D    D P      +  F H+  AWK +
Sbjct  273   GRHCRGNDGGMYDSPKERSSSTPGFFHVINAWKYE  307



>gb|EYU45840.1| hypothetical protein MIMGU_mgv1a019714mg [Erythranthe guttata]
Length=313

 Score =   234 bits (596),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 128/283 (45%), Positives = 183/283 (65%), Gaps = 22/283 (8%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++ C+Y   IAG +R+VTV W KNL++++L I V++  +E  YTCKIDLK W FW KK
Sbjct  31    QTTVTCVYQTHIAGFWRNVTVLWGKNLMNYSLSISVDSVEKEGVYTCKIDLKPWHFWAKK  90

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G K F+VD  +++ YWD++SAKFS SPE VS +++ L    E++LLLGD +K+A KRTK+
Sbjct  91    GYKAFEVDGNQMEAYWDLRSAKFSGSPEPVSDFYVVLVSEEEVVLLLGDLKKKAYKRTKA  150

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE+   K SFSTR    ++KKEH I++ES+ SG  +PEMWIS+DG+  
Sbjct  151   RPALVDAMLFYKKENVFGKKSFSTRAKFDRKKKEHEIVVESSTSGPKDPEMWISIDGIVL  210

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK-------------  897
             + IVNL W+FRGN+T+ V+  P++VFWDVH WL+    +  G+FIFK             
Sbjct  211   VHIVNLQWKFRGNQTVLVNKQPIQVFWDVHAWLFCGPGSNHGLFIFKNGEGEGESDEEVE  270

Query  898   -----QSTNKDE---ASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                    +  DE   + NS+   T      + FC   YAWK++
Sbjct  271   GEEDENGSKGDESECSENSKYFSTHSYSKDSKFCLFLYAWKIE  313



>ref|XP_009592922.1| PREDICTED: uncharacterized protein LOC104089679 [Nicotiana tomentosiformis]
Length=309

 Score =   233 bits (595),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 186/276 (67%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + S+ C+Y + I G +R+VTV WSKNL++H++ + V++   + H TCKIDLK W FW KK
Sbjct  34    QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESDYHQTCKIDLKPWHFWAKK  93

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  +L+ YWD++SAKFS SPE  S +++AL    E++LLLGD +K+A K+TKS
Sbjct  94    GYKTFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEEVVLLLGDYKKKAYKKTKS  153

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE    K SFSTR    QRK+E  I++ES+ SG  +PEMWIS+DG+  
Sbjct  154   RPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESSTSGLRDPEMWISIDGIVL  213

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ-  933
             I I NL W+FRGNET+ V+  PV+V WDVH WL+ S  +G G+FIFK   ++D++   + 
Sbjct  214   IHIKNLQWKFRGNETVLVNKQPVQVLWDVHAWLFCSPGSGHGLFIFKPGASEDDSDREES  273

Query  934   -----TDETDED-YPST-------DFCHIFYAWKLQ  1002
                  +D +D   Y ST        FC   YAWK++
Sbjct  274   SVGGGSDCSDHSKYYSTLSYSKASPFCLFLYAWKIE  309



>ref|XP_011016815.1| PREDICTED: uncharacterized protein LOC105120349, partial [Populus 
euphratica]
Length=296

 Score =   233 bits (593),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 169/232 (73%), Gaps = 1/232 (0%)
 Frame = +1

Query  220  RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
            + S+  IY  ++A L  +VTVTW+KN+++ +L I VEN  +E+HYTCKID+KTWQFWGKK
Sbjct  33   QISVTYIYTVEVAELLSNVTVTWNKNVMNCSLSISVENPLDESHYTCKIDIKTWQFWGKK  92

Query  400  GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
            GLK+F+VD KR+D+YWD + AKFS+  E +S Y++AL    E++L+LGD + +A KRTK 
Sbjct  93   GLKSFEVDGKRVDVYWDFRQAKFSNHAEPLSDYYVALVYNEEVVLMLGDMKMDAFKRTKK  152

Query  580  KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
            +PSL    L+ KKE+   K SF  + +  + K EH ++IE ++SG  +PEM I++DG E 
Sbjct  153  RPSLTEPILLCKKENVYGKRSFCAKAVFQKDKTEHDLVIEFSLSGLGDPEMGITIDGFEV  212

Query  757  IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNK  912
            IR++NL+WRFRGNE + VDDV V++FWDVHDWL+  ++   G+FI K +  +
Sbjct  213  IRVMNLNWRFRGNENMKVDDVGVQIFWDVHDWLFTGSSTSHGLFILKPAAEE  264



>ref|XP_002266988.1| PREDICTED: uncharacterized protein LOC100249414 [Vitis vinifera]
Length=312

 Score =   233 bits (594),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 185/277 (67%), Gaps = 15/277 (5%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
            T + ++ C Y   IAG +R+VT+ W KN+++H+L I V++   E H+TCKIDLK W FW 
Sbjct  35   TAQSTVTCAYQTNIAGFWRNVTILWCKNIMNHSLSITVDSLDGEIHHTCKIDLKPWHFWS  94

Query  394  KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
            KKG K+F+ D   +D++WD++SAKFS  PE  + Y++AL    E++LLLGD +K+A KRT
Sbjct  95   KKGYKSFEFDGNPVDVFWDLRSAKFSGGPEPSADYYVALVSDEEVVLLLGDHKKKAYKRT  154

Query  574  KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
            KS+P+LV A   +KKE+  AK  FSTR    ++KKEH I++ES+ SG  +PEMWIS+DG+
Sbjct  155  KSRPALVDAIQFYKKENVFAKKCFSTRAKFEEKKKEHDIVVESSTSGPRDPEMWISIDGI  214

Query  751  ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKDE  918
              I + NL W+FRGN+T+ VD + V+VFWDVHDWL+ +   G G+FIFK    ++ +  +
Sbjct  215  VLIHVKNLQWKFRGNQTVLVDKLQVQVFWDVHDWLFSNPGTGHGLFIFKPGAPEADSDRD  274

Query  919  ASNSQTDETDEDYPST----------DFCHIFYAWKL  999
              +S+  ++D    S+          +F  + YAWK+
Sbjct  275  GDSSRGGDSDTSTGSSRYYNARAAAPEFSLLLYAWKI  311



>ref|XP_009778863.1| PREDICTED: uncharacterized protein LOC104228156 [Nicotiana sylvestris]
Length=309

 Score =   233 bits (594),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 186/276 (67%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + S+ C+Y + I G +R+VTV WSKNL++H++ + V++   + H TCKIDLK W FW KK
Sbjct  34    QSSVTCVYQSHIGGYWRNVTVIWSKNLMNHSVTLTVDSVESDYHQTCKIDLKPWHFWAKK  93

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G K F+VD  +L+ YWD++SAKFS SPE  S +++AL    E++LLLGD +K+A K+TKS
Sbjct  94    GYKIFEVDGNQLEAYWDLRSAKFSGSPEPCSDFYVALVSEEEVVLLLGDYKKKAYKKTKS  153

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE    K SFSTR    QRK+E  I++ES+ SG  +PEMWIS+DG+  
Sbjct  154   RPALVDALLFYKKEHVFGKKSFSTRAKFDQRKQESDIVVESSTSGPRDPEMWISIDGIVL  213

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQ-  933
             I I NL W+FRGNET+ V+  PV+VFWDVH WL+ S  +G G+FIFK   ++D++   + 
Sbjct  214   IHIKNLQWKFRGNETVLVNKQPVQVFWDVHAWLFCSPGSGHGLFIFKPGASEDDSDREES  273

Query  934   -----TDETDED-YPST-------DFCHIFYAWKLQ  1002
                  +D +D   Y ST        FC   YAWK++
Sbjct  274   SVGGGSDCSDHSKYYSTLSYSKASPFCLFLYAWKIE  309



>ref|XP_006469407.1| PREDICTED: uncharacterized protein LOC102629245 [Citrus sinensis]
 gb|KDO51012.1| hypothetical protein CISIN_1g047581mg [Citrus sinensis]
Length=308

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 181/281 (64%), Gaps = 18/281 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C Y   IAG  R+VTV W KNL++H+L I++ +   + HY+CK+DLK W FW 
Sbjct  28    TAQSTVTCGYQTHIAGYLRNVTVLWCKNLMNHSLSIMINSLEGDYHYSCKVDLKPWHFWS  87

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+  V+  +++IYWD++SAKFS  PE    +++AL    E++LLLGD +K+A KRT
Sbjct  88    KKGYKSLDVEGNQVEIYWDLRSAKFSGGPEPCGDFYVALVWEEEVVLLLGDYKKKAYKRT  147

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             K++P+LV A   +KKE+  AK SF TR    +RK+EH I++ES+  G  +PEMWIS+DG+
Sbjct  148   KARPALVEALQYYKKENVFAKKSFGTRAKFDERKREHDIVVESSTLGPKDPEMWISIDGI  207

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST---NKDEA  921
               + + NL W+FRGN+T+ VD  PV+VFWDVHDWL+ +   G G+FIFK +    ++ E 
Sbjct  208   VLVHVRNLQWKFRGNQTVLVDKQPVQVFWDVHDWLFSTPGTGHGLFIFKPNAPEISESEG  267

Query  922   SNSQTDETDEDYPS--------------TDFCHIFYAWKLQ  1002
             S+    ++D    S               +FC   YAWK++
Sbjct  268   SSQGGGDSDNSNGSKYHSSRNSSRSNTAPEFCLFLYAWKIE  308



>ref|XP_002300574.2| hypothetical protein POPTR_0001s47170g [Populus trichocarpa]
 gb|EEE85379.2| hypothetical protein POPTR_0001s47170g [Populus trichocarpa]
Length=309

 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 168/232 (72%), Gaps = 1/232 (0%)
 Frame = +1

Query  220  RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
            + S+  IY  ++A L  +VTVTW+KN+++ +L I VEN  +E+HYTCKID+KTWQFWGKK
Sbjct  33   QISVTYIYTVEVAELRSNVTVTWNKNVMNCSLSISVENPLDESHYTCKIDIKTWQFWGKK  92

Query  400  GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
            GLK+F+VD KR+D+YWD + AKFS+  E +S Y++AL    E++L+LGD + +A KRTK 
Sbjct  93   GLKSFEVDGKRVDVYWDFRQAKFSNHAEPLSDYYVALVYNEEVVLMLGDMKMDAFKRTKK  152

Query  580  KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
            +PSL    L+ KKE+   K SF  + +    K EH ++IE ++SG  +PEM I+VDG E 
Sbjct  153  RPSLTEPILLCKKENVYGKRSFCAKAMFQNDKTEHDLVIEFSLSGLGDPEMGITVDGFEV  212

Query  757  IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNK  912
            IR++NL+WRFRGNE + VDDV V++FWDVHDWL+  ++   G+FI K +  +
Sbjct  213  IRVMNLNWRFRGNENMKVDDVGVQIFWDVHDWLFSGSSTSHGLFILKPAAQE  264



>ref|XP_007049429.1| Uncharacterized protein TCM_002465 [Theobroma cacao]
 gb|EOX93586.1| Uncharacterized protein TCM_002465 [Theobroma cacao]
Length=311

 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 184/276 (67%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + ++  +Y   I G +R+VT+ W KNL++H L I+V +   +  Y+CKIDLK W FW KK
Sbjct  36    QSAVTLVYQTNILGYWRNVTIMWCKNLMNHALSIMVNSMEGDAQYSCKIDLKPWHFWSKK  95

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G K+F+V+ K++D+YWD++SAKF++ PE  + Y++AL    E++LLLGD +K+A KRTKS
Sbjct  96    GYKSFEVEGKQVDVYWDLRSAKFTTGPEPAAEYYVALVADEEVVLLLGDYKKKAYKRTKS  155

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV   L +K+E+  AK SF+TR    +R+KEH I++ES+ +G  +PEMWIS+DG+  
Sbjct  156   RPALVEPLLFYKQENVFAKKSFATRARFDERRKEHDIVVESSTNGFKDPEMWISMDGVVL  215

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK----QSTNKDEAS  924
             I + NL W+FRGN+T+ VD  PV+V WDVHDWL+ SA  G G+FIFK    ++ +  E S
Sbjct  216   IHVRNLQWKFRGNQTVLVDKQPVQVLWDVHDWLFTSAGTGHGLFIFKPIAAEAESDREGS  275

Query  925   NSQTD---ETDEDYPST-------DFCHIFYAWKLQ  1002
                 D    T   Y ST       +F    +AWK++
Sbjct  276   GHGGDSDTSTGTRYYSTHSPTMTSEFSLFLHAWKIE  311



>ref|XP_011080356.1| PREDICTED: uncharacterized protein LOC105163627 [Sesamum indicum]
Length=319

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/278 (46%), Positives = 180/278 (65%), Gaps = 15/278 (5%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+Y   IAG +R+ TV WSKNL++H+L I V++  +E    CKIDLK W FW 
Sbjct  42    TPQTTVTCVYQTHIAGFWRNATVLWSKNLMNHSLSISVDSAEQETASMCKIDLKPWHFWA  101

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG KTF+VD  +L+ YWD++SAKFS SPE  + +++AL    E++LLLGDQ+K+A KRT
Sbjct  102   KKGYKTFEVDGNQLEAYWDLRSAKFSGSPEPSADFYVALVSDEEVVLLLGDQKKKAYKRT  161

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             ++ P+LV A + +KKE+   K SFSTR    +RK+EH I++ES+ +G  +PEMWIS+DG+
Sbjct  162   RATPALVDAMMFYKKENVFGKKSFSTRVKFDERKREHEIVVESSTTGPRDPEMWISIDGI  221

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE----  918
               I I NL W+FRGN+T+ VD   V+VFWDVH WL+ +  +  G+FIFK      +    
Sbjct  222   VLIHIKNLQWKFRGNQTVQVDKQTVQVFWDVHAWLFCAPGSNYGLFIFKSGDPDADSDGD  281

Query  919   ----------ASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                       + NS+   T      T FC   YAWK++
Sbjct  282   DSSRGDDSECSGNSRYYSTQSYSKGTQFCLFLYAWKIE  319



>ref|XP_006447854.1| hypothetical protein CICLE_v10017488mg [Citrus clementina]
 gb|ESR61094.1| hypothetical protein CICLE_v10017488mg [Citrus clementina]
Length=308

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 181/281 (64%), Gaps = 18/281 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C Y   IAG  R+VTV W KNL++H+L I++ +   + HY+CK+DLK W FW 
Sbjct  28    TAQSTVTCGYQTHIAGYLRNVTVLWCKNLMNHSLSIMINSLEGDYHYSCKVDLKPWHFWS  87

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+  V+  +++IYWD++SAKFS  PE    +++AL    E++LLLGD +K+A KRT
Sbjct  88    KKGYKSLDVEGNQVEIYWDLRSAKFSGGPEPCGDFYVALVWEEEVVLLLGDYKKKAYKRT  147

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             K++P+LV A   +KKE+  AK SF TR    +RK+EH I++ES+  G  +PEMW+S+DG+
Sbjct  148   KARPALVEALQYYKKENVFAKKSFGTRAKFDERKREHDIVVESSTLGPKDPEMWVSIDGI  207

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST---NKDEA  921
               + + NL W+FRGN+T+ VD  PV+VFWDVHDWL+ +   G G+FIFK +    ++ E 
Sbjct  208   VLVHVRNLQWKFRGNQTVLVDKQPVQVFWDVHDWLFSTPGTGHGLFIFKPNAPEISESEG  267

Query  922   SNSQTDETDEDYPS--------------TDFCHIFYAWKLQ  1002
             S+    ++D    S               +FC   YAWK++
Sbjct  268   SSQGGGDSDNSNGSKYHSSRNSSRSNTAPEFCLFLYAWKIE  308



>gb|KHN23821.1| hypothetical protein glysoja_028114 [Glycine soja]
Length=308

 Score =   231 bits (589),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 183/269 (68%), Gaps = 15/269 (6%)
 Frame = +1

Query  238  IYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLKTFK  417
            +Y  K+A L RS+T++W K+ + H L + V+NT EEN YTCKIDL + Q WGKKGL++F+
Sbjct  39   VYQTKVAELLRSITISWCKDPIDHFLSMSVDNTLEENKYTCKIDLGSGQSWGKKGLRSFE  98

Query  418  VDQKRLDIYWDVKSAKFSS-SPEAVSGYHIalamggelllllgdqekealKRTKSKPSLV  594
            +   R+DI+WD + A+FS+ SP+  SGY++AL    E+LLLLGD EK+A +RTKSKPSL 
Sbjct  99   IAGVRVDIFWDFRRAEFSATSPQPCSGYYVALVYKKEVLLLLGDLEKDAFERTKSKPSLD  158

Query  595  AAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVN  771
             A L+ K+++   K  F TR +L   K EH ++IE+++SG ++PEMWI++DGM   RI+N
Sbjct  159  EATLLCKRDNVYGKKMFCTRAILEDGKIEHDVVIETSLSGPDDPEMWINIDGMLASRIMN  218

Query  772  LHWRFRGNETITVDDVPVEVFWDVHDWLY-DSANAGPGIFIFK----QSTN-------KD  915
            LHWRFRGNE + V++ PV++FWDVHDWL+ +    GP  F+FK    ++T+        +
Sbjct  219  LHWRFRGNEIVMVNNFPVQIFWDVHDWLFTNDLGLGPAFFVFKPVFLETTSDFNSIECPE  278

Query  916  EASNSQTDETDEDYPSTD-FCHIFYAWKL  999
                S   E  ED  ST  FCH  YAW++
Sbjct  279  RGGGSSKHELLEDNSSTQGFCHYLYAWRI  307



>ref|XP_009777340.1| PREDICTED: uncharacterized protein LOC104226933 [Nicotiana sylvestris]
Length=308

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 182/276 (66%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             +CS+ C+Y + I G +R+VTV W K+L++H+L + V++    +H TCKIDLK W FW KK
Sbjct  33    QCSVTCVYQSHIGGYWRNVTVIWRKHLMNHSLTVSVDSVENNDHQTCKIDLKPWHFWAKK  92

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  +L+ YWD++SAKFS SPE    +++AL    E+++LLGD +K+A KRTKS
Sbjct  93    GYKTFEVDGNQLEAYWDLRSAKFSGSPEPYKDFYVALVSDEEVVMLLGDYKKKAYKRTKS  152

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE    K SFSTR      KKE  I++ES+ SG  +PEMWIS+DG+  
Sbjct  153   RPALVDALLFYKKEHVFGKKSFSTRAKFDNNKKESDIVVESSTSGPRDPEMWISIDGIVL  212

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNKDEA  921
             I I NL W+FRGN+T+ V+   V+VFWDVH WL+ S  +  G+FIFK       ++KD +
Sbjct  213   IHIKNLQWKFRGNQTVLVNKQHVQVFWDVHSWLFSSPGSSHGLFIFKPGELELDSDKDGS  272

Query  922   S-NSQTDETDE-DYPST-------DFCHIFYAWKLQ  1002
             S   ++D +D   Y ST        FC    AWK++
Sbjct  273   SVGGESDCSDHTKYYSTLSHSKAAPFCLFLCAWKIE  308



>emb|CBI28480.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 173/263 (66%), Gaps = 23/263 (9%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
            T + ++ C Y   IAG +R+VT+ W KN+++H+L I V++   E H+TCKIDLK W FW 
Sbjct  35   TAQSTVTCAYQTNIAGFWRNVTILWCKNIMNHSLSITVDSLDGEIHHTCKIDLKPWHFWS  94

Query  394  KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
            KKG K+F+ D   +D++WD++SAKFS  PE  + Y++AL    E++LLLGD +K+A KRT
Sbjct  95   KKGYKSFEFDGNPVDVFWDLRSAKFSGGPEPSADYYVALVSDEEVVLLLGDHKKKAYKRT  154

Query  574  KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
            KS+P+LV A   +KKE+  AK  FSTR    ++KKEH I++ES+ SG  +PEMWIS+DG+
Sbjct  155  KSRPALVDAIQFYKKENVFAKKCFSTRAKFEEKKKEHDIVVESSTSGPRDPEMWISIDGI  214

Query  751  ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
              I + NL W+FRGN+T+ VD + V+VFWDVHDWL+ +   G G+FIFK           
Sbjct  215  VLIHVKNLQWKFRGNQTVLVDKLQVQVFWDVHDWLFSNPGTGHGLFIFK-----------  263

Query  931  QTDETDEDYPSTDFCHIFYAWKL  999
                        +F  + YAWK+
Sbjct  264  -----------PEFSLLLYAWKI  275



>ref|XP_002532169.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30206.1| conserved hypothetical protein [Ricinus communis]
Length=317

 Score =   229 bits (585),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/289 (44%), Positives = 184/289 (64%), Gaps = 29/289 (10%)
 Frame = +1

Query  223   CSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKG  402
              S+  IY A +A   R+V VTW+K+L++++L I VEN   ENHYTCKIDLKTWQFWG+KG
Sbjct  29    SSVTLIYEANVAEFNRNVIVTWNKSLINYSLTISVENLSNENHYTCKIDLKTWQFWGRKG  88

Query  403   LKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSK  582
             LK+F VD  ++D+YWD + AKFSS+PE  S Y++AL    E++L+LGD +K+A +RTK +
Sbjct  89    LKSFPVDGGKVDVYWDFRRAKFSSNPEPSSDYYVALVYEEEVVLMLGDSKKDAYRRTKKR  148

Query  583   PSLVAAALVHKKESACAKTSFSTRTLL---GQRKKEHIIIIESAMSGNEPEMWISVDGME  753
             PS+    L+ KKE+   K  F T+ +L    +  +EH I+IE +    +PE+WIS+D  E
Sbjct  149   PSMFEPILLCKKENVYGKKIFCTKAMLHLGNEEHREHDIVIEMSSGLGDPELWISIDSFE  208

Query  754   CIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSA---NAGPGIFIFKQ--------  900
                + NLHWRFRGNE + +++V +++FWDVHDWL+ S     +G G+FIFK         
Sbjct  209   VTHVKNLHWRFRGNEKVIMNNVVIDIFWDVHDWLFGSPASQTSGHGLFIFKPGELDYQPD  268

Query  901   ---STNKDEASNSQT-----------DETDEDY-PSTDFCHIFYAWKLQ  1002
                + N++ + N              D + E + PS+ F H+ YAWKL+
Sbjct  269   SDTNRNRNTSRNGNNVLFEDKLGLGYDSSSEIWTPSSGFFHVVYAWKLE  317



>ref|XP_004305864.1| PREDICTED: uncharacterized protein LOC101301230 [Fragaria vesca 
subsp. vesca]
Length=312

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 186/281 (66%), Gaps = 18/281 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C+++A IA  +R VTV W KNL++H+L + +++   + HYTCKIDLK W FW 
Sbjct  32    TAQSTVTCVHLANIAMNWRKVTVIWCKNLMNHSLSVRIDSLEGDFHYTCKIDLKPWHFWS  91

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+F V+   +++YWD++SAKF   PE    +++AL    E++LLLGD +K+A KRT
Sbjct  92    KKGYKSFAVEGTHVEVYWDLRSAKFVGGPEPNHDFYVALVCDEEVVLLLGDMKKKAYKRT  151

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDGM  750
             K++PS+  A + +KKE+  AK SFSTR    +++KEH I++ES+ SG  +PEMWIS+DG+
Sbjct  152   KARPSVAEAVMYYKKENVFAKKSFSTRVRFDEKRKEHDIVVESSTSGQKDPEMWISIDGI  211

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQ-STNKDEASN  927
               + + NL W+FRGN+T+ V+ +PV+VFWDVHDWL+ S   G G+FIFK  + + +E   
Sbjct  212   VLVHVKNLQWKFRGNQTVMVNMLPVQVFWDVHDWLFSSPGTGHGLFIFKPGAPDSEENDY  271

Query  928   SQTDETDE----------------DYPSTDFCHIFYAWKLQ  1002
              + D  D+                +  ++DFC   +A+KL+
Sbjct  272   DRGDGVDQCGDSDNGSAYFSTRSLNTTASDFCLFLHAYKLE  312



>ref|XP_008444827.1| PREDICTED: uncharacterized protein LOC103488057 [Cucumis melo]
Length=311

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 179/281 (64%), Gaps = 18/281 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C Y A IAG +R+VTV W KNL++HTL I +++   + H   KID+K W FW 
Sbjct  31    TAQSTVTCFYQANIAGFWRNVTVLWCKNLMNHTLTITIQSLQGDFHCNYKIDVKPWHFWS  90

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+ ++D  ++DIYWDV+SAKFS+ PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  91    KKGFKSLELDGNQIDIYWDVRSAKFSTGPEPYSDFYVALVSDEEVVLLLGDYKKKAYKRT  150

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+L+ A L++KKE+  AK  FSTR     R+KE  I++E + SG  +PEMWIS+DG+
Sbjct  151   KSRPALLDAILIYKKENVFAKKCFSTRAKFDDRRKECDIVVEISTSGAKDPEMWISIDGI  210

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
               +++ NL W+FRGN+T+ V+   V+V WDVHDWL+ +   G G+FIFK    + E+   
Sbjct  211   VLVQVKNLQWKFRGNQTVLVNKQSVQVLWDVHDWLFTNPGTGHGLFIFKPGPPESESDKE  270

Query  931   QTDETDEDYPS-----------------TDFCHIFYAWKLQ  1002
              +       PS                 T+FC   YAWKL+
Sbjct  271   GSGGGGALEPSDDGSIYYSTRSMNSSHQTEFCLFLYAWKLE  311



>ref|XP_004502142.1| PREDICTED: uncharacterized protein LOC101513281 [Cicer arietinum]
Length=316

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 187/283 (66%), Gaps = 20/283 (7%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEEN-------HYTCKIDL  372
             T + ++ CIY   IAG +R+VTV W KNL++HTL + V++T  EN       HY CKI++
Sbjct  34    TAQSTVTCIYQTNIAGHWRNVTVLWCKNLMNHTLNLKVDSTRGENNNNINQFHYNCKIEV  93

Query  373   KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKF-SSSPEAVSGYHIalamggelllllgdq  549
             K W FW KKG K+F+VD + +D+YWD++SAKF  SSPE  S Y++AL    +++LLLGD 
Sbjct  94    KPWYFWNKKGYKSFEVDGQHVDVYWDLRSAKFCGSSPEPCSDYYVALVSDEDVVLLLGDY  153

Query  550   ekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN--EP  723
             +K+A KR K +P++V A L+ K+E+  AK SFST+    +++KE  I++ES+ + N  +P
Sbjct  154   KKKAYKRLKMRPAIVEATLLVKRENVFAKKSFSTKAKFDEKRKESDIVVESSTAANNKDP  213

Query  724   EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIF---  894
             EMWIS+DG+  I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+  + +GPG+FIF   
Sbjct  214   EMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFWDVHDWLFSVSGSGPGLFIFKPG  273

Query  895   -------KQSTNKDEASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                    K+    D+ S +    + + Y   + C +  A+KL+
Sbjct  274   PTEVESDKEGCESDDGSTTSGYYSTKSYTPFESCLVLCAYKLE  316



>ref|XP_003556772.1| PREDICTED: uncharacterized protein LOC100806502 [Glycine max]
Length=315

 Score =   227 bits (578),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 185/280 (66%), Gaps = 17/280 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             + + ++  IY A +AG  R V+V W KNL++HTL + V++T  +  YTCKI +K W FW 
Sbjct  36    SSQSTVTFIYQANVAGYSRHVSVLWCKNLMNHTLNLKVDSTRGDFSYTCKIQVKPWYFWN  95

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKF-SSSPEAVSGYHIalamggelllllgdqekealKR  570
             KKG K+F+VD  ++++YWD++SA+F  SSPE  S Y++A+    E++LLLGDQ+K+A KR
Sbjct  96    KKGYKSFEVDGHQVEVYWDLRSARFVGSSPEPGSDYYLAMVSDEEVVLLLGDQKKKAYKR  155

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDG  747
              K +PS+V A L+ K+ES  AK SF+T+    +++KE+ I++ES+  GN EPEMWIS+DG
Sbjct  156   MKMRPSIVEALLLVKRESVFAKKSFATKARFDEKRKENDIVVESSTFGNKEPEMWISIDG  215

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNK  912
             +  I + NL W FRGN+T+ V+  PV+VFWDVHDWL+    +GPG+FIFK       + K
Sbjct  216   IVLIHVKNLQWNFRGNQTVMVNKQPVQVFWDVHDWLFSVPGSGPGLFIFKAGPVEVESEK  275

Query  913   DEASNSQTDETDE----------DYPSTDFCHIFYAWKLQ  1002
             +E  N   D  +            Y  ++ C + YA+KL+
Sbjct  276   EERVNEGCDSDNGSCASGYYSTLSYAPSESCLVLYAYKLE  315



>ref|XP_009622577.1| PREDICTED: uncharacterized protein LOC104113961 [Nicotiana tomentosiformis]
Length=308

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 178/276 (64%), Gaps = 15/276 (5%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKK  399
             + S+ C+Y + I G +R+VTV W K+L++H+L I V++    +H TCKIDLK W FW KK
Sbjct  33    QGSVTCVYQSHIGGYWRNVTVIWRKHLMNHSLTISVDSVENGDHQTCKIDLKPWHFWAKK  92

Query  400   GLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKS  579
             G KTF+VD  +L+ YWD++SAKFS SPE    +++AL    E+++LLGD +K+A KRTKS
Sbjct  93    GYKTFEVDGNQLEAYWDLRSAKFSGSPEPYKDFYVALVSEEEVVMLLGDYKKKAYKRTKS  152

Query  580   KPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
             +P+LV A L +KKE    K SFSTR    + KKE  I++ES+ SG  +PEMWIS+DG+  
Sbjct  153   RPALVDALLFYKKEHVFGKKSFSTRAKFDKNKKESDIVVESSTSGPRDPEMWISIDGIVL  212

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQST----NKDEAS  924
             I I NL W+FRGN+T+ V+   V+VFWDVH WL+ S  +  G+FIFK       +  E S
Sbjct  213   IHIKNLQWKFRGNQTVLVNKQHVQVFWDVHSWLFSSPGSSHGLFIFKPGELELDSDKEGS  272

Query  925   NSQTDETDEDY----------PSTDFCHIFYAWKLQ  1002
             ++  D    D+           ++ FC    AWK++
Sbjct  273   SAGGDSDCSDHTKYYSTLSHSKASPFCLFLCAWKIE  308



>ref|XP_001781081.1| predicted protein [Physcomitrella patens]
 gb|EDQ54107.1| predicted protein [Physcomitrella patens]
Length=223

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 164/216 (76%), Gaps = 15/216 (7%)
 Frame = -3

Query  2240  LLADWNSYASTKASD--GDGASSSLIAAFDLEAAV--------RSANDTVSGTFNVVSKG  2091
             +L+ WNSYA+    +  G GA+       DLE+ V        +SAN ++ G FN V+KG
Sbjct  13    VLSAWNSYAARSQPEPAGQGATGR-----DLESGVSETLAPLLKSANSSIVGAFNSVTKG  67

Query  2090  VRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLG  1911
             VR++P ++QSAT  +PS +AL  F + +A+GV FIFMAF +FLP+IVLVPQKFAI FT+G
Sbjct  68    VRELPANVQSATQFVPSRQALTAFAIMIAAGVFFIFMAFFMFLPIIVLVPQKFAIAFTIG  127

Query  1910  CCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQ  1731
             C FI+GSFFAL+G K QF HM SKERLPFT GF+GSM  T+YVSM LHSYILSV F+VIQ
Sbjct  128   CIFIVGSFFALKGPKAQFFHMISKERLPFTAGFIGSMAATIYVSMVLHSYILSVFFAVIQ  187

Query  1730  VMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             V+ALLYY +SYFPGG+AG++FL+S +VSS+ KCFGR
Sbjct  188   VLALLYYLLSYFPGGTAGMQFLTSMIVSSITKCFGR  223



>ref|XP_006857698.1| hypothetical protein AMTR_s00061p00168530 [Amborella trichopoda]
 gb|ERN19165.1| hypothetical protein AMTR_s00061p00168530 [Amborella trichopoda]
Length=286

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 176/264 (67%), Gaps = 9/264 (3%)
 Frame = +1

Query  220   RCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENT-YEENHYTCKIDLKTWQFWGK  396
             + ++ C+Y AKIAG  R VTVTW KNL++H L I +E     +NHYTCKI+LK W FW K
Sbjct  29    QSTVNCLYEAKIAGFRRLVTVTWCKNLMAHDLSIALEKPGTSDNHYTCKIELKPWYFWSK  88

Query  397   KGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTK  576
             KG K+F++D K+LD YWD+++AKFS SPE  + +++AL    E++LL+GD +KEA K+TK
Sbjct  89    KGFKSFEIDGKKLDFYWDLRTAKFSGSPEPFADFYVALVFEEEVVLLMGDLKKEAFKKTK  148

Query  577   SKPSLVAAALVHKKESACAKTSFSTRTLLGQR-KKEHIIIIESAMSG-NEPEMWISVDGM  750
             ++PSL  A L+ K+E    K SF TR    +R  K H IIIE  ++G    E+WIS+DGM
Sbjct  149   ARPSLTDAVLLSKREHVFGKRSFVTRARFDERVNKAHEIIIECPVNGILNHELWISIDGM  208

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNS  930
               I++ NL W+FRGN+TI V+ +PV+VFWDVHDW++    +G  +FIFK  +     S  
Sbjct  209   VLIQVNNLQWKFRGNDTIMVNKLPVQVFWDVHDWIF-GIGSGHALFIFKPDS---PHSGE  264

Query  931   QTDETDEDYPSTDFCHIFYAWKLQ  1002
             Q   + E    T FC   YAWK++
Sbjct  265   QRHFSGEGL--TGFCLFLYAWKIE  286



>ref|XP_002524594.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37802.1| conserved hypothetical protein [Ricinus communis]
Length=311

 Score =   224 bits (570),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/283 (45%), Positives = 184/283 (65%), Gaps = 16/283 (6%)
 Frame = +1

Query  202   SVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEEN-HYTCKIDLKT  378
              V  T + ++ C+Y   I+G + +VTV W KNL++H+L +++ N       Y+CKIDLK 
Sbjct  29    GVNKTPQSTVTCVYQIHISGYWCNVTVLWCKNLMNHSLNLILNNPESGQIFYSCKIDLKP  88

Query  379   WQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqeke  558
             W FW KKG K+F ++  ++DI+WD++SA+FSSSPE    Y++AL   GE++LLLGD +K+
Sbjct  89    WLFWSKKGCKSFDLEGSQVDIHWDLRSARFSSSPEPYGDYYVALVSDGEVVLLLGDLKKK  148

Query  559   alKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWI  735
             A K+TKS+P+LV   L +KKE+  AK SFSTR    +RK+EH I +ES+ +G  +PEMWI
Sbjct  149   AYKKTKSRPALVDPTLFYKKENVFAKKSFSTRAKFDERKQEHDIAVESSTAGPKDPEMWI  208

Query  736   SVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK------  897
             S+DG+  I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+++   G G+FIFK      
Sbjct  209   SIDGIVVIHVKNLQWKFRGNQTVIVNKQPVQVFWDVHDWLFNTTGTGHGLFIFKPRSGDS  268

Query  898   --------QSTNKDEASNSQTDETDEDYPSTDFCHIFYAWKLQ  1002
                       TN D +  S+   T    P  +F    YAWK++
Sbjct  269   DDDRDDSTHGTNSDTSDGSKYFSTKSTTPIPEFSLFLYAWKIE  311



>ref|XP_006343140.1| PREDICTED: uncharacterized protein LOC102583919 [Solanum tuberosum]
Length=308

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 179/274 (65%), Gaps = 15/274 (5%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGL  405
             S+ C+Y + I G +R+VTV W KN+++H L I V++   E+H TCKIDLK W FW KKG 
Sbjct  35    SVTCVYQSHIGGYWRNVTVIWRKNMMNHCLTISVDSVENEDHQTCKIDLKPWHFWAKKGY  94

Query  406   KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
             KTF+VD  +L+ YWD++SAKFS SPE    +++AL    E++LLLGD +K+A KRTKS+P
Sbjct  95    KTFEVDGHQLEAYWDLRSAKFSGSPEPFKDFYVALIAEEEVVLLLGDYKKKAYKRTKSRP  154

Query  586   SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIR  762
             +LV A L +KKE    K SFSTR      KKE  I++ES+ SG  +PEMWIS+DG+  I 
Sbjct  155   ALVDALLFYKKEHVFGKKSFSTRAKFENNKKESDIVVESSTSGPRDPEMWISIDGIVLIH  214

Query  763   IVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNKDEAS-  924
             I NL W+FRGN+T+ V++  V+VFWDVH WL+    +  G+FIFK       +++D +S 
Sbjct  215   IKNLQWKFRGNQTVLVNEQHVQVFWDVHSWLFCEPGSTHGLFIFKPGVSELESDRDGSSV  274

Query  925   NSQTDETDE-DYPST-------DFCHIFYAWKLQ  1002
                +D +D   Y ST        FC    AWK++
Sbjct  275   GGDSDCSDHTKYYSTLSHSRASPFCLFLCAWKIE  308



>ref|XP_004235628.1| PREDICTED: uncharacterized protein LOC101250288 [Solanum lycopersicum]
Length=308

 Score =   223 bits (568),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 179/274 (65%), Gaps = 15/274 (5%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGL  405
             S+ C+Y + I G +R+VTV W KN+++H L I V++   E+H TCKIDLK W FW KKG 
Sbjct  35    SVTCVYQSHIGGYWRNVTVIWRKNMMNHCLTISVDSVENEDHQTCKIDLKPWHFWAKKGY  94

Query  406   KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
             KTF+VD  +L+ YWD++SAKFS SPE    +++AL    E++LLLGD +K+A KRTKS+P
Sbjct  95    KTFEVDGYQLEAYWDLRSAKFSGSPEPFKDFYVALIAEEEVVLLLGDYKKKAYKRTKSRP  154

Query  586   SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIR  762
             +LV A L +KKE    K SFSTR      KKE  I++ES+ SG  +PEMWIS+DG+  I 
Sbjct  155   ALVDALLFYKKEHVFGKKSFSTRAKFENNKKESDIVVESSTSGPRDPEMWISIDGIVLIH  214

Query  763   IVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQS-----TNKDEAS-  924
             I NL W+FRGN+T+ V++  V+VFWDVH WL+    +  G+FIFK       +++D +S 
Sbjct  215   IKNLQWKFRGNQTVLVNEQHVQVFWDVHSWLFCEPGSTHGLFIFKPGVSELESDRDGSSV  274

Query  925   NSQTDETDE-DYPST-------DFCHIFYAWKLQ  1002
                +D +D   Y ST        FC    AWK++
Sbjct  275   GGDSDCSDHTKYFSTLSHSRASPFCLFLCAWKIE  308



>ref|XP_004135720.1| PREDICTED: uncharacterized protein LOC101212848 [Cucumis sativus]
 ref|XP_004158103.1| PREDICTED: uncharacterized protein LOC101228551 [Cucumis sativus]
 gb|KGN65893.1| hypothetical protein Csa_1G537430 [Cucumis sativus]
Length=314

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/284 (43%), Positives = 180/284 (63%), Gaps = 21/284 (7%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
             T + ++ C Y A IAG +R+VTV W KNL++HTL I +++   + H   KID+K W FW 
Sbjct  31    TAQSTVTCFYQANIAGFWRNVTVLWCKNLMNHTLTITIQSLQGDFHCNYKIDVKPWHFWS  90

Query  394   KKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRT  573
             KKG K+  +D  ++D+YWDV+SAKFS+ PE  S +++AL    E++LLLGD +K+A KRT
Sbjct  91    KKGFKSIDLDGSQIDLYWDVRSAKFSTGPEPYSDFYVALVSDEEVVLLLGDYKKKAYKRT  150

Query  574   KSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDGM  750
             KS+P+L+ A L++KKE+  AK  FSTR     R+KE  I++E + SG  +PEMWIS+DG+
Sbjct  151   KSRPALLDAILIYKKENVFAKKCFSTRAKFDDRRKECDIVVEISTSGAKDPEMWISIDGI  210

Query  751   ECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASN-  927
               +++ NL W+FRGN+T+ V+   V+V WDVHDWL+ +   G G+FIFK    + E+   
Sbjct  211   VLVQVKNLQWKFRGNQTVLVNKQSVQVLWDVHDWLFTNPGTGHGLFIFKPGPPESESDKE  270

Query  928   -----------SQTDETDEDYPS--------TDFCHIFYAWKLQ  1002
                          +D+    Y +        T+FC   YAWKL+
Sbjct  271   GSGGGGGGGAFEPSDDGSIYYSTRSMNSSHHTEFCLFLYAWKLE  314



>ref|XP_009392096.1| PREDICTED: uncharacterized protein LOC103978120 [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 178/281 (63%), Gaps = 19/281 (7%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWG  393
            T +CS+  IY A + G+ R+VTV W+KNL++H+L + ++ +  E+  TCK+DLK W FW 
Sbjct  17   TPQCSVISIYRAMVGGVPRNVTVVWTKNLMNHSLSVSIDKSNGESPLTCKVDLKPWPFWS  76

Query  394  K-KGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
            K KG K+F  D +RLD++W+++SAKFS  PE +  Y++AL  G E+++LLGD +K+A ++
Sbjct  77   KLKGSKSFDDDSERLDVFWNLRSAKFSDGPEPLENYYVALVCGEEVVMLLGDLKKKAYRK  136

Query  571  TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDG  747
            T+S+PSL    L+ KKE+   K  FS+R     RKKEH II+ +++SG+ +PEMWIS+DG
Sbjct  137  TRSRPSLEDVTLLSKKENVFGKKCFSSRVKFDDRKKEHDIIVVNSISGHKDPEMWISIDG  196

Query  748  MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASN  927
            +  I + NL W+FRGNET+ V+ VPV+VFWDVH WL+    +G  +FIFK       A+ 
Sbjct  197  IVLIHVSNLQWKFRGNETVWVEQVPVQVFWDVHGWLFRGPGSGHALFIFKPGLPASAAAG  256

Query  928  SQTDETDE-----------------DYPSTDFCHIFYAWKL  999
            ++                          S +FC   YAW++
Sbjct  257  NRGSSGKPTSSRRNNSESSLVSSCGGGGSQEFCFFLYAWRM  297



>ref|XP_006407245.1| hypothetical protein EUTSA_v10022027mg [Eutrema salsugineum]
 gb|ESQ48698.1| hypothetical protein EUTSA_v10022027mg [Eutrema salsugineum]
Length=282

 Score =   219 bits (559),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/280 (44%), Positives = 177/280 (63%), Gaps = 18/280 (6%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEE----NHYTCKIDLKTW  381
             +  S+  +YV +IA   ++V VTWSK + SH+L I +EN  +E    +H+  KIDL   
Sbjct  3    NQSSSVSLLYVVEIANSTQNVDVTWSKTISSHSLTIKIENLKKEEQNNHHHQVKIDLGGS  62

Query  382  QFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekea  561
             FW KKGLK+ + +  R+D+YWD +  KFS+ PE  SG++++L     ++L +GD + EA
Sbjct  63   SFWAKKGLKSLEANGTRVDVYWDFRQTKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKNEA  122

Query  562  lKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQR--KKEHIIIIESAMSG-NEPEMW  732
             +RTK KPS   AALV K+E    K  F TRT  G    ++E+ ++IE+++SG N+PEMW
Sbjct  123  FQRTKKKPSATEAALVSKQERVHGKRVFYTRTSFGGEASRRENEVVIETSLSGPNDPEMW  182

Query  733  ISVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTN  909
            I+VDG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++S+ +  G+F+FK  T 
Sbjct  183  ITVDGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFESSGSSSGLFVFKPKTG  242

Query  910  KDE----------ASNSQTDETDEDYPSTDFCHIFYAWKL  999
             D             N    +  +D  ST +CH+ YA K+
Sbjct  243  FDSKTLSFNGGYGGENDDFGDCGDDDSSTKYCHVLYAVKI  282



>ref|XP_011022881.1| PREDICTED: uncharacterized protein LOC105124530 [Populus euphratica]
Length=309

 Score =   220 bits (561),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 179/279 (64%), Gaps = 15/279 (5%)
 Frame = +1

Query  211   TTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFW  390
             TT + ++ C Y A +AG +R++TV W KN ++HTL +++ N   E    CKIDLK W FW
Sbjct  31    TTPQNTVTCAYQAYVAGYWRNLTVFWCKNHMNHTLNLIINNLEGEVCRNCKIDLKPWLFW  90

Query  391   GKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
              KKG K+F+++  ++D++WD +SAKF+ SPE  S Y++A+    E++L LGD +K+A KR
Sbjct  91    SKKGSKSFELEGCQVDLHWDFRSAKFAGSPEPASDYYVAVVSDEEIVLSLGDYKKKAYKR  150

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDG  747
               ++P LV A L  KKE    K +FSTR    ++K EH II+ES+  G  +PEMWIS+DG
Sbjct  151   ANARPPLVEAILYLKKEHVFHKKTFSTRAKFDEKKHEHDIIVESSTGGPRDPEMWISMDG  210

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE---  918
             +  I + NL W+FRGN+T+ +   PV+VFWDVHDWL+ +   G G+FIFK   ++ E   
Sbjct  211   IIMIHVRNLQWKFRGNQTVMLSRQPVQVFWDVHDWLFSAPGTGHGLFIFKPGVSESEDDR  270

Query  919   ---ASNSQTDETDED-YPST-------DFCHIFYAWKLQ  1002
                +  +Q+D +D   Y ST       +FC   YAWK++
Sbjct  271   DSSSYGAQSDTSDGSMYFSTRSVSATPEFCLFLYAWKIE  309



>ref|XP_002310533.1| hypothetical protein POPTR_0007s04630g [Populus trichocarpa]
 gb|EEE90983.1| hypothetical protein POPTR_0007s04630g [Populus trichocarpa]
Length=309

 Score =   220 bits (560),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 179/279 (64%), Gaps = 15/279 (5%)
 Frame = +1

Query  211   TTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFW  390
             TT + ++ C Y A +AG +R++TV W KN ++HTL +++ N   E    CKIDLK W FW
Sbjct  31    TTPQNTVTCAYQAYVAGYWRNLTVFWCKNHMNHTLNLIINNLEGEVCCNCKIDLKPWLFW  90

Query  391   GKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
              KKG K+F+++  ++D++WD +SAKF+ SPE  S Y++A+    E++L LGD +K+A KR
Sbjct  91    SKKGSKSFELEGCQVDLHWDFRSAKFAGSPEPASDYYVAVVSDEEIVLSLGDYKKKAYKR  150

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NEPEMWISVDG  747
               ++P LV A L  KKE    K +FSTR    ++K EH II+ES+  G  +PEMWIS+DG
Sbjct  151   ANARPPLVEAILYLKKEHVFHKKTFSTRAKFDEKKHEHDIIVESSTGGPRDPEMWISMDG  210

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE---  918
             +  I + NL W+FRGN+T+ +   PV+VFWDVHDWL+ +   G G+FIFK   ++ E   
Sbjct  211   IIMIHVRNLQWKFRGNQTVMLSRQPVQVFWDVHDWLFTAPGTGHGLFIFKPGVSESEDDR  270

Query  919   ---ASNSQTDETDED-YPST-------DFCHIFYAWKLQ  1002
                +  +Q+D +D   Y ST       +FC   YAWK++
Sbjct  271   DSSSYGAQSDTSDGSMYFSTRSVSATPEFCLFLYAWKIE  309



>ref|NP_199638.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97007.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAZ52778.1| hypothetical protein At5g48270 [Arabidopsis thaliana]
 gb|ABE65575.1| hypothetical protein At5g48270 [Arabidopsis thaliana]
 gb|AED95644.1| uncharacterized protein AT5G48270 [Arabidopsis thaliana]
Length=322

 Score =   219 bits (559),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/293 (42%), Positives = 180/293 (61%), Gaps = 23/293 (8%)
 Frame = +1

Query  193   LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
             L  +   +   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30    LKSAASPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373   -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
              K WQFW K+G K+F V+   ++++WD++SAK +   SPE VS Y++A+    E++LLLG
Sbjct  90    VKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDEEVVLLLG  149

Query  544   dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEP  723
             D +++A KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    EP
Sbjct  150   DLKQKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNGAAEP  209

Query  724   EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFK  897
             EMWISVDG+  + + NL W+FRGN+ + VD  PV V++DVHDWL+ S+   A  G+F+FK
Sbjct  210   EMWISVDGIVVVNVKNLQWKFRGNQMVMVDRTPVMVYYDVHDWLFASSETAASSGLFLFK  269

Query  898   QSTNKDEASNSQTDETDEDY------------------PSTDFCHIFYAWKLQ  1002
                       S +D  + D                   P  DFC   YAWKL+
Sbjct  270   PVPVGAMVDESFSDAEEGDSGGGSSPLSRYNSASSGFGPLHDFCLFLYAWKLE  322



>ref|XP_010676107.1| PREDICTED: uncharacterized protein LOC104892001 [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   219 bits (557),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 172/271 (63%), Gaps = 12/271 (4%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGL  405
             S+ CIY   +A   R++ +TWSK    H+L I VEN  +ENH TC+ID ++ QFW +KGL
Sbjct  30    SVTCIYQVMLAACLRNIIITWSKTSTIHSLTITVENHSDENHQTCQIDFQSGQFWSRKGL  89

Query  406   KTFKVDQ-KRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSK  582
             K+  VD+  R+DI+WD ++ KFS++PE  S Y++A     +++LLLGD + EA KRT  +
Sbjct  90    KSLSVDETDRVDIFWDFRAVKFSTNPEPCSNYYVAFVFDKQVVLLLGDSKDEAYKRTMGR  149

Query  583   PSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIES-AMSGNEPEMWISVDGMECI  759
             PS V   L+HK+E       F T+ LLG   KEH I+I + +   +EPE+ IS+DG   +
Sbjct  150   PSQVGPTLLHKEEILYGNNCFYTQVLLGDGPKEHDIVINNPSKMPDEPELKISIDGRAVV  209

Query  760   RIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSA-NAGPGIFIFKQST-------NKD  915
             +++NL WRFRGNET+ V++VPV++FWDVHDWL+ S+   G G+FIFK  +       +K 
Sbjct  210   QVMNLSWRFRGNETVLVNNVPVQIFWDVHDWLFSSSPGTGHGLFIFKPESLKNILDDDKS  269

Query  916   EASNSQTDETDEDYPSTDF--CHIFYAWKLQ  1002
                N +    DEDY ++    CH  +A K Q
Sbjct  270   HKGNREKKNRDEDYVTSAVGCCHFVFAVKTQ  300



>ref|XP_006281899.1| hypothetical protein CARUB_v10028103mg [Capsella rubella]
 gb|EOA14797.1| hypothetical protein CARUB_v10028103mg [Capsella rubella]
Length=322

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/282 (43%), Positives = 177/282 (63%), Gaps = 23/282 (8%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL-KTWQFWGKKG  402
             ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL K WQFW K+G
Sbjct  41    TVTCGYQAHVAGYFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFWSKRG  100

Query  403   LKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllgdqekealKRTK  576
              K+F V+   ++++WD++SAK +   SPE VS Y++A+    E++LLLGD +++A KRTK
Sbjct  101   SKSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAIVSDEEVVLLLGDLKQKAYKRTK  160

Query  577   SKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGMEC  756
             S+P+LV   +  KKES   K SFSTR    +++KEH +++ES+    EPEMWISVDG+  
Sbjct  161   SRPALVEGFIYFKKESIFGKKSFSTRARFDEQRKEHEVVVESSNGAAEPEMWISVDGIVV  220

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFKQSTNKDEASNS  930
             + + NL W+FRGN+ + VD  P+ V++DVHDWL+ ++   A  G+F+FK           
Sbjct  221   VHVKNLQWKFRGNQMVLVDRTPIMVYYDVHDWLFATSETTATSGLFLFKPVAVGSMVDEC  280

Query  931   QTDETDEDY------------------PSTDFCHIFYAWKLQ  1002
              +DE + D                   P  DFC   YAWKL+
Sbjct  281   YSDEEEGDSAGGSSPLSRYNSASSGYGPLHDFCLFLYAWKLE  322



>ref|XP_010552345.1| PREDICTED: uncharacterized protein LOC104822715 isoform X1 [Tarenaya 
hassleriana]
Length=273

 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 179/263 (68%), Gaps = 8/263 (3%)
 Frame = +1

Query  226  SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEE-NHYTCKIDLKTWQFWGKKG  402
            S+  IY+ +IAG+  +V  TWSK++ SH+L + +EN  ++ NH+T KIDL  W FWGKKG
Sbjct  7    SVTFIYIVEIAGITLNVVATWSKSISSHSLSVSIENPKDDRNHHTVKIDLSGWSFWGKKG  66

Query  403  LKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSK  582
            LKT + D  R+D+YWD + AKFS+ PE  SG+++AL     ++L +GD   EA+KRT+ +
Sbjct  67   LKTLEADGTRIDVYWDFRQAKFSNVPEPSSGFYVALVSQDVVVLTIGDLVNEAMKRTRKR  126

Query  583  PSLVAAALVHKKESACAKTSFSTRTLL-GQRKKEHIIIIESAMSG-NEPEMWISVDGMEC  756
            PS   AALV KKE    K  F TRT   G  ++EH ++IE+++SG  EPEMWI+VDG+  
Sbjct  127  PSAREAALVCKKEHVYGKRVFYTRTAFDGTGRREHEVVIETSLSGPEEPEMWITVDGVAA  186

Query  757  IRIVNLHWRFRGNETITV-DDVPVEVFWDVHDWLYDSANAGPGIFIFKQ---STNKDEAS  924
            +R++NL+WRFRGNE +TV + V VE++WD+HDWL+ S  +  G+F+FKQ   S  +  + 
Sbjct  187  MRVMNLNWRFRGNEVVTVKEGVAVEIYWDIHDWLFGSCGSSCGLFVFKQKLVSEGRSLSF  246

Query  925  NSQTDETDEDYPS-TDFCHIFYA  990
            N   DE +    S +++C++ YA
Sbjct  247  NGGVDENEGGEDSLSEYCYVLYA  269



>emb|CDY48744.1| BnaA02g30050D [Brassica napus]
Length=304

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 174/267 (65%), Gaps = 5/267 (2%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL-KTWQFW  390
            T   ++ C Y A +AG FR++TV WSKNL++H+L ++V +   + +Y CKIDL K WQFW
Sbjct  37   TPHSTVTCGYQAHVAGFFRNITVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFW  96

Query  391  GKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllgdqekeal  564
             K+G K+F V+ K ++++WD+++AK S   SPE +S Y++A+    E++LLLGD + +A 
Sbjct  97   SKRGSKSFDVEGKFVEVFWDLRAAKLSGNGSPEPMSDYYVAIVSDEEVVLLLGDLKHKAY  156

Query  565  KRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVD  744
            KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+  G++PEMWISVD
Sbjct  157  KRTKSRPALVEGYIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSHGGDDPEMWISVD  216

Query  745  GMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDS--ANAGPGIFIFKQSTNKDE  918
            G+  + + NL W+FRGN+ + VD   V V++DVHDWL+ S  + A  G+F+FK       
Sbjct  217  GIVIMHVKNLQWKFRGNQMVLVDKTHVMVYYDVHDWLFGSSESTASSGLFVFKPVAVGGM  276

Query  919  ASNSQTDETDEDYPSTDFCHIFYAWKL  999
              +     +       DFC   YAWK+
Sbjct  277  VDDRYNSASSGYGTLNDFCLFLYAWKV  303



>ref|XP_010484925.1| PREDICTED: uncharacterized protein LOC104763219 [Camelina sativa]
Length=322

 Score =   218 bits (554),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/282 (43%), Positives = 177/282 (63%), Gaps = 23/282 (8%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL-KTWQFWGKKG  402
             ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL K WQFW K+G
Sbjct  41    TVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFWSKRG  100

Query  403   LKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllgdqekealKRTK  576
              K+F V+   ++++WD++SAK +   SPE VS Y++A+    E++LLLGD +++A KRTK
Sbjct  101   SKSFDVEGNIVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDEEVVLLLGDLKQKAYKRTK  160

Query  577   SKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGMEC  756
             S+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    EPEMWISVDG+  
Sbjct  161   SRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNGAAEPEMWISVDGIVV  220

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSA--NAGPGIFIFKQSTNKDEASNS  930
             + + NL W+FRGN+ + VD  PV V++DVHDWL+ ++   A  G+F+FK         + 
Sbjct  221   VHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFATSETTATSGLFLFKPVAVGAMVDDC  280

Query  931   QTDETDEDY------------------PSTDFCHIFYAWKLQ  1002
              +D  D D                   P  DFC   YAWKL+
Sbjct  281   FSDAEDGDSGGGSSPLSRYNSASSGYGPLHDFCLFLYAWKLE  322



>emb|CDX86317.1| BnaA06g30340D [Brassica napus]
Length=307

 Score =   217 bits (552),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 179/278 (64%), Gaps = 8/278 (3%)
 Frame = +1

Query  193   LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
             L  +   T   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30    LKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373   -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
              K WQFW K+G K+F V+   ++++WD++SAK S   SPE VS Y++A+    E++LLLG
Sbjct  90    VKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLLG  149

Query  544   dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEP  723
             D + +A KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    + 
Sbjct  150   DLKHKAYKRTKSRPALVEGFISFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNDEKDQ  209

Query  724   EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFK  897
             EMWIS+DG+  + + NL W+FRGN  + VD  PV V++DVHDWL+ S+   A  G+F+FK
Sbjct  210   EMWISMDGIVLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFGSSESTASSGLFLFK  269

Query  898   QSTNKDEASN--SQTDETDEDY-PSTDFCHIFYAWKLQ  1002
                +    S+  S+ +     Y P  +FC   YAWKL+
Sbjct  270   PDGDSGGGSSPLSRYNSASSGYGPLHEFCLFLYAWKLE  307



>ref|XP_002865625.1| hypothetical protein ARALYDRAFT_917720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41884.1| hypothetical protein ARALYDRAFT_917720 [Arabidopsis lyrata subsp. 
lyrata]
Length=322

 Score =   217 bits (553),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/293 (42%), Positives = 179/293 (61%), Gaps = 23/293 (8%)
 Frame = +1

Query  193   LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
             L  +   +   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30    LKSAATPSPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373   -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
              K WQFW K+G K F V+   ++++WD++SAK +   SPE VS Y++A+    E++LLLG
Sbjct  90    VKPWQFWSKRGSKAFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDEEVVLLLG  149

Query  544   dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEP  723
             D +++A KRTKS+P+LV   +  KKES   K +FSTR    ++KKEH +++ES+    +P
Sbjct  150   DLKQKAYKRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQKKEHEVVVESSNGAADP  209

Query  724   EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFK  897
             EMWISVDG+  + + NL W+FRGN+ + VD  PV V++DVHDWL+ S+   A  G+F+FK
Sbjct  210   EMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFASSETAATSGLFLFK  269

Query  898   QSTNKDEASNSQTDETDEDY------------------PSTDFCHIFYAWKLQ  1002
                       S +D  + D                   P  DFC   YAWKL+
Sbjct  270   PVPVGAMVDESFSDAEEGDSGGGSSPLSRYNSASSGYGPLHDFCLFLYAWKLE  322



>gb|KHN46178.1| hypothetical protein glysoja_022820 [Glycine soja]
Length=248

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 171/248 (69%), Gaps = 14/248 (6%)
 Frame = +1

Query  301   VSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSP  480
             ++H+L + V++   E  Y+CKID+K W FW KKG KTF+VD  ++++YWD++SAKF+ SP
Sbjct  1     MNHSLHVTVDSVGGEVQYSCKIDVKPWHFWSKKGYKTFEVDGNQVELYWDLRSAKFAGSP  60

Query  481   EAVSGYHIalamggelllllgdqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTL  660
             E  S Y++AL    E++LLLGD +K+A KRTKS+P+LV A L+ KKE+  AK SFST+  
Sbjct  61    EPSSDYYVALVSDEEVVLLLGDYKKKAYKRTKSRPALVDAMLLVKKENVFAKKSFSTKAR  120

Query  661   LGQRKKEHIIIIESAMSG-NEPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFW  837
               +++K++ I+++S   G ++PEMWIS+DG+  I + NL W+FRGN+T+ V+  PV+VFW
Sbjct  121   FDEKRKDNEIVVDSLTGGPSDPEMWISIDGIVLIHVKNLQWKFRGNQTVMVNKQPVQVFW  180

Query  838   DVHDWLYDSANAGPGIFIFKQSTNKDEASNS-------QTDETDEDYPST------DFCH  978
             DVHDWL+  + +GPG+FIFK    + E+          ++D+    Y ST      +FC 
Sbjct  181   DVHDWLFSGSGSGPGLFIFKPGPPEAESEKEGSAVEGCESDDGSVGYFSTMNIATFEFCL  240

Query  979   IFYAWKLQ  1002
             + YA+K++
Sbjct  241   VLYAYKIE  248



>ref|XP_010495442.1| PREDICTED: uncharacterized protein LOC104772538 [Camelina sativa]
Length=322

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 177/282 (63%), Gaps = 23/282 (8%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL-KTWQFWGKKG  402
             ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL K WQFW K+G
Sbjct  41    TVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFWSKRG  100

Query  403   LKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllgdqekealKRTK  576
              K+F V+   ++++WD++SAK +   SPE VS Y++A+    E++LLLGD +++A KRTK
Sbjct  101   SKSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDEEVVLLLGDLKQKAYKRTK  160

Query  577   SKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGMEC  756
             S+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    EPEMWISVDG+  
Sbjct  161   SRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNGAAEPEMWISVDGIVV  220

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFKQSTNKDEASNS  930
             + + NL W+FRGN+ + VD  PV V++DVHDWL+ ++   A  G+F+FK         + 
Sbjct  221   VHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFATSETTATSGLFLFKPVAVGAMVDDC  280

Query  931   QTDETDEDY------------------PSTDFCHIFYAWKLQ  1002
              +D  + D                   P  DFC   YAWKL+
Sbjct  281   FSDAEEGDSGGGSSPLSRYNSASSGYGPLHDFCLFLYAWKLE  322



>gb|EEE65995.1| hypothetical protein OsJ_21934 [Oryza sativa Japonica Group]
Length=559

 Score =   222 bits (566),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 151/211 (72%), Gaps = 4/211 (2%)
 Frame = -3

Query  2324  MQKWFSGssagddarqqqqqttaasspSLLADWNSYASTKASDGDGASSSLIAAFDLEAA  2145
             MQ WFSG+     +          S   LLA+WNSYA+ ++++ +          D+EAA
Sbjct  1     MQAWFSGTGPSASSASSSSSPPQPS---LLAEWNSYAAARSAEEEEDGGGGGFGIDIEAA  57

Query  2144  VRSANDTVSGTFNVVSKGVRDIPGSLQSATSNIPSGKALMYFGLFLASGVLFIFMAFALF  1965
             VRSAND VSGTF VVSKGV  +PGS +S TS++PS K+L+YFGLFLASG+  +F+AF +F
Sbjct  58    VRSANDRVSGTFGVVSKGVLGLPGSFKSTTSSVPSSKSLVYFGLFLASGIFLVFIAFTIF  117

Query  1964  LPVIVLVPQKFAICFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLY  1785
             LPV+V++PQKFAICFT GC FIIGSFFAL+G KNQ  HM SKERLPFT+GF+GSM  T+Y
Sbjct  118   LPVMVIMPQKFAICFTAGCAFIIGSFFALKGPKNQLYHMISKERLPFTMGFVGSMAATIY  177

Query  1784  VSMGLHSYILSVLFSVIQVMALLYYAVSYFP  1692
             VSM LHSYILSV FS +Q   L  +A+   P
Sbjct  178   VSMVLHSYILSVFFSCLQ-FCLFAFAIEVVP  207



>ref|XP_006395202.1| hypothetical protein EUTSA_v10005686mg [Eutrema salsugineum]
 gb|ESQ32488.1| hypothetical protein EUTSA_v10005686mg [Eutrema salsugineum]
Length=329

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 183/300 (61%), Gaps = 30/300 (10%)
 Frame = +1

Query  193   LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
             L  +   T   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30    LKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373   -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
              K WQFW K+G K+F V+   ++++WD++SAK S   SPE VS Y++A+    E++LLLG
Sbjct  90    VKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAVVSDEEVVLLLG  149

Query  544   dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG---  714
             D +++A KRTKS+P+LV A +  KKES   K +FSTR    +++K+H +++ES+  G   
Sbjct  150   DLKQKAYKRTKSRPALVEAFIYFKKESIFGKKTFSTRARFDEQRKDHEVVVESSNGGVST  209

Query  715   ---NEPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGP  879
                 +PEMWISVDG+  + + NL W+FRGN+ + VD  PV V++DVHDWL+ S+   A  
Sbjct  210   REEKDPEMWISVDGIVVVHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFGSSESTASS  269

Query  880   GIFIFK------------------QSTNKDEASNSQTDETDEDY-PSTDFCHIFYAWKLQ  1002
             G+F+FK                   S     +  S+ +     Y P  DFC   YAWKL+
Sbjct  270   GLFVFKPVAVGAMVDDGFSDAEEGDSNGGGSSPLSRYNSASSGYGPLHDFCLFLYAWKLE  329



>ref|XP_002884958.1| hypothetical protein ARALYDRAFT_478708 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61217.1| hypothetical protein ARALYDRAFT_478708 [Arabidopsis lyrata subsp. 
lyrata]
Length=292

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 177/278 (64%), Gaps = 17/278 (6%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEE---NHYTCKIDLKTWQ  384
             +  S+  +YV +IA   ++V VTWSK + SH+L I +EN  +E   +H   KIDL    
Sbjct  3    NQSSSVSLLYVVEIAKTTQNVDVTWSKTMSSHSLTIKIENLKDEQHNHHQPVKIDLSGSS  62

Query  385  FWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekeal  564
            FW KKGLK+ + +  R+D+YWD + AKFS+ PE  SG++++L      +L +GD + EAL
Sbjct  63   FWAKKGLKSLEANGARVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNATILTMGDLKNEAL  122

Query  565  KRTKSKPSLVAAALVHKKESACAKTSFSTRTLLG--QRKKEHIIIIESAMSG-NEPEMWI  735
            KRTK  PS   AALV K+E    K  F TRT  G  + ++E+ ++IE+++SG ++PEMWI
Sbjct  123  KRTKKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPSDPEMWI  182

Query  736  SVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTNK  912
            +VDG+  IRI+NL+WRFRGNE +TV D V +E+FWDVHDWL++++ +  G+F+FK     
Sbjct  183  TVDGVPAIRIMNLNWRFRGNEVLTVSDGVSLEIFWDVHDWLFETSGSSSGLFVFKPKAGF  242

Query  913  DEASNS----------QTDETDEDYPSTDFCHIFYAWK  996
            +  S S          +  + ++D  S  +CH+ YA K
Sbjct  243  ESKSLSFNGGYGDGEGEDHDVEDDDSSPKYCHVLYAVK  280



>gb|KFK31309.1| hypothetical protein AALP_AA6G096000 [Arabis alpina]
Length=326

 Score =   215 bits (547),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 181/296 (61%), Gaps = 27/296 (9%)
 Frame = +1

Query  193  LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
            L  +   T   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30   LKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373  -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
             K WQFW K+G K+F V+   ++++WD++SAK S   SPE VS Y++A+    E++LLLG
Sbjct  90   VKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKMSGNGSPEPVSDYYVAVVSDEEVVLLLG  149

Query  544  dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG---  714
            D +++A KRTKS+P+LV   +  KKES   K +F+TR    +++KEH +++ES+  G   
Sbjct  150  DLKQKAYKRTKSRPALVEGFMYSKKESIFGKKTFATRARFDEQRKEHEVVVESSNGGVAE  209

Query  715  -NEPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN-AGPGIF  888
              EPEMWISVDG+  + + NL W+FRGN+ + VD  PV V++DVHDWL+ S+  A  G+F
Sbjct  210  EREPEMWISVDGIVLVHVRNLQWKFRGNQMVVVDRTPVMVYYDVHDWLFGSSETAASGLF  269

Query  889  IFKQSTNKDEASNSQTDETDEDY-------------------PSTDFCHIFYAWKL  999
            +FK         ++ +D  D ++                   P  DF    YAWKL
Sbjct  270  VFKPVPVGAMVDDNFSDAEDGEHSGGGSSPLSRYNSASSGYGPLHDFSLFLYAWKL  325



>gb|KHN43917.1| hypothetical protein glysoja_025956 [Glycine soja]
Length=243

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 167/241 (69%), Gaps = 15/241 (6%)
 Frame = +1

Query  319  IVVENTYEENHYTCKIDLKTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSS-PEAVSG  495
            ++V+NT EEN YTCKIDL++ Q WGKKGLK+F++   R+DI+WD + AKFS++ P+  SG
Sbjct  1    MIVDNTLEENKYTCKIDLESGQSWGKKGLKSFEITGARVDIFWDFRRAKFSATGPQPYSG  60

Query  496  YHIalamggelllllgdqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRK  675
            Y++AL    E+LLLLGD EK+A +RTKSKPSL  AAL+ K+++   K  F TR +L   K
Sbjct  61   YYVALVYKKEVLLLLGDLEKDAYERTKSKPSLDEAALLCKRDNVYGKKMFCTRAILEDGK  120

Query  676  KEHIIIIESAMSG-NEPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDW  852
             EH ++IE+++ G ++PEMWIS+DGM   RI+NLHWRFRGNE + V+++PV++FWDVHDW
Sbjct  121  TEHDVVIEASLCGPDDPEMWISIDGMLASRIMNLHWRFRGNEILMVNNLPVQIFWDVHDW  180

Query  853  LY-DSANAGPGIFIFKQ---STNKDEAS---------NSQTDETDEDYPSTDFCHIFYAW  993
            L+ +    GP  F+FK     T  D  S         +++ +  +E+  +  FCH  YAW
Sbjct  181  LFTNDLGLGPAFFVFKPVFLETTSDSNSIECLERSGGSNKRELLEENSSTQGFCHYLYAW  240

Query  994  K  996
            +
Sbjct  241  R  241



>ref|XP_010465151.1| PREDICTED: uncharacterized protein LOC104745569 [Camelina sativa]
Length=285

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 175/283 (62%), Gaps = 21/283 (7%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEE---NHYTCKIDLKTWQ  384
             +  S+  IYV +IA   +++ VTWSK + SH+L I  EN  +E   +H   KIDL    
Sbjct  3    NQSSSVSLIYVVEIANTTQNIDVTWSKTISSHSLTIKAENLKDEQQNHHQEVKIDLSGSS  62

Query  385  FWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekeal  564
            FW KKGLK  + +  R+D+YWD + AKFS+ PE  SG++++L     ++L +GD +KEAL
Sbjct  63   FWAKKGLKRLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKKEAL  122

Query  565  KRTKSKPSLVAAALVHKKESACAKTSFSTRTLLG--QRKKEHIIIIESAMSG-NEPEMWI  735
             RTK KPS   AALV K E    K  F TRT  G  + ++E+ ++IE+++SG N+PEMWI
Sbjct  123  NRTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMWI  182

Query  736  SVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTNK  912
            +VDG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK     
Sbjct  183  TVDGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKAGF  242

Query  913  DEASNSQTDETD--------------EDYPSTDFCHIFYAWKL  999
            +  S S     D              ED  S  +CH+ YA K+
Sbjct  243  ESRSLSYNGGYDDGDGGDVEGDVNVVEDDSSPKYCHVLYAVKV  285



>ref|XP_010445941.1| PREDICTED: uncharacterized protein LOC104728686 [Camelina sativa]
Length=322

 Score =   214 bits (544),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 176/282 (62%), Gaps = 23/282 (8%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL-KTWQFWGKKG  402
             ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL K WQFW K+G
Sbjct  41    TVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFWSKRG  100

Query  403   LKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllgdqekealKRTK  576
               +F V+   ++++WD++SAK +   SPE VS Y++A+    E++LLLGD +++A KRTK
Sbjct  101   SNSFDVEGNFVEVFWDLRSAKLAGNGSPEPVSDYYVAVVSDEEVVLLLGDLKEKAYKRTK  160

Query  577   SKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGMEC  756
             S+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    EPEMWISVDG+  
Sbjct  161   SRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNGAAEPEMWISVDGIVV  220

Query  757   IRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFKQSTNKDEASNS  930
             + + NL W+FRGN+ + VD  PV V++DVHDWL+ ++   A  G+F+FK         + 
Sbjct  221   VHVKNLQWKFRGNQMVLVDRTPVMVYYDVHDWLFATSETTATSGLFLFKPVAVGAMVDDC  280

Query  931   QTDETDEDY------------------PSTDFCHIFYAWKLQ  1002
              +D  + D                   P  DFC   YAWKL+
Sbjct  281   FSDAEEGDSGGGSSPLSRYNSASSGYGPLHDFCLFLYAWKLE  322



>ref|XP_003601505.1| hypothetical protein MTR_3g082430 [Medicago truncatula]
 gb|AES71756.1| DUF868 family protein [Medicago truncatula]
Length=293

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 185/280 (66%), Gaps = 17/280 (6%)
 Frame = +1

Query  214   TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTY-EENHYTCKIDLKTWQFW  390
             T + ++ C+Y   I G +R+++V W KNL++HTL + V++   E+ H  CKI++K W FW
Sbjct  14    TAQSTVTCLYQTSIGGQWRNISVLWCKNLINHTLNLKVDSARGEQFHQNCKIEVKPWCFW  73

Query  391   GKKGLKTFKVDQKRLDIYWDVKSAKFSSS-PEAVSGYHIalamggelllllgdqekealK  567
              +KG ++F VD  ++D+YWD++SAKF+ + PE  S Y++ L    E++LLLGD +K+A K
Sbjct  74    NRKGYRSFDVDGNQIDVYWDLRSAKFAGNCPEPCSDYYVMLVSDEEVVLLLGDYKKKAYK  133

Query  568   RTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVD  744
             R K + +LV A L+ K+E+  AK SFST+    +++KE  I++ES+ +GN +PEMWIS+D
Sbjct  134   RMKMRQALVEATLLVKRENVFAKKSFSTKAKFDEKRKESDIVVESSTAGNKDPEMWISID  193

Query  745   GMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFK------QST  906
             G+  I I NL W+FRGN+T+ V+  PV VFWDV+DWL+  + +GPG+FIFK      +S 
Sbjct  194   GIVLIHIKNLQWKFRGNQTVMVNKQPVHVFWDVYDWLFSVSGSGPGLFIFKPGPTEVESD  253

Query  907   NKDEASNSQTDE--------TDEDYPSTDFCHIFYAWKLQ  1002
              +++    ++D+        + + Y   + C +  A+KL+
Sbjct  254   KEEKGLEGESDDGSATSGYYSTKSYTPFESCLVLCAYKLE  293



>ref|XP_006299636.1| hypothetical protein CARUB_v10015817mg [Capsella rubella]
 gb|EOA32534.1| hypothetical protein CARUB_v10015817mg [Capsella rubella]
Length=288

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 176/286 (62%), Gaps = 24/286 (8%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENH-----YTCKIDLKT  378
             +  S+  IYV +IA   ++V VTWSK + SH+L I +EN  +E H        KIDL  
Sbjct  3    NQSSSVSLIYVVEIANTSQNVDVTWSKTISSHSLTIKIENLKDEQHNHHNQQQVKIDLSG  62

Query  379  WQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqeke  558
              FW KKGLK  + +  R+D+YWD + AKFS+ PE  SG++++L     ++L +GD + E
Sbjct  63   SSFWAKKGLKNLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSHNAVVLTIGDLKNE  122

Query  559  alKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLG--QRKKEHIIIIESAMSG-NEPEM  729
            ALKRTK  PS   AALV K+E    K  F TRT  G  + ++E+ ++IE+++SG N+PEM
Sbjct  123  ALKRTKKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEM  182

Query  730  WISVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQST  906
            WI+VDG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK  +
Sbjct  183  WITVDGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKS  242

Query  907  NKDEASNS---------------QTDETDEDYPSTDFCHIFYAWKL  999
              +  S S                    D+D  S  +CH+ YA K+
Sbjct  243  GFESRSLSFNGGYGDGDADVDDHGDVVEDDDDSSPKYCHVLYAVKV  288



>emb|CDY05690.1| BnaC02g38470D [Brassica napus]
Length=300

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 176/268 (66%), Gaps = 11/268 (4%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL-KTWQFW  390
            T   ++ C Y A +AG FR++TV WSKNL++H+L ++V +   + +Y CKIDL K WQFW
Sbjct  37   TPHSTVTCGYQAHVAGFFRNITVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDLVKPWQFW  96

Query  391  GKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllgdqekeal  564
             K+G K+F V+   ++++WD+++AK S   SPE +S Y++A+    E++LLLGD + +A 
Sbjct  97   SKRGSKSFDVEGNFVEVFWDLRAAKLSGNGSPEPMSDYYVAIVSDEEVVLLLGDSKHKAY  156

Query  565  KRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVD  744
            KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+  G++PEMWISVD
Sbjct  157  KRTKSRPALVEGFIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNGGDDPEMWISVD  216

Query  745  GMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDS--ANAGPGIFIFKQSTNKDE  918
            G+  + + NL W+FRGN+ + VD   V V++DVHDWL+ S  + A  G+F+   S+    
Sbjct  217  GIVIMHVKNLQWKFRGNQMVLVDKTHVMVYYDVHDWLFGSSESTASSGLFVGGGSSPL--  274

Query  919  ASNSQTDETDEDYPST-DFCHIFYAWKL  999
               S+ +     Y +  DFC   YAWK+
Sbjct  275  ---SRYNSASSGYGTLHDFCLFLYAWKV  299



>ref|NP_683561.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02790.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT68366.1| hypothetical protein At3g13229 [Arabidopsis thaliana]
 gb|AAV63905.1| hypothetical protein At3g13229 [Arabidopsis thaliana]
 gb|AEE75321.1| uncharacterized protein AT3G13229 [Arabidopsis thaliana]
Length=289

 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 172/278 (62%), Gaps = 17/278 (6%)
 Frame = +1

Query  214  TRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEE---NHYTCKIDLKTWQ  384
             +  S+  IYV +IA   ++V VTWSK   SH+L I +EN  +E   +H   KIDL    
Sbjct  3    NQSSSVSLIYVVEIAKTPQNVDVTWSKTTSSHSLTIKIENVKDEQQNHHQPVKIDLSGSS  62

Query  385  FWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekeal  564
            FW KKGLK+ + +  R+D+YWD + AKFS+ PE  SG++++L      +L +GD   EAL
Sbjct  63   FWAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNATVLTIGDLRNEAL  122

Query  565  KRTKSKPSLVAAALVHKKESACAKTSFSTRTLL--GQRKKEHIIIIESAMSG-NEPEMWI  735
            KRTK  PS   AALV K+E    K  F TRT    G+ ++E+ ++IE+++SG ++PEMWI
Sbjct  123  KRTKKNPSATEAALVSKQEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPSDPEMWI  182

Query  736  SVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTNK  912
            +VDG+  IRI+NL+WRFRGNE +TV D V +E+FWDVHDWL++ + +  G+F+FK     
Sbjct  183  TVDGVPAIRIMNLNWRFRGNEVVTVSDGVSLEIFWDVHDWLFEPSGSSSGLFVFKPKAGF  242

Query  913  DE----------ASNSQTDETDEDYPSTDFCHIFYAWK  996
            +               +  + ++D  S  +CH+ YA K
Sbjct  243  ESKCLSFNGGYGDGEGEDHDVEDDDSSPKYCHVLYAVK  280



>ref|XP_010500251.1| PREDICTED: uncharacterized protein LOC104777658 [Camelina sativa]
Length=288

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 171/285 (60%), Gaps = 24/285 (8%)
 Frame = +1

Query  217  RRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYT-----CKIDLKTW  381
            +  S+  IYV +IA   ++V VTWSK + SH+L I   N  +E          KIDL   
Sbjct  4    QSSSVSLIYVVEIANTTQNVDVTWSKTISSHSLTIKTNNPTDEQQNHHQQQQVKIDLSGS  63

Query  382  QFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekea  561
             FW KKGLK+ + +  R+D+YWD + AKFS+ PE  SG++++L     ++L +GD + EA
Sbjct  64   SFWAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKMEA  123

Query  562  lKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLG--QRKKEHIIIIESAMSG-NEPEMW  732
            L RTK KPS   AALV K E    K  F TRT  G  + ++E+ ++IE+++SG N+PEMW
Sbjct  124  LNRTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMW  183

Query  733  ISVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTN  909
            I+VDG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK    
Sbjct  184  ITVDGVSAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKAG  243

Query  910  KDEASNSQTDETD---------------EDYPSTDFCHIFYAWKL  999
             +  S S                     ED  S  +CH+ YA K+
Sbjct  244  FESRSLSYNGGYVDGDGDGDVEGDVNDLEDDSSPKYCHVLYAVKV  288



>ref|XP_009151627.1| PREDICTED: uncharacterized protein LOC103874941 isoform X1 [Brassica 
rapa]
Length=323

 Score =   209 bits (532),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 180/294 (61%), Gaps = 24/294 (8%)
 Frame = +1

Query  193   LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
             L  +   T   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30    LKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373   -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
              K WQFW K+G K+F V+   ++++WD++SAK S   SPE VS Y++A+    E++LLLG
Sbjct  90    VKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLLG  149

Query  544   dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEP  723
             D + +A KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    + 
Sbjct  150   DLKHKAYKRTKSRPALVEGFISFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNDEKDQ  209

Query  724   EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFK  897
             EMWIS+DG+  + + NL W+FRGN  + VD  PV V++DVHDWL+ S+   A  G+F+FK
Sbjct  210   EMWISMDGIVLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFGSSESTASSGLFLFK  269

Query  898   Q------------STNKDEASN------SQTDETDEDY-PSTDFCHIFYAWKLQ  1002
                          S  +D  S       S+ +     Y P  +FC   YAWKL+
Sbjct  270   PVAVGAMMVDEYFSDAEDGDSGGGSSPLSRYNSASSGYGPLHEFCLFLYAWKLE  323



>ref|XP_009151628.1| PREDICTED: uncharacterized protein LOC103874941 isoform X2 [Brassica 
rapa]
Length=312

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 180/294 (61%), Gaps = 24/294 (8%)
 Frame = +1

Query  193   LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
             L  +   T   ++ C Y A +AG FR+VTV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  19    LKSAATPTPHSTVTCGYQAHVAGFFRNVTVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  78

Query  373   -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
              K WQFW K+G K+F V+   ++++WD++SAK S   SPE VS Y++A+    E++LLLG
Sbjct  79    VKPWQFWSKRGSKSFDVEGNFVEVFWDLRSAKLSGNGSPEPVSDYYVAIVSDEEVVLLLG  138

Query  544   dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEP  723
             D + +A KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+    + 
Sbjct  139   DLKHKAYKRTKSRPALVEGFISFKKESIFGKKTFSTRARFDEQRKEHEVVVESSNDEKDQ  198

Query  724   EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFK  897
             EMWIS+DG+  + + NL W+FRGN  + VD  PV V++DVHDWL+ S+   A  G+F+FK
Sbjct  199   EMWISMDGIVLVHVKNLQWKFRGNVMVLVDRTPVMVYYDVHDWLFGSSESTASSGLFLFK  258

Query  898   Q------------STNKDEASN------SQTDETDEDY-PSTDFCHIFYAWKLQ  1002
                          S  +D  S       S+ +     Y P  +FC   YAWKL+
Sbjct  259   PVAVGAMMVDEYFSDAEDGDSGGGSSPLSRYNSASSGYGPLHEFCLFLYAWKLE  312



>ref|XP_009129718.1| PREDICTED: uncharacterized protein LOC103854529 [Brassica rapa]
Length=322

 Score =   208 bits (530),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 179/292 (61%), Gaps = 23/292 (8%)
 Frame = +1

Query  193  LIVSVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDL  372
            L  +   T   ++ C Y A +AG FR++TV WSKNL++H+L ++V +   + +Y CKIDL
Sbjct  30   LKSAATPTPHSTVTCGYQAHVAGFFRNITVLWSKNLMNHSLTVMVSSLDNDMNYCCKIDL  89

Query  373  -KTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSS--SPEAVSGYHIalamggelllllg  543
             K WQFW K+G K+F V+   ++++WD+++AK S   SPE +S Y++A+    E++LLLG
Sbjct  90   VKPWQFWSKRGSKSFDVEGNFVEVFWDLRAAKLSGNGSPEPMSDYYVAIVSDEEVVLLLG  149

Query  544  dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEP  723
            D + +A KRTKS+P+LV   +  KKES   K +FSTR    +++KEH +++ES+  G++P
Sbjct  150  DLKHKAYKRTKSRPALVEGYIYFKKESIFGKKTFSTRARFDEQRKEHEVVVESSHGGDDP  209

Query  724  EMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSAN--AGPGIFIFK  897
            EMWISVDG+  + + NL W+F GN+ + VD   V V++DVHDWL+ S+   A  G+F+FK
Sbjct  210  EMWISVDGIVIMHVTNLQWKFWGNQMVLVDKTHVMVYYDVHDWLFGSSESTASSGLFVFK  269

Query  898  QS----------TNKDEASNSQTDETDEDYPS--------TDFCHIFYAWKL  999
                        ++ +E  +         Y S         DFC   YAWK+
Sbjct  270  PVAVGGMVDEYFSDAEEGDSGGGSSPLSRYNSASSGYGTLNDFCLFLYAWKV  321



>ref|XP_010487075.1| PREDICTED: uncharacterized protein LOC104765102 isoform X1 [Camelina 
sativa]
Length=289

 Score =   207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 122/286 (43%), Positives = 172/286 (60%), Gaps = 25/286 (9%)
 Frame = +1

Query  217  RRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYT-----CKIDLKTW  381
            +  S+  IYV +IA   ++V VTWSK + SH+L I   N  +E          KIDL   
Sbjct  4    QSSSVSLIYVVEIANTTQNVDVTWSKTISSHSLTIKTGNLKDEQQNHHQQQQVKIDLSGS  63

Query  382  QFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekea  561
             FW KKGLK+ + +  R+D+YWD + AKFS+ PE  SG++++L     ++L +GD +KEA
Sbjct  64   SFWAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKKEA  123

Query  562  lKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLG--QRKKEHIIIIESAMSG-NEPEMW  732
            L RTK KPS   AALV K E    K  F TRT  G  + ++E+ ++IE+++SG N+PEMW
Sbjct  124  LNRTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMW  183

Query  733  ISVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTN  909
            I+VDG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK    
Sbjct  184  ITVDGVSAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKAG  243

Query  910  KDEASNSQTDETD----------------EDYPSTDFCHIFYAWKL  999
             +  S S                      ED  S  +CH+ YA K+
Sbjct  244  FESRSLSYNGAGYGDGDGDGDVEGDVNDVEDDSSPKYCHVLYAVKV  289



>ref|XP_009387555.1| PREDICTED: uncharacterized protein LOC103974443 [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   207 bits (528),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/280 (43%), Positives = 175/280 (63%), Gaps = 19/280 (7%)
 Frame = +1

Query  211   TTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFW  390
             T  +CS+   Y AKI G+ R VTV WSKNL++H+L + +E     +  TCK+DLK W F 
Sbjct  25    TPPQCSVISTYRAKIGGVPRIVTVVWSKNLMNHSLSVSIEKG---SSLTCKVDLKPWPFR  81

Query  391   GKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
              KKG K+F VD K++D+ W+ + AKFS  PE   GY++AL    E++LLLGD++K+A K+
Sbjct  82    SKKGSKSFDVDGKQIDVSWNFRLAKFSDGPEPTEGYYVALVCDEEVVLLLGDRKKKAYKK  141

Query  571   TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGN-EPEMWISVDG  747
             T+S+PSL  A LV KKE+   K  F+ R     R KEH I++ ++++ + +PEMWIS+DG
Sbjct  142   TRSRPSLEEATLVSKKENVFGKKCFAARVRFDGRNKEHDIVVANSIAEHKDPEMWISIDG  201

Query  748   MECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQ------STN  909
             +  I + +L W+FRGNET+ V+ VPV+V WDVHDWL+    +G  +F+FK       +  
Sbjct  202   VILIHVNHLQWKFRGNETVWVEQVPVQVLWDVHDWLFRGPGSGHALFMFKPGLPALAAEE  261

Query  910   KDEASNSQTDETD---------EDYPSTDFCHIFYAWKLQ  1002
             K +  +  +  T+          D  S +FC   YAWK++
Sbjct  262   KHDGGDPVSSNTESSMVSSGGGGDDGSPEFCFFLYAWKME  301



>ref|XP_010487076.1| PREDICTED: uncharacterized protein LOC104765102 isoform X2 [Camelina 
sativa]
Length=289

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/286 (43%), Positives = 172/286 (60%), Gaps = 25/286 (9%)
 Frame = +1

Query  217  RRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYT-----CKIDLKTW  381
            +  S+  IYV +IA   ++V VTWSK + SH+L I   N  +E          KIDL   
Sbjct  4    QSSSVSLIYVVEIANTTQNVDVTWSKTISSHSLTIKTGNLKDEQQNHHQQQQVKIDLSGS  63

Query  382  QFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekea  561
             FW KKGLK+ + +  R+D+YWD + AKFS+ PE  SG++++L     ++L +GD +KEA
Sbjct  64   SFWAKKGLKSLEANGTRVDVYWDFRQAKFSNFPEPSSGFYVSLVSQNAVVLTIGDLKKEA  123

Query  562  lKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLG--QRKKEHIIIIESAMSG-NEPEMW  732
            L RTK KPS   AALV K E    K  F TRT  G  + ++E+ ++IE+++SG N+PEMW
Sbjct  124  LNRTKKKPSATEAALVSKLEHVHGKRVFYTRTAFGGGESRRENEVVIETSLSGPNDPEMW  183

Query  733  ISVDGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTN  909
            I+VDG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK    
Sbjct  184  ITVDGVPLIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKAG  243

Query  910  KDEASNSQTDETD----------------EDYPSTDFCHIFYAWKL  999
             +  S S                      ED  S  +CH+ YA K+
Sbjct  244  FESRSLSYNGAGYGDGDGDGDVEGDVNDVEDDSSPKYCHVLYAVKV  289



>gb|EPS70399.1| hypothetical protein M569_04363 [Genlisea aurea]
Length=272

 Score =   204 bits (520),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 171/261 (66%), Gaps = 19/261 (7%)
 Frame = +1

Query  226   SIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGL  405
             S+ C+Y A IAG +R+VTV W+KNL++++L I +E   +    TC+ID+K+WQFW KKG 
Sbjct  29    SVTCMYRAFIAGFWRNVTVFWNKNLMNYSLSISIEGCRDS---TCRIDVKSWQFWAKKGY  85

Query  406   KTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKRTKSKP  585
             KTF+VD K+++ YWD++SAKFS S + +S Y++AL    E++LLLGD+ K+A KR+KS+P
Sbjct  86    KTFEVDGKQVEAYWDLRSAKFSGSSQPLSDYYVALISDEEVVLLLGDKRKKAYKRSKSRP  145

Query  586   SLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSGNEPEMWISVDGMECIRI  765
             +L    ++ K E A  K SFSTR     R+++ I++  S     EPEMWIS+DG+  I +
Sbjct  146   ALSDPIMLSKTEHAFGKRSFSTRASFDNRREQEIVVESSVSGSKEPEMWISIDGIVVIHV  205

Query  766   VNLHWRFRGNETITVD-DVPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDEASNSQTDE  942
              NL W+FRGN+T+ +     V+V+WDVH WL+ S N G G+F+FK    ++E   S    
Sbjct  206   RNLQWKFRGNQTVVIGKQEAVQVYWDVHAWLF-SGNGGYGLFLFKAGVAEEEEEGSD---  261

Query  943   TDEDYPSTDFCHIF-YAWKLQ  1002
                       C +F YAWK++
Sbjct  262   ----------CRLFLYAWKIE  272



>ref|XP_009135291.1| PREDICTED: uncharacterized protein LOC103859505 [Brassica rapa]
Length=291

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/286 (40%), Positives = 175/286 (61%), Gaps = 27/286 (9%)
 Frame = +1

Query  223  CSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVEN----TYEENHYTCKIDLKTWQFW  390
             S+  +Y  +IA   +++  TWS+ + SH+L I  EN     ++ +H   KIDL    FW
Sbjct  6    SSVSLLYAIEIADATQNIDFTWSRTISSHSLTIKTENIKNEEHDHHHQQVKIDLAGSSFW  65

Query  391  GKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
            GKKGLK+ + +  ++D+YWD + AKFS+ PE  SG++++L     ++L +GD + EA++R
Sbjct  66   GKKGLKSLEANHTKVDVYWDFRKAKFSTFPEPSSGFYVSLVSQNAVVLTIGDLKNEAMQR  125

Query  571  TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQR--KKEHIIIIESAMSG-NEPEMWISV  741
            TK KPS   AALV K+E    K  F TRT  G    ++E+ ++IE+++SG N+PEM+I+V
Sbjct  126  TKKKPSATEAALVSKQEHVHGKRVFYTRTAFGGESSRRENEVVIETSLSGPNDPEMFITV  185

Query  742  DGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE  918
            DG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK     + 
Sbjct  186  DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKVGDES  245

Query  919  AS---NSQTDETDED----------------YPSTDFCHIFYAWKL  999
             +   N   D  ++D                  S  +CH+ YA K+
Sbjct  246  RTLSFNGGYDGENDDGNSGGDNDNCDDGGDGDESPKYCHVLYAVKV  291



>gb|KHN09942.1| hypothetical protein glysoja_043621 [Glycine soja]
Length=251

 Score =   203 bits (516),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 167/251 (67%), Gaps = 17/251 (7%)
 Frame = +1

Query  301   VSHTLFIVVENTYEENHYTCKIDLKTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKF-SSS  477
             ++HTL + V++T  +  YTCKI +K W FW KKG K+F+VD  ++++YWD++SA+F  SS
Sbjct  1     MNHTLNLKVDSTRGDFSYTCKIQVKPWYFWNKKGYKSFEVDGHQVEVYWDLRSARFVGSS  60

Query  478   PEAVSGYHIalamggelllllgdqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRT  657
             PE  S Y++A+    E++LLLGDQ+K+A KR K +PS+V A L+ K+ES  AK SF+T+ 
Sbjct  61    PEPGSDYYLAMVSDEEVVLLLGDQKKKAYKRMKMRPSIVEALLLVKRESVFAKKSFATKA  120

Query  658   LLGQRKKEHIIIIESAMSGN-EPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVF  834
                +++KE+ I++ES+  GN EPEMWIS+DG+  I + NL W FRGN+T+ V+  PV+VF
Sbjct  121   RFDEKRKENDIVVESSTFGNKEPEMWISIDGIVLIHVKNLQWNFRGNQTVMVNKQPVQVF  180

Query  835   WDVHDWLYDSANAGPGIFIFKQS-----TNKDEASNSQTDETDE----------DYPSTD  969
             WDVHDWL+    +GPG+FIFK       + K+E  N   D  +            Y  ++
Sbjct  181   WDVHDWLFSVPGSGPGLFIFKAGPVEVESEKEERVNEGCDSDNGSCASGYYSTLSYAPSE  240

Query  970   FCHIFYAWKLQ  1002
              C + YA+KL+
Sbjct  241   SCLVLYAYKLE  251



>ref|XP_010552346.1| PREDICTED: uncharacterized protein LOC104822715 isoform X2 [Tarenaya 
hassleriana]
Length=250

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 158/234 (68%), Gaps = 8/234 (3%)
 Frame = +1

Query  322  VVENTYEE-NHYTCKIDLKTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGY  498
            + EN  ++ NH+T KIDL  W FWGKKGLKT + D  R+D+YWD + AKFS+ PE  SG+
Sbjct  16   IAENPKDDRNHHTVKIDLSGWSFWGKKGLKTLEADGTRIDVYWDFRQAKFSNVPEPSSGF  75

Query  499  HIalamggelllllgdqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLL-GQRK  675
            ++AL     ++L +GD   EA+KRT+ +PS   AALV KKE    K  F TRT   G  +
Sbjct  76   YVALVSQDVVVLTIGDLVNEAMKRTRKRPSAREAALVCKKEHVYGKRVFYTRTAFDGTGR  135

Query  676  KEHIIIIESAMSG-NEPEMWISVDGMECIRIVNLHWRFRGNETITV-DDVPVEVFWDVHD  849
            +EH ++IE+++SG  EPEMWI+VDG+  +R++NL+WRFRGNE +TV + V VE++WD+HD
Sbjct  136  REHEVVIETSLSGPEEPEMWITVDGVAAMRVMNLNWRFRGNEVVTVKEGVAVEIYWDIHD  195

Query  850  WLYDSANAGPGIFIFKQ---STNKDEASNSQTDETDEDYPS-TDFCHIFYAWKL  999
            WL+ S  +  G+F+FKQ   S  +  + N   DE +    S +++C++ YA ++
Sbjct  196  WLFGSCGSSCGLFVFKQKLVSEGRSLSFNGGVDENEGGEDSLSEYCYVLYAVRV  249



>emb|CDY66553.1| BnaCnng51410D [Brassica napus]
Length=282

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 173/277 (62%), Gaps = 18/277 (6%)
 Frame = +1

Query  223  CSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYEE----NHYTCKIDLKTWQFW  390
             S+  +Y  +IA   +++  TWS+ + SH+L I  EN   E    +H   KIDL    FW
Sbjct  6    SSVSLLYAIEIADATQNIDFTWSRTISSHSLTIKTENIKNEEHDHHHQQVKIDLAGSSFW  65

Query  391  GKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
            GKKGLK+ + +  ++D+YWD + AKFS+ PE  SG++++L     ++L +GD + EA++R
Sbjct  66   GKKGLKSLEANHTKVDVYWDFRKAKFSTFPEPSSGFYVSLVSQNAVVLTIGDLKNEAMQR  125

Query  571  TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQR--KKEHIIIIESAMSG-NEPEMWISV  741
            TK KPS   AALV K+E    K  F TRT  G    ++E+ ++IE+++SG N+PEM+I+V
Sbjct  126  TKKKPSATEAALVSKQEHVHGKRVFYTRTAFGGESSRRENEVVIETSLSGPNDPEMFITV  185

Query  742  DGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE  918
            DG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK     + 
Sbjct  186  DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKVGDES  245

Query  919  ASNS----------QTDETDEDYPSTDFCHIFYAWKL  999
             + S            D  D+   S  +CH+ YA K+
Sbjct  246  RTLSFNGGGGDNDNGDDGGDDGDESPKYCHVLYAVKV  282



>emb|CDX82547.1| BnaA03g32740D [Brassica napus]
Length=291

 Score =   202 bits (513),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 173/286 (60%), Gaps = 27/286 (9%)
 Frame = +1

Query  223  CSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVEN----TYEENHYTCKIDLKTWQFW  390
             S+  +Y  +IA   +++  TWS+ + SH+L I  EN     ++ +H   KIDL    FW
Sbjct  6    SSVSLLYAIEIADATQNIDFTWSRTISSHSLTIKTENIKNEEHDHHHQQVKIDLAGSSFW  65

Query  391  GKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelllllgdqekealKR  570
            GKKGLK+ + +  ++D+YWD + AKFS+ PE  SG++++L     ++L +GD + EA++R
Sbjct  66   GKKGLKSLEANHTKVDVYWDFRKAKFSTFPEPSSGFYVSLVSQNAVVLTIGDLKNEAMQR  125

Query  571  TKSKPSLVAAALVHKKESACAKTSFSTRTLLGQR--KKEHIIIIESAMSG-NEPEMWISV  741
            TK KPS   AALV K+E    K  F TRT  G    ++E+ ++IE+++SG N+PEM+I+V
Sbjct  126  TKKKPSATEAALVSKQEHVHGKRVFYTRTAFGGESSRRENEVVIETSLSGPNDPEMFITV  185

Query  742  DGMECIRIVNLHWRFRGNETITVDD-VPVEVFWDVHDWLYDSANAGPGIFIFKQSTNKDE  918
            DG+  IRI+NL+WRFRGNE +TV D V VE+FWDVHDWL++++ +  G+F+FK     + 
Sbjct  186  DGVPAIRIMNLNWRFRGNEVVTVSDGVSVEIFWDVHDWLFETSGSSSGLFVFKPKVGDES  245

Query  919  ASNSQTDETDED-------------------YPSTDFCHIFYAWKL  999
             + S     D +                     S  +CH+ YA K+
Sbjct  246  RTLSFNGGYDGENDDGNSGGDNDNGDDGGDGDESPKYCHVLYAVKV  291



>gb|KDP22998.1| hypothetical protein JCGZ_01720 [Jatropha curcas]
Length=721

 Score =   205 bits (521),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 161/230 (70%), Gaps = 14/230 (6%)
 Frame = +1

Query  355   TCKIDLKTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKFSSSPEAVSGYHIalamggelll  534
             TCKIDLK W FW KKG K+F+++  ++DI+WD++SA+F  SPE  S +++AL   GE++L
Sbjct  492   TCKIDLKPWIFWTKKGCKSFELEGSQVDIHWDLRSARFCGSPEPCSDFYVALVSDGEVVL  551

Query  535   llgdqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG  714
             LLGD +K+A KRTK++P+L  A L +KKE+  AK SFSTR    Q+K+EH I++ES+ +G
Sbjct  552   LLGDHKKKAYKRTKARPALSEAVLFYKKENVFAKKSFSTRAKFDQQKQEHDIVVESSTTG  611

Query  715   N-EPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFI  891
             + +PEMWIS+DG+  I + NL W+FRGN+T+ V+  PV+VFWDVHDWL+++A  G G+FI
Sbjct  612   HKDPEMWISIDGLVVIHVKNLQWKFRGNQTVMVNTQPVQVFWDVHDWLFNNAATGHGLFI  671

Query  892   FKQST-----NKDEASNSQTDETD--------EDYPSTDFCHIFYAWKLQ  1002
             FK        +KD +  + +D +D         +  + +FC   YAWK++
Sbjct  672   FKPGAPECDDDKDSSPRAASDNSDSSKYFSAKSNASTPEFCLFLYAWKIE  721



>ref|XP_010689671.1| PREDICTED: uncharacterized protein LOC104903342 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   193 bits (491),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 179/288 (62%), Gaps = 30/288 (10%)
 Frame = +1

Query  223  CSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVENTYE---ENHYTCKIDLKTWQFWG  393
            C++  +++  IAG +R+V+V W KN+++ +  I+++  +E   E   TCK++LK W FW 
Sbjct  29   CTVSSVFLTNIAGYWRNVSVLWCKNMMNISFSIIIDG-FEGDLETQTTCKVELKPWHFWS  87

Query  394  KKGLKTFKVDQK---------RLDIYWDVKSAKFS-SSPEAVSGYHIalamggelllllg  543
            +KG K+F+++ +         +LDIYWD++SAKFS SSPE  S Y++AL    E++LLLG
Sbjct  88   RKGYKSFEINIQHKLAEESYHQLDIYWDLRSAKFSGSSPEPCSDYYLALVSDEEVVLLLG  147

Query  544  dqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG-NE  720
            D +K+A KRTK +P+LV A    KKE   AK SF+TR    + K EH ++IES+ SG  +
Sbjct  148  DNKKKAYKRTKKRPALVDAIQSLKKEIVYAKKSFATRARFTEGKGEHDVVIESSTSGPKD  207

Query  721  PEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPGIFIFKQ  900
            PEMWIS+DG+  I + NL W+FRGNE + V+  P++V WDVH WL+ +   G G+F+FK 
Sbjct  208  PEMWISIDGIVLIHVKNLQWKFRGNEMVVVNKTPIQVLWDVHAWLFSNPGTGCGLFVFKP  267

Query  901  STNK---DEASNSQTDETDEDYPS------------TDFCHIFYAWKL  999
               +   D   ++++  +D  + S             DFC +  AWK+
Sbjct  268  GAPEVEFDREGSNRSGNSDNSFGSMFYSTQSTQTKIVDFCLLLQAWKI  315



>ref|XP_005650126.1| tetraspanning membrane protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25582.1| tetraspanning membrane protein [Coccomyxa subellipsoidea C-169]
Length=244

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 141/214 (66%), Gaps = 9/214 (4%)
 Frame = -3

Query  2240  LLADWNSYA-STKASDG----DGASSSLIAAFDLEAAVRSANDTVSGTFNVVSKGVRDIP  2076
             +LA+WN YA   +A +G     GASSS   A  +E    +    +  TF+ VS GV+ + 
Sbjct  23    VLAEWNKYAGDDQAQEGCHAVAGASSSDTLASKMEEGSANVQHFLVNTFSRVSTGVQGVG  82

Query  2075  GS----LQSATSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAICFTLGC  1908
              S    +QSA S +PS     +F  FLASG++F+ +AF+LFLPVI+L P KFAICFT G 
Sbjct  83    QSVGSGIQSAQSTLPSTSHFTWFLAFLASGIVFLILAFSLFLPVIILAPSKFAICFTFGS  142

Query  1907  CFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVLFSVIQV  1728
               I+G+F +LRG K+Q  HM S ERLPFT+G++GSM GTLY ++ LHSYILS++   +QV
Sbjct  143   ALIMGAFVSLRGWKSQLLHMFSAERLPFTIGYVGSMAGTLYAALALHSYILSLVCCCLQV  202

Query  1727  MALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFG  1626
             +ALLYY +SYFPGG+ G+KF+      +  +C G
Sbjct  203   VALLYYTISYFPGGTNGVKFVMKMAFGAFAQCLG  236



>ref|XP_002989475.1| hypothetical protein SELMODRAFT_129941 [Selaginella moellendorffii]
 gb|EFJ09351.1| hypothetical protein SELMODRAFT_129941 [Selaginella moellendorffii]
Length=166

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -3

Query  2102  VSKGVRDIPGSLQSA-TSNIPSGKALMYFGLFLASGVLFIFMAFALFLPVIVLVPQKFAI  1926
             V+  V ++PG++Q+A T  +PS   L+YF + L +G  FIF++  +FLP+IVL+P KFA 
Sbjct  6     VTTRVTNLPGNVQTAATGGLPSRNQLLYFSIMLGAGCFFIFISLVMFLPLIVLMPAKFAS  65

Query  1925  CFTLGCCFIIGSFFALRGTKNQFAHMSSKERLPFTLGFLGSMIGTLYVSMGLHSYILSVL  1746
             CF+LG C +IGSFFAL+G + Q AHM SKERLPF++ F+GSM+G +Y S+ +HSY+L +L
Sbjct  66    CFSLGSCLVIGSFFALKGPRAQLAHMMSKERLPFSVAFVGSMVGAIYSSVIMHSYLLCLL  125

Query  1745  FSVIQVMALLYYAVSYFPGGSAGLKFLSSSMVSSVLKCFGR  1623
             FS +Q++ALLYY +SYFPGG+AGLKF+ S M + +L CF R
Sbjct  126   FSALQILALLYYVLSYFPGGTAGLKFMLSMMKNMILGCFRR  166



>gb|EMT16711.1| hypothetical protein F775_12417 [Aegilops tauschii]
Length=313

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 167/280 (60%), Gaps = 19/280 (7%)
 Frame = +1

Query  202  SVCTTRRCSIFCIYVAKIAGLFRSVTVTWSKNLVSHTLFIVVEN--------TYEENHYT  357
            S   T +CS   +Y+ +I G    VT  W+KN+++ +  I ++           ++   +
Sbjct  36   SSSATAQCSTMTVYLVRINGTEHLVTAVWNKNIINQSFTITIDRHGDGAGSGGGDDGALS  95

Query  358  CKIDLKTWQFWGKKGLKTFKVDQKRLDIYWDVKSAKF-SSSPEAVSGYHIalamggelll  534
             K++LK W FW KKGLK+F +D  RLD++WD++SAKF +SSPE  SGY  AL    +++L
Sbjct  96   LKVELKPWPFWSKKGLKSFFLDGHRLDVFWDLRSAKFPASSPEPASGYFGALVSQEQVVL  155

Query  535  llgdqekealKRTKSKPSLVAAALVHKKESACAKTSFSTRTLLGQRKKEHIIIIESAMSG  714
             LGD +K+A KR+K +PSL  A  + ++E+   + SF  R  L   +K+H I+IE++++G
Sbjct  156  TLGDLKKDAYKRSKCRPSLEDAVPLCRRETVFGRRSFVARGWLDTSRKDHDIVIEASLAG  215

Query  715  -NEPEMWISVDGMECIRIVNLHWRFRGNETITVDDVPVEVFWDVHDWLYDSANAGPG---  882
              EPEM I+VDG   +++ NL W+FRGNET+ VD  PV+V WDVHDW++    AGPG   
Sbjct  216  PREPEMAITVDGRALVQVKNLQWKFRGNETVLVDQSPVQVLWDVHDWIF----AGPGSQA  271

Query  883  IFIFKQSTNKDEASNSQTDETDEDYPS--TDFCHIFYAWK  996
            +F FK     +  S+    E+    P    D+    +AWK
Sbjct  272  VFAFKPGAPPEVNSDEAGLESGSGIPGDPGDYSFFLHAWK  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7736894236528