BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23014_g1_i2 len=4114 path=[8657:0-2351 4766:2352-2514
@1551@!:2515-2707 3094:2708-3010 4481:3011-3106 @1753@!:3107-3769
2416:3770-4113]

Length=4114
                                                                      Score     E

ref|XP_009759176.1|  PREDICTED: pentatricopeptide repeat-containi...    927   0.0      
ref|XP_009599439.1|  PREDICTED: pentatricopeptide repeat-containi...    912   0.0      
ref|XP_006358175.1|  PREDICTED: pentatricopeptide repeat-containi...    905   0.0      
ref|XP_004235443.1|  PREDICTED: pentatricopeptide repeat-containi...    900   0.0      
ref|XP_002266503.1|  PREDICTED: pentatricopeptide repeat-containi...    867   0.0      Vitis vinifera
emb|CDP13864.1|  unnamed protein product                                850   0.0      
ref|XP_007052225.1|  Tetratricopeptide repeat (TPR)-like superfam...    839   0.0      
ref|XP_007219156.1|  hypothetical protein PRUPE_ppa016282mg             835   0.0      
ref|XP_002511627.1|  pentatricopeptide repeat-containing protein,...    842   0.0      Ricinus communis
ref|XP_008232397.1|  PREDICTED: pentatricopeptide repeat-containi...    834   0.0      
emb|CBI39452.3|  unnamed protein product                                814   0.0      
ref|XP_010103831.1|  hypothetical protein L484_024133                   815   0.0      
ref|XP_006375239.1|  hypothetical protein POPTR_0014s05550g             809   0.0      
ref|XP_010252151.1|  PREDICTED: pentatricopeptide repeat-containi...    805   0.0      
ref|XP_008344150.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    823   0.0      
gb|KHF97527.1|  hypothetical protein F383_12018                         801   0.0      
ref|XP_011076550.1|  PREDICTED: pentatricopeptide repeat-containi...    803   0.0      
ref|XP_011042452.1|  PREDICTED: pentatricopeptide repeat-containi...    815   0.0      
emb|CAN73209.1|  hypothetical protein VITISV_002838                     799   0.0      Vitis vinifera
ref|XP_010052040.1|  PREDICTED: pentatricopeptide repeat-containi...    786   0.0      
ref|XP_004161177.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    778   0.0      
ref|XP_004142707.1|  PREDICTED: pentatricopeptide repeat-containi...    779   0.0      
ref|XP_008444214.1|  PREDICTED: pentatricopeptide repeat-containi...    779   0.0      
ref|XP_006592806.1|  PREDICTED: pentatricopeptide repeat-containi...    772   0.0      
ref|XP_006592805.1|  PREDICTED: pentatricopeptide repeat-containi...    772   0.0      
ref|XP_003539494.2|  PREDICTED: pentatricopeptide repeat-containi...    772   0.0      
ref|XP_010544362.1|  PREDICTED: pentatricopeptide repeat-containi...    768   0.0      
ref|XP_003622527.1|  Pentatricopeptide repeat-containing protein        770   0.0      
ref|XP_007138408.1|  hypothetical protein PHAVU_009G206300g             769   0.0      
ref|XP_004510607.1|  PREDICTED: pentatricopeptide repeat-containi...    766   0.0      
ref|XP_004308525.1|  PREDICTED: pentatricopeptide repeat-containi...    772   0.0      
ref|NP_171708.1|  pentatricopeptide repeat-containing protein           756   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK42575.1|  hypothetical protein AALP_AA1G013500                    751   0.0      
ref|XP_006418483.1|  hypothetical protein EUTSA_v10006939mg             747   0.0      
gb|EYU20150.1|  hypothetical protein MIMGU_mgv1a002588mg                744   0.0      
ref|XP_006304700.1|  hypothetical protein CARUB_v10011958mg             742   0.0      
ref|XP_010501268.1|  PREDICTED: pentatricopeptide repeat-containi...    746   0.0      
ref|XP_002889338.1|  pentatricopeptide repeat-containing protein        729   0.0      
gb|AAC24378.1|  Unknown protein                                         708   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX93340.1|  BnaC04g45560D                                          698   0.0      
ref|XP_009141700.1|  PREDICTED: pentatricopeptide repeat-containi...    682   0.0      
gb|EPS68740.1|  hypothetical protein M569_06021                         672   0.0      
ref|XP_006836847.1|  hypothetical protein AMTR_s00099p00074160          642   0.0      
ref|XP_010497224.1|  PREDICTED: pentatricopeptide repeat-containi...    595   0.0      
gb|KHN18005.1|  Pentatricopeptide repeat-containing protein, chlo...    544   2e-173   
ref|XP_010909614.1|  PREDICTED: pentatricopeptide repeat-containi...    545   6e-173   
ref|XP_008777446.1|  PREDICTED: pentatricopeptide repeat-containi...    545   8e-173   
ref|XP_009386447.1|  PREDICTED: pentatricopeptide repeat-containi...    518   4e-163   
ref|XP_010089004.1|  hypothetical protein L484_020290                   495   2e-158   
gb|KHN22949.1|  Pentatricopeptide repeat-containing protein, chlo...    470   1e-149   
ref|XP_006358176.1|  PREDICTED: cell division cycle 20.2, cofacto...    250   6e-131   
ref|XP_002451419.1|  hypothetical protein SORBIDRAFT_04g001815          415   9e-126   Sorghum bicolor [broomcorn]
ref|NP_001045722.1|  Os02g0121900                                       410   9e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010662225.1|  PREDICTED: cell division cycle 20.2, cofacto...    236   2e-123   
ref|XP_002277711.2|  PREDICTED: cell division cycle 20.5, cofacto...    236   6e-123   Vitis vinifera
ref|XP_003573599.1|  PREDICTED: pentatricopeptide repeat-containi...    406   4e-122   
emb|CBI38557.3|  unnamed protein product                                236   3e-121   
ref|XP_011076552.1|  PREDICTED: cell division cycle 20.2, cofacto...    235   3e-119   
ref|NP_001169582.1|  hypothetical protein                               395   2e-118   Zea mays [maize]
ref|XP_006648252.1|  PREDICTED: pentatricopeptide repeat-containi...    394   2e-118   
ref|XP_011040316.1|  PREDICTED: cell division cycle 20.5, cofacto...    238   9e-118   
ref|XP_006589022.1|  PREDICTED: cell division cycle 20.5, cofacto...    226   1e-117   
ref|XP_010109151.1|  Anaphase-promoting complex subunit cdc20           200   2e-117   
ref|XP_009362728.1|  PREDICTED: cell division cycle 20.5, cofacto...    239   2e-116   
gb|EMT16521.1|  hypothetical protein F775_33155                         381   1e-115   
ref|XP_004952080.1|  PREDICTED: pentatricopeptide repeat-containi...    387   2e-115   
ref|XP_010662227.1|  PREDICTED: cell division cycle 20.5, cofacto...    236   7e-115   
ref|XP_008368038.1|  PREDICTED: cell division cycle 20.3, cofacto...    228   2e-111   
emb|CDP13865.1|  unnamed protein product                                223   6e-111   
emb|CAN72563.1|  hypothetical protein VITISV_011377                     192   7e-110   Vitis vinifera
ref|XP_007220389.1|  hypothetical protein PRUPE_ppa023058mg             239   2e-109   
ref|XP_006846806.1|  hypothetical protein AMTR_s00148p00070260          374   3e-109   
gb|EYU20148.1|  hypothetical protein MIMGU_mgv1a026617mg                245   6e-108   
ref|XP_002321776.2|  hypothetical protein POPTR_0015s12180g             237   1e-106   Populus trichocarpa [western balsam poplar]
emb|CDO97701.1|  unnamed protein product                                367   2e-106   
ref|XP_009599440.1|  PREDICTED: cell division cycle 20.3, cofacto...    257   5e-103   
ref|XP_010318209.1|  PREDICTED: cell division cycle 20.2, cofacto...    251   3e-102   
ref|XP_009759177.1|  PREDICTED: cell division cycle 20.5, cofacto...    253   1e-101   
ref|XP_009630943.1|  PREDICTED: pentatricopeptide repeat-containi...    352   1e-101   
ref|XP_009759178.1|  PREDICTED: cell division cycle 20.5, cofacto...    253   2e-101   
ref|XP_010275217.1|  PREDICTED: pentatricopeptide repeat-containi...    348   1e-99    
gb|KHN05551.1|  Anaphase-promoting complex subunit cdc20                224   5e-99    
ref|XP_004251992.1|  PREDICTED: pentatricopeptide repeat-containi...    344   1e-98    
ref|XP_010242034.1|  PREDICTED: pentatricopeptide repeat-containi...    345   1e-98    
gb|KDP29122.1|  hypothetical protein JCGZ_16511                         344   2e-98    
ref|XP_006353112.1|  PREDICTED: pentatricopeptide repeat-containi...    342   5e-98    
ref|XP_011094657.1|  PREDICTED: pentatricopeptide repeat-containi...    343   6e-98    
ref|XP_009782844.1|  PREDICTED: pentatricopeptide repeat-containi...    340   1e-97    
ref|XP_006296196.1|  hypothetical protein CARUB_v10025361mg             341   2e-97    
gb|KHN46063.1|  Pentatricopeptide repeat-containing protein             338   2e-97    
ref|XP_002881498.1|  pentatricopeptide repeat-containing protein        341   3e-97    
ref|XP_006410903.1|  hypothetical protein EUTSA_v10017966mg             340   6e-97    
gb|KHG02661.1|  Anaphase-promoting complex subunit cdc20                231   6e-97    
ref|XP_010516983.1|  PREDICTED: pentatricopeptide repeat-containi...    337   5e-96    
ref|XP_009420793.1|  PREDICTED: cell division cycle 20.2, cofacto...    225   5e-96    
ref|XP_003524868.1|  PREDICTED: pentatricopeptide repeat-containi...    335   1e-95    
ref|XP_002315730.1|  pentatricopeptide repeat-containing family p...    336   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_011030581.1|  PREDICTED: pentatricopeptide repeat-containi...    335   4e-95    
gb|KFK36611.1|  hypothetical protein AALP_AA4G146200                    334   5e-95    
ref|NP_181260.1|  pentatricopeptide repeat-containing protein           334   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338950.1|  PREDICTED: pentatricopeptide repeat-containi...    334   8e-95    
ref|XP_003532699.1|  PREDICTED: pentatricopeptide repeat-containi...    333   9e-95    
ref|XP_004299746.1|  PREDICTED: pentatricopeptide repeat-containi...    333   9e-95    
ref|XP_009133136.1|  PREDICTED: pentatricopeptide repeat-containi...    333   1e-94    
emb|CDY46765.1|  BnaA03g17090D                                          332   3e-94    
ref|XP_002530985.1|  pentatricopeptide repeat-containing protein,...    332   4e-94    Ricinus communis
ref|XP_007038204.1|  Transducin/WD40 repeat-like superfamily protein    237   4e-94    
emb|CBI32743.3|  unnamed protein product                                332   4e-94    
ref|XP_002276355.1|  PREDICTED: pentatricopeptide repeat-containi...    331   6e-94    Vitis vinifera
ref|XP_006484268.1|  PREDICTED: cell division cycle 20.1, cofacto...    242   6e-94    
ref|XP_006437839.1|  hypothetical protein CICLE_v10031460mg             242   8e-94    
emb|CDX79725.1|  BnaC03g20610D                                          330   9e-94    
ref|XP_007033459.1|  Tetratricopeptide repeat (TPR)-like superfam...    329   2e-93    
gb|KDO70258.1|  hypothetical protein CISIN_1g040533mg                   240   3e-93    
gb|ACU25632.1|  pentatricopeptide repeat-containing protein             320   4e-93    Neosparton ephedroides
ref|XP_010509363.1|  PREDICTED: pentatricopeptide repeat-containi...    328   4e-93    
gb|ACU25622.1|  pentatricopeptide repeat-containing protein             320   5e-93    Junellia uniflora
ref|XP_006481496.1|  PREDICTED: pentatricopeptide repeat-containi...    328   5e-93    
ref|XP_004309007.1|  PREDICTED: anaphase-promoting complex subuni...    237   7e-93    
ref|XP_010505300.1|  PREDICTED: pentatricopeptide repeat-containi...    328   7e-93    
ref|XP_008378595.1|  PREDICTED: pentatricopeptide repeat-containi...    328   9e-93    
gb|ACU25601.1|  pentatricopeptide repeat-containing protein             318   1e-92    Verbena perennis
ref|XP_009376212.1|  PREDICTED: pentatricopeptide repeat-containi...    327   2e-92    
gb|ACU25618.1|  pentatricopeptide repeat-containing protein             318   2e-92    Glandularia dissecta
ref|XP_010529884.1|  PREDICTED: pentatricopeptide repeat-containi...    326   3e-92    
ref|XP_007158766.1|  hypothetical protein PHAVU_002G180100g             325   3e-92    
ref|XP_010274571.1|  PREDICTED: cell division cycle 20.2, cofacto...    224   4e-92    
gb|KDO50689.1|  hypothetical protein CISIN_1g005856mg                   323   4e-92    
gb|KDO50690.1|  hypothetical protein CISIN_1g005856mg                   323   4e-92    
ref|XP_010274573.1|  PREDICTED: cell division cycle 20.2, cofacto...    224   5e-92    
ref|XP_010111755.1|  hypothetical protein L484_008414                   326   5e-92    
gb|KDO50688.1|  hypothetical protein CISIN_1g005856mg                   323   6e-92    
gb|ACU25615.1|  pentatricopeptide repeat-containing protein             317   7e-92    Glandularia araucana
gb|ACU25607.1|  pentatricopeptide repeat-containing protein             316   8e-92    Verbena hastata [American blue vervain]
gb|ACU25614.1|  pentatricopeptide repeat-containing protein             316   8e-92    Glandularia microphylla
gb|ACU25620.1|  pentatricopeptide repeat-containing protein             316   1e-91    Junellia spathulata
gb|ACU25617.1|  pentatricopeptide repeat-containing protein             315   1e-91    Glandularia subincana
gb|ACU25603.1|  pentatricopeptide repeat-containing protein             315   2e-91    Verbena macdougalii [New Mexico vervain]
ref|XP_010669847.1|  PREDICTED: pentatricopeptide repeat-containi...    325   2e-91    
gb|ACU25604.1|  pentatricopeptide repeat-containing protein             315   2e-91    Verbena halei
gb|ACU25636.1|  pentatricopeptide repeat-containing protein             315   2e-91    Tamonea boxiana
gb|ACU25640.1|  pentatricopeptide repeat-containing protein             315   2e-91    Stachytarpheta cayennensis [blue snakeweed]
gb|ACU25606.1|  pentatricopeptide repeat-containing protein             315   3e-91    Verbena canescens [gray vervain]
ref|XP_006428766.1|  hypothetical protein CICLE_v10011107mg             324   3e-91    
gb|ACU25631.1|  pentatricopeptide repeat-containing protein             314   4e-91    Lampayo castellani
gb|ACU25619.1|  pentatricopeptide repeat-containing protein             314   4e-91    Glandularia incisa
gb|ACU25612.1|  pentatricopeptide repeat-containing protein             314   4e-91    Verbena intermedia
gb|ACU25609.1|  pentatricopeptide repeat-containing protein             314   4e-91    Verbena bonariensis [purpletop]
gb|ACU25610.1|  pentatricopeptide repeat-containing protein             313   8e-91    Verbena montevidensis
gb|ACU25621.1|  pentatricopeptide repeat-containing protein             313   9e-91    Junellia seriphioides
gb|ACU25630.1|  pentatricopeptide repeat-containing protein             313   1e-90    Dipyrena glaberrima
ref|XP_004163187.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    321   2e-90    
ref|XP_004149878.1|  PREDICTED: pentatricopeptide repeat-containi...    321   2e-90    
ref|XP_010061750.1|  PREDICTED: pentatricopeptide repeat-containi...    321   2e-90    
gb|ACU25639.1|  pentatricopeptide repeat-containing protein             312   2e-90    
gb|ACU25608.1|  pentatricopeptide repeat-containing protein             311   4e-90    Verbena hispida
gb|ACU25616.1|  pentatricopeptide repeat-containing protein             311   5e-90    Glandularia flava
gb|ACU25629.1|  pentatricopeptide repeat-containing protein             311   6e-90    Aloysia virgata
gb|ACU25602.1|  pentatricopeptide repeat-containing protein             311   6e-90    Verbena bracteata [creeping vervain]
gb|KEH37314.1|  pentatricopeptide (PPR) repeat protein                  319   7e-90    
ref|XP_004488235.1|  PREDICTED: pentatricopeptide repeat-containi...    318   8e-90    
gb|ACU25628.1|  pentatricopeptide repeat-containing protein             310   1e-89    Xeroaloysia ovatifolia
gb|ACU25600.1|  pentatricopeptide repeat-containing protein             310   1e-89    Verbena orcuttiana
gb|ACU25627.1|  pentatricopeptide repeat-containing protein             310   1e-89    Lantana canescens
gb|ACU25613.1|  pentatricopeptide repeat-containing protein             310   2e-89    Verbena rigida [veined verbena]
gb|ACU25625.1|  pentatricopeptide repeat-containing protein             309   2e-89    Mulguraea aspera
gb|ACU25611.1|  pentatricopeptide repeat-containing protein             309   2e-89    Verbena litoralis [seashore vervain]
gb|ACU25634.1|  pentatricopeptide repeat-containing protein             309   3e-89    Priva cordifolia
gb|ACU25626.1|  pentatricopeptide repeat-containing protein             308   4e-89    Phyla dulcis
gb|ACU25623.1|  pentatricopeptide repeat-containing protein             308   6e-89    Mulguraea asparagoides
gb|ACU25624.1|  pentatricopeptide repeat-containing protein             308   7e-89    Mulguraea scoparia
ref|XP_008443807.1|  PREDICTED: pentatricopeptide repeat-containi...    316   7e-89    
gb|ACU25643.1|  pentatricopeptide repeat-containing protein             308   9e-89    Petrea racemosa
gb|ACU25635.1|  pentatricopeptide repeat-containing protein             307   1e-88    Rhaphithamnus venustus
gb|ACU25605.1|  pentatricopeptide repeat-containing protein             306   2e-88    Verbena officinalis [common verbena]
gb|ACU25642.1|  pentatricopeptide repeat-containing protein             306   2e-88    Duranta serratifolia
gb|ACU25633.1|  pentatricopeptide repeat-containing protein             306   4e-88    Pitraea cuneato-ovata
ref|XP_004497861.1|  PREDICTED: anaphase-promoting complex subuni...    208   3e-87    
gb|ACU25637.1|  pentatricopeptide repeat-containing protein             303   5e-87    Citharexylum ligustrinum
ref|XP_008219256.1|  PREDICTED: pentatricopeptide repeat-containi...    309   2e-86    
ref|XP_007225233.1|  hypothetical protein PRUPE_ppa001877mg             309   2e-86    
ref|XP_002511051.1|  cell division cycle, putative                      226   3e-86    Ricinus communis
ref|XP_009392129.1|  PREDICTED: pentatricopeptide repeat-containi...    308   4e-86    
gb|ACU25644.1|  pentatricopeptide repeat-containing protein             300   4e-86    Casselia glaziovii
gb|EYU34455.1|  hypothetical protein MIMGU_mgv1a002067mg                307   4e-86    
ref|XP_006485044.1|  PREDICTED: cell division cycle 20.2, cofacto...    216   1e-84    
dbj|BAG70980.1|  pentatricopeptide (PPR) repeat-containing protein      305   1e-84    Musa balbisiana [starchy banana]
ref|XP_008807561.1|  PREDICTED: pentatricopeptide repeat-containi...    303   3e-84    
ref|XP_003595776.1|  Cell division cycle protein-like protein           208   5e-84    
gb|ACU25638.1|  pentatricopeptide repeat-containing protein             293   9e-84    Citharexylum montevidense
ref|XP_010906524.1|  PREDICTED: pentatricopeptide repeat-containi...    299   5e-83    
gb|ACF79319.1|  unknown                                                 293   1e-81    Zea mays [maize]
gb|ACU25641.1|  pentatricopeptide repeat-containing protein             286   2e-81    Bouchea fluminensis
ref|NP_001130930.1|  uncharacterized protein LOC100192035               293   4e-81    Zea mays [maize]
ref|XP_003571864.2|  PREDICTED: pentatricopeptide repeat-containi...    293   8e-81    
gb|KHG24728.1|  Anaphase-promoting complex subunit cdc20                206   1e-80    
ref|XP_008780268.1|  PREDICTED: cell division cycle 20.1, cofacto...    210   2e-79    
ref|XP_006646772.1|  PREDICTED: pentatricopeptide repeat-containi...    289   2e-79    
gb|EMT27270.1|  hypothetical protein F775_52113                         288   2e-79    
ref|NP_001045649.1|  Os02g0110400                                       288   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777075.1|  PREDICTED: cell division cycle 20.2, cofacto...    209   3e-79    
ref|XP_002453150.1|  hypothetical protein SORBIDRAFT_04g000850          287   7e-79    Sorghum bicolor [broomcorn]
gb|EPS65130.1|  hypothetical protein M569_09650                         197   2e-78    
ref|XP_010934406.1|  PREDICTED: cell division cycle 20.2, cofacto...    212   3e-78    
gb|EEC72333.1|  hypothetical protein OsI_05540                          285   5e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_010907481.1|  PREDICTED: cell division cycle 20.2, cofacto...    208   1e-77    
gb|KHN12442.1|  Pentatricopeptide repeat-containing protein             278   1e-77    
dbj|BAJ87147.1|  predicted protein                                      283   3e-77    
gb|EMT33853.1|  hypothetical protein F775_26591                         275   4e-76    
ref|XP_009383114.1|  PREDICTED: cell division cycle 20.2, cofacto...    201   4e-74    
ref|XP_004952178.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    273   7e-74    
ref|XP_001757257.1|  predicted protein                                  197   7e-74    
gb|EPS72095.1|  hypothetical protein M569_02663                         271   1e-73    
ref|XP_010274572.1|  PREDICTED: cell division cycle 20.2, cofacto...    224   4e-73    
ref|XP_002970067.1|  hypothetical protein SELMODRAFT_92939              197   2e-72    
ref|XP_006828788.1|  hypothetical protein AMTR_s00001p00114780          192   3e-72    
ref|XP_001766400.1|  predicted protein                                  190   6e-72    
ref|XP_002967241.1|  hypothetical protein SELMODRAFT_86492              188   9e-71    
ref|XP_002960485.1|  hypothetical protein SELMODRAFT_229944             188   9e-71    
ref|XP_009794506.1|  PREDICTED: cell division cycle 20.1, cofacto...    185   5e-70    
ref|XP_009794507.1|  PREDICTED: cell division cycle 20.1, cofacto...    184   7e-70    
ref|XP_009606788.1|  PREDICTED: cell division cycle 20.1, cofacto...    182   4e-69    
ref|XP_001765142.1|  predicted protein                                  182   4e-69    
ref|XP_003059233.1|  predicted protein                                  186   6e-69    
ref|XP_009606789.1|  PREDICTED: cell division cycle 20.1, cofacto...    182   6e-69    
ref|XP_002502587.1|  anaphase promoting complex protein                 183   1e-68    Micromonas commoda
emb|CEF97720.1|  WD40/YVTN repeat-like-containing domain                187   1e-68    
gb|AAV68609.1|  CDC20 protein                                           187   2e-68    Ostreococcus tauri
ref|XP_001753296.1|  predicted protein                                  184   2e-68    
gb|KDP21935.1|  hypothetical protein JCGZ_03073                         181   3e-68    
ref|XP_003078994.1|  cell division cycle protein 20 homolog (p55c...    186   3e-68    
ref|XP_001417356.1|  predicted protein                                  186   3e-68    Ostreococcus lucimarinus CCE9901
dbj|BAJ85982.1|  predicted protein                                      183   4e-68    
ref|XP_007511434.1|  predicted protein                                  178   6e-68    
gb|AFW69887.1|  hypothetical protein ZEAMMB73_120375                    246   3e-67    
ref|XP_008873033.1|  hypothetical protein H310_08893                    185   4e-67    
ref|XP_005651189.1|  cell division cycle 20                             178   5e-67    
ref|XP_004511460.1|  PREDICTED: anaphase-promoting complex subuni...    182   6e-67    
ref|XP_006429995.1|  hypothetical protein CICLE_v10011710mg             182   6e-67    
ref|XP_004511458.1|  PREDICTED: anaphase-promoting complex subuni...    182   6e-67    
gb|EMS66828.1|  Anaphase-promoting complex subunit cdc20                184   6e-67    
ref|XP_004511461.1|  PREDICTED: anaphase-promoting complex subuni...    182   6e-67    
ref|XP_008621004.1|  cell division cycle 20, cofactor-APC complex       187   8e-67    
ref|XP_003600092.1|  Fizzy-related protein-like protein                 181   8e-67    
ref|XP_003610876.1|  Cell division cycle protein-like protein           182   8e-67    
ref|XP_004494277.1|  PREDICTED: anaphase-promoting complex subuni...    183   9e-67    
gb|KHN22585.1|  Anaphase-promoting complex subunit cdc20                183   1e-66    
ref|XP_002323378.2|  hypothetical protein POPTR_0016s06920g             183   2e-66    Populus trichocarpa [western balsam poplar]
ref|XP_007163007.1|  hypothetical protein PHAVU_001G198300g             181   2e-66    
gb|KFK29939.1|  hypothetical protein AALP_AA7G197900                    182   2e-66    
ref|XP_011042575.1|  PREDICTED: cell division cycle 20.2, cofacto...    182   3e-66    
gb|KFK31387.1|  hypothetical protein AALP_AA6G105400                    182   3e-66    
ref|XP_005844476.1|  hypothetical protein CHLNCDRAFT_26822              171   3e-66    
dbj|GAM17015.1|  hypothetical protein SAMD00019534_001900               179   3e-66    
ref|XP_002265521.2|  PREDICTED: cell division cycle 20.2, cofacto...    186   4e-66    Vitis vinifera
ref|XP_006283731.1|  hypothetical protein CARUB_v10004802mg             182   4e-66    
gb|KDO28013.1|  hypothetical protein SPRG_06757                         186   5e-66    
ref|XP_008223574.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    181   5e-66    
ref|XP_010650587.1|  PREDICTED: cell division cycle 20.2, cofacto...    185   6e-66    
ref|XP_010540408.1|  PREDICTED: cell division cycle 20.1, cofacto...    181   6e-66    
ref|XP_002960071.1|  hypothetical protein SELMODRAFT_139237             179   6e-66    
ref|XP_009123591.1|  PREDICTED: cell division cycle 20.1, cofacto...    182   7e-66    
ref|XP_002867190.1|  CDC20.1                                            181   1e-65    
ref|NP_195053.1|  cell division cycle 20.1, cofactor of APC complex     181   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521504.1|  PREDICTED: cell division cycle 20.1, cofacto...    183   1e-65    
gb|AAF14048.1|AF029262_1  putative cdc20 protein                        181   1e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203139.1|  hypothetical protein PRUPE_ppa024178mg             186   1e-65    
ref|XP_002984069.1|  hypothetical protein SELMODRAFT_234427             179   1e-65    
ref|XP_005092133.1|  PREDICTED: cell division cycle protein 20 ho...    184   1e-65    
emb|CBI36683.3|  unnamed protein product                                184   2e-65    
ref|XP_009351862.1|  PREDICTED: cell division cycle 20.1, cofacto...    176   2e-65    
ref|XP_010437822.1|  PREDICTED: cell division cycle 20.2, cofacto...    181   2e-65    
ref|XP_007038744.1|  Transducin family protein / WD-40 repeat fam...    178   2e-65    
ref|XP_010650593.1|  PREDICTED: cell division cycle 20.2, cofacto...    184   2e-65    
emb|CAA11819.1|  hypothetical protein                                   182   2e-65    Brassica napus [oilseed rape]
ref|XP_010650594.1|  PREDICTED: cell division cycle 20.2, cofacto...    184   2e-65    
ref|XP_002875703.1|  hypothetical protein ARALYDRAFT_347582             183   2e-65    
ref|NP_195052.1|  cell division cycle 20.2, cofactor of APC complex     181   4e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036354.1|  PREDICTED: cell division cycle 20.2, cofacto...    180   4e-65    
ref|XP_003291139.1|  hypothetical protein DICPUDRAFT_155718             184   4e-65    
gb|EFA84008.1|  WD40 repeat-containing protein                          174   4e-65    
ref|XP_010447303.1|  PREDICTED: cell division cycle 20.2, cofacto...    180   4e-65    
ref|XP_010105065.1|  Anaphase-promoting complex subunit cdc20           177   4e-65    
ref|XP_002319120.1|  WD-40 repeat family protein                        180   4e-65    
ref|XP_008232468.1|  PREDICTED: cell division cycle 20.2, cofacto...    191   5e-65    
ref|XP_002325348.2|  WD-40 repeat family protein                        180   5e-65    
ref|XP_008337482.1|  PREDICTED: cell division cycle 20.1, cofacto...    181   5e-65    
ref|XP_010432586.1|  PREDICTED: cell division cycle 20.2, cofacto...    179   5e-65    
ref|XP_011038460.1|  PREDICTED: cell division cycle 20.2, cofacto...    180   5e-65    
ref|XP_006291118.1|  hypothetical protein CARUB_v10017230mg             178   6e-65    
ref|XP_010447264.1|  PREDICTED: cell division cycle 20.2, cofacto...    178   8e-65    
ref|XP_009842403.1|  hypothetical protein H257_15852                    175   8e-65    
ref|XP_004244418.1|  PREDICTED: cell division cycle 20.2, cofacto...    174   9e-65    
gb|KEH24293.1|  transducin family protein/WD-40 repeat protein          174   1e-64    
ref|XP_001775446.1|  predicted protein                                  167   1e-64    
ref|XP_004351048.1|  WD40 repeat-containing protein                     175   1e-64    
ref|XP_002520003.1|  cell division cycle, putative                      174   1e-64    
ref|XP_006291117.1|  hypothetical protein CARUB_v10017230mg             177   1e-64    
ref|XP_004149610.1|  PREDICTED: anaphase-promoting complex subuni...    175   1e-64    
ref|XP_010437783.1|  PREDICTED: cell division cycle 20.2, cofacto...    177   2e-64    
ref|XP_002271532.2|  PREDICTED: cell division cycle 20.2, cofacto...    182   2e-64    
ref|XP_009842404.1|  hypothetical protein, variant                      174   2e-64    
gb|EMT02024.1|  hypothetical protein F775_29940                         184   2e-64    
ref|XP_781780.2|  PREDICTED: cell division cycle protein 20 homolog     183   2e-64    
ref|XP_010650596.1|  PREDICTED: cell division cycle 20.2, cofacto...    182   2e-64    
emb|CBI17229.3|  unnamed protein product                                182   2e-64    
emb|CBI36686.3|  unnamed protein product                                182   2e-64    
ref|XP_008232469.1|  PREDICTED: cell division cycle 20.1, cofacto...    186   2e-64    
ref|XP_006396914.1|  hypothetical protein EUTSA_v10028650mg             177   2e-64    
ref|XP_005838926.1|  hypothetical protein GUITHDRAFT_102558             176   3e-64    
emb|CDP11766.1|  unnamed protein product                                177   3e-64    
ref|XP_006289977.1|  hypothetical protein CARUB_v10003607mg             179   3e-64    
ref|XP_008437508.1|  PREDICTED: cell division cycle 20.2, cofacto...    175   3e-64    
ref|XP_010662147.1|  PREDICTED: cell division cycle 20.2, cofacto...    180   3e-64    
ref|XP_009138177.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    180   3e-64    
ref|XP_009373598.1|  PREDICTED: cell division cycle 20.1, cofacto...    179   3e-64    
ref|XP_007029168.1|  Transducin family protein / WD-40 repeat fam...    174   3e-64    
ref|XP_010449766.1|  PREDICTED: cell division cycle 20.2, cofacto...    176   4e-64    
ref|XP_004145892.1|  PREDICTED: anaphase-promoting complex subuni...    175   4e-64    
ref|XP_003531791.1|  PREDICTED: cell division cycle 20.2, cofacto...    174   4e-64    
ref|XP_006283703.1|  hypothetical protein CARUB_v10004774mg             177   4e-64    
ref|XP_004171148.1|  PREDICTED: anaphase-promoting complex subuni...    174   5e-64    
ref|XP_007029169.1|  Transducin family protein / WD-40 repeat fam...    174   6e-64    
gb|KHG27991.1|  Anaphase-promoting complex subunit cdc20                171   6e-64    
ref|XP_007202056.1|  hypothetical protein PRUPE_ppa005800mg             184   7e-64    
gb|KHN38129.1|  Anaphase-promoting complex subunit cdc20                174   7e-64    
ref|XP_008241144.1|  PREDICTED: cell division cycle 20.1, cofacto...    181   1e-63    
ref|XP_008241143.1|  PREDICTED: cell division cycle 20.1, cofacto...    180   1e-63    
ref|XP_002524109.1|  cell division cycle, putative                      173   1e-63    
ref|XP_010437786.1|  PREDICTED: cell division cycle 20.2, cofacto...    176   2e-63    
emb|CAN74957.1|  hypothetical protein VITISV_029499                     179   2e-63    
ref|XP_008461771.1|  PREDICTED: cell division cycle 20.2, cofacto...    172   2e-63    
dbj|BAJ93401.1|  predicted protein                                      177   3e-63    
ref|XP_010547836.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    175   4e-63    
ref|XP_007151843.1|  hypothetical protein PHAVU_004G080000g             182   4e-63    
ref|XP_638150.1|  WD40 repeat-containing protein                        179   4e-63    
ref|XP_002089956.1|  GE21464                                            179   6e-63    
ref|XP_003578010.1|  PREDICTED: cell division cycle 20.2, cofacto...    173   7e-63    
ref|XP_002880798.1|  hypothetical protein ARALYDRAFT_344325             177   7e-63    
ref|XP_006373995.1|  WD-40 repeat family protein                        170   8e-63    
ref|XP_002038157.1|  GM18667                                            179   8e-63    
ref|XP_009362443.1|  PREDICTED: pentatricopeptide repeat-containi...    239   1e-62    
ref|NP_001062648.2|  Os09g0242300                                       176   1e-62    
gb|EEE69236.1|  hypothetical protein OsJ_28482                          176   1e-62    
ref|XP_003393065.1|  PREDICTED: cell division cycle protein 20 ho...    173   1e-62    
ref|XP_004334181.1|  WD domain, Gbeta repeat-containing protein         184   1e-62    
ref|XP_003492050.1|  PREDICTED: cell division cycle protein 20 ho...    173   1e-62    
ref|NP_477501.1|  fizzy                                                 178   2e-62    
ref|XP_006437020.1|  hypothetical protein CICLE_v10033745mg             169   2e-62    
gb|AAQ23567.1|  RE39287p                                                178   2e-62    
ref|XP_006361252.1|  PREDICTED: cell division cycle 20.1, cofacto...    168   2e-62    
gb|EMT13397.1|  hypothetical protein F775_16036                         175   2e-62    
gb|EZA55009.1|  Cell division cycle protein 20-like protein             174   2e-62    
ref|XP_001969041.1|  GG25203                                            177   2e-62    
ref|XP_009521389.1|  hypothetical protein PHYSODRAFT_483739             167   2e-62    
gb|EEC84142.1|  hypothetical protein OsI_30499                          175   3e-62    
ref|XP_011065627.1|  PREDICTED: cell division cycle protein 20 ho...    172   3e-62    
gb|EMS50178.1|  Anaphase-promoting complex subunit cdc20                175   4e-62    
gb|EPS69981.1|  cell division control 20                                171   5e-62    
gb|ELT92712.1|  hypothetical protein CAPTEDRAFT_152549                  177   5e-62    
ref|XP_009143919.1|  PREDICTED: cell division cycle 20.2, cofacto...    174   5e-62    
ref|XP_006828862.1|  hypothetical protein AMTR_s00001p00165480          239   7e-62    
ref|XP_624567.3|  PREDICTED: cell division cycle protein 20 homol...    171   7e-62    
ref|XP_003697924.1|  PREDICTED: cell division cycle protein 20 ho...    170   7e-62    
ref|XP_003707890.1|  PREDICTED: cell division cycle protein 20 ho...    171   7e-62    
ref|XP_006622956.1|  PREDICTED: cell division cycle protein 20 ho...    171   8e-62    
ref|XP_006622957.1|  PREDICTED: cell division cycle protein 20 ho...    171   8e-62    
ref|XP_006570781.1|  PREDICTED: cell division cycle protein 20 ho...    171   8e-62    
ref|XP_001962155.1|  GF14581                                            176   1e-61    
ref|XP_002064665.1|  GK23987                                            175   1e-61    
ref|XP_001357126.1|  GA18074                                            175   2e-61    
ref|XP_008896318.1|  hypothetical protein PPTG_04206                    164   2e-61    
gb|ETL82878.1|  hypothetical protein L917_17064                         164   2e-61    
gb|ETO64702.1|  hypothetical protein F444_17846                         164   2e-61    
ref|XP_007023263.1|  Transducin family protein / WD-40 repeat fam...    171   2e-61    
gb|ETL29656.1|  hypothetical protein L916_17231                         164   2e-61    
gb|ETM36111.1|  hypothetical protein L914_17134                         163   2e-61    
gb|ETK76218.1|  hypothetical protein L915_17338                         163   2e-61    
gb|ETI35983.1|  hypothetical protein F443_17809                         163   2e-61    
ref|XP_005109850.1|  PREDICTED: cell division cycle protein 20 ho...    179   2e-61    
ref|XP_002001863.1|  GI17076                                            172   2e-61    
ref|XP_010672535.1|  PREDICTED: cell division cycle 20.1, cofacto...    182   2e-61    
ref|XP_003576769.2|  PREDICTED: cell division cycle 20.5, cofacto...    176   3e-61    
ref|XP_008896319.1|  hypothetical protein, variant 2                    163   3e-61    
ref|XP_011004748.1|  PREDICTED: cell division cycle 20.2, cofacto...    165   3e-61    
gb|ETM36113.1|  hypothetical protein, variant 2                         163   3e-61    
gb|ETK76220.1|  hypothetical protein, variant 2                         163   4e-61    
gb|ETI35985.1|  hypothetical protein, variant 2                         163   4e-61    
gb|AAB63030.1|  WD-repeat protein                                       171   4e-61    
ref|XP_002051748.1|  GJ10640                                            173   5e-61    
ref|XP_001988920.1|  GH10315                                            175   5e-61    
gb|EPZ33907.1|  hypothetical protein O9G_002470                         173   7e-61    
gb|AES79047.2|  transducin family protein/WD-40 repeat protein          176   7e-61    
ref|XP_002176387.1|  predicted protein                                  167   8e-61    
ref|XP_002872290.1|  hypothetical protein ARALYDRAFT_489619             170   9e-61    
ref|XP_005707004.1|  cell division cycle 2, cofactor of APC complex     171   1e-60    
ref|NP_001154940.1|  fizzy                                              166   1e-60    
ref|XP_010276630.1|  PREDICTED: pentatricopeptide repeat-containi...    234   1e-60    
ref|XP_008213301.1|  PREDICTED: fizzy isoform X2                        166   1e-60    
ref|XP_008213300.1|  PREDICTED: fizzy isoform X1                        166   1e-60    
ref|XP_008552218.1|  PREDICTED: cell division cycle protein 20 ho...    168   1e-60    
ref|XP_002742040.1|  PREDICTED: cell division cycle protein 20 ho...    175   1e-60    
ref|XP_010466762.1|  PREDICTED: cell division cycle 20.1, cofacto...    178   1e-60    
ref|XP_010510434.1|  PREDICTED: cell division cycle 20.2, cofacto...    175   1e-60    
ref|XP_010510435.1|  PREDICTED: cell division cycle 20.2, cofacto...    175   2e-60    
emb|CBJ28300.1|  conserved unknown protein                              152   2e-60    
gb|KFP33157.1|  Cell division cycle protein 20                          176   2e-60    
ref|XP_010203719.1|  PREDICTED: cell division cycle protein 20 ho...    176   2e-60    
ref|NP_001190900.1|  cell division cycle 20.2, cofactor of APC co...    181   2e-60    
emb|CBJ48770.1|  Putative cell division cycle 20. Subunit or the ...    167   2e-60    
ref|XP_009032332.1|  hypothetical protein AURANDRAFT_70027              162   3e-60    
ref|XP_010473977.1|  PREDICTED: cell division cycle 20.2, cofacto...    180   3e-60    
gb|EHJ68575.1|  fizzy                                                   169   9e-60    
gb|ETN60906.1|  WD repeat-containing protein slp1                       173   1e-59    
ref|XP_002971777.1|  hypothetical protein SELMODRAFT_96029              227   1e-59    
ref|XP_005535112.1|  cell cycle switch protein                          160   2e-59    
emb|CCI43869.1|  unnamed protein product                                166   2e-59    
ref|XP_004533287.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    167   2e-59    
ref|XP_005181817.1|  PREDICTED: cell division cycle protein 20 ho...    169   2e-59    
gb|ABD32462.1|  Cdc20/Fizzy; WD40-like                                  169   2e-59    
gb|KDO57689.1|  hypothetical protein CISIN_1g019847mg                   219   2e-59    
ref|XP_008879711.1|  hypothetical protein H310_13841                    162   3e-59    
ref|XP_008798701.1|  PREDICTED: cell division cycle 20.2, cofacto...    172   3e-59    
gb|EFN82859.1|  Cell division cycle protein 20-like protein             165   3e-59    
gb|KFM67417.1|  Cell division cycle protein 20-like protein             167   4e-59    
gb|EYU23270.1|  hypothetical protein MIMGU_mgv1a006755mg                167   4e-59    
ref|XP_310009.4|  AGAP009338-PA                                         173   4e-59    
ref|XP_010552481.1|  PREDICTED: cell division cycle 20.2, cofacto...    171   4e-59    
ref|XP_010552482.1|  PREDICTED: cell division cycle 20.2, cofacto...    171   4e-59    
ref|XP_002114324.1|  hypothetical protein TRIADDRAFT_58017              169   4e-59    
ref|XP_010510479.1|  PREDICTED: cell division cycle 20.2, cofacto...    175   5e-59    
gb|EFW39620.2|  Fzr1 protein                                            172   5e-59    
gb|EFN61970.1|  Cell division cycle protein 20-like protein             160   5e-59    
ref|XP_004365016.1|  Fzr1 protein                                       171   5e-59    
ref|XP_011092602.1|  PREDICTED: cell division cycle 20.1, cofacto...    162   5e-59    
gb|KFB39029.1|  hypothetical protein ZHAS_00006739                      171   5e-59    
ref|XP_010510471.1|  PREDICTED: cell division cycle 20.2, cofacto...    174   6e-59    
ref|XP_002136520.1|  GA29186                                            169   7e-59    
gb|KDD73409.1|  hypothetical protein H632_c2205p0                       165   7e-59    
emb|CBK25119.2|  unnamed protein product                                158   9e-59    
ref|XP_010510480.1|  PREDICTED: cell division cycle 20.2, cofacto...    174   1e-58    
ref|XP_010911345.1|  PREDICTED: cell division cycle 20.2, cofacto...    170   1e-58    
ref|XP_010510481.1|  PREDICTED: cell division cycle 20.2, cofacto...    174   1e-58    
ref|XP_969612.1|  PREDICTED: cell division cycle protein 20 homolog     169   1e-58    
ref|XP_008645183.1|  PREDICTED: pentatricopeptide repeat-containi...    218   1e-58    
ref|XP_010048631.1|  PREDICTED: cell division cycle 20.1, cofacto...    166   1e-58    
ref|XP_002971208.1|  hypothetical protein SELMODRAFT_94745              224   1e-58    
ref|XP_002134509.1|  GA22332                                            169   2e-58    
ref|XP_009840020.1|  hypothetical protein H257_14008                    155   2e-58    
ref|XP_010473513.1|  PREDICTED: pentatricopeptide repeat-containi...    226   2e-58    
gb|EJK63225.1|  hypothetical protein THAOC_16131                        153   2e-58    
ref|XP_008485604.1|  PREDICTED: cell division cycle protein 20 ho...    168   2e-58    
ref|XP_009362435.1|  PREDICTED: pentatricopeptide repeat-containi...    226   3e-58    
ref|XP_005437410.1|  PREDICTED: cell division cycle protein 20 ho...    169   4e-58    
ref|XP_005238487.1|  PREDICTED: cell division cycle protein 20 ho...    169   5e-58    
ref|XP_006382397.1|  hypothetical protein POPTR_0005s01750g             219   5e-58    
emb|CDY44519.1|  BnaCnng11300D                                          175   6e-58    
ref|XP_001747841.1|  hypothetical protein                               171   8e-58    
ref|XP_004346004.1|  Cdc20, putative                                    178   8e-58    
ref|XP_003801258.1|  PREDICTED: cell division cycle protein 20 ho...    163   9e-58    
gb|KFM27081.1|  Cell division cycle protein 20-like protein             152   9e-58    
ref|XP_009060982.1|  hypothetical protein LOTGIDRAFT_193514             160   9e-58    
ref|XP_007526147.1|  PREDICTED: cell division cycle protein 20 ho...    164   1e-57    
ref|XP_010028496.1|  PREDICTED: pentatricopeptide repeat-containi...    225   1e-57    
ref|XP_001732748.1|  hypothetical protein MGL_0523                      174   1e-57    
ref|XP_003767263.1|  PREDICTED: cell division cycle protein 20 ho...    165   1e-57    
ref|XP_009900237.1|  PREDICTED: cell division cycle protein 20 ho...    168   1e-57    
ref|NP_001006536.1|  cell division cycle protein 20 homolog             167   1e-57    
emb|CCA23239.1|  cell division cycle protein 20 putative                160   1e-57    
ref|XP_011036957.1|  PREDICTED: pentatricopeptide repeat-containi...    224   1e-57    
ref|XP_001865054.1|  WD repeat-containing protein slp1                  166   1e-57    
ref|XP_011038920.1|  PREDICTED: pentatricopeptide repeat-containi...    224   2e-57    
ref|NP_001079443.1|  cell division cycle 20 homolog                     165   2e-57    
ref|XP_001625800.1|  predicted protein                                  160   2e-57    
gb|KFV11700.1|  Cell division cycle protein 20                          166   2e-57    
ref|XP_010048734.1|  PREDICTED: cell division cycle 20.2, cofacto...    166   2e-57    
ref|XP_005791451.1|  hypothetical protein EMIHUDRAFT_417498             156   3e-57    
ref|NP_988945.1|  cell division cycle 20                                167   3e-57    
gb|KFK29937.1|  hypothetical protein AALP_AA7G197700                    154   3e-57    
gb|KFU96364.1|  Cell division cycle protein 20                          165   3e-57    
gb|ACE87227.1|  cell division cycle 20 homolog (S. cerevisiae) pr...    162   3e-57    
gb|KDO44671.1|  hypothetical protein CISIN_1g038622mg                   221   3e-57    
ref|XP_010077388.1|  PREDICTED: cell division cycle protein 20 ho...    166   3e-57    
gb|AGH55821.1|  Cdc20C                                                  169   3e-57    
ref|XP_010714520.1|  PREDICTED: cell division cycle protein 20 ho...    166   3e-57    
ref|XP_010431704.1|  PREDICTED: pentatricopeptide repeat-containi...    216   3e-57    
ref|XP_002961595.1|  hypothetical protein SELMODRAFT_76510              221   3e-57    
ref|XP_010370177.1|  PREDICTED: cell division cycle protein 20 ho...    161   3e-57    
ref|XP_002810983.1|  PREDICTED: cell division cycle protein 20 ho...    161   3e-57    
ref|NP_001248046.1|  cell division cycle protein 20 homolog             161   3e-57    
ref|XP_001363768.2|  PREDICTED: cell division cycle protein 20 ho...    163   4e-57    
ref|XP_004921737.1|  PREDICTED: cell division cycle protein 20 ho...    160   4e-57    
ref|XP_010943639.1|  PREDICTED: cell division cycle 20.2, cofacto...    164   4e-57    
gb|KGL93035.1|  Cell division cycle protein 20                          164   4e-57    
ref|XP_008056274.1|  PREDICTED: cell division cycle protein 20 ho...    161   4e-57    
ref|XP_007042371.1|  Tetratricopeptide repeat (TPR)-like superfam...    223   4e-57    
gb|AAA19017.1|  p55CDC                                                  161   4e-57    
gb|AAH00624.1|  CDC20 protein                                           160   4e-57    
gb|ENN73820.1|  hypothetical protein YQE_09598                          164   4e-57    
ref|NP_001246.2|  cell division cycle protein 20 homolog                160   4e-57    



>ref|XP_009759176.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Nicotiana sylvestris]
Length=764

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/715 (65%), Positives = 557/715 (78%), Gaps = 9/715 (1%)
 Frame = +3

Query  156   SHCLSTLSQLFSPPSTAAAASQLFSGPSnaaaaaaaddndaKLPDVAKPKLSSRKKALAL  335
             SH LSTLSQLFS  +         + P+           +           S  K A  +
Sbjct  37    SHPLSTLSQLFSKQT---------ANPTKTNKPKNGKQLNNPPKPKPSSCSSKSKTAANM  87

Query  336   AELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ  515
             A LI    WS   ESSLS+L  PSLS TTV+H++R +K P KAL FF W ++ GF+ T Q
Sbjct  88    ANLINTNIWSSNLESSLSSLTQPSLSHTTVLHTLRFIKKPSKALNFFNWTQKLGFSHTHQ  147

Query  516   CYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLF  695
              YF ML+LLG  RNLN+ARNFLFSIP RSNG VPL+ ++FN+LI++Y  AGLFQESLK+F
Sbjct  148   SYFLMLQLLGNARNLNSARNFLFSIPTRSNGTVPLQDKYFNTLIRSYGKAGLFQESLKVF  207

Query  696   TSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCM  875
              +MK +GISPSVVTFN+LF+IL+KRGRTGMVY+LFDEMLKT+G KPD YTFNILIRG CM
Sbjct  208   KTMKSLGISPSVVTFNSLFTILLKRGRTGMVYDLFDEMLKTYGAKPDSYTFNILIRGFCM  267

Query  876   NSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNV  1055
             NSMVDQGFRFFKEME+HECEPDVITYNTI+DGLCRAGKV+IAHNV+KGM+K+G  LSPNV
Sbjct  268   NSMVDQGFRFFKEMERHECEPDVITYNTIIDGLCRAGKVKIAHNVLKGMVKRGHQLSPNV  327

Query  1056  VTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKG  1235
             V+YTTLVRGYCEKQ+VE AL+VFKEM+D G +P S+TYNTL+QGL EA+KFD++KE+ + 
Sbjct  328   VSYTTLVRGYCEKQEVEHALDVFKEMIDLGLKPTSITYNTLVQGLCEAQKFDRIKEILER  387

Query  1236  AGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKG  1415
                 GRF+PDTCTFNTLI  HC+ GNL  +++ FE MS L   PDSATYSILIR  CQKG
Sbjct  388   TLGGGRFIPDTCTFNTLITYHCNVGNLDESMKVFESMSDLKVKPDSATYSILIRSFCQKG  447

Query  1416  DFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQ  1595
              F+ AEK FD+L KT  LL D GC+P+VAAYNP+F++LC+ GKTKKAEKVFRQLMR G Q
Sbjct  448   YFDRAEKLFDKLMKTEVLLCDDGCKPLVAAYNPLFEHLCKIGKTKKAEKVFRQLMRRGTQ  507

Query  1596  DPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTL  1775
             DPL ++ LIMG+  E    D HELLV MLRR++VPD E YESL+EGLLQ+  P++AYDTL
Sbjct  508   DPLAYRILIMGHCRESTFNDAHELLVLMLRRDYVPDIEIYESLIEGLLQKNDPKVAYDTL  567

Query  1776  ERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKA  1955
             ERMLKSSHLPR   FH ILTEL+K+NC +ECA LV LML  K+RQ+I+LSTDTVRILF+ 
Sbjct  568   ERMLKSSHLPRASTFHQILTELIKKNCTIECASLVKLMLDNKVRQSISLSTDTVRILFQT  627

Query  1956  GLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTV  2135
             GL+ER FEI+ CLY+NGY+VNM+ L+V L Q +KL EARDLLLFSL     + ++ CSTV
Sbjct  628   GLRERGFEIVRCLYENGYMVNMEGLVVSLCQCRKLLEARDLLLFSLSKDHILNVDTCSTV  687

Query  2136  LSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
             LSALCKA RA EAFE+YYEL+E+ ++ PL CLE+L L LE EGR+KEAEFV KR+
Sbjct  688   LSALCKARRASEAFEMYYELLEKGVQQPLKCLEELGLVLETEGRTKEAEFVKKRI  742



>ref|XP_009599439.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Nicotiana tomentosiformis]
Length=765

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/715 (64%), Positives = 554/715 (77%), Gaps = 9/715 (1%)
 Frame = +3

Query  156   SHCLSTLSQLFSPPSTAAAASQLFSGPSnaaaaaaaddndaKLPDVAKPKLSSRKKALAL  335
             SH LSTLSQLF+  +         + P+           +      +    S  K A  +
Sbjct  38    SHPLSTLSQLFTKQT---------ANPTKTNKPKNGKQLNNPPKPKSSSSSSKSKTAANM  88

Query  336   AELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ  515
             A LI    WS   ESSLS+L  PSLS TTV+H++R +K P KAL FF W ++ GF+ T Q
Sbjct  89    ANLINTNTWSSNLESSLSSLTQPSLSHTTVLHTLRFIKKPSKALHFFNWTQKLGFSHTHQ  148

Query  516   CYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLF  695
              YF ML+LLG  RNLN+ARNFLFSIP RS   VPL+ ++FN+LI++Y  AGLFQESLK+F
Sbjct  149   SYFLMLQLLGNARNLNSARNFLFSIPTRSKTTVPLQDKYFNTLIRSYGKAGLFQESLKVF  208

Query  696   TSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCM  875
              +MK +GISPSVVTFN+LFSIL+KRGRTGMVY+LFDEMLKT+G KPDLYTFNILIRG CM
Sbjct  209   KTMKSLGISPSVVTFNSLFSILLKRGRTGMVYDLFDEMLKTYGAKPDLYTFNILIRGFCM  268

Query  876   NSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNV  1055
             NSMVDQGFRFFKEME+HECEPDVITYNTI+DGLCRAGK  IAHNV+KGM+K+G  LSPNV
Sbjct  269   NSMVDQGFRFFKEMERHECEPDVITYNTIIDGLCRAGKARIAHNVLKGMVKRGHQLSPNV  328

Query  1056  VTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKG  1235
             V+YTTLVRGYCEKQ+VE AL+VFKEM+D G +P S+TYNTL+QGL EA+KFD++KE+ +G
Sbjct  329   VSYTTLVRGYCEKQEVEHALDVFKEMIDLGLKPTSITYNTLVQGLCEAQKFDRIKEILEG  388

Query  1236  AGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKG  1415
                 G F+PDTCTFNTLI  H + GNL  A++ FE MS L   PDSATYSILIR  CQKG
Sbjct  389   TLGGGGFIPDTCTFNTLITCHWNAGNLDEAMKVFESMSDLKVKPDSATYSILIRSFCQKG  448

Query  1416  DFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQ  1595
              F+ A K FDEL KT  LL D GC+PVVAAYN MF++LC+ GKTKKAEKVFRQLMR G Q
Sbjct  449   YFDRALKLFDELKKTDVLLCDDGCKPVVAAYNLMFEHLCKIGKTKKAEKVFRQLMRRGTQ  508

Query  1596  DPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTL  1775
             DPL ++ LIMG+  EG   D HELLV MLR+++VPD E YESL++GLLQ+  P++AYDTL
Sbjct  509   DPLAYRILIMGHCREGTFNDAHELLVLMLRKDYVPDIEIYESLIKGLLQKNDPKVAYDTL  568

Query  1776  ERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKA  1955
             E+MLKSSHLPR+  FH ILTEL+K+NCA ECA LV LML  K+RQ+I+LSTDTVRIL + 
Sbjct  569   EKMLKSSHLPRSSTFHQILTELIKKNCASECASLVKLMLDNKVRQSISLSTDTVRILCQT  628

Query  1956  GLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTV  2135
             GL+ERAFEI+ CLY+NGY+VNM+ L+V L Q +KL EAR+LLLFSL     + ++ CST+
Sbjct  629   GLRERAFEIVRCLYENGYMVNMEGLVVSLCQCRKLLEARELLLFSLSKDHILNVDTCSTL  688

Query  2136  LSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
             LSALCKA RA EAFE+YYEL+E+ ++ PL CLE+L L LE EGR+KEAEFV KR+
Sbjct  689   LSALCKARRASEAFEIYYELLEKGVQQPLKCLEELGLVLETEGRTKEAEFVKKRI  743



>ref|XP_006358175.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like isoform X1 [Solanum tuberosum]
Length=718

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/660 (67%), Positives = 532/660 (81%), Gaps = 0/660 (0%)
 Frame = +3

Query  324   ALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFA  503
             A  +A +I   PWS   ESSLS+L  PSLS TTV+H++R +K P KAL FF W ++ GF 
Sbjct  56    ARNIASIINTNPWSSHLESSLSSLTQPSLSHTTVLHTLRFIKIPFKALYFFNWTQKMGFQ  115

Query  504   LTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQES  683
              T Q Y  ML+LLG+ R+LN+ARNFL SIP+RSNG VPL+ R+FN+LI++Y  AGLFQES
Sbjct  116   HTHQSYLLMLQLLGSSRSLNSARNFLLSIPRRSNGTVPLQDRYFNTLIQSYGKAGLFQES  175

Query  684   LKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIR  863
             LK+F  MK +GISPSVVTFN+LFSIL+KRGRTGMVYELFDEMLKTFG KPD+YTFNILIR
Sbjct  176   LKVFKVMKSLGISPSVVTFNSLFSILLKRGRTGMVYELFDEMLKTFGAKPDVYTFNILIR  235

Query  864   GCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDL  1043
             G CMNSMVD+GFRFFKEME+HECEPDVITYNTIVDGLCRAGKVEIAHNV+KGM+K+G  L
Sbjct  236   GFCMNSMVDKGFRFFKEMERHECEPDVITYNTIVDGLCRAGKVEIAHNVLKGMVKRGHQL  295

Query  1044  SPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKE  1223
             SPNVV+YTTLVRGYCEKQ+VE AL+VF+EM+D G +P S+TYNTL+QGL EA++FD++KE
Sbjct  296   SPNVVSYTTLVRGYCEKQEVERALDVFEEMIDCGLKPTSITYNTLVQGLCEAKRFDRIKE  355

Query  1224  LFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCL  1403
             + +G    G  +PDTCTFNTLI  HC+ GNL  A++ FE M  L   PDSATYSILIR  
Sbjct  356   ILEGTLGSGGLIPDTCTFNTLITFHCNVGNLDEAVKVFENMLYLKVKPDSATYSILIRSF  415

Query  1404  CQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMR  1583
             CQKG F+ AEK FD+L K   LL D GC P++AAYNPMF+Y C+ GKTKKAEKVFRQLMR
Sbjct  416   CQKGYFDRAEKLFDDLMKKEILLRDDGCTPLIAAYNPMFEYFCKIGKTKKAEKVFRQLMR  475

Query  1584  MGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLA  1763
              G QDP  ++ LIMG+  EG   D HELLV MLRR++VP+   YESL+EGLLQ+  P++A
Sbjct  476   RGTQDPFAYELLIMGHCKEGTFNDAHELLVLMLRRDYVPNIVIYESLIEGLLQKNDPKVA  535

Query  1764  YDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRI  1943
             YDTLE+MLKSSHLPR+  FH ILTEL+K+NCA ECA LV LML  K+RQNINLSTDTVRI
Sbjct  536   YDTLEKMLKSSHLPRSSTFHQILTELIKKNCASECASLVTLMLDNKVRQNINLSTDTVRI  595

Query  1944  LFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEI  2123
             LF+AGL+ERAFEI+ CLY+N Y+V+M+ L+ FL Q +KL EA  LLLFS      + ++ 
Sbjct  596   LFQAGLRERAFEIVRCLYENEYVVDMEGLVAFLCQCRKLLEACKLLLFSSSKGHILNVDT  655

Query  2124  CSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMP  2303
             CST+LSALCKA R  EAFE+YYEL+E+ ++ PL C+E+L L LE EGR+KEAEFV KR+P
Sbjct  656   CSTLLSALCKASRTLEAFEIYYELLEKGVQQPLECVEELGLALETEGRTKEAEFVKKRIP  715



>ref|XP_004235443.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Solanum lycopersicum]
Length=710

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/660 (66%), Positives = 532/660 (81%), Gaps = 0/660 (0%)
 Frame = +3

Query  324   ALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFA  503
             A  +A +I   PWS   ESSLS++  PSLS TTV+H++R +K P KAL FF W ++ GF 
Sbjct  50    ARKIATIINTNPWSSHLESSLSSITQPSLSHTTVLHTLRFIKIPSKALYFFNWTQKMGFQ  109

Query  504   LTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQES  683
              T Q Y  ML+LLG+ R+LN+ARNFL SIP+RSNGAVPL+ R+FN+LI++Y  AGLFQES
Sbjct  110   HTHQSYLLMLQLLGSSRSLNSARNFLLSIPRRSNGAVPLQDRYFNTLIQSYGKAGLFQES  169

Query  684   LKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIR  863
             LK+F  MK +GISPSVVTFN+LF+IL+KRGRTGMVYELFDEMLKTFG KPD+YTFNILIR
Sbjct  170   LKVFKVMKSLGISPSVVTFNSLFTILLKRGRTGMVYELFDEMLKTFGAKPDVYTFNILIR  229

Query  864   GCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDL  1043
             G C+NSMVD+GFRFFKEME+HECEP+VITYNTIVDGLCRAGKVEIAHNV+KGM K+G  L
Sbjct  230   GFCINSMVDKGFRFFKEMERHECEPNVITYNTIVDGLCRAGKVEIAHNVLKGMAKRGHQL  289

Query  1044  SPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKE  1223
             SPNVV+YTTLVRGYCEKQ+VE AL+VF+EM+DRG +P S+TYNTL+QGL EA++FD++KE
Sbjct  290   SPNVVSYTTLVRGYCEKQEVERALDVFEEMIDRGLKPTSITYNTLVQGLCEAKRFDRIKE  349

Query  1224  LFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCL  1403
             + +G    G  +PDTCTFNTLI  HC+ GNL  A++ FE M  L   PDSATYSILIR  
Sbjct  350   ILEGTLGSGGLIPDTCTFNTLITYHCNVGNLDEAVKVFENMLYLKVKPDSATYSILIRSF  409

Query  1404  CQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMR  1583
             CQKG F+ AEK FD+L K   LL D GC P++AAYNPMF+Y C+ GKTKKAEKVFRQLMR
Sbjct  410   CQKGYFDRAEKLFDDLMKKEVLLRDDGCTPLIAAYNPMFEYFCKIGKTKKAEKVFRQLMR  469

Query  1584  MGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLA  1763
              G QDP  ++ LI G+  EG   D H LLV MLRR++VP+   YESL+EGLLQ+  P++A
Sbjct  470   RGTQDPFAYELLIRGHCKEGTFNDAHGLLVLMLRRDYVPNIVIYESLIEGLLQKNDPKVA  529

Query  1764  YDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRI  1943
             YDTLE+MLKSSHLPR+ ++H ILTEL+K+NCA ECA LV LML  K+RQNINLSTDTV+I
Sbjct  530   YDTLEKMLKSSHLPRSSIYHQILTELIKKNCASECASLVTLMLDNKVRQNINLSTDTVKI  589

Query  1944  LFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEI  2123
             LF+ GL+ERAFEI+ CLY+N Y+V+M+ L+ FL Q +KL EA  LLLFSL     + ++ 
Sbjct  590   LFQTGLRERAFEIVRCLYENEYVVDMEGLVAFLCQRRKLLEACKLLLFSLSKGHILNVDT  649

Query  2124  CSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMP  2303
             CST+LSALCKA RA EAFE+YYEL+E+ ++ PL C+E+L L LE EGR KEAEFV KR+P
Sbjct  650   CSTLLSALCKARRASEAFEIYYELLEKGVQQPLECIEELGLALETEGRIKEAEFVKKRIP  709



>ref|XP_002266503.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Vitis vinifera]
 ref|XP_010650422.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Vitis vinifera]
Length=746

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/678 (62%), Positives = 530/678 (78%), Gaps = 3/678 (0%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKG  497
             K++ A+A LI  +PWS + +SSL+ LA     +TTV+ +++L++TP KAL FF W E KG
Sbjct  64    KRSQAMARLINTEPWSHELQSSLAELAPSLS-KTTVLQTLQLIRTPAKALHFFRWVEAKG  122

Query  498   FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQ  677
             F    Q YF M+E+LG  RNLN ARNF+FSI K+S GAV L  RFFNSLI++Y  AGLFQ
Sbjct  123   FTHNEQSYFLMIEILGRSRNLNAARNFVFSIEKKSGGAVKLGDRFFNSLIRSYGWAGLFQ  182

Query  678   ESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNIL  857
             ES+K+F +MK IG+SPSVVTFN+L SI++KRGRT M  +LFDEML T+GV PD YTFNIL
Sbjct  183   ESIKVFKTMKEIGVSPSVVTFNSLLSIVLKRGRTSMAKQLFDEMLDTYGVTPDTYTFNIL  242

Query  858   IRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGS  1037
             IRG CMNSMVD+GF FFKEM + +C+PDV+TYNT+VDGLCRAGKV+IAHNVVKGM+KK  
Sbjct  243   IRGFCMNSMVDEGFWFFKEMSRFKCDPDVVTYNTLVDGLCRAGKVKIAHNVVKGMVKKSP  302

Query  1038  DLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKV  1217
             +LSPNVVTYTTL+RGYC KQ + EAL++  EMV RG +PN +TYNTLIQGL EA+K DK+
Sbjct  303   NLSPNVVTYTTLIRGYCMKQDMAEALSLLAEMVSRGLKPNKITYNTLIQGLCEAQKLDKI  362

Query  1218  KELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIR  1397
             KE+ +G   DG F+PDTCT NTLI  HC+ G L+ A   FEKMS L   PDSATYS+L+R
Sbjct  363   KEILEGMVGDGGFIPDTCTLNTLIKAHCTMGKLEEAFSVFEKMSELRVQPDSATYSVLVR  422

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQL  1577
              LCQ+GDF  AE+FFDEL +   LL D GC+P+VAAYNPMF+YLC NGKTKKAE+VFRQL
Sbjct  423   SLCQRGDFRRAEEFFDELAEKEILLHDVGCKPLVAAYNPMFEYLCSNGKTKKAERVFRQL  482

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
             M+ G QDP ++KTLI+G+  EG  E G +LLV MLRR+FVPD ETY  +++GLL++G P 
Sbjct  483   MKRGTQDPPSYKTLILGHCREGTPEAGFDLLVLMLRRDFVPDAETYGLMIDGLLKKGDPV  542

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
             LA+ +LE+MLKSSHLP T +FHSIL  LV++ CA E A LV LML ++IRQNI+LST TV
Sbjct  543   LAHKSLEKMLKSSHLPTTAIFHSILAALVEKGCAHESASLVKLMLERRIRQNIDLSTHTV  602

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
             R+L+K+GL+++AF  +G LY+NGYLV M+EL+ FL Q +KL EA+ +LLFSL+  QSV I
Sbjct  603   RLLYKSGLQDKAFMTIGLLYENGYLVKMEELVSFLCQSRKLLEAQKMLLFSLEKRQSVDI  662

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
             ++CSTV+S LCKA +  EAF LYYELVE+ ++  L C EDLR+ LE EGR  EA+FV+K+
Sbjct  663   DMCSTVISGLCKAHKVSEAFALYYELVEKGMQHRLTCQEDLRISLEAEGRLNEAKFVSKK  722

Query  2298  MPRL--EGALDYIGPRIT  2345
             MP +  +   D  GP+++
Sbjct  723   MPEVPKQWQSDRTGPKVS  740



>emb|CDP13864.1| unnamed protein product [Coffea canephora]
Length=751

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/661 (61%), Positives = 526/661 (80%), Gaps = 4/661 (1%)
 Frame = +3

Query  321   KALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGF  500
             +A  +A LI  +PWS   ++SL+  +     +TTV+ ++RL+ TP KAL FF WA + GF
Sbjct  70    RARTMARLINARPWSTDLQASLAQSSLS---QTTVLQTLRLITTPAKALHFFHWAHKSGF  126

Query  501   ALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQE  680
               T Q YF MLELL   RN N+ARNFL SIP++SNGAV LE + FN LI+ +  AGLF+E
Sbjct  127   THTPQSYFLMLELLCQARNFNSARNFLLSIPRKSNGAVQLEDKHFNCLIRAFGEAGLFKE  186

Query  681   SLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILI  860
             SLK+F +MK IG+SPSV+TFN LFSIL+KRGRTGMV+ELFDEML+T+GV+PDLY+FNILI
Sbjct  187   SLKIFKTMKSIGVSPSVITFNHLFSILLKRGRTGMVFELFDEMLETYGVEPDLYSFNILI  246

Query  861   RGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSD  1040
             RG C NSMVD+GFRFFK+MEK  C+PDVITYNTI+DGLC+ G+V+IAHNV+KGML KG +
Sbjct  247   RGFCKNSMVDEGFRFFKKMEKFNCQPDVITYNTIIDGLCKDGRVKIAHNVMKGMLNKGPN  306

Query  1041  LSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVK  1220
             LSPN+VTYTTL+RGYCEK +++EAL+VF+E+  RG +PN +T NTL+QGL EAR  +KVK
Sbjct  307   LSPNIVTYTTLIRGYCEKLEIDEALDVFEEIACRGLKPNEITCNTLVQGLCEARMLNKVK  366

Query  1221  ELFKG-AGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIR  1397
             E+  G  GE+G FVPDTCTFNTL++ HCSDGNL    + F+KMS L   PDSATYS+LIR
Sbjct  367   EILDGCGGENGGFVPDTCTFNTLMNAHCSDGNLDGVFKIFQKMSELKVHPDSATYSMLIR  426

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQL  1577
               C+KG+FE AE  F EL++   LL DAGC P+VA+YNPMF+YL ++GKT+ AEKVF+QL
Sbjct  427   SFCEKGNFEKAEGLFRELYEKEILLHDAGCTPLVASYNPMFRYLTQSGKTEMAEKVFKQL  486

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
             ++ G QD   FKT++MG+  EG  +   E+LV MLRR+FVPDFETYESL+EGLL++ +P 
Sbjct  487   LKRGRQDASAFKTIMMGHCREGTVKAAFEILVLMLRRDFVPDFETYESLIEGLLEKDEPI  546

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
             LA++TLE+MLKSSHLPRT +FH  L  LV + CA E   +++LML KKIR N+N++TDTV
Sbjct  547   LAHETLEKMLKSSHLPRTSIFHRTLARLVNKGCAHESFSMLMLMLEKKIRHNLNIATDTV  606

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
              +LFKAG++++AFE++ CLY++GY++NM+ELI+FL + +KL EAR++LLF  K  Q V +
Sbjct  607   NVLFKAGMRDKAFEVVRCLYEHGYIINMEELIIFLCKQRKLLEAREMLLFGTKKGQRVDL  666

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
              +C+TVL+ LCK  R  EAFELYYEL+E+ I+ PL+CL++LR+ LE EGRSKEAEFV+KR
Sbjct  667   GVCNTVLNGLCKIKRVNEAFELYYELLEQGIQQPLSCLQELRVALEAEGRSKEAEFVSKR  726

Query  2298  M  2300
             M
Sbjct  727   M  727



>ref|XP_007052225.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOX96382.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=724

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/671 (62%), Positives = 520/671 (77%), Gaps = 2/671 (0%)
 Frame = +3

Query  297   KPKLSSR-KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKF  473
             K K S++ K+A ++A +I   PWS     S  +   PSLS+TTV+ ++RL+K P KAL+F
Sbjct  51    KAKSSTKTKRAKSMARVINSTPWS-SELESSLSSLSPSLSKTTVLQTLRLIKAPSKALQF  109

Query  474   FVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKN  653
             F W ++ GF   +Q +F +LE+LG ERNLN ARN L SI KRSNG+V LE +FFNSLI++
Sbjct  110   FDWVQKMGFPHNAQSFFLILEILGKERNLNAARNLLLSIEKRSNGSVKLEDQFFNSLIRS  169

Query  654   YAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKP  833
             Y  AGLFQES+K+F +MK IG+SPSVV+FN L  IL+KRGRT M   +FDEML T+GV P
Sbjct  170   YGKAGLFQESIKVFETMKGIGVSPSVVSFNNLLMILLKRGRTNMAKSVFDEMLSTYGVSP  229

Query  834   DLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVV  1013
             D+YTFNILIRG CMNSMVD+GFRFFKEME+ +C+PDV+TYNTIVDGLCRAGKV IA NVV
Sbjct  230   DVYTFNILIRGFCMNSMVDEGFRFFKEMERFKCDPDVVTYNTIVDGLCRAGKVGIARNVV  289

Query  1014  KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLL  1193
             +GM KK  DL+PNVVTYTTLVRGYC KQ+++EAL VFKEM+ R   PN +TYNTLI+GL 
Sbjct  290   RGMSKKSLDLNPNVVTYTTLVRGYCMKQEIDEALVVFKEMISRRLRPNRITYNTLIKGLS  349

Query  1194  EARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDS  1373
             E  +++K+KE+ +G GEDGRFVPDTCT NTLI+ HC+  N+  AL  F++MS LN  PDS
Sbjct  350   EVHEYEKIKEILEGMGEDGRFVPDTCTLNTLINAHCNAENMDEALNVFKRMSELNVLPDS  409

Query  1374  ATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKK  1553
             ATYS++IR LCQ+GDFE AE+FFDEL +   LLSD GC P+VAAYNPMF+YLC NGKTKK
Sbjct  410   ATYSVIIRSLCQRGDFEKAEEFFDELAEKEILLSDVGCTPLVAAYNPMFEYLCGNGKTKK  469

Query  1554  AEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEG  1733
             AE VFRQLM+ G QDP  +KTLI+G+  EG  +DG+ELLV MLRR+F P FE Y+SL+ G
Sbjct  470   AEIVFRQLMKRGRQDPPAYKTLILGHCREGTFKDGYELLVLMLRRDFEPGFEIYDSLICG  529

Query  1734  LLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQN  1913
             LLQ+G+P LA+ TLE+MLKSSHLP+T   HSIL EL+K++CA E A LV LML  +IRQN
Sbjct  530   LLQKGEPLLAHLTLEKMLKSSHLPQTSSVHSILAELLKKSCAQEAASLVTLMLDTRIRQN  589

Query  1914  INLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSL  2093
             +NLST T ++LF   L+++AF+I+G LYDNGY+V M+EL+ FL Q  KL EA  +L FSL
Sbjct  590   VNLSTQTAKLLFARRLQDKAFQIIGLLYDNGYVVEMEELVGFLCQSGKLLEACKMLQFSL  649

Query  2094  KNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSK  2273
             +  +SV IE+CS V+  LC + R  EAF LYYELVER     L CLE+L++ LE  GR  
Sbjct  650   EKHKSVDIEMCSMVIEGLCNSKRLSEAFGLYYELVERGKHQQLRCLENLKIALEAGGRLD  709

Query  2274  EAEFVAKRMPR  2306
             EAEFV+KRMP+
Sbjct  710   EAEFVSKRMPK  720



>ref|XP_007219156.1| hypothetical protein PRUPE_ppa016282mg, partial [Prunus persica]
 gb|EMJ20355.1| hypothetical protein PRUPE_ppa016282mg, partial [Prunus persica]
Length=721

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/710 (60%), Positives = 524/710 (74%), Gaps = 6/710 (1%)
 Frame = +3

Query  204   AAAASQLFSGPSnaaaaaaaddndaKLPDVAKPKLSSRKKALALAELIKFQPWSPQTEss  383
             A    QLFS PS  + +       AK P  + PK    K A  +A L+    WS     S
Sbjct  13    AVFRKQLFS-PSLKSNSQPDSFLRAKQPKSSTPK---TKTAKDMARLVNTNTWS-SELES  67

Query  384   lsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLN  563
               +    SLS+TTV  ++ L+KTP KAL+FF W E  GF+   Q YF MLE+LG  RNLN
Sbjct  68    SLSTISSSLSKTTVHQTLHLIKTPHKALQFFKWVEVMGFSHNDQSYFLMLEILGRARNLN  127

Query  564   TARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFN  743
              ARN LFSI KRSNGAV LE RFFNSLI+NY  AGLFQES+KLFT+MK +G+SPSVV+FN
Sbjct  128   AARNLLFSIEKRSNGAVKLEDRFFNSLIRNYGRAGLFQESIKLFTTMKSLGVSPSVVSFN  187

Query  744   TLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEK  923
             +L SIL+K+GRT M   ++DEML  +GV PD YTFNILIRG CMNSMVD+G+RFFK+M  
Sbjct  188   SLLSILLKKGRTNMAKNVYDEMLSMYGVTPDTYTFNILIRGFCMNSMVDEGYRFFKDMSG  247

Query  924   HECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKV  1103
               C+PDVITYNT+VDGLCRAGKVEIAHNVV GM K+  DL+PNVVTYTTL+RGYC KQ++
Sbjct  248   FRCDPDVITYNTLVDGLCRAGKVEIAHNVVNGMSKRSGDLTPNVVTYTTLIRGYCVKQEI  307

Query  1104  EEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNT  1283
             ++AL++ +EM  RG +PN  TYNTLI+GL EA+K DK+KE+F+G    G F PDTCTFNT
Sbjct  308   DKALSILEEMTTRGLKPNGFTYNTLIKGLCEAQKLDKIKEIFEGTMIGGEFTPDTCTFNT  367

Query  1284  LIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTG  1463
             L+H+HC+ GNL  AL+ F KMS L   PDSATYS+LI  LCQ+GD+  AE+ FDEL K  
Sbjct  368   LMHSHCNAGNLDEALKVFAKMSELKVPPDSATYSVLICSLCQRGDYPRAEELFDELSKKE  427

Query  1464  TLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEG  1643
              LL D GC+P+VA+YNP+F YL  NGKT+KAE+VFRQLMR G QDPL++KTLIMGN  EG
Sbjct  428   ILLRDDGCKPLVASYNPIFGYLSSNGKTQKAEEVFRQLMRRGTQDPLSYKTLIMGNCKEG  487

Query  1644  MSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFH  1823
               E G+ELLVWMLRR+FVPD E Y SL++GLLQ+GKP LA  TLE+MLKSSHLP+T  FH
Sbjct  488   TYEAGYELLVWMLRRDFVPDEEIYVSLIDGLLQKGKPLLAQQTLEKMLKSSHLPQTSTFH  547

Query  1824  SILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDN  2003
             S+L EL+KQ+CA E A  V LML KKIRQNINLST  VR+LF  GL+++AFEI+G LY+N
Sbjct  548   SLLAELLKQHCAHESASFVTLMLEKKIRQNINLSTHLVRLLFSHGLRDKAFEIVGMLYEN  607

Query  2004  GYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFEL  2183
             GY + M+EL+ FL Q +KL EA ++L FSL+  QSV I+  + V+  LC   +  EAF L
Sbjct  608   GYSIKMEELVCFLCQSRKLLEACEMLQFSLQKHQSVDIDNFNQVIVGLCDINKLSEAFGL  667

Query  2184  YYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGALDYIG  2333
             YYELVE +    L CL+ L+  LEV GRS EAEF++KR+PR +  LD  G
Sbjct  668   YYELVENKGYQQLPCLDSLKSALEVAGRSVEAEFLSKRIPR-QQLLDKFG  716



>ref|XP_002511627.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF50296.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1163

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/674 (61%), Positives = 519/674 (77%), Gaps = 3/674 (0%)
 Frame = +3

Query  288   DVAKPKLSSRK--KALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRK  461
             DV +PK +S K  KA ++A LI  +PWS     S  +   PS+S+TTV   +RL+KTP K
Sbjct  43    DVVRPKRASTKTKKAKSMARLINSKPWS-TELESSLSSLSPSISKTTVFEVLRLIKTPSK  101

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             AL+FF WA + GF    Q YF MLE+LG  RNLN ARNFLFSI +RSNG V LE RFFNS
Sbjct  102   ALQFFNWAPELGFTHNDQSYFLMLEILGRARNLNVARNFLFSIKRRSNGTVKLEDRFFNS  161

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             LI++Y  AGLFQES+++F SMK +G+SPSVVTFN+L  IL+KRGRT M   +FDEML T+
Sbjct  162   LIRSYGKAGLFQESVQVFNSMKSVGVSPSVVTFNSLLLILLKRGRTNMAQSVFDEMLSTY  221

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD YTFNILIRG C NSMVD+GFRFFKEM + +C+PD++TYNT+VDGLCRAGKV IA
Sbjct  222   GVTPDTYTFNILIRGFCKNSMVDEGFRFFKEMSRFKCDPDLVTYNTLVDGLCRAGKVNIA  281

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
             HNVV GM+KK ++L+P+VVTYTTLVRGYC K +++EAL VF+EMV +G +PN +TYNTLI
Sbjct  282   HNVVNGMVKKSTNLNPDVVTYTTLVRGYCMKHEIDEALVVFEEMVSKGLKPNEITYNTLI  341

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL E +K DK+K++F+GA   G F+PDTCT NTL++ HC+ GNL  ALE FEKM +LN 
Sbjct  342   KGLCEVQKIDKIKQIFEGALGGGGFIPDTCTLNTLMNAHCNAGNLNDALEVFEKMMVLNV  401

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
              PDSATYS+LIR LCQ+G+FE AE+ FDEL +   LL D GC P+VAAY  MF++LC NG
Sbjct  402   RPDSATYSVLIRNLCQRGNFERAEQLFDELSEKEILLRDDGCTPLVAAYKSMFEFLCRNG  461

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KT KAE+VFRQLM+ G QDPL+FK LI G+  EG  E G+ELLV MLRR+FVPD ETY+S
Sbjct  462   KTAKAERVFRQLMKRGTQDPLSFKILIKGHCREGTFEAGYELLVLMLRRDFVPDLETYQS  521

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L++GLLQ+G+P +AY TLE+M+KSSH+P T  FHSIL  L+ + CA E A  ++LML  K
Sbjct  522   LIDGLLQKGEPLVAYQTLEKMIKSSHVPETSTFHSILARLLAKGCAHESARFIMLMLEGK  581

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             IRQNINLST TVR+LF +GL+++AF+I+G LY NGY+V+M+ELI FLS  +K   A  LL
Sbjct  582   IRQNINLSTHTVRLLFGSGLRDKAFKIVGLLYANGYVVDMEELIGFLSHNRKFLLAHKLL  641

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
             LF L+  Q+V I++C TV+  LCK  R  EAF LYYELVE+    PL CLE+LR+ LE  
Sbjct  642   LFCLEKHQNVDIDMCDTVIEGLCKMKRHSEAFGLYYELVEKGNNQPLRCLENLRVALEAR  701

Query  2262  GRSKEAEFVAKRMP  2303
             GR +E +F++KRMP
Sbjct  702   GRLEEVKFLSKRMP  715



>ref|XP_008232397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Prunus mume]
Length=1150

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/676 (62%), Positives = 511/676 (76%), Gaps = 4/676 (1%)
 Frame = +3

Query  279   KLPDVAKPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPR  458
             K P  + PK    K A  +A L+   PWS     S  +    SLS+TTV  ++ L+KTP 
Sbjct  56    KQPKSSTPK---TKTAKDMARLVNTNPWS-SELESSLSTISSSLSKTTVHQALHLIKTPH  111

Query  459   KALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFN  638
             KAL+FF W E  GF+   Q YF MLE+LG  RNLN ARN LFSI K+SNGAV LE RFFN
Sbjct  112   KALQFFKWVEVMGFSHNDQSYFLMLEILGRARNLNAARNLLFSIEKKSNGAVKLEDRFFN  171

Query  639   SLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKT  818
             SLI+NY  AGLFQES+KLFT+MK +G+SPSVV+FN+L SIL+K+GRT M   ++DEML  
Sbjct  172   SLIRNYGRAGLFQESIKLFTTMKSLGVSPSVVSFNSLLSILLKKGRTNMAKNVYDEMLSM  231

Query  819   FGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEI  998
             +GV PD YTFNILIRG CMNSMVD+G+RFFK+M    C+PDVITYNT+VDGLCRAGKVEI
Sbjct  232   YGVTPDTYTFNILIRGFCMNSMVDEGYRFFKDMSGFRCDPDVITYNTLVDGLCRAGKVEI  291

Query  999   AHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTL  1178
             AHNVVKGM K+  DL+PNVVTYTTL+RGYC KQ++++AL + +E+  RG +PN  TYNTL
Sbjct  292   AHNVVKGMSKRSGDLTPNVVTYTTLIRGYCVKQEIDKALCILEEITTRGLKPNGFTYNTL  351

Query  1179  IQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILN  1358
             I+GL EA+K DK+KE+ +G    G F+PDTCTFNTL+H+HC+ GNL  AL+ F KMS L 
Sbjct  352   IKGLCEAQKLDKIKEILEGTMIGGEFIPDTCTFNTLMHSHCNAGNLDEALKVFAKMSELK  411

Query  1359  AAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCEN  1538
               PDSATYS+LIR LCQ+GD+  AE+ FDEL K   LL D GC+P+VA+YNP+F YL  N
Sbjct  412   VPPDSATYSVLIRSLCQRGDYPRAEELFDELSKKEILLRDDGCKPLVASYNPIFGYLSSN  471

Query  1539  GKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYE  1718
             GKT+KAE+VFRQLMR G QDPL++KTLIMGN  EG  E G+ELLVWMLRR+FVPD E Y 
Sbjct  472   GKTQKAEEVFRQLMRRGTQDPLSYKTLIMGNCKEGTYEAGYELLVWMLRRDFVPDEEIYV  531

Query  1719  SLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVK  1898
             SL++GLLQ+GKP LA  TLE+MLKSSHLP+T  FHS+L EL+KQ+CA E A  V LML K
Sbjct  532   SLIDGLLQKGKPLLAQQTLEKMLKSSHLPQTSTFHSLLAELLKQHCARESASFVTLMLEK  591

Query  1899  KIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDL  2078
             KIRQNINLST  VR+LF  GL+++AFEI+  LY+NGY + M+EL+ FL Q +KL EA ++
Sbjct  592   KIRQNINLSTHLVRLLFSRGLRDKAFEIVAMLYENGYSIKMEELVCFLCQSRKLLEACEM  651

Query  2079  LLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEV  2258
             L FSL+  QSV I+  + V+  LC   +  EAF LYYELVE +    L CL+ L+  LEV
Sbjct  652   LQFSLQKHQSVVIDNFNQVIVGLCDINKLSEAFGLYYELVENKGYQQLPCLDSLKSALEV  711

Query  2259  EGRSKEAEFVAKRMPR  2306
              GRS EAEF++KR+PR
Sbjct  712   AGRSVEAEFLSKRIPR  727



>emb|CBI39452.3| unnamed protein product [Vitis vinifera]
Length=718

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/678 (59%), Positives = 506/678 (75%), Gaps = 31/678 (5%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKG  497
             K++ A+A LI  +PWS + +SSL+ LA     +TTV+ +++L++TP KAL FF W E KG
Sbjct  64    KRSQAMARLINTEPWSHELQSSLAELAPSLS-KTTVLQTLQLIRTPAKALHFFRWVEAKG  122

Query  498   FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQ  677
             F    Q YF M+E+LG  RNLN ARNF+FSI K+S GAV L  RFFNSLI++Y  AGLFQ
Sbjct  123   FTHNEQSYFLMIEILGRSRNLNAARNFVFSIEKKSGGAVKLGDRFFNSLIRSYGWAGLFQ  182

Query  678   ESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNIL  857
             ES+K+F +MK IG+SPSVVTFN+L SI++KRGRT M  +LFDEML T+GV PD YTFNIL
Sbjct  183   ESIKVFKTMKEIGVSPSVVTFNSLLSIVLKRGRTSMAKQLFDEMLDTYGVTPDTYTFNIL  242

Query  858   IRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGS  1037
             IRG CMNSMVD+GF FFKEM + +C+PDV+TYNT+VDGLCRAGKV+IAHNVVKGM+KK  
Sbjct  243   IRGFCMNSMVDEGFWFFKEMSRFKCDPDVVTYNTLVDGLCRAGKVKIAHNVVKGMVKKSP  302

Query  1038  DLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKV  1217
             +LSPNVVTYTTL+RGYC KQ + EAL++  EMV RG +PN +TYNTLIQGL EA+K DK+
Sbjct  303   NLSPNVVTYTTLIRGYCMKQDMAEALSLLAEMVSRGLKPNKITYNTLIQGLCEAQKLDKI  362

Query  1218  KELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIR  1397
             KE+ +G   DG F+PDTCT NTLI  HC+ G L+ A   FEKMS L   PDSATYS+L+R
Sbjct  363   KEILEGMVGDGGFIPDTCTLNTLIKAHCTMGKLEEAFSVFEKMSELRVQPDSATYSVLVR  422

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQL  1577
              LCQ+GDF  AE+FFDEL +   LL D GC+P+VAAYNPMF+YLC NGKTKKAE+VFRQL
Sbjct  423   SLCQRGDFRRAEEFFDELAEKEILLHDVGCKPLVAAYNPMFEYLCSNGKTKKAERVFRQL  482

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
             M+ G QDP ++KTLI+G+  EG  E G +LLV MLRR+FVPD ETY  +++GLL++G P 
Sbjct  483   MKRGTQDPPSYKTLILGHCREGTPEAGFDLLVLMLRRDFVPDAETYGLMIDGLLKKGDPV  542

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
             LA+ +LE+MLKSSHLP T +FHSIL  LV++ CA E A LV LML ++IRQNI+LST T 
Sbjct  543   LAHKSLEKMLKSSHLPTTAIFHSILAALVEKGCAHESASLVKLMLERRIRQNIDLSTHT-  601

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
                                        M+EL+ FL Q +KL EA+ +LLFSL+  QSV I
Sbjct  602   ---------------------------MEELVSFLCQSRKLLEAQKMLLFSLEKRQSVDI  634

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
             ++CSTV+S LCKA +  EAF LYYELVE+ ++  L C EDLR+ LE EGR  EA+FV+K+
Sbjct  635   DMCSTVISGLCKAHKVSEAFALYYELVEKGMQHRLTCQEDLRISLEAEGRLNEAKFVSKK  694

Query  2298  MPRL--EGALDYIGPRIT  2345
             MP +  +   D  GP+++
Sbjct  695   MPEVPKQWQSDRTGPKVS  712



>ref|XP_010103831.1| hypothetical protein L484_024133 [Morus notabilis]
 gb|EXB97272.1| hypothetical protein L484_024133 [Morus notabilis]
Length=786

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/709 (58%), Positives = 520/709 (73%), Gaps = 3/709 (0%)
 Frame = +3

Query  180   QLFSPPSTAAAASQLFSGPSnaaaaaaaddndaKLPDVAKPKLSSRKKALALAELIKFQP  359
             QLF+P S     S+  +  S        +++  + P   +P  S  K+A  ++ LI   P
Sbjct  63    QLFTPTSVLRCYSRQRTNNSGENEEKNQNEDVMEKP---RPSSSKTKRAKEMSRLINTNP  119

Query  360   WSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLEL  539
             WS   ESSLS+L    LS+TTV+ ++RL+ +P KA +FF W  Q GF+   Q  F MLE+
Sbjct  120   WSTDLESSLSSLFPFPLSKTTVLQTLRLITSPSKAFQFFKWVPQMGFSHNDQSCFMMLEI  179

Query  540   LGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGI  719
             LG  RNLN ARNFLFSI K+SNG+V LE RFFNSLI++Y  AGLFQES+KLF++MK + I
Sbjct  180   LGRSRNLNAARNFLFSIEKKSNGSVKLEDRFFNSLIRSYGNAGLFQESVKLFSTMKELAI  239

Query  720   SPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGF  899
             +PSVVTFN+L  +L+KRGRT M   +FDEML T+GV+PD +TFN+LIRG CMNSMVD+GF
Sbjct  240   APSVVTFNSLLLVLLKRGRTNMARNVFDEMLGTYGVEPDTFTFNVLIRGFCMNSMVDEGF  299

Query  900   RFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVR  1079
              FFKEM + +CEPDV+TYNT+VDGLCRAGKV+IA NVVKGM KK  DL+PN+VTYTTL++
Sbjct  300   HFFKEMSRFKCEPDVVTYNTLVDGLCRAGKVDIARNVVKGMSKKSVDLNPNIVTYTTLIK  359

Query  1080  GYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFV  1259
             GYC KQ+++EAL V KEM +RG +PN +TYNTLI+GL EA+K D V+++  G    G FV
Sbjct  360   GYCGKQEIDEALLVLKEMTERGLKPNGITYNTLIKGLCEAQKLDDVRKILDGTMRRGEFV  419

Query  1260  PDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKF  1439
             P+TCTFNTLIHTHC  G L  AL+ FEKM  L    DSATYS LIR LCQ+GD+  AE+ 
Sbjct  420   PNTCTFNTLIHTHCQAGRLDEALKVFEKMLELQVLQDSATYSALIRSLCQRGDYIRAEEL  479

Query  1440  FDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTL  1619
             FD+L     LLSD GCRP+VAAYNPMF++LC NGKTKKAE+VFRQLM+ G QDP ++KTL
Sbjct  480   FDKLSDKEILLSDDGCRPIVAAYNPMFEHLCRNGKTKKAERVFRQLMKRGTQDPPSYKTL  539

Query  1620  IMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSH  1799
             IMG+  EG  E G+ELLV MLRR+FVPD E YESL+ GLLQ+ KP LA  TLE+ML+SSH
Sbjct  540   IMGHCREGTFEAGYELLVLMLRRDFVPDAEIYESLITGLLQKDKPLLAKTTLEKMLRSSH  599

Query  1800  LPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFE  1979
             LPR   FH IL EL+K+ CA E A    LML +K RQNI LST+ + +LF  GL ++AFE
Sbjct  600   LPRASAFHCILEELLKKGCAKESASFATLMLEQKFRQNITLSTNLITLLFSNGLGDKAFE  659

Query  1980  ILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKAC  2159
             ++  LY++GY V ++EL+ FL Q  KL EA  LL FSL+ +QSV IEI + V+  L K  
Sbjct  660   LIKVLYESGYSVKIEELVSFLCQKSKLLEACKLLQFSLQKNQSVGIEIFNKVIGGLSKIR  719

Query  2160  RAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPR  2306
             R  EAF+LYY+LVE+ +   L CLEDL+  L++ GRS EA+FV+KRMP+
Sbjct  720   RVSEAFDLYYKLVEKGVHHRLVCLEDLKTALKLAGRSAEADFVSKRMPK  768



>ref|XP_006375239.1| hypothetical protein POPTR_0014s05550g [Populus trichocarpa]
 gb|ERP53036.1| hypothetical protein POPTR_0014s05550g [Populus trichocarpa]
Length=728

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/674 (59%), Positives = 511/674 (76%), Gaps = 3/674 (0%)
 Frame = +3

Query  288   DVAKPKLSSRKK--ALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRK  461
             +V +P+ SS K   A ++A LI  +PWS + ESSL +L+     +TT    +R + +P K
Sbjct  48    NVKEPRKSSNKSKTAKSMARLINSKPWSTELESSLFSLSPSIS-KTTFFQVLRFIASPPK  106

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             A +FF WA + GFA  S+ YF ML++LG   NLN ARNFLFSI +RSNG+V +E RF N+
Sbjct  107   AFEFFNWASRNGFAHDSRSYFMMLDILGRNGNLNIARNFLFSIERRSNGSVKIEDRFCNT  166

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             L+++Y  AGLF E++KLF+ MK  G+SPSV+TFN+L  IL+KRGRT M + +FDEM  T+
Sbjct  167   LLRSYGNAGLFNEAIKLFSLMKSSGVSPSVITFNSLLLILLKRGRTNMAHSVFDEMCGTY  226

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD YTFNILIRG C NSMVD+GFRFFKEM +  CEPDV+TYNT+VDGLCRAGKV IA
Sbjct  227   GVTPDTYTFNILIRGFCKNSMVDEGFRFFKEMSRFNCEPDVVTYNTLVDGLCRAGKVRIA  286

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
             HNVVKGM+KK  DLSP+VVTYTTLVRGYC KQ+++EAL VF+EMV RG +PN +TYNTLI
Sbjct  287   HNVVKGMVKKMKDLSPDVVTYTTLVRGYCMKQEIDEALVVFEEMVSRGLKPNDITYNTLI  346

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL E +KFDK+KE+  GA     FVPDTCT+NTL++  C  GN   AL+ F+KM  L  
Sbjct  347   KGLCEVQKFDKIKEILGGAVGGRGFVPDTCTYNTLMNAQCDAGNFDEALKMFKKMKELKV  406

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
              PDSATYS+LIR LCQ+GDFE AE+ FD+L     LL D GC P+VAAYNP+F +LC+NG
Sbjct  407   QPDSATYSVLIRNLCQRGDFERAEQLFDKLSDEDILLRDDGCTPLVAAYNPIFDFLCKNG  466

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KT KAE+VFRQLM+ G QDP ++KTLI+G+  EG  E G++LL++MLRR++VPDFETY  
Sbjct  467   KTHKAERVFRQLMKKGTQDPPSYKTLIIGHCKEGTFEAGYKLLLFMLRRDYVPDFETYVL  526

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L+ G LQ+G+P LAY TLERMLKSS+LP+T VFHSIL+EL+K + A E A  VVLM+ +K
Sbjct  527   LINGFLQKGEPILAYKTLERMLKSSYLPKTSVFHSILSELLKNDFARESASFVVLMIDRK  586

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             IRQNINLST T+R+LF +GL+ +AF+I+  LYDNGY+V+M+ELI F+ Q  KL +A+ +L
Sbjct  587   IRQNINLSTHTMRLLFGSGLRIKAFQIVELLYDNGYMVDMEELIGFICQNGKLLDAQKML  646

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
              F L+   +V I +C+ V+  LCK  R  EAF LYY LVE+     L+CLE LR  LE  
Sbjct  647   SFCLEKGHNVDINVCNVVIEGLCKMKRPLEAFGLYYMLVEKSNHQQLSCLEGLRTALEAG  706

Query  2262  GRSKEAEFVAKRMP  2303
             GRS+EA+FV+KRMP
Sbjct  707   GRSEEAKFVSKRMP  720



>ref|XP_010252151.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Nelumbo nucifera]
Length=680

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/672 (58%), Positives = 499/672 (74%), Gaps = 1/672 (0%)
 Frame = +3

Query  297   KPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFF  476
             KP+ S  K A  LA LI  + WSP  ESS+S L      +TTV+ ++ L++TP KA +FF
Sbjct  2     KPRSSKTKTARTLARLINNRAWSPDLESSISPLCSHLS-KTTVLQTLHLVRTPSKAFQFF  60

Query  477   VWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNY  656
              W +  GF    Q YF+MLE+LG  RNLN ARN LFSI K S+G V L  RFFNSLI++Y
Sbjct  61    KWTQNNGFTHNDQTYFKMLEILGHSRNLNAARNLLFSIEKNSSGTVKLHDRFFNSLIRSY  120

Query  657   AVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPD  836
               AGL QESLK++ +MK +G+SPSVVTFN+LFSIL++RGR  M  +L+DEM+ T GV PD
Sbjct  121   GQAGLIQESLKVYMTMKSLGVSPSVVTFNSLFSILLRRGRKTMAKKLYDEMITTVGVCPD  180

Query  837   LYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVK  1016
             +YTFNILIRG C+NSMVD GFRFFKEM +  C PDV+TYNT+VDGLCR GKV IAHN++ 
Sbjct  181   VYTFNILIRGFCLNSMVDDGFRFFKEMSRFGCNPDVVTYNTLVDGLCRTGKVRIAHNLLN  240

Query  1017  GMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLE  1196
             GM  K SDL+PNVVTYTTL+RGYCEKQ + +AL+VFKEM+ RG +PN +TYNTLIQGL E
Sbjct  241   GMCTKSSDLNPNVVTYTTLIRGYCEKQDIAQALDVFKEMLGRGMKPNGITYNTLIQGLCE  300

Query  1197  ARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSA  1376
             A K DK++E+ +G  E G FVPDTCTFNTL+  HC+ G L+ AL  FEKMS L   PDSA
Sbjct  301   AGKLDKIREILEGVTEGGEFVPDTCTFNTLMSAHCNAGKLEEALHVFEKMSNLRVQPDSA  360

Query  1377  TYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKA  1556
             TYS+LIR LCQ+GDF  AE+ FD+L+K   L+ + GC P+VAAYNPMF++LC NG+T+KA
Sbjct  361   TYSVLIRSLCQRGDFMKAEELFDDLWKNEILVKEVGCVPLVAAYNPMFEFLCGNGRTEKA  420

Query  1557  EKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGL  1736
             +KVFRQ+++ G QDP  FK LI+G+  EG  + G++LLV MLRR+FVPD ETY SL+EG 
Sbjct  421   DKVFRQMLKRGTQDPPAFKILILGHCKEGTVQAGYDLLVLMLRRDFVPDMETYNSLIEGF  480

Query  1737  LQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNI  1916
             LQ+ +P  AY TLE+MLKSSHLP+T  FHSIL  LV++ CA E A  + +ML +KIR N 
Sbjct  481   LQKREPGFAYKTLEKMLKSSHLPKTSTFHSILAALVQEGCAHEAASFIKMMLERKIRPNT  540

Query  1917  NLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLK  2096
             NLSTDT+  +FK+ L++ AFE++  LY NGY + M++++ FLS   K  EAR LLLFSL+
Sbjct  541   NLSTDTIIEIFKSKLQDTAFEVVELLYGNGYSIKMEKVVCFLSGNCKFLEARKLLLFSLE  600

Query  2097  NSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKE  2276
               QS   +IC+TV++ LC+  ++ EAF LYY L E+   L  +CL +L++ LE EG   E
Sbjct  601   MHQSAGTKICNTVITGLCRIHKSLEAFSLYYALSEKGSHLSSSCLRELKVALEDEGNLNE  660

Query  2277  AEFVAKRMPRLE  2312
             AEF++KR+ R E
Sbjct  661   AEFLSKRIERQE  672



>ref|XP_008344150.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g02060, chloroplastic [Malus domestica]
Length=1210

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/732 (58%), Positives = 533/732 (73%), Gaps = 7/732 (1%)
 Frame = +3

Query  141   AQHPFS--HCLSTLSQLFSPPSTAAAASQLFSGPSnaaaaaaaddndaKLPDVAKPKLSS  314
             A +P S    L+ L Q FS P+  +  + L    S+       DD   +  +  +PKLS+
Sbjct  2     AANPISXRRALALLRQQFSSPTLNSQXASLLRCRSSQKTQNHKDDEQLQ-NNTQRPKLST  60

Query  315   --RKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAE  488
                K+A  +A+LI   PWS + ESSLS +A     +TTV  ++ L+K P KAL+FF WAE
Sbjct  61    PKTKRAKDMAKLIDSMPWSTELESSLSTIASSLS-KTTVHQTLHLIKAPSKALQFFKWAE  119

Query  489   QKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAG  668
               GF+   Q Y  MLE+LG  RNLN ARNFLFSI K+SNGAV LE RFFNSLI+NY  AG
Sbjct  120   VMGFSHNDQSYXLMLEILGRNRNLNAARNFLFSIEKKSNGAVKLEDRFFNSLIRNYGRAG  179

Query  669   LFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTF  848
             LFQES+KLF++MK IG+SPSVV+FN+L  IL+++GRT M   ++DEM+  +G  PD  TF
Sbjct  180   LFQESIKLFSTMKSIGVSPSVVSFNSLLXILLRKGRTNMAKNVYDEMVSMYGATPDTCTF  239

Query  849   NILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLK  1028
             N LIRG CMNSMVD+GFRFFKEM + +C+PDVITYNT+VDGLCRAGKV IAHNVVKGM K
Sbjct  240   NTLIRGFCMNSMVDEGFRFFKEMSRFKCDPDVITYNTLVDGLCRAGKVGIAHNVVKGMSK  299

Query  1029  KGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKF  1208
             + +DL+PN+VTYTTL+RGYC KQ+++EAL V +EM  +G +PN +T NTLI+GL EA K 
Sbjct  300   RSADLNPNIVTYTTLIRGYCMKQEIDEALCVLEEMTSQGLKPNGITCNTLIKGLCEAHKL  359

Query  1209  DKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSI  1388
             DK+K++ +G    G F PDTCTFNTL+H+HC+ GNL  AL+ F KMS L   PDSATYS+
Sbjct  360   DKIKDILEGTMSGGEFTPDTCTFNTLMHSHCNAGNLDEALKVFAKMSELKVPPDSATYSV  419

Query  1389  LIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVF  1568
             LIR LCQ+GD+  AE+ FDEL K   LLSD GC+P+VA+YNP+F+YLC  GK KKAE VF
Sbjct  420   LIRSLCQRGDYSRAEELFDELSKKEILLSDDGCKPLVASYNPIFEYLCSKGKIKKAEAVF  479

Query  1569  RQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEG  1748
             RQLMR G QDP+++KTLIMG+  EG  E G+ELLVWMLRR+FVPD E YESL+ GLLQ+G
Sbjct  480   RQLMRRGTQDPVSYKTLIMGHCKEGTFETGYELLVWMLRRDFVPDVEIYESLIGGLLQKG  539

Query  1749  KPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
             K  LA  TLE+MLKSSHLP+T  FH IL EL+++NCALE A+ V+LML +KIRQNINLST
Sbjct  540   KALLAQQTLEKMLKSSHLPKTCTFHCILAELLEKNCALESANCVILMLERKIRQNINLST  599

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
               VR+LF +GL+++AF I+G L+ NGY + M+E++ FL Q +KL +A  +L FSL+  QS
Sbjct  600   HLVRLLFSSGLRDKAFXIVGMLHXNGYSIKMEEVVHFLCQRRKLLDACKMLQFSLQKHQS  659

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFV  2288
             V I+I + V+  LC   +  EAF LYYELVE        CL  L+  LE+ G S EAEF+
Sbjct  660   VSIDIFNQVIEGLCNINKPSEAFGLYYELVENAGYQQFPCLGSLKSALEIAGXSVEAEFL  719

Query  2289  AKRMPRLEGALD  2324
             +K MP  E +LD
Sbjct  720   SKGMPG-EQSLD  730



>gb|KHF97527.1| hypothetical protein F383_12018 [Gossypium arboreum]
Length=741

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/669 (60%), Positives = 500/669 (75%), Gaps = 1/669 (0%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKG  497
             K A  +A +I   PWS     S  +   PSLS+TTV+ ++RL+K P KAL+FF W +Q G
Sbjct  59    KGAKFMARVINSTPWS-SELESSISSLSPSLSKTTVLQTLRLIKNPSKALQFFNWVQQMG  117

Query  498   FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQ  677
             F   +Q +F M+E+LG ERNL  ARN   SI KRSNG+V LE +FFNSLI++Y  AGLFQ
Sbjct  118   FPHDAQSFFLMIEILGKERNLYAARNLTLSIEKRSNGSVKLEDKFFNSLIRSYGKAGLFQ  177

Query  678   ESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNIL  857
             ES+K+F +MK IG+SPSV++FN L SIL+KRGRT M   +FDEML T+GV PD+YTFNIL
Sbjct  178   ESIKVFETMKSIGVSPSVISFNNLLSILLKRGRTNMAKSVFDEMLSTYGVTPDVYTFNIL  237

Query  858   IRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGS  1037
             I+G  MNSMVD+GFRFFKEME+ +C+PDV+TYNTIVDGLCR GKV IAHNVVKGM KK  
Sbjct  238   IKGFGMNSMVDEGFRFFKEMERFKCDPDVVTYNTIVDGLCRVGKVRIAHNVVKGMSKKSL  297

Query  1038  DLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKV  1217
             DL+PNVVTYTTLVRGYC KQ ++EAL VF+EM+ RG +PN +TYNTLI+GL E  K+DK+
Sbjct  298   DLNPNVVTYTTLVRGYCMKQDIDEALAVFQEMICRGLKPNKITYNTLIKGLSEVHKYDKI  357

Query  1218  KELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIR  1397
             KE+ +G  +DGRF PDTCTFNTLI+ HC+ GN+  AL  F++MS +    DSATYS++IR
Sbjct  358   KEILEGMRKDGRFTPDTCTFNTLINAHCNAGNMDEALNVFKRMSEMKVQSDSATYSVIIR  417

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQL  1577
              LCQ  DFE AE+FFDEL K   LL   GC PVVAAYNPMF+YLC NGKTKKAE+VFRQL
Sbjct  418   SLCQIADFEKAEEFFDELAKKEILLGHVGCTPVVAAYNPMFEYLCANGKTKKAERVFRQL  477

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
             ++ G QDP  +KTLI+G+  EG  E G+ELLV MLRR+F P FE Y+SL+ GLL +G+  
Sbjct  478   LKRGRQDPPAYKTLILGHCKEGTFEAGYELLVLMLRRDFEPGFEIYDSLITGLLLKGESL  537

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
             LA  TLE+MLKSSHLP+T   HSIL EL+K++CA E A LV LML  +IR NINLST TV
Sbjct  538   LACLTLEKMLKSSHLPQTSSVHSILAELLKKSCAQEAASLVTLMLDHRIRLNINLSTQTV  597

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
             ++L    ++++AF++L  LYD+GY+V M++L+ FL Q   L EA  ++ FSL+  Q+  I
Sbjct  598   KLLLARRMQDKAFQVLVLLYDDGYMVKMEDLVHFLCQSGMLLEACKMIQFSLEKHQTADI  657

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
             EIC TV+  LC   R  EAF LYYELVER   L L CL++L++ L+  GR  EAEFV+KR
Sbjct  658   EICCTVIEGLCNNRRLSEAFGLYYELVERGKHLELRCLDNLKITLQAGGRLNEAEFVSKR  717

Query  2298  MPRLEGALD  2324
             MP    A D
Sbjct  718   MPNQWQAND  726



>ref|XP_011076550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Sesamum indicum]
Length=790

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/672 (59%), Positives = 511/672 (76%), Gaps = 3/672 (0%)
 Frame = +3

Query  288   DVAKPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKAL  467
             D    +  S +KA  +A+LI  +PWS + ES LS L+  S  ETT   ++RL+K P +AL
Sbjct  118   DTPVRRAKSTRKARTMAKLINTKPWSARVESCLSNLSPFS--ETTFFQTLRLIKAPSEAL  175

Query  468   KFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLI  647
             +FF WA+  GF  + + YF MLE+LG  RNLN ARNFLFSIP++SN  VPL  +FFNSLI
Sbjct  176   RFFNWAQDSGFNHSHRSYFMMLEILGRARNLNMARNFLFSIPRKSNYMVPLTDKFFNSLI  235

Query  648   KNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGV  827
             ++Y  AGLFQES+K+F  MK + ISPS VTFN+LF IL+KRGR  MV+EL+DEML+T+GV
Sbjct  236   RSYGDAGLFQESMKVFKVMKSMVISPSTVTFNSLFLILLKRGRVAMVFELYDEMLRTYGV  295

Query  828   KPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHN  1007
             KPDLYTFNILIRG CMNS VD+ FR FKEME+ ECEPD+ITYNTIVDGLCRAGKV +A N
Sbjct  296   KPDLYTFNILIRGFCMNSKVDEAFRMFKEMERFECEPDLITYNTIVDGLCRAGKVNVARN  355

Query  1008  VVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQG  1187
             VV GM KK   L PNVV+YTTL+RG+C +Q+++EA++VF++MV  G +PN +T NT+IQG
Sbjct  356   VVNGMSKKCEKLRPNVVSYTTLIRGFCGRQEIDEAMDVFRQMVSSGIKPNEITCNTIIQG  415

Query  1188  LLEARKFDKVKELFKGAGEDGR-FVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAA  1364
             L  ++KFD +KE+ +    DGR FVPDTCTFNT+++ HC++ NL  AL+ FEKM  +N  
Sbjct  416   LCASQKFDMIKEILEECQVDGRGFVPDTCTFNTVMNAHCNEENLDEALKVFEKMKEMNVK  475

Query  1365  PDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGK  1544
              DSATYS+LIR LC+K  F+ AE+  DELF+   LL +    P+ AAYNP+F+YLC NGK
Sbjct  476   QDSATYSMLIRALCKKKKFDKAEELLDELFEQEILLRNDNTTPLAAAYNPIFEYLCTNGK  535

Query  1545  TKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESL  1724
             TKKAE+VFRQLM+ G+QDP  F+T+I+G+  EG    G++LLV MLRR FV D E YESL
Sbjct  536   TKKAERVFRQLMKRGIQDPHAFETMILGHCTEGTFVAGYKLLVLMLRRAFVLDVEVYESL  595

Query  1725  LEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKI  1904
             +EGLLQ  +P LA+DTL +M+KSSHLPRT  FH +L EL++   A E ADL++LML KKI
Sbjct  596   IEGLLQSREPNLAHDTLVKMMKSSHLPRTSTFHRVLMELIEIGSANESADLMMLMLDKKI  655

Query  1905  RQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLL  2084
             R  +NLSTD VR+LF+  ++ RAF+++  LY+NGY++NM++LI FL Q +KLSEA  LLL
Sbjct  656   RPYMNLSTDAVRLLFRGSMQNRAFQLVRSLYENGYILNMEDLIFFLCQDRKLSEACQLLL  715

Query  2085  FSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEG  2264
             +SLKN Q+V   +C+TVL++LCKA +  EAF LYYEL+E  I  PL+CLE L+  LE EG
Sbjct  716   YSLKNDQNVDTSLCTTVLTSLCKAHKISEAFHLYYELLEMGIRQPLSCLEGLQNALETEG  775

Query  2265  RSKEAEFVAKRM  2300
             + KEAEFVAKRM
Sbjct  776   KLKEAEFVAKRM  787



>ref|XP_011042452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Populus euphratica]
Length=1216

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/674 (60%), Positives = 512/674 (76%), Gaps = 3/674 (0%)
 Frame = +3

Query  288   DVAKPKLSSRKK--ALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRK  461
             +V +P+ SS K   A ++A LI  +PWS + ESSL +L+     +TT    +R + +P K
Sbjct  48    NVNEPRKSSNKSKTAKSMARLINSKPWSTELESSLFSLSPSIS-KTTFFQVLRFIASPSK  106

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             A +FF WA + GF   S+ YF MLE+LG   NLN ARNFLFSI +RSNG+V +E RF N+
Sbjct  107   AFEFFNWASRNGFTHDSRSYFMMLEILGRNGNLNIARNFLFSIERRSNGSVKIEDRFCNT  166

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             L+++Y  AGLF E++KLF+ MK  G+SPSV+TFN+L  IL+KRGRT M + +FDEM  T+
Sbjct  167   LLRSYGNAGLFNEAIKLFSLMKSSGVSPSVITFNSLLLILLKRGRTNMAHSVFDEMCGTY  226

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD YTFNILIRG C NSMVD+GFRFFKEM +  CEPDV+TYNT+VDGLCRAGKV IA
Sbjct  227   GVTPDTYTFNILIRGFCKNSMVDEGFRFFKEMSRFNCEPDVVTYNTLVDGLCRAGKVRIA  286

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
             HNVVKGM+KK  DLSP+VVTYTTLVRGYC KQ+++EAL VF+EMV RG +PN +TYNTLI
Sbjct  287   HNVVKGMVKKMKDLSPDVVTYTTLVRGYCMKQEIDEALVVFEEMVSRGLKPNDITYNTLI  346

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL E +KFDK+KE+  GA     FVPDTCT+NTL+++ C  GN   AL+ F+KM  L  
Sbjct  347   KGLCEVQKFDKIKEILGGAVGGRGFVPDTCTYNTLMNSQCDAGNFDEALKMFKKMKELKV  406

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
              PDSATYS+LIR LCQ+GDFE AE+ FDEL     LL D GC P+VAAYNP+F +LC+NG
Sbjct  407   QPDSATYSVLIRNLCQRGDFERAEQLFDELSDDDILLRDDGCTPLVAAYNPIFDFLCKNG  466

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KT KAE+VFRQLM+ G QDP ++KTLI+G+  EG  E G++LL++MLRR++VPDFETY  
Sbjct  467   KTSKAERVFRQLMKKGTQDPPSYKTLILGHCKEGTFEAGYKLLLYMLRRDYVPDFETYVL  526

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L+ G LQ+G+P LAY TLERMLKSS+LP+T VFHSIL+EL+K + A E A  VVLM+ +K
Sbjct  527   LINGFLQKGEPILAYKTLERMLKSSYLPKTSVFHSILSELLKHDFARESASFVVLMIDRK  586

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             IRQNINLST T+R+LF +GL+ +AF+I+  LYDNGY+V+M+ELI F+ Q  KL +A+ +L
Sbjct  587   IRQNINLSTHTMRLLFGSGLRNKAFQIVELLYDNGYVVDMEELIGFICQNGKLLDAQKML  646

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
              F L+   +V I +C+ V+  LCK  R  EAF LYY+LVE+     L+CLE LR  LE  
Sbjct  647   SFCLEKGHTVDINVCNVVIEGLCKMKRPLEAFGLYYKLVEKSNHQQLSCLEGLRTALEAG  706

Query  2262  GRSKEAEFVAKRMP  2303
             GRS+EA+FV+KRMP
Sbjct  707   GRSEEAKFVSKRMP  720



>emb|CAN73209.1| hypothetical protein VITISV_002838 [Vitis vinifera]
Length=1024

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/678 (58%), Positives = 504/678 (74%), Gaps = 39/678 (6%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKG  497
             K++ A+A LI  +PWS + +SSL+ LA     +TTV+ +++L++TP KAL FF W E KG
Sbjct  157   KRSQAMARLINTEPWSHELQSSLAELAPSLS-KTTVLQTLQLIRTPAKALHFFRWVEAKG  215

Query  498   FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQ  677
             F    Q YF M+E+LG  RNLN ARNF+FSI K+S GA                      
Sbjct  216   FTHNEQSYFLMIEILGRSRNLNAARNFVFSIEKKSGGA----------------------  253

Query  678   ESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNIL  857
             ES+K+F +MK IG+SPSVVTFN+L SI++KRGRT M  +LFDEML T+GV PD YTFNIL
Sbjct  254   ESIKVFKTMKEIGVSPSVVTFNSLLSIVLKRGRTSMAKQLFDEMLDTYGVTPDTYTFNIL  313

Query  858   IRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGS  1037
             IRG CMNSMVD+GF FFKEM + +C+PDV+TYNT+VDGLCRAGKV+IAHNVVKGM+KK  
Sbjct  314   IRGFCMNSMVDEGFWFFKEMSRFKCDPDVVTYNTLVDGLCRAGKVKIAHNVVKGMVKKSP  373

Query  1038  DLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKV  1217
             +LSPNVVTYTTL+RGYC KQ + EAL++  EMV RG +PN +TYNTLIQGL EA+K DK+
Sbjct  374   NLSPNVVTYTTLIRGYCMKQDMAEALSLLAEMVSRGLKPNKITYNTLIQGLCEAQKLDKI  433

Query  1218  KELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIR  1397
             KE+ +G   DG F+PDTCT NTLI  HC+ G L+ A   FEKMS L   PDSATYS+L+R
Sbjct  434   KEILEGMVGDGGFIPDTCTLNTLIKAHCTMGKLEEAFSVFEKMSELRVQPDSATYSVLVR  493

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQL  1577
              LCQ+GDF  AE+FFDEL +   LL D GC+P+VAAYNPMF+YLC NGKTKKAE+VFRQL
Sbjct  494   SLCQRGDFRRAEEFFDELAEKEILLHDVGCKPLVAAYNPMFEYLCSNGKTKKAERVFRQL  553

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
             M+ G QDP ++KTLI+G+  EG  E G +LLV MLRR+FVPD ETY  +++GLL++G P 
Sbjct  554   MKRGTQDPPSYKTLILGHCREGTPEAGFDLLVLMLRRDFVPDAETYGLMIDGLLKKGDPV  613

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
             LA+ +LE+MLKSSHLP T +FHSIL  LV++               ++IRQNI+LST TV
Sbjct  614   LAHKSLEKMLKSSHLPTTAIFHSILAALVEKE--------------RRIRQNIDLSTHTV  659

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
             R+L+K+GL+++AF  +G LY+NGYLV M+EL+ FL Q +KL EA+ +LLFSL+  QSV I
Sbjct  660   RLLYKSGLQDKAFMTIGLLYENGYLVKMEELVSFLCQSRKLLEAQKMLLFSLEKRQSVDI  719

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
             ++CSTV+S LCKA +  EAF LYYELVE+ ++  L C EDLR+ LE EGR  EA+FV+K+
Sbjct  720   DMCSTVISGLCKAHKVSEAFALYYELVEKGMQHRLTCQEDLRISLEAEGRLNEAKFVSKK  779

Query  2298  MPRL--EGALDYIGPRIT  2345
             MP +  +   D  GP+++
Sbjct  780   MPEVPKQWQSDRTGPKLS  797



>ref|XP_010052040.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Eucalyptus grandis]
 gb|KCW75895.1| hypothetical protein EUGRSUZ_D00277 [Eucalyptus grandis]
Length=761

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/676 (59%), Positives = 504/676 (75%), Gaps = 4/676 (1%)
 Frame = +3

Query  285   PDVAKPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKA  464
             P     K +  +    +++LI    WS + ESSLS LA     +T V+ +++L+K+P +A
Sbjct  47    PQDKSSKRAKTRIVHVISQLINRSKWSDKLESSLSPLAASLS-KTNVLRTLQLIKSPARA  105

Query  465   LKFFVWAEQK-GFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             L FF W + K GF    Q YF MLE+LG  RNLN ARNFLFSI + SNGAV LE R+FNS
Sbjct  106   LLFFKWIQGKMGFVHDHQSYFFMLEMLGRCRNLNAARNFLFSIERMSNGAVKLEDRYFNS  165

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             LI++Y  AGLFQESLKLF  MK IGISPSV+TFN LFS+L+KRGRT MV  ++DEML T+
Sbjct  166   LIRSYGKAGLFQESLKLFEKMKEIGISPSVITFNNLFSLLLKRGRTNMVKHVYDEMLNTY  225

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD YT+NILIRG CMNSMVD+GF FFKEM +  CEPDVITYNT+VDGLCRAGKV IA
Sbjct  226   GVTPDTYTYNILIRGFCMNSMVDEGFHFFKEMSQFNCEPDVITYNTLVDGLCRAGKVNIA  285

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
             +NVVKGM  K +DL PNV+TYTTL+RGYC K ++++AL + +EMV+ G +PN +TYNTLI
Sbjct  286   NNVVKGMRTKSADLKPNVITYTTLIRGYCMKGEIDDALAIIEEMVNGGLKPNKITYNTLI  345

Query  1182  QGLLEARKFDKVKELFKG-AGEDGR-FVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSIL  1355
             +GL EARK DK+KE+ +G  G+  R F+PD+CT NTL+H+HC+ GNL  AL  FEKMS L
Sbjct  346   KGLCEARKLDKIKEILEGTVGKGDRVFIPDSCTLNTLMHSHCNSGNLDEALNVFEKMSEL  405

Query  1356  NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCE  1535
               +PDSA+YS+LIR LCQKG+FE AE  F+EL +   LLSDAGC P+VAAY+PMF YLC+
Sbjct  406   QVSPDSASYSVLIRSLCQKGEFERAEVLFNELSEKQILLSDAGCVPLVAAYHPMFVYLCK  465

Query  1536  NGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETY  1715
             +GKTKKAE+VFRQLM+ G+QDP ++KTLI+G+  EG  E G++LLV MLRR+FVPD+ETY
Sbjct  466   SGKTKKAEEVFRQLMKRGMQDPPSYKTLIVGHCREGTFEAGYDLLVLMLRRDFVPDYETY  525

Query  1716  ESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLV  1895
              SL+EGLL +  P LAY  LE+ML+SSH PR+  FH+ILT L+K+  A E A LV +ML 
Sbjct  526   LSLIEGLLSKDNPLLAYKILEKMLRSSHHPRSSTFHAILTVLLKKERAHESASLVKVMLE  585

Query  1896  KKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARD  2075
             K IRQNINLST TVR+LF  GL  +AFE++  LY NGY++ ++EL  FL Q  K+ EA +
Sbjct  586   KHIRQNINLSTQTVRLLFSRGLGRKAFELVNLLYQNGYVIAIEELTSFLCQKGKVLEAGE  645

Query  2076  LLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLE  2255
             LLL+ L+    + I + S V+  LC+  +  +AF L+YELVER+    L+C E+LR  L 
Sbjct  646   LLLYGLRKDSRIDINMYSIVMKGLCERRQLSQAFALFYELVERESFQNLDCCEELRTALV  705

Query  2256  VEGRSKEAEFVAKRMP  2303
              +GR  EA FVAKRMP
Sbjct  706   ADGRHAEANFVAKRMP  721



>ref|XP_004161177.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g02060, chloroplastic-like [Cucumis sativus]
Length=720

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/672 (58%), Positives = 499/672 (74%), Gaps = 2/672 (0%)
 Frame = +3

Query  294   AKPKLSSRK-KALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALK  470
              K K S++  KA  +AE+I  +PWS     S  A   PSLS+TTV+ ++  L+   KAL+
Sbjct  39    TKTKSSTKTVKATVMAEMINSKPWS-SDLESSLASLSPSLSQTTVLQTLGFLRDTSKALQ  97

Query  471   FFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIK  650
             FF WA++ G+  T Q YF MLE+LG  R+LNTARNFLFSI KRS G V LEARFFNSL++
Sbjct  98    FFNWAQEMGYTHTEQSYFSMLEILGRNRHLNTARNFLFSIEKRSRGIVKLEARFFNSLMR  157

Query  651   NYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVK  830
             N+  AGLFQES+K+FT MK  G+SPSVVTFN+L +IL+KRGRT M  +++DEML T+GV 
Sbjct  158   NFNRAGLFQESIKVFTIMKSHGVSPSVVTFNSLLTILLKRGRTNMAKKVYDEMLSTYGVT  217

Query  831   PDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNV  1010
             PD +TFNILIRG CMN MVD GFR F ++ +  CEPDV+TYNT+VDGLCRAGKV +A+NV
Sbjct  218   PDTFTFNILIRGFCMNGMVDDGFRIFNDLSRFGCEPDVVTYNTLVDGLCRAGKVTVAYNV  277

Query  1011  VKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGL  1190
             VKGM KK  DL+PNVVTYTTL+RGYC K+++E+AL VF+EMV++G + N++TYNTLI+GL
Sbjct  278   VKGMGKKSVDLNPNVVTYTTLIRGYCAKREIEKALAVFEEMVNQGLKANNITYNTLIKGL  337

Query  1191  LEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPD  1370
              EARKF+K+K++ +G   DG F PDTCTFNTL+H HC  GNL  AL+ FE+MS L   PD
Sbjct  338   CEARKFEKIKDILEGTAGDGTFSPDTCTFNTLMHCHCHAGNLDDALKVFERMSELKIQPD  397

Query  1371  SATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTK  1550
             SATYS L+R LCQ G +E AE   D+L +   LLS  GC+P+VAAYNP+FKYLCE GKTK
Sbjct  398   SATYSALVRSLCQGGHYEKAEDLLDKLLERKILLSGDGCKPLVAAYNPIFKYLCETGKTK  457

Query  1551  KAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLE  1730
             KAEK FRQLMR G QDP ++KTLIMG+  EG  E G+ELLV MLR++F PDFETYESL+ 
Sbjct  458   KAEKAFRQLMRRGTQDPPSYKTLIMGHCKEGTFESGYELLVLMLRKDFXPDFETYESLIN  517

Query  1731  GLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQ  1910
             GLL   KP LA  +LE+ML+SSH P +  FHSIL +L++Q  A E A L+ LML K IRQ
Sbjct  518   GLLHMDKPLLALQSLEKMLRSSHRPNSSTFHSILAKLLEQGRASESASLIQLMLDKNIRQ  577

Query  1911  NINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFS  2090
             N++ ST  VR+LF AG+ ++AF+++  LY  GY V M+ELI +L   +K+ +   LLLFS
Sbjct  578   NLSFSTGCVRLLFGAGMNDKAFQLVHLLYGKGYSVKMEELIRYLCHCRKVIQGSKLLLFS  637

Query  2091  LKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRS  2270
             L++ Q V +++C+TV+  LC+  +  EAF LYY+LVE  +   L+C   L++ L+  G+ 
Sbjct  638   LESHQFVDMDLCNTVIFQLCEINKLSEAFSLYYKLVEMGVHQQLSCQNQLKVSLKAGGKL  697

Query  2271  KEAEFVAKRMPR  2306
             +EAE V KRM R
Sbjct  698   EEAESVQKRMER  709



>ref|XP_004142707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Cucumis sativus]
 gb|KGN54533.1| hypothetical protein Csa_4G358710 [Cucumis sativus]
Length=757

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/674 (58%), Positives = 501/674 (74%), Gaps = 2/674 (0%)
 Frame = +3

Query  294   AKPKLSSRK-KALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALK  470
              K K S++  KA  +AE+I  +PWS     S  A   PSLS+TTV+ ++  L+   KAL+
Sbjct  39    TKTKSSTKTVKATVMAEMINSKPWS-SDLESSLASLSPSLSQTTVLQTLGFLRDTSKALQ  97

Query  471   FFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIK  650
             FF WA++ G+  T Q YF MLE+LG  R+LNTARNFLFSI KRS G V LEARFFNSL++
Sbjct  98    FFNWAQEMGYTHTEQSYFSMLEILGRNRHLNTARNFLFSIEKRSRGIVKLEARFFNSLMR  157

Query  651   NYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVK  830
             N+  AGLFQES+K+FT MK  G+SPSVVTFN+L +IL+KRGRT M  +++DEML T+GV 
Sbjct  158   NFNRAGLFQESIKVFTIMKSHGVSPSVVTFNSLLTILLKRGRTNMAKKVYDEMLSTYGVT  217

Query  831   PDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNV  1010
             PD +TFNILIRG CMN MVD GFR F ++ +  CEPDV+TYNT+VDGLCRAGKV +A+NV
Sbjct  218   PDTFTFNILIRGFCMNGMVDDGFRIFNDLSRFGCEPDVVTYNTLVDGLCRAGKVTVAYNV  277

Query  1011  VKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGL  1190
             VKGM KK  DL+PNVVTYTTL+RGYC K+++E+AL VF+EMV++G + N++TYNTLI+GL
Sbjct  278   VKGMGKKSVDLNPNVVTYTTLIRGYCAKREIEKALAVFEEMVNQGLKANNITYNTLIKGL  337

Query  1191  LEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPD  1370
              EARKF+K+K++ +G   DG F PDTCTFNTL+H HC  GNL  AL+ FE+MS L   PD
Sbjct  338   CEARKFEKIKDILEGTAGDGTFSPDTCTFNTLMHCHCHAGNLDDALKVFERMSELKIQPD  397

Query  1371  SATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTK  1550
             SATYS L+R LCQ G +E AE   D+L +   LLS  GC+P+VAAYNP+FKYLCE GKTK
Sbjct  398   SATYSALVRSLCQGGHYEKAEDLLDKLLERKILLSGDGCKPLVAAYNPIFKYLCETGKTK  457

Query  1551  KAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLE  1730
             KAEK FRQLMR G QDP ++KTLIMG+  EG  E G+ELLV MLR++F+PDFETYESL+ 
Sbjct  458   KAEKAFRQLMRRGTQDPPSYKTLIMGHCKEGTFESGYELLVLMLRKDFLPDFETYESLIN  517

Query  1731  GLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQ  1910
             GLL   KP LA  +LE+ML+SSH P +  FHSIL +L++Q    E A L+ LML K IRQ
Sbjct  518   GLLHMDKPLLALQSLEKMLRSSHRPNSSTFHSILAKLLEQGRTSESASLIQLMLDKNIRQ  577

Query  1911  NINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFS  2090
             N++ ST  VR+LF AG+ ++AF+++  LY  GY V M+ELI +L   +K+ +   LLLFS
Sbjct  578   NLSFSTGCVRLLFGAGMNDKAFQLVHLLYGKGYSVKMEELIRYLCHCRKVIQGSKLLLFS  637

Query  2091  LKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRS  2270
             L++ Q V +++C+TV+  LC+  +  EAF LYY+LVE  +   L+C   L++ LE   + 
Sbjct  638   LESHQFVDMDLCNTVIFQLCEINKLSEAFSLYYKLVEMGVHQQLSCQNQLKVSLEAGEKL  697

Query  2271  KEAEFVAKRMPRLE  2312
             +EAEFV+KRM  +E
Sbjct  698   EEAEFVSKRMEPVE  711



>ref|XP_008444214.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Cucumis melo]
 ref|XP_008444216.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Cucumis melo]
Length=757

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/678 (57%), Positives = 502/678 (74%), Gaps = 1/678 (0%)
 Frame = +3

Query  279   KLPDVAKPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPR  458
             +L +      +  +KA A+A +I  +PWS     S  A   PSLS+TTV+ ++  L+ P 
Sbjct  35    RLTETVTKSSTKTEKARAMARMINSKPWS-SDLESSLASLSPSLSKTTVLQTLGFLRDPP  93

Query  459   KALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFN  638
             KAL+FF WA++ G+  T Q YF MLE+LG  R+LNTARNFLFSI KRS G V LEARFFN
Sbjct  94    KALQFFNWAQEMGYTHTEQSYFSMLEILGRNRHLNTARNFLFSIEKRSRGIVKLEARFFN  153

Query  639   SLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKT  818
             SL++N++ AGLFQES+K+FT MK  G+SPSVVTFN+L +IL+KRGRT M   ++ EML T
Sbjct  154   SLMRNFSRAGLFQESIKVFTIMKSHGVSPSVVTFNSLLTILLKRGRTNMAKNVYYEMLST  213

Query  819   FGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEI  998
             +GV PD YTFNILIRG CMN MVD GFR F ++ +  CEPDV+TYNT+VDGLCRAGKV +
Sbjct  214   YGVTPDTYTFNILIRGFCMNGMVDDGFRIFNDLPRFGCEPDVVTYNTLVDGLCRAGKVTV  273

Query  999   AHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTL  1178
             A+N+ KGM KK  DL+PNVVTYTTL+RGYC K+++++AL VF+EMV++G + N++TYNTL
Sbjct  274   AYNLAKGMGKKSVDLNPNVVTYTTLIRGYCAKREIDKALAVFEEMVNQGLKANNITYNTL  333

Query  1179  IQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILN  1358
             I+GL EA+KF+K+KE+ +    DG F PDTCTFNTL+H HC  GNL  AL+ FE+MS L 
Sbjct  334   IKGLCEAQKFEKIKEILEATAGDGTFSPDTCTFNTLMHCHCHAGNLDDALKVFERMSELK  393

Query  1359  AAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCEN  1538
               PDSATYS+L R LCQ G +E AE   D+L +   LLSD  C+P+VA+YNP+FKYLCEN
Sbjct  394   IQPDSATYSVLARSLCQGGHYEKAEDLLDKLLERKILLSDDSCKPLVASYNPIFKYLCEN  453

Query  1539  GKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYE  1718
             GKTKKAEKVFRQLMR G QDP ++KTLIMG+  EG  E G+ELLV MLR++F+PDFE YE
Sbjct  454   GKTKKAEKVFRQLMRRGTQDPPSYKTLIMGHCKEGTFESGYELLVLMLRKDFLPDFEIYE  513

Query  1719  SLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVK  1898
             SL+ GLL   KP LA  +LE+MLKSSH P++  FHSIL +L++Q  A E A L+ LML K
Sbjct  514   SLINGLLHIDKPLLALQSLEKMLKSSHRPKSSTFHSILAKLLEQGSASESASLIQLMLDK  573

Query  1899  KIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDL  2078
              IRQN++ ST  VR+LF AG+ ++AF ++  LY  GY V M+ELI +L   +K+ +A  L
Sbjct  574   NIRQNLSFSTGCVRLLFGAGMNDKAFLLVHLLYKKGYSVKMEELIHYLCHCRKVIQASKL  633

Query  2079  LLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEV  2258
             LLFSL++ Q V +++C+TV+  LC+  +  EAF LYY+LVE  +   L+C   L++ LE 
Sbjct  634   LLFSLESHQFVDMDVCNTVIFQLCEISKLSEAFSLYYKLVEMGVHQQLSCQNQLKVSLEA  693

Query  2259  EGRSKEAEFVAKRMPRLE  2312
               + +EAEFV+KRM  +E
Sbjct  694   GEKLEEAEFVSKRMEPVE  711



>ref|XP_006592806.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like isoform X3 [Glycine max]
Length=734

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/677 (56%), Positives = 502/677 (74%), Gaps = 5/677 (1%)
 Frame = +3

Query  285   PDVAKPK-LSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRK  461
             P  ++P+  ++ K A  +A LI  +P+S    + L +    ++S+TTV+ ++RL+K P K
Sbjct  40    PQNSRPRSRNASKTAKTIANLINSKPFS----NGLLSSLLITISKTTVLRTLRLIKDPSK  95

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             AL+FF W +QKGF+ T + YF MLE+LG ERNLN ARNFLFSI K S G V LE RFFNS
Sbjct  96    ALRFFKWTQQKGFSHTPESYFIMLEILGRERNLNVARNFLFSIEKHSKGTVKLEDRFFNS  155

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             LI++YA AGLF+ES+KLF +MK I +SPSVVTFN+L SIL+KRGRT M  E++DEML T+
Sbjct  156   LIRSYAEAGLFKESMKLFQTMKSIAVSPSVVTFNSLMSILLKRGRTNMAKEVYDEMLGTY  215

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD  T+N+LIRG C NSMVD+GFRFF+EME   C+ DV+TYNT+VDGLCRAGKV IA
Sbjct  216   GVSPDTCTYNVLIRGFCKNSMVDEGFRFFREMESFNCDADVVTYNTLVDGLCRAGKVRIA  275

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
              N+V GM KK   L+PNVVTYTTL+RGYC KQ+VEEAL V +EM  RG +PN +TYNTL+
Sbjct  276   RNLVNGMGKKCEGLNPNVVTYTTLIRGYCMKQEVEEALVVLEEMTSRGLKPNMITYNTLV  335

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL EA K DK+K++ +    DG F PDT TFNT+IH HC  GNL  AL+ FE M     
Sbjct  336   KGLCEAHKLDKMKDVLERMKSDGGFSPDTFTFNTIIHLHCCAGNLDEALKVFESMKKFRI  395

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
               DSA+YS LIR LCQKGD++MAE+ FDELF+   LLS  G +P+ A+YNP+F+ LCE+G
Sbjct  396   PADSASYSTLIRSLCQKGDYDMAEQLFDELFEKEILLSKFGSKPLAASYNPIFESLCEHG  455

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KTKKAE+V RQLM+ G QDP ++ T+IMG+  EG  E G+ELL+WMLRR+F+PD E Y+ 
Sbjct  456   KTKKAERVIRQLMKRGTQDPQSYTTVIMGHCKEGAYESGYELLMWMLRRDFLPDIEIYDY  515

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L++G LQ+ KP LA +TLE+MLKSS+ P+T  +HS+L +L+++ CA E + ++V+ML K 
Sbjct  516   LIDGFLQKDKPLLAKETLEKMLKSSYQPKTSTWHSVLAKLLEKGCAHESSCVIVMMLEKN  575

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             +RQNINLST+++++LF     ERAFEI+  LY NGY V ++E+  FL +  KLSEA  LL
Sbjct  576   VRQNINLSTESLQLLFGREQHERAFEIINLLYKNGYYVKIEEVAQFLLKRGKLSEACKLL  635

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
             LFSL+N Q+V I++C+  +  LCK  +  EAF L YELVE  +   L CL+DL   LE  
Sbjct  636   LFSLENHQNVDIDLCNATILNLCKINKVSEAFSLCYELVENGLHQELTCLDDLIAALEEG  695

Query  2262  GRSKEAEFVAKRMPRLE  2312
             G+ +EA F++KR+PRL+
Sbjct  696   GKREEAAFISKRLPRLD  712



>ref|XP_006592805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like isoform X2 [Glycine max]
Length=743

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/677 (56%), Positives = 502/677 (74%), Gaps = 5/677 (1%)
 Frame = +3

Query  285   PDVAKPK-LSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRK  461
             P  ++P+  ++ K A  +A LI  +P+S    + L +    ++S+TTV+ ++RL+K P K
Sbjct  40    PQNSRPRSRNASKTAKTIANLINSKPFS----NGLLSSLLITISKTTVLRTLRLIKDPSK  95

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             AL+FF W +QKGF+ T + YF MLE+LG ERNLN ARNFLFSI K S G V LE RFFNS
Sbjct  96    ALRFFKWTQQKGFSHTPESYFIMLEILGRERNLNVARNFLFSIEKHSKGTVKLEDRFFNS  155

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             LI++YA AGLF+ES+KLF +MK I +SPSVVTFN+L SIL+KRGRT M  E++DEML T+
Sbjct  156   LIRSYAEAGLFKESMKLFQTMKSIAVSPSVVTFNSLMSILLKRGRTNMAKEVYDEMLGTY  215

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD  T+N+LIRG C NSMVD+GFRFF+EME   C+ DV+TYNT+VDGLCRAGKV IA
Sbjct  216   GVSPDTCTYNVLIRGFCKNSMVDEGFRFFREMESFNCDADVVTYNTLVDGLCRAGKVRIA  275

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
              N+V GM KK   L+PNVVTYTTL+RGYC KQ+VEEAL V +EM  RG +PN +TYNTL+
Sbjct  276   RNLVNGMGKKCEGLNPNVVTYTTLIRGYCMKQEVEEALVVLEEMTSRGLKPNMITYNTLV  335

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL EA K DK+K++ +    DG F PDT TFNT+IH HC  GNL  AL+ FE M     
Sbjct  336   KGLCEAHKLDKMKDVLERMKSDGGFSPDTFTFNTIIHLHCCAGNLDEALKVFESMKKFRI  395

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
               DSA+YS LIR LCQKGD++MAE+ FDELF+   LLS  G +P+ A+YNP+F+ LCE+G
Sbjct  396   PADSASYSTLIRSLCQKGDYDMAEQLFDELFEKEILLSKFGSKPLAASYNPIFESLCEHG  455

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KTKKAE+V RQLM+ G QDP ++ T+IMG+  EG  E G+ELL+WMLRR+F+PD E Y+ 
Sbjct  456   KTKKAERVIRQLMKRGTQDPQSYTTVIMGHCKEGAYESGYELLMWMLRRDFLPDIEIYDY  515

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L++G LQ+ KP LA +TLE+MLKSS+ P+T  +HS+L +L+++ CA E + ++V+ML K 
Sbjct  516   LIDGFLQKDKPLLAKETLEKMLKSSYQPKTSTWHSVLAKLLEKGCAHESSCVIVMMLEKN  575

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             +RQNINLST+++++LF     ERAFEI+  LY NGY V ++E+  FL +  KLSEA  LL
Sbjct  576   VRQNINLSTESLQLLFGREQHERAFEIINLLYKNGYYVKIEEVAQFLLKRGKLSEACKLL  635

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
             LFSL+N Q+V I++C+  +  LCK  +  EAF L YELVE  +   L CL+DL   LE  
Sbjct  636   LFSLENHQNVDIDLCNATILNLCKINKVSEAFSLCYELVENGLHQELTCLDDLIAALEEG  695

Query  2262  GRSKEAEFVAKRMPRLE  2312
             G+ +EA F++KR+PRL+
Sbjct  696   GKREEAAFISKRLPRLD  712



>ref|XP_003539494.2| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like isoform X1 [Glycine max]
Length=741

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/677 (56%), Positives = 502/677 (74%), Gaps = 5/677 (1%)
 Frame = +3

Query  285   PDVAKPK-LSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRK  461
             P  ++P+  ++ K A  +A LI  +P+S    + L +    ++S+TTV+ ++RL+K P K
Sbjct  38    PQNSRPRSRNASKTAKTIANLINSKPFS----NGLLSSLLITISKTTVLRTLRLIKDPSK  93

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             AL+FF W +QKGF+ T + YF MLE+LG ERNLN ARNFLFSI K S G V LE RFFNS
Sbjct  94    ALRFFKWTQQKGFSHTPESYFIMLEILGRERNLNVARNFLFSIEKHSKGTVKLEDRFFNS  153

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             LI++YA AGLF+ES+KLF +MK I +SPSVVTFN+L SIL+KRGRT M  E++DEML T+
Sbjct  154   LIRSYAEAGLFKESMKLFQTMKSIAVSPSVVTFNSLMSILLKRGRTNMAKEVYDEMLGTY  213

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD  T+N+LIRG C NSMVD+GFRFF+EME   C+ DV+TYNT+VDGLCRAGKV IA
Sbjct  214   GVSPDTCTYNVLIRGFCKNSMVDEGFRFFREMESFNCDADVVTYNTLVDGLCRAGKVRIA  273

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
              N+V GM KK   L+PNVVTYTTL+RGYC KQ+VEEAL V +EM  RG +PN +TYNTL+
Sbjct  274   RNLVNGMGKKCEGLNPNVVTYTTLIRGYCMKQEVEEALVVLEEMTSRGLKPNMITYNTLV  333

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL EA K DK+K++ +    DG F PDT TFNT+IH HC  GNL  AL+ FE M     
Sbjct  334   KGLCEAHKLDKMKDVLERMKSDGGFSPDTFTFNTIIHLHCCAGNLDEALKVFESMKKFRI  393

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
               DSA+YS LIR LCQKGD++MAE+ FDELF+   LLS  G +P+ A+YNP+F+ LCE+G
Sbjct  394   PADSASYSTLIRSLCQKGDYDMAEQLFDELFEKEILLSKFGSKPLAASYNPIFESLCEHG  453

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KTKKAE+V RQLM+ G QDP ++ T+IMG+  EG  E G+ELL+WMLRR+F+PD E Y+ 
Sbjct  454   KTKKAERVIRQLMKRGTQDPQSYTTVIMGHCKEGAYESGYELLMWMLRRDFLPDIEIYDY  513

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L++G LQ+ KP LA +TLE+MLKSS+ P+T  +HS+L +L+++ CA E + ++V+ML K 
Sbjct  514   LIDGFLQKDKPLLAKETLEKMLKSSYQPKTSTWHSVLAKLLEKGCAHESSCVIVMMLEKN  573

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             +RQNINLST+++++LF     ERAFEI+  LY NGY V ++E+  FL +  KLSEA  LL
Sbjct  574   VRQNINLSTESLQLLFGREQHERAFEIINLLYKNGYYVKIEEVAQFLLKRGKLSEACKLL  633

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
             LFSL+N Q+V I++C+  +  LCK  +  EAF L YELVE  +   L CL+DL   LE  
Sbjct  634   LFSLENHQNVDIDLCNATILNLCKINKVSEAFSLCYELVENGLHQELTCLDDLIAALEEG  693

Query  2262  GRSKEAEFVAKRMPRLE  2312
             G+ +EA F++KR+PRL+
Sbjct  694   GKREEAAFISKRLPRLD  710



>ref|XP_010544362.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Tarenaya hassleriana]
Length=676

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/662 (58%), Positives = 490/662 (74%), Gaps = 1/662 (0%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagpsls-ETTVIHSIRLLKTPRKALKFFVWAEQK  494
             K A ++A L+   PWS + ESSLS+L+      +TTV+ ++RL+KTP KAL+FF W  QK
Sbjct  12    KLARSVARLVNSNPWSEELESSLSSLSPSESFSKTTVLQTLRLVKTPAKALRFFDWVSQK  71

Query  495   GFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLF  674
             GF+   Q +F MLE+LG  RNLN ARNFLFSI KRSNG+V L+ RFFNSLI++Y  AGLF
Sbjct  72    GFSHNDQSFFLMLEVLGRARNLNVARNFLFSIRKRSNGSVKLQDRFFNSLIRSYGNAGLF  131

Query  675   QESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNI  854
             Q S+KLF +MK +G+SPSVVTFN+LFSIL+KRG+TGMV+ +FDEML T+GV PD YT+NI
Sbjct  132   QASIKLFETMKEMGVSPSVVTFNSLFSILLKRGKTGMVHNMFDEMLHTYGVTPDSYTYNI  191

Query  855   LIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKG  1034
             LIRG C +SMV +GFR FKEME+ +C P+V+TYNTIVDGLCRAGKV+IAHNVVKGM+KKG
Sbjct  192   LIRGFCKDSMVHEGFRLFKEMEQSKCHPNVVTYNTIVDGLCRAGKVKIAHNVVKGMMKKG  251

Query  1035  SDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDK  1214
             +DL PN+VTYTTLVRGYC K +++EAL VF+EM+ RG +PN +TYNTLI+GL EA+++++
Sbjct  252   TDLRPNIVTYTTLVRGYCMKHEIDEALAVFREMLTRGLKPNDITYNTLIKGLCEAQRYEE  311

Query  1215  VKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILI  1394
             +KE+    G+   F PD CT+N LI  HC  GNL AA + F +M  LN  PDSA+YSILI
Sbjct  312   IKEILDVGGKSSGFAPDACTYNILIAAHCDAGNLDAATKVFGEMVNLNVQPDSASYSILI  371

Query  1395  RCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQ  1574
             R  CQ+ DFE AE   +EL +   LL   GC+P+ AAYNP+F YLC NGKT+KAEKVFRQ
Sbjct  372   RNFCQRKDFERAEALLNELLEKEILLGKDGCKPLFAAYNPVFTYLCANGKTEKAEKVFRQ  431

Query  1575  LMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKP  1754
             LM+ G QD  ++KTLIMG   EG  +  +ELLV MLR++F P+FE YE L+ GLL++G+ 
Sbjct  432   LMKRGTQDSPSYKTLIMGFCREGKFKAAYELLVLMLRQDFEPEFEIYEFLINGLLKKGEA  491

Query  1755  RLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDT  1934
              +AY TL++ML+SSHLP   VFHSIL ELVK  C  E   L+ LML K IRQN++LST  
Sbjct  492   AIAYKTLQKMLRSSHLPGAIVFHSILAELVKAKCPNESFGLLKLMLEKGIRQNMDLSTHA  551

Query  1935  VRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVC  2114
             V  LF +G K++ F+I+  LYDNGYLV+M++L+  L + + + EA  LLLF ++ SQSV 
Sbjct  552   VISLFSSGQKDKGFQIVTLLYDNGYLVDMEKLLHSLCESRNMLEAHRLLLFCMERSQSVD  611

Query  2115  IEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                C TV+  LC+  R  EAF LYYELVE+     LNC + LR  LE  G+  E  FV K
Sbjct  612   TRTCDTVIEELCRRKRPSEAFGLYYELVEKGNHQQLNCHDVLRNALEAAGKRDELHFVLK  671

Query  2295  RM  2300
             RM
Sbjct  672   RM  673



>ref|XP_003622527.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES78745.1| PPR containing plant-like protein [Medicago truncatula]
Length=721

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/668 (56%), Positives = 499/668 (75%), Gaps = 4/668 (1%)
 Frame = +3

Query  309   SSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAE  488
             ++ K A  +A LI ++PWS +    L +    SLS+TTV  ++R +K P KA  FF W  
Sbjct  54    NNSKTAKTIANLINYKPWSDE----LLSSFTTSLSKTTVFQTLRHIKVPTKAFLFFNWIH  109

Query  489   QKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAG  668
             +KGF+   Q YF MLE+LG E+NLN ARNFL+SI KRSNG V LE RFFNSLI++Y  AG
Sbjct  110   EKGFSHNPQTYFIMLEILGREKNLNIARNFLYSIEKRSNGEVKLEDRFFNSLIRSYGEAG  169

Query  669   LFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTF  848
             LF+ES+KLF +MK+IG+SP VVTFN++  +L+KRGRT M  E++DEMLKT+GVKPD YT+
Sbjct  170   LFKESVKLFENMKLIGVSPGVVTFNSVLLVLLKRGRTNMAKEVYDEMLKTYGVKPDTYTY  229

Query  849   NILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLK  1028
             NILIRG C NSMVD+GF FFKEM   +C+PDV+TYNT+VDGLCRAGK+++AHN+V GM K
Sbjct  230   NILIRGFCKNSMVDEGFYFFKEMTSFDCDPDVVTYNTLVDGLCRAGKIKVAHNLVNGMSK  289

Query  1029  KGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKF  1208
             K  DLSP+VVTYTTL+RGYC KQ+V+EAL++ +EM  RG +PN VTYNTLI+GL EA+K+
Sbjct  290   KCKDLSPDVVTYTTLIRGYCRKQEVDEALDILEEMNGRGLKPNIVTYNTLIKGLCEAQKW  349

Query  1209  DKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSI  1388
             DK+KE+ +    DG  +PD CTFNTLI++HC  GNL  A + FE M  L  + DSA+YS+
Sbjct  350   DKMKEILEQMKGDGGSIPDACTFNTLINSHCCAGNLDEAFKVFENMKKLEVSADSASYSV  409

Query  1389  LIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVF  1568
             LIR LCQKGD+  AE  FDELF+   LLS  G +P+ A+Y  MF+YLCENGKTKKAE+V 
Sbjct  410   LIRTLCQKGDYGKAEMLFDELFEKEILLSSYGPKPLAASYKCMFQYLCENGKTKKAERVL  469

Query  1569  RQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEG  1748
             RQLM+ G QDPL+++ +I+G+  EG  E+G+ LLVWMLRR+F+PD + Y+ L++G L++ 
Sbjct  470   RQLMKRGTQDPLSYQIVILGHCKEGSYENGYGLLVWMLRRDFLPDIDIYDYLIDGFLRKD  529

Query  1749  KPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
             KP LA +TLE+MLKSS+ P+T  +HSIL  L++Q C  E A ++V+ML + IRQNIN ST
Sbjct  530   KPLLAKETLEKMLKSSYKPQTSTWHSILNRLLEQGCVHESAGVIVMMLERNIRQNINFST  589

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
               +++LF  GL+++AF+I   +Y NG+ V M E++ FL   ++  EA  LLLFSLKN+++
Sbjct  590   KCLQLLFDRGLQDKAFKITELIYKNGFCVKMDEVVQFLCNKRRALEACKLLLFSLKNNEN  649

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFV  2288
             + I +C+ V+  LCK  +A EAF L YELV++ +   L CL DL   LE  GR++EA F+
Sbjct  650   IDIGLCNIVILDLCKLNKASEAFSLCYELVDKGLHQDLICLNDLVAALEAGGRTEEAAFI  709

Query  2289  AKRMPRLE  2312
             +KR+PR E
Sbjct  710   SKRVPRPE  717



>ref|XP_007138408.1| hypothetical protein PHAVU_009G206300g [Phaseolus vulgaris]
 gb|ESW10402.1| hypothetical protein PHAVU_009G206300g [Phaseolus vulgaris]
Length=728

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/681 (56%), Positives = 502/681 (74%), Gaps = 7/681 (1%)
 Frame = +3

Query  285   PDVAKPKLSSR---KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTP  455
             P+    +L SR   K A  +A+LI  +PWS    ++L +     LS+TTV+ ++RL+K P
Sbjct  35    PESPNARLRSRNASKTAKNMADLINSKPWS----NALVSPLPTPLSKTTVLRTLRLIKDP  90

Query  456   RKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFF  635
              KAL FF WA+Q GF  T+Q YF ML++LG  RNLN ARN LFSI K+SNG V L  RFF
Sbjct  91    SKALHFFKWAQQSGFPHTAQSYFIMLQILGRHRNLNVARNLLFSIEKKSNGTVKLGDRFF  150

Query  636   NSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLK  815
             N+LI++YA AGLF+ESLKLF +MK + +SPSVVTFN++ SIL+KRGRT M  E++DEML 
Sbjct  151   NTLIRSYAEAGLFKESLKLFQTMKSVAVSPSVVTFNSVLSILLKRGRTNMAKEVYDEMLH  210

Query  816   TFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVE  995
             T+GV PD+ T+N+LIRG C NSMVD+GFRFF EM    C+PD++TYNT+VDGLCRAGKV 
Sbjct  211   TYGVTPDICTYNVLIRGFCKNSMVDEGFRFFNEMATVNCDPDIVTYNTLVDGLCRAGKVR  270

Query  996   IAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNT  1175
             IA N+V  M KK   L+PNVVTYTTL+RGYC KQ+V+EAL V +EM  RG EPN +TYNT
Sbjct  271   IARNLVNAMTKKCEGLNPNVVTYTTLIRGYCMKQEVDEALVVLEEMSGRGIEPNMITYNT  330

Query  1176  LIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSIL  1355
             LI+GL EA K DK+K++ K   ++G F PDT TFNT+IH+HC  GNL  AL+ FE M   
Sbjct  331   LIKGLCEAHKLDKMKDVLKWMKDNGGFSPDTFTFNTIIHSHCCAGNLDEALKVFESMKKF  390

Query  1356  NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCE  1535
                 DSA+YS LIR LCQKGD++MAE  FDELF+   LL + G +P+VAAY+P+F+YLCE
Sbjct  391   QVRMDSASYSTLIRSLCQKGDYDMAELLFDELFEKEILLCNFGSKPLVAAYSPLFQYLCE  450

Query  1536  NGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETY  1715
             +GK+KKAE+V RQLM+ G QD  ++KTLIMG+  EG  E G+E LVWMLRR+F+PD + Y
Sbjct  451   HGKSKKAERVMRQLMKRGTQDAQSYKTLIMGHCKEGAYESGYEFLVWMLRRDFLPDVDIY  510

Query  1716  ESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLV  1895
             + L++G L + KP LA +TLE+MLKSS+ P+T  +HSIL +L+++ CA E A ++++ML 
Sbjct  511   DYLIDGFLLKNKPLLAKETLEKMLKSSYQPKTATWHSILAKLLEKGCAHESACVIMMMLE  570

Query  1896  KKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARD  2075
             K +RQNIN+ST+++++LF  G  ERAFEI+  LY NGY V ++E++ FL +  KLSEA  
Sbjct  571   KNVRQNINMSTESLKLLFGCGQHERAFEIIDLLYKNGYRVKIEEVVQFLFERGKLSEACK  630

Query  2076  LLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLE  2255
             LLLFSL+  Q+V I++C+ ++  LCKA +  EAF L Y LVE  +   L CL DL   LE
Sbjct  631   LLLFSLEIHQNVDIDLCNAIVLNLCKANKVSEAFNLCYGLVENGLCQELTCLNDLMAALE  690

Query  2256  VEGRSKEAEFVAKRMPRLEGA  2318
               GR +EA F++KR+P+LE +
Sbjct  691   ERGRREEAVFISKRLPKLENS  711



>ref|XP_004510607.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Cicer arietinum]
Length=740

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/679 (55%), Positives = 497/679 (73%), Gaps = 5/679 (1%)
 Frame = +3

Query  279   KLPDVAKPKL-SSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTP  455
             +L    KPK  ++ K A  +  LI F+PWS    + L +    SLS+TTV+ ++R +K P
Sbjct  47    QLVQTEKPKTRNASKTAKTIVNLINFKPWS----NGLLSSFTNSLSKTTVLQTLRHIKFP  102

Query  456   RKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFF  635
              KA  FF W  + GF+  SQ YF MLE+LG E+NLN ARNFLFSI KRSNG V LE RFF
Sbjct  103   SKAFHFFNWVHENGFSHNSQSYFIMLEILGREKNLNVARNFLFSIEKRSNGEVKLEDRFF  162

Query  636   NSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLK  815
             NSLI++Y  AGLF+ES+KLF +MK IG+SPSV+TFN++  IL++RGRT M  E+FDEML 
Sbjct  163   NSLIRSYGEAGLFKESIKLFQTMKSIGVSPSVITFNSVLLILLRRGRTNMAKEVFDEMLS  222

Query  816   TFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVE  995
             T+GV PD YT+NILIRG C NSMVD+GF FFKEM    C+PDV+TYNT+VDGLCRAGK++
Sbjct  223   TYGVTPDTYTYNILIRGFCKNSMVDEGFHFFKEMTSFNCDPDVVTYNTLVDGLCRAGKIK  282

Query  996   IAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNT  1175
              AHN+V GM KK   LSP+VVTYTTL+RGYC KQ+V EAL + +EM  RG +PN VTYNT
Sbjct  283   TAHNLVNGMSKKCGGLSPDVVTYTTLIRGYCMKQEVNEALVILEEMNGRGLKPNIVTYNT  342

Query  1176  LIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSIL  1355
             LI+GL EA+K+DK+K++ +    D   +PD CTFNTLI++HC  GNL  A + FE M  L
Sbjct  343   LIKGLCEAQKWDKMKDILEQMKGDSGAIPDACTFNTLINSHCCAGNLDEAFKVFENMKKL  402

Query  1356  NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCE  1535
               + DSA+YS+LIR LCQ G+++ AE  FDELF+   LL  +G +P+ A+Y  +F+YLCE
Sbjct  403   QVSADSASYSVLIRSLCQIGNYDKAEMLFDELFENEILLRSSGPKPLAASYKRIFQYLCE  462

Query  1536  NGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETY  1715
             +GKTKKAE+V RQLM+ G QDPL++KT+I+G+  EG  E+G+ELL+WMLRR+F+PD + Y
Sbjct  463   HGKTKKAERVLRQLMKRGTQDPLSYKTVILGHCKEGAFENGYELLIWMLRRDFLPDIDIY  522

Query  1716  ESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLV  1895
             + L++G LQ+ KP LA + LE+M+KSS+ P+T  +HS+L  L++++C  E A ++V ML 
Sbjct  523   DYLIDGFLQKDKPLLAMEALEKMVKSSYQPKTSTWHSVLARLLEKDCVHESASVLVAMLE  582

Query  1896  KKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARD  2075
             K IRQNINLST  +++LF  GL++RAF+I   +Y NGY V M E++ FL +  + SEA  
Sbjct  583   KNIRQNINLSTKCLQLLFDRGLQDRAFKINELIYKNGYCVKMDEVVQFLCKRGRASEACK  642

Query  2076  LLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLE  2255
             +LLFSLKN+    I++C+TV+  LCK  +A EAF L YELVE+ +   L C+ DL   LE
Sbjct  643   MLLFSLKNNHKFDIDLCNTVILDLCKINKASEAFSLCYELVEKGLNHDLICINDLVAALE  702

Query  2256  VEGRSKEAEFVAKRMPRLE  2312
               GR+ EA F++KR+PR E
Sbjct  703   AGGRTAEAAFISKRIPRTE  721



>ref|XP_004308525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=1128

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/665 (58%), Positives = 497/665 (75%), Gaps = 6/665 (1%)
 Frame = +3

Query  324   ALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFA  503
             A A+A LI   PWS     S  +   PS+S TTV  ++R +KTP +A+KFF W E  GF+
Sbjct  51    AQAMASLINSTPWS-PHLQSSLSSLSPSISTTTVSQTLRRIKTPSQAIKFFNWVESLGFS  109

Query  504   LTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQES  683
              TS  YF +LELLG  RNLN ARNFLFSI KRSNG V LE +FFNSLI++Y  AGLFQE+
Sbjct  110   HTSHSYFTILELLGRNRNLNAARNFLFSIEKRSNGKVKLEDKFFNSLIRSYGAAGLFQEA  169

Query  684   LKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIR  863
             + +F +MK +GIS SV +FN+LFS+L+KRGRT MV  ++DEML  +GV+PD +TFNILIR
Sbjct  170   VNVFKTMKSMGISASVFSFNSLFSVLLKRGRTSMVRNVYDEMLGMYGVEPDTHTFNILIR  229

Query  864   GCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSD-  1040
             G CM+SMVD+GF FFKEME+ +CEPDV+TYNT+VDGLCR GKVEIA NVVKGM+ K S+ 
Sbjct  230   GFCMSSMVDEGFWFFKEMERFKCEPDVVTYNTLVDGLCRDGKVEIARNVVKGMMSKSSEG  289

Query  1041  ----LSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKF  1208
                 L+PNVVTYTTL+RGYC +Q+V+EAL V +EM  +G +PN +TYNTL +GL EA++ 
Sbjct  290   ELNQLNPNVVTYTTLIRGYCVRQEVDEALGVLEEMTSQGMKPNEITYNTLFKGLCEAKRL  349

Query  1209  DKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSI  1388
             DK+KE+ +GA     F PDTCTFNTL+H+HC  GNL+ AL+ F  MS L   PDSATYS+
Sbjct  350   DKIKEILEGAMRGEGFTPDTCTFNTLMHSHCIAGNLEEALKVFRMMSELKVPPDSATYSV  409

Query  1389  LIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVF  1568
             LIR  C++ D+  AE+ FDEL K   LLSD GC P+VA+Y P+F+YLC NG+TKKA++VF
Sbjct  410   LIRSWCERRDYSKAEELFDELSKKQILLSDCGCTPIVASYKPIFEYLCSNGRTKKADEVF  469

Query  1569  RQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEG  1748
             RQL++ G QDP +FKTLIMG+  EG  E G++L+V MLRR++VPD + Y+SL++G L++G
Sbjct  470   RQLLKRGTQDPPSFKTLIMGHCREGTYEAGYKLVVLMLRRDYVPDVKIYDSLIDGFLEKG  529

Query  1749  KPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
              P LA  TLE+MLKSSHLPRT  FHSIL  L++++CA E A L  LML K  R NI+LST
Sbjct  530   NPLLAQQTLEKMLKSSHLPRTSTFHSILAALLEKHCARESASLFSLMLEKNFRPNIDLST  589

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
             D +++LF  GL+E+AF+I+G L+D GY + ++EL+ FL Q +KL EA +LL FSL+  ++
Sbjct  590   DLLKLLFSEGLQEKAFKIVGLLHDGGYSIKLEELVKFLCQSRKLLEACELLQFSLRKQEN  649

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFV  2288
             V I+I   V+  LC+  + +EAF LYYEL+E      L CL  L+  LEV GRS EA+FV
Sbjct  650   VSIDILDQVILGLCEINKLREAFGLYYELIENGDHGQLPCLHHLKSSLEVAGRSVEADFV  709

Query  2289  AKRMP  2303
             +KRMP
Sbjct  710   SKRMP  714



>ref|NP_171708.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|O81908.2|PPR2_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE27372.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=710

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/672 (57%), Positives = 493/672 (73%), Gaps = 4/672 (1%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsala-gpslsETTVIHSIRLLKTPRKALKFFVWAEQK  494
             K A +LA  +   PWS + ESSLS+L    ++S TTV+ ++RL+K P   L+FF W   K
Sbjct  35    KLARSLARAVNSNPWSDELESSLSSLHPSQTISRTTVLQTLRLIKVPADGLRFFDWVSNK  94

Query  495   GFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLF  674
             GF+   Q +F MLE LG  RNLN ARNFLFSI +RSNG V L+ R+FNSLI++Y  AGLF
Sbjct  95    GFSHKEQSFFLMLEFLGRARNLNVARNFLFSIERRSNGCVKLQDRYFNSLIRSYGNAGLF  154

Query  675   QESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNI  854
             QES+KLF +MK +GISPSV+TFN+L SIL+KRGRTGM ++LFDEM +T+GV PD YTFN 
Sbjct  155   QESVKLFQTMKQMGISPSVLTFNSLLSILLKRGRTGMAHDLFDEMRRTYGVTPDSYTFNT  214

Query  855   LIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKG  1034
             LI G C NSMVD+ FR FK+ME + C PDV+TYNTI+DGLCRAGKV+IAHNV+ GMLKK 
Sbjct  215   LINGFCKNSMVDEAFRIFKDMELYHCNPDVVTYNTIIDGLCRAGKVKIAHNVLSGMLKKA  274

Query  1035  SDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDK  1214
             +D+ PNVV+YTTLVRGYC KQ+++EA+ VF +M+ RG +PN+VTYNTLI+GL EA ++D+
Sbjct  275   TDVHPNVVSYTTLVRGYCMKQEIDEAVLVFHDMLSRGLKPNAVTYNTLIKGLSEAHRYDE  334

Query  1215  VKELFKGAGEDG--RFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSI  1388
             +K++  G G D    F PD CTFN LI  HC  G+L AA++ F++M  +   PDSA+YS+
Sbjct  335   IKDILIG-GNDAFTTFAPDACTFNILIKAHCDAGHLDAAMKVFQEMLNMKLHPDSASYSV  393

Query  1389  LIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVF  1568
             LIR LC + +F+ AE  F+ELF+   LL    C+P+ AAYNPMF+YLC NGKTK+AEKVF
Sbjct  394   LIRTLCMRNEFDRAETLFNELFEKEVLLGKDECKPLAAAYNPMFEYLCANGKTKQAEKVF  453

Query  1569  RQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEG  1748
             RQLM+ GVQDP ++KTLI G+  EG  +  +ELLV MLRR FVPD ETYE L++GLL+ G
Sbjct  454   RQLMKRGVQDPPSYKTLITGHCREGKFKPAYELLVLMLRREFVPDLETYELLIDGLLKIG  513

Query  1749  KPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
             +  LA+DTL+RML+SS+LP    FHS+L EL K+  A E   LV LML K+IRQNI+LST
Sbjct  514   EALLAHDTLQRMLRSSYLPVATTFHSVLAELAKRKFANESFCLVTLMLEKRIRQNIDLST  573

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
               VR+LF +  KE+AF I+  LYDNGYLV M+EL+ +L + +KL +A  L+LF L+ SQ 
Sbjct  574   QVVRLLFSSAQKEKAFLIVRLLYDNGYLVKMEELLGYLCENRKLLDAHTLVLFCLEKSQM  633

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFV  2288
             V I+ C+TV+  LCK  R  EAF LY ELVE      L+C   LR  LE  G+ +E +FV
Sbjct  634   VDIDTCNTVIEGLCKHKRHSEAFSLYNELVELGNHQQLSCHVVLRNALEAAGKWEELQFV  693

Query  2289  AKRMPRLEGALD  2324
             +KRM  L  + D
Sbjct  694   SKRMATLRESDD  705



>gb|KFK42575.1| hypothetical protein AALP_AA1G013500 [Arabis alpina]
Length=716

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/684 (56%), Positives = 493/684 (72%), Gaps = 3/684 (0%)
 Frame = +3

Query  291   VAKPKLSSRKKALALAELIKFQPWSPQTEsslsalagps-lsETTVIHSIRLLKTPRKAL  467
             V+    +  K A ++A  +   PWS + ESSLS+L     +S TTV+ ++RL+K P   L
Sbjct  26    VSNEASTKSKLARSMARAVNSTPWSDEVESSLSSLHSSEPISRTTVLQTLRLIKNPADGL  85

Query  468   KFFVW-AEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSL  644
             +FF W + +KGF+     +F MLE LG  RNLN ARNFLFSI KRS+G V LE R+FNSL
Sbjct  86    RFFDWVSNKKGFSHKEHSFFLMLEFLGRARNLNVARNFLFSIEKRSSGCVKLEDRYFNSL  145

Query  645   IKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFG  824
             I++Y  AGLFQES+KLF +MK +G+SPSVVTFN L SIL+KRG+TGM +++FDEM +T+G
Sbjct  146   IRSYGNAGLFQESVKLFETMKKMGVSPSVVTFNCLLSILLKRGKTGMAHDVFDEMRRTYG  205

Query  825   VKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAH  1004
             V PD +TFNILIRG C NSMVD+ FR FKEME ++C PDV+TYNTI+DGLCRAGKV+IAH
Sbjct  206   VTPDAFTFNILIRGFCKNSMVDEAFRVFKEMETYKCSPDVVTYNTIIDGLCRAGKVKIAH  265

Query  1005  NVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD-RGPEPNSVTYNTLI  1181
             NV+ GM+KK +D+ PN+V+YTTL+RGYC KQ ++EAL VF EM+  RG +PN+VT+NTLI
Sbjct  266   NVLNGMMKKTTDVHPNIVSYTTLLRGYCMKQDIDEALVVFHEMLSSRGLKPNAVTFNTLI  325

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL EA+++D++KE+  G      F PD CTFN LI  HC  G+L AA++ F++M  +  
Sbjct  326   KGLSEAQRYDEIKEILNGGDSFTTFAPDACTFNILIKAHCDAGHLDAAMKVFQEMENMKL  385

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
              PDSA+YS+LIR LC + +F+ A+  FDELF    LL   GC+P+ AAYNPMF+YLC NG
Sbjct  386   QPDSASYSVLIRTLCVRNEFDRAKTLFDELFDKEVLLGKDGCKPLAAAYNPMFEYLCANG  445

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
             KTK+AEKVFRQLM+ G QDP +++TLI G+  EG  +  +ELLV MLRR FVPD ETYE 
Sbjct  446   KTKQAEKVFRQLMKRGAQDPPSYRTLITGHCREGKFKAAYELLVLMLRREFVPDLETYEL  505

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L+ GLL+ G+  LAYDTL+RML+SS+LP    F S+L ELVK   A E   +V LML K+
Sbjct  506   LIGGLLKIGEAVLAYDTLQRMLRSSYLPVATTFLSVLAELVKGKFANESFSIVSLMLEKQ  565

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             IRQNI+LSTD VR+LF    KE+AF I+  LYDNGYLV M+EL+ FL + +KL +A  L+
Sbjct  566   IRQNIDLSTDAVRLLFSNSQKEKAFLIVRLLYDNGYLVKMEELLEFLCENRKLVDAHKLV  625

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
             LF L+ SQ V I  C+TV+  LCK  R  EAF LY ELVE      L+C   L+  LE  
Sbjct  626   LFCLEKSQMVDIGTCNTVIEGLCKDKRHSEAFSLYNELVELGNHQQLSCHVVLKNALEAA  685

Query  2262  GRSKEAEFVAKRMPRLEGALDYIG  2333
             G+ +E EFV+KRM  L  + D  G
Sbjct  686   GKLEELEFVSKRMATLRKSDDCNG  709



>ref|XP_006418483.1| hypothetical protein EUTSA_v10006939mg [Eutrema salsugineum]
 gb|ESQ36836.1| hypothetical protein EUTSA_v10006939mg [Eutrema salsugineum]
Length=720

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/675 (57%), Positives = 489/675 (72%), Gaps = 3/675 (0%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagps--lsETTVIHSIRLLKTPRKALKFFVWAEQ  491
             K A ++A  +  +PWS + ESSLS+L  PS  +S TTV+ ++RL+K P   L+FF W   
Sbjct  39    KLARSMARAVNSKPWSDEVESSLSSLLHPSESISRTTVLQTLRLIKIPADGLRFFDWVSN  98

Query  492   KGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGL  671
             KGF+     +F MLELLG  RNLN ARNFLFSI KRSNG V LE R+FNSLI++Y  AGL
Sbjct  99    KGFSHKEHSFFLMLELLGRARNLNVARNFLFSIEKRSNGCVQLEDRYFNSLIRSYGNAGL  158

Query  672   FQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFN  851
             FQES+KLF +MK + ISPSV+TFN+L SIL+KRG+TGM  ++FDEM +T+G+ PD YTFN
Sbjct  159   FQESVKLFEAMKKMCISPSVLTFNSLLSILLKRGKTGMALDVFDEMRRTYGLTPDSYTFN  218

Query  852   ILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKK  1031
             ILI G C NSMVD+ FR FK+ME ++C PDV+TYNTI+DGLCRAGKV+IAHNV+ GMLKK
Sbjct  219   ILISGLCKNSMVDEAFRIFKDMEPYKCSPDVVTYNTIIDGLCRAGKVKIAHNVLNGMLKK  278

Query  1032  GSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFD  1211
              +D+ PN V+YTTLVRGYC KQ+++EAL VF +M+ RG +PN VT+NTLI+GL EA+++D
Sbjct  279   AADVHPNTVSYTTLVRGYCMKQEIDEALVVFHDMLTRGLKPNVVTFNTLIKGLSEAQRYD  338

Query  1212  KVKELFKGAG-EDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSI  1388
             ++KE+  G       F PD CTFN LI  HC  G+L AA++ F +M  +   PDSA+YS+
Sbjct  339   EIKEILNGRDYTSTTFAPDACTFNILIKAHCDAGHLDAAMKVFHQMVNMKLHPDSASYSV  398

Query  1389  LIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVF  1568
             LIR LC + +F+ A   F+ELF+   LL   GC+P+ AAYNPMF+YLC NGKTK+AEKVF
Sbjct  399   LIRTLCLRNEFDRAATLFNELFEKEVLLGKDGCKPLAAAYNPMFQYLCANGKTKQAEKVF  458

Query  1569  RQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEG  1748
             RQLM+ G QDP +++TLI G+  EG  +  +ELLV MLRR FVPD ETYE L++GLL+ G
Sbjct  459   RQLMKRGAQDPPSYRTLIAGHCREGKFKAAYELLVLMLRREFVPDLETYEILIDGLLKVG  518

Query  1749  KPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
             +  LAYDTL+RML+SS+LP    FHS+L ELVK   A E    + LML K+IRQNI+LST
Sbjct  519   EAVLAYDTLQRMLRSSYLPAATTFHSVLAELVKGKFANESFGFMRLMLEKRIRQNIDLST  578

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
               VR+LF +G K++AF I+  LYDNGYLV M+EL+ FL +  KL +A  L+LF L+ SQ 
Sbjct  579   HAVRLLFSSGQKDKAFLIVRLLYDNGYLVKMEELLDFLCENGKLLDAYRLVLFCLEKSQV  638

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFV  2288
             V I  C++V+  LCK  R  EAF LY ELVE      L+C   LR  LE  GR +E +FV
Sbjct  639   VDIGTCNSVIEGLCKHKRHSEAFSLYNELVELGNHQQLSCHVVLRNALEAAGRLEELQFV  698

Query  2289  AKRMPRLEGALDYIG  2333
             +KRM  L  A D  G
Sbjct  699   SKRMATLRKADDCYG  713



>gb|EYU20150.1| hypothetical protein MIMGU_mgv1a002588mg [Erythranthe guttata]
Length=656

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/649 (57%), Positives = 467/649 (72%), Gaps = 13/649 (2%)
 Frame = +3

Query  354   QPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRML  533
             +PW+   ES LS    P   +T    ++R +KTP  AL+FF WA+  GF      YF ML
Sbjct  14    KPWAAPLESRLSTALTPLS-QTAFFQTLRRIKTPSNALRFFNWAQSSGFTHNHHSYFIML  72

Query  534   ELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVI  713
             ++LG  R+LN ARNFLFSIPK+SN  VPL  +FFNSLI++Y  AGL+QESLK+F  MK +
Sbjct  73    QILGRARHLNPARNFLFSIPKKSNNTVPLTDKFFNSLIRSYGDAGLYQESLKIFQVMKSM  132

Query  714   GISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQ  893
              +SPS VTFN+LFSIL+KRGR GMV+EL++EMLKT+G KPD YTFN+LIRG CMNS VD+
Sbjct  133   AVSPSTVTFNSLFSILLKRGRMGMVFELYNEMLKTYGAKPDSYTFNVLIRGLCMNSSVDE  192

Query  894   GFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTL  1073
              FR FKEMEK +C+PD+ITYNTIVDGLCR GKV IA NVV G+ K   DL PNVVTYTTL
Sbjct  193   AFRMFKEMEKFDCKPDLITYNTIVDGLCRTGKVSIARNVVTGLFKTCEDLRPNVVTYTTL  252

Query  1074  VRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGR  1253
             +RGYC K+++EEA +VF+EM+  G  PN +T NTLIQGL E+RKFD +KE+ +  G  G 
Sbjct  253   IRGYCGKREIEEAFDVFREMIGGGITPNEITCNTLIQGLCESRKFDMIKEVLRECG--GT  310

Query  1254  FVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAE  1433
              VPDTCTFNT+++ HC+ GNL+ AL  FEKM  +N   DSATYS++IR LC+KG FE AE
Sbjct  311   IVPDTCTFNTMMNAHCNSGNLEEALIFFEKMKEMNVKRDSATYSVIIRALCEKGSFEKAE  370

Query  1434  KFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFK  1613
             +  DELF    LL    C P++AAYNP+F YLC NGKTKKAE+VFRQLM+ G  DP+ F+
Sbjct  371   ELLDELFGEEILLRGDNCTPIIAAYNPIFNYLCTNGKTKKAERVFRQLMKRGTHDPIAFE  430

Query  1614  TLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKS  1793
             TLI G   EG  +D H LL+ MLRR+F+P  + YESL++GLL++ +  LA+DTLE+ML+S
Sbjct  431   TLIFGQCKEGNFQDAHNLLILMLRRDFLPSVKIYESLIDGLLKKKEANLAHDTLEKMLRS  490

Query  1794  SHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERA  1973
              ++PR   FH +L ELV++  A E ADL+ LML K+IR N+NLSTD VR+LFK  + ++A
Sbjct  491   KYIPRASKFHGVLMELVEKEYAKESADLMGLMLEKEIRPNVNLSTDVVRVLFKNCMNDKA  550

Query  1974  FEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCK  2153
             FEIL  LY N Y+VNM+EL+ FL  G KL E          N Q V   +   V+++LCK
Sbjct  551   FEILTSLYGNSYVVNMEELVSFLCGGGKLVE----------NDQIVDSGLFDRVVTSLCK  600

Query  2154  ACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
                A E F +YYEL+E+    PL C+EDLR  L  +G+  EA+FVAKRM
Sbjct  601   GGMALEGFRVYYELLEKDARHPLGCVEDLRNALVDQGKLTEADFVAKRM  649



>ref|XP_006304700.1| hypothetical protein CARUB_v10011958mg [Capsella rubella]
 gb|EOA37598.1| hypothetical protein CARUB_v10011958mg [Capsella rubella]
Length=796

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/640 (57%), Positives = 469/640 (73%), Gaps = 1/640 (0%)
 Frame = +3

Query  417   TTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
             T V+ ++R +K P  AL+FF W    GF+     +F MLELLG  RNLN ARNFLFSI K
Sbjct  150   TAVLQTLRRIKVPAHALRFFDWVSNNGFSHKEHSFFLMLELLGRARNLNIARNFLFSIEK  209

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             RSNG V L  R+FNSLI++Y  AGLFQES+KLF +MK +GISPSVVTFN L SIL+KRGR
Sbjct  210   RSNGCVKLHDRYFNSLIRSYGNAGLFQESVKLFQTMKKMGISPSVVTFNILLSILLKRGR  269

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
             T M ++LFDEM +T+GV PD +TFNILI G C NSMVD+ FR FKEME + C+PDV+TYN
Sbjct  270   TAMAHDLFDEMRRTYGVSPDSFTFNILISGFCKNSMVDEAFRVFKEMELYHCDPDVVTYN  329

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             TI+DGLCRAGKV IAHNV+ GM+KK + + PN+V+YTTLVRGYC KQ ++EAL VF +M+
Sbjct  330   TIIDGLCRAGKVRIAHNVLNGMMKKATHVHPNIVSYTTLVRGYCMKQDLDEALLVFHQML  389

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGED-GRFVPDTCTFNTLIHTHCSDGN  1313
              RG +PN+VTYNTLI+GL  A+++D++K +  G G+    F PD CTFN LI  HC  G+
Sbjct  390   CRGLKPNAVTYNTLIKGLSVAQRYDEIKVILNGGGDAFTSFAPDACTFNILIKVHCDSGH  449

Query  1314  LKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRP  1493
             L AA++ F++M  +   PDSA+YS+LIR LC + +F+ AE  F ELF    LL   GC+P
Sbjct  450   LDAAMKVFQEMVNIKLHPDSASYSVLIRTLCLRNEFDRAELLFKELFDKQVLLGKDGCKP  509

Query  1494  VVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
             + AAYNPMF+YLC NGKTK+AEK+FRQLM+ G QDP +++TLIMG+  EG  +  +ELLV
Sbjct  510   LSAAYNPMFEYLCANGKTKQAEKIFRQLMKRGAQDPPSYRTLIMGHCREGQFKAAYELLV  569

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              MLRR+FVPD ETYE L++GLL+ G+  LA+DTL+RML+SS+LP   VFHS+L+ELVK+ 
Sbjct  570   LMLRRDFVPDPETYELLIDGLLKIGEALLAHDTLQRMLRSSYLPVATVFHSVLSELVKRK  629

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
              A E   LV LML K+IRQNI+LST  VR+LF +  KE+AF I+  LYDNGYLV M+EL+
Sbjct  630   FANESFGLVTLMLEKRIRQNIDLSTYAVRLLFSSAQKEKAFLIVRLLYDNGYLVKMEELL  689

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
              FL + +KL +A  L+LF L+ S  V I  C+TV+  LCK  R  EAF LY ELVE   +
Sbjct  690   DFLCENRKLLDACTLVLFCLEKSHMVHINTCNTVIEGLCKHKRHSEAFSLYNELVELGND  749

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGALDYIG  2333
               L+C   LR  LE  G+ +E +FV+KRM  +  + D  G
Sbjct  750   QQLSCHVILRNALEAAGKWEEFQFVSKRMATMSISDDCSG  789



>ref|XP_010501268.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Camelina sativa]
Length=1119

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/628 (58%), Positives = 465/628 (74%), Gaps = 0/628 (0%)
 Frame = +3

Query  417   TTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
             TTV+ ++RL+K P   L+FF W   KGF+   Q +F MLE LG  RNLN ARNFLFSI K
Sbjct  66    TTVLQTLRLIKIPSHGLRFFDWVSSKGFSHKDQSFFLMLEFLGRARNLNIARNFLFSIEK  125

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             RSNG V L+ R+FNSLI++Y  AGLFQES+KLF +MK +GISPSVVTFN+L SIL+KRGR
Sbjct  126   RSNGCVKLQDRYFNSLIRSYGNAGLFQESVKLFETMKKMGISPSVVTFNSLLSILLKRGR  185

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
             T M +++FDEM +T+GV PD +TFNILI G C NSMVD+ FR FKEME + C+PDV+TYN
Sbjct  186   TAMAHDMFDEMRRTYGVTPDSFTFNILINGFCKNSMVDEAFRVFKEMEPYHCDPDVVTYN  245

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             TI+DGLCRAGKV+IAHNV+ GM+KK +D+ PN+VTYTTL+RGYC KQ ++EAL VF +M+
Sbjct  246   TIIDGLCRAGKVKIAHNVLNGMMKKATDVHPNIVTYTTLLRGYCMKQDIDEALLVFHQML  305

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
              RG +PN+VT+NTLI+GL EA+++D++K++  G      F PD CTFN LI  HC  G+L
Sbjct  306   CRGLKPNAVTFNTLIKGLSEAQRYDEIKDILNGRDAFTTFTPDACTFNILIKVHCDAGHL  365

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA++ F +M  +   PDSA+YS+LIR LC + +F+ AE+ F ELF+   LL   GC P+
Sbjct  366   DAAMKVFHEMVDIKLHPDSASYSVLIRTLCLRNEFDRAERLFTELFEKEVLLGKDGCLPL  425

Query  1497  VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
              AAYNPMF+YLC NGKTK+AEKVFRQLM+ G QDP +++TLIMG   E   +  +ELLV 
Sbjct  426   AAAYNPMFEYLCANGKTKQAEKVFRQLMKRGAQDPPSYRTLIMGYCRESKFKAAYELLVL  485

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             MLRR FVPD ETYE L++GLL+ G+  LA+DTL+RML+SS+LP    FHS+L ELVK+  
Sbjct  486   MLRREFVPDLETYELLIDGLLKIGEALLAHDTLQRMLRSSYLPVATTFHSVLAELVKRKF  545

Query  1857  ALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIV  2036
             A E   LV LML K+IRQ I+LST+ VR+LF +  KE+AF I+  LYDNGYLV + EL+ 
Sbjct  546   ANESFGLVTLMLEKQIRQKIDLSTEAVRLLFSSAQKEKAFLIVRLLYDNGYLVKLDELLD  605

Query  2037  FLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIEL  2216
             FL + +KL +A  L+LF L+ S  V I+ C+TV+  LCK  R  EAF LY ELVE     
Sbjct  606   FLCENRKLLDAHTLVLFCLEKSHMVDIDTCNTVIEGLCKHKRHSEAFSLYNELVELGNHQ  665

Query  2217  PLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
              L+C   LR  LE  G+ +E +FV+KRM
Sbjct  666   QLSCHVILRNSLEAAGKWEELQFVSKRM  693



>ref|XP_002889338.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65597.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=712

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/665 (56%), Positives = 479/665 (72%), Gaps = 1/665 (0%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagps-lsETTVIHSIRLLKTPRKALKFFVWAEQK  494
             K A +LA  +   PWS + ESSLS+L     LS TTV+ ++RL+K P   L+FF W   K
Sbjct  38    KLARSLARAVNSNPWSDELESSLSSLHPSEPLSRTTVLQTLRLIKVPADGLRFFDWVYNK  97

Query  495   GFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLF  674
             GF+   Q +F MLE LG  RNLN ARNFLFSI KRSNG V L+ R+FNSLI++Y  AGLF
Sbjct  98    GFSHKEQSFFLMLEFLGRARNLNAARNFLFSIEKRSNGCVKLQDRYFNSLIRSYGNAGLF  157

Query  675   QESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNI  854
             QES+ LF +MK +GISPSV+TFN+L SIL+KRGRTGM +++FDEM +T+GV PD YTFN 
Sbjct  158   QESVNLFQTMKKMGISPSVLTFNSLLSILLKRGRTGMAHDMFDEMRRTYGVTPDSYTFNT  217

Query  855   LIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKG  1034
             LI G C NSMVDQ F  FKEME + C PDV+TYNTI+DGLCRAGKV+IAHN++ GMLKK 
Sbjct  218   LISGFCKNSMVDQAFTIFKEMELYSCNPDVVTYNTIIDGLCRAGKVKIAHNLLNGMLKKA  277

Query  1035  SDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDK  1214
             + + PN+V+YTTL+RGYC KQ+++EAL VF EM+ RG +PN+VTYNTLI+GL EA ++D+
Sbjct  278   TAVHPNIVSYTTLLRGYCMKQEIDEALLVFHEMLTRGLKPNAVTYNTLIKGLSEAHRYDE  337

Query  1215  VKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILI  1394
             +K    G      F PD CTFN LI  HC  G+L AA++ F++M  +   PDSA+YS+LI
Sbjct  338   IKGFLIGGDAFTTFSPDACTFNILIKAHCDAGHLDAAMKVFQEMLNMKLHPDSASYSVLI  397

Query  1395  RCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQ  1574
             R LC + +F+ AE  F+ELF+   LL    C+P+ AAYN MF+YLC NGK K+AEKVFRQ
Sbjct  398   RTLCLRNEFDKAETLFNELFEKEVLLGKNECKPLAAAYNLMFEYLCANGKAKQAEKVFRQ  457

Query  1575  LMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKP  1754
             LM+ G QDP +++TLI G   EG  +  +ELLV MLRR FVPD ETYE L++GLL+ G+ 
Sbjct  458   LMKRGAQDPSSYRTLITGLCREGKFKAAYELLVLMLRREFVPDPETYEVLIDGLLKIGEA  517

Query  1755  RLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDT  1934
              LA+DTL+RML+SS+LP    FHS+L ELVK+  A +   L+ +ML K+IRQNI+LST  
Sbjct  518   LLAHDTLQRMLRSSYLPVATTFHSVLAELVKRKFANDSFGLLTVMLEKRIRQNIDLSTQA  577

Query  1935  VRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVC  2114
             VR++F +  KE+AF I+  LYDNGYL+ M+EL+ FL + +KL +A  L+LF L+ SQ V 
Sbjct  578   VRLVFSSAQKEKAFLIVRLLYDNGYLIKMEELLDFLCENRKLLDAHTLVLFCLEKSQMVD  637

Query  2115  IEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
             I+ C+T++  LCK  R  EAF LY ELVE      L+C   L   LE  G+ +E +FV+K
Sbjct  638   IDTCNTIIEGLCKHKRHSEAFSLYNELVELGNHQQLSCHVVLTNALEAAGKWEELQFVSK  697

Query  2295  RMPRL  2309
             RM  +
Sbjct  698   RMATM  702



>gb|AAC24378.1| Unknown protein [Arabidopsis thaliana]
Length=691

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/672 (55%), Positives = 476/672 (71%), Gaps = 23/672 (3%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsala-gpslsETTVIHSIRLLKTPRKALKFFVWAEQK  494
             K A +LA  +   PWS + ESSLS+L    ++S TTV+ ++RL+K P   L+FF W   K
Sbjct  35    KLARSLARAVNSNPWSDELESSLSSLHPSQTISRTTVLQTLRLIKVPADGLRFFDWVSNK  94

Query  495   GFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLF  674
             GF+   Q +F MLE LG  RNLN ARNFLFSI +RSNG V L+ R+FNSLI++Y  AGLF
Sbjct  95    GFSHKEQSFFLMLEFLGRARNLNVARNFLFSIERRSNGCVKLQDRYFNSLIRSYGNAGLF  154

Query  675   QESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNI  854
             QES+KLF +MK +GISPSV+TFN+L SIL+KRGRTGM ++LFDEM +T+GV PD YTFN 
Sbjct  155   QESVKLFQTMKQMGISPSVLTFNSLLSILLKRGRTGMAHDLFDEMRRTYGVTPDSYTFNT  214

Query  855   LIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKG  1034
             LI G C NSMVD+ FR FK+ME                    AGKV+IAHNV+ GMLKK 
Sbjct  215   LINGFCKNSMVDEAFRIFKDME-------------------LAGKVKIAHNVLSGMLKKA  255

Query  1035  SDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDK  1214
             +D+ PNVV+YTTLVRGYC KQ+++EA+ VF +M+ RG +PN+VTYNTLI+GL EA ++D+
Sbjct  256   TDVHPNVVSYTTLVRGYCMKQEIDEAVLVFHDMLSRGLKPNAVTYNTLIKGLSEAHRYDE  315

Query  1215  VKELFKGAGEDG--RFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSI  1388
             +K++  G G D    F PD CTFN LI  HC  G+L AA++ F++M  +   PDSA+YS+
Sbjct  316   IKDILIG-GNDAFTTFAPDACTFNILIKAHCDAGHLDAAMKVFQEMLNMKLHPDSASYSV  374

Query  1389  LIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVF  1568
             LIR LC + +F+ AE  F+ELF+   LL    C+P+ AAYNPMF+YLC NGKTK+AEKVF
Sbjct  375   LIRTLCMRNEFDRAETLFNELFEKEVLLGKDECKPLAAAYNPMFEYLCANGKTKQAEKVF  434

Query  1569  RQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEG  1748
             RQLM+ GVQDP ++KTLI G+  EG  +  +ELLV MLRR FVPD ETYE L++GLL+ G
Sbjct  435   RQLMKRGVQDPPSYKTLITGHCREGKFKPAYELLVLMLRREFVPDLETYELLIDGLLKIG  494

Query  1749  KPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
             +  LA+DTL+RML+SS+LP    FHS+L EL K+  A E   LV LML K+IRQNI+LST
Sbjct  495   EALLAHDTLQRMLRSSYLPVATTFHSVLAELAKRKFANESFCLVTLMLEKRIRQNIDLST  554

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
               VR+LF +  KE+AF I+  LYDNGYLV M+EL+ +L + +KL +A  L+LF L+ SQ 
Sbjct  555   QVVRLLFSSAQKEKAFLIVRLLYDNGYLVKMEELLGYLCENRKLLDAHTLVLFCLEKSQM  614

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFV  2288
             V I+ C+TV+  LCK  R  EAF LY ELVE      L+C   LR  LE  G+ +E +FV
Sbjct  615   VDIDTCNTVIEGLCKHKRHSEAFSLYNELVELGNHQQLSCHVVLRNALEAAGKWEELQFV  674

Query  2289  AKRMPRLEGALD  2324
             +KRM  L  + D
Sbjct  675   SKRMATLRESDD  686



>emb|CDX93340.1| BnaC04g45560D [Brassica napus]
Length=948

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/674 (54%), Positives = 487/674 (72%), Gaps = 21/674 (3%)
 Frame = +3

Query  297   KPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFF  476
             KP+ +  K A +LA  I     S Q ESSLS+L   SLS TTV+ ++RL+  P +AL+FF
Sbjct  283   KPQRTESKLATSLARAIN---SSDQVESSLSSLQPLSLSTTTVLQTLRLITHPPRALRFF  339

Query  477   VW-AEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKN  653
              + +    F+     +F ML LL   R+LN ARNFLFSI KRSNG+V L  RFFN+LIK+
Sbjct  340   DYLSTTNAFSHNPHSFFLMLHLLSQSRSLNAARNFLFSIEKRSNGSVKLHPRFFNTLIKS  399

Query  654   YAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKP  833
             YA AGL  ESL LF +MK +G+SPS+VTFNTL SIL++RG+TGM  +LF EM +T+GVKP
Sbjct  400   YADAGLLHESLSLFHTMKKMGVSPSLVTFNTLLSILLRRGKTGMALDLFREMRRTYGVKP  459

Query  834   DLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVV  1013
             D YTFNILI G C NSMV + FR FK+ME   C PD++TYNTI++GLCRAGKV  AHNV+
Sbjct  460   DCYTFNILINGFCKNSMVAEAFRVFKDME---CVPDLVTYNTIINGLCRAGKVNTAHNVL  516

Query  1014  KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLL  1193
             KGM+K+G  + PNVV+YTTLVRGYC  ++V++AL+VF+E+     +PN+V++NTLI+GL 
Sbjct  517   KGMVKRGV-VEPNVVSYTTLVRGYCMNREVDKALDVFREI----DKPNAVSFNTLIKGLS  571

Query  1194  EARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDS  1373
             EA++FD++KE+ + +     F PD CTFN LI  HC  G++ AA++ F++M    A PDS
Sbjct  572   EAQRFDEIKEVLRASS----FAPDACTFNVLIKAHCDGGDMDAAVKVFKEM----ARPDS  623

Query  1374  ATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKK  1553
             A++S+LIR LC + +F+ AE+ FDEL+  G LL   G +P+ AAYNPMF+YLC NGKT++
Sbjct  624   ASFSVLIRALCLRQEFDRAERLFDELYDKGVLLEKGGSKPLAAAYNPMFEYLCANGKTRR  683

Query  1554  AEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEG  1733
             AE+VFRQLM++GVQDP ++ TLIMG+  EG  + G+ELLV MLRR FVPDFE YE L++G
Sbjct  684   AERVFRQLMKIGVQDPPSYGTLIMGHCREGGFKGGYELLVLMLRREFVPDFEIYELLIDG  743

Query  1734  LLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQN  1913
             LL+ G+  LA+D LERML+SS+LP    FH +L ELVK   A EC DLV +ML K IRQ+
Sbjct  744   LLKTGEALLAHDVLERMLRSSYLPVAATFHCVLGELVKGGFANECFDLVRIMLEKGIRQS  803

Query  1914  INLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSE-ARDLLLFS  2090
             I+LSTD VR+LF +G K++AF ++  +Y+NGY+V M+ELI FL + +KL + A  L+LF 
Sbjct  804   IDLSTDVVRLLFSSGQKDKAFLVVRLVYENGYVVKMEELIDFLCENRKLVDSAHRLVLFC  863

Query  2091  LKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRS  2270
             L+N+Q + I  C+ VL  LCK  R  EAF LY ELVE      L+C   LR  LE  G+ 
Sbjct  864   LENNQMIDISRCNRVLEGLCKVKRHSEAFSLYNELVEIGKHQELSCHVVLRNALEAAGKL  923

Query  2271  KEAEFVAKRMPRLE  2312
             +E +FV+KRM  L+
Sbjct  924   EEVKFVSKRMAVLD  937



>ref|XP_009141700.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Brassica rapa]
Length=680

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/670 (54%), Positives = 474/670 (71%), Gaps = 20/670 (3%)
 Frame = +3

Query  297   KPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFF  476
             KP+ +  K A +LA  I     S Q ESSLS+L   SLS TTV+ ++RL+  P +AL+FF
Sbjct  14    KPQRTKSKLATSLARAIN---SSDQVESSLSSLQPLSLSTTTVLQTLRLITHPPRALRFF  70

Query  477   VW-AEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKN  653
              + +    F+     +F ML LL   RNLN ARNFLFSI KRSNG+V L  RFFN+LIK+
Sbjct  71    DYLSTTTSFSHNPHSFFLMLHLLSQSRNLNAARNFLFSIEKRSNGSVKLHPRFFNTLIKS  130

Query  654   YAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKP  833
             YA AGL  ESL LF +MK + I+PS +TFNTL SIL+KRG+TGM  +LF EM +T+GV P
Sbjct  131   YADAGLLHESLSLFHTMKEMSITPSPITFNTLLSILLKRGKTGMALDLFREMRRTYGVSP  190

Query  834   DLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVV  1013
             D YTFNILI G C NSMV + FR FK+M     +PD++TYNTI+DGLCRAGKV  A NV+
Sbjct  191   DAYTFNILINGFCKNSMVAEAFRVFKDMR---FDPDLVTYNTIIDGLCRAGKVNTARNVL  247

Query  1014  KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLL  1193
              GM+K+G  + PNVV+YTTLVRGYC K +V++AL +F+E+     EPN+V++NTLI+GL 
Sbjct  248   NGMVKRGV-VPPNVVSYTTLVRGYCMKHEVDKALALFREI----DEPNAVSFNTLIKGLS  302

Query  1194  EARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDS  1373
             EAR+FD++KE+ + +     F PD CTFN LI  HC  G+L  A++ F +M      PDS
Sbjct  303   EARRFDEIKEVLRASSA---FAPDRCTFNVLIKAHCDGGDLDEAVKVFGEME----RPDS  355

Query  1374  ATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKK  1553
             A+YS+LIR LC + +F  AE+ FDEL++ G LL   G +P+ AAYNPMF+YLC NGKTK+
Sbjct  356   ASYSVLIRALCLRQEFGRAERLFDELYEKGVLLEKDGSKPIAAAYNPMFEYLCANGKTKR  415

Query  1554  AEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEG  1733
             AE+VFRQLM++G QDP ++ TLIMG+  EG  + G+ELLV MLRR FVPDFE YE L++G
Sbjct  416   AERVFRQLMKIGAQDPASYGTLIMGHCREGGFKGGYELLVLMLRREFVPDFEIYELLIDG  475

Query  1734  LLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQN  1913
             LL+ G+  LA+D LERM++SS+LP    FH +L ELV++  A EC DLV +ML K IRQN
Sbjct  476   LLKTGEALLAHDVLERMMRSSYLPVAATFHCVLEELVRRGFANECFDLVRIMLEKGIRQN  535

Query  1914  INLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSE-ARDLLLFS  2090
             ++LSTD VR+LF +G K++AF ++  +Y+NGYLV M+ELI FL + +KL + A  L+LF 
Sbjct  536   VDLSTDVVRLLFSSGQKDKAFLVVRLVYENGYLVKMEELIDFLCESRKLVDSAHKLVLFC  595

Query  2091  LKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRS  2270
             L+N+Q V I  C+ V+  LCK  R  EAF L+ ELVE      L+C   LR  LE  G+ 
Sbjct  596   LENNQMVDISRCNRVIEGLCKRKRHSEAFGLFNELVEVGKHQELSCHVVLRNALEAAGKF  655

Query  2271  KEAEFVAKRM  2300
             +E  FV+KRM
Sbjct  656   EEVRFVSKRM  665



>gb|EPS68740.1| hypothetical protein M569_06021 [Genlisea aurea]
Length=766

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/686 (52%), Positives = 475/686 (69%), Gaps = 14/686 (2%)
 Frame = +3

Query  291   VAKPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALK  470
             V KP+ +S KKA + A+LI   PWS   ES+LS    P   +T    +IR ++TP KAL+
Sbjct  73    VKKPRNNS-KKARSTAKLIDENPWSESLESALSGDLLPLS-QTGFFQTIRRIRTPAKALR  130

Query  471   FFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRS---NGA-VPLEARFFN  638
             FF WA   GFA ++  YFRM+E+LG  R+LN ARNFL +IP+++   NGA V L  + FN
Sbjct  131   FFDWATNSGFAHSTHSYFRMIEILGKARHLNAARNFLLAIPRKTTDNNGAGVRLTDKLFN  190

Query  639   SLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKT  818
             SLI++YA AGLF+ES+KLF  MK  GISPS  TFNTLF+IL  RGR GM  +LFDEML T
Sbjct  191   SLIRSYAGAGLFRESIKLFKLMKSYGISPSAFTFNTLFTILFGRGRLGMALQLFDEMLGT  250

Query  819   FGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEI  998
             +GVKPDL TFN+LI+G C NS  D  FR F +M  + CEPD+ITYNT+V+GLCRAGKV+I
Sbjct  251   YGVKPDLCTFNVLIKGFCANSTTDTAFRMFNKMSVYNCEPDLITYNTLVNGLCRAGKVDI  310

Query  999   AHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTL  1178
             A N+V GM +K   L PNVVTYTTL+R YC K+ ++ AL+V +EMV  G  PN VTYNT+
Sbjct  311   ARNLVAGMRRKDPKLRPNVVTYTTLLRSYCGKRDLDTALDVLEEMVQNGVLPNDVTYNTM  370

Query  1179  IQGLLEARKFDKVKE--LFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSI  1352
             IQGL E+     + +  +     + G F PDTCTFNTL++  CS GN+ AAL  FE+   
Sbjct  371   IQGLCESENISMIIKDVVLSAENKKGGFEPDTCTFNTLVNALCSRGNVAAALRCFERAKD  430

Query  1353  LNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLC  1532
                 PDSATYSILIR LC+ G+F  AE+  DEL +  TLL + GC P+ AAYNP+F++LC
Sbjct  431   SRVDPDSATYSILIRALCRSGEFSAAEELLDELLEKETLLRNRGCVPLCAAYNPIFEHLC  490

Query  1533  ENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFET  1712
               GKT+KA+ V R+LMR GVQDP  F+TLI+G+  EG   DGH+LLV MLRR+F P  + 
Sbjct  491   SCGKTRKADGVLRRLMRRGVQDPPAFETLILGHCKEGSFSDGHKLLVLMLRRDFKPHVDV  550

Query  1713  YESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLML  1892
             Y  L++GLLQ+ + +LA+DT+ +ML+S +LPR  +FH IL EL++   A E A+L++LML
Sbjct  551   YLFLIDGLLQKHEAKLAFDTVLKMLRSDYLPRASIFHRILMELIRGGSANESAELMMLML  610

Query  1893  VKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFL----SQGKKL  2060
              K +R NINLSTD VR+LF+ G K  A E++ C+Y  GY++N+ EL+       ++  +L
Sbjct  611   EKGVRLNINLSTDVVRLLFEKGSKSEALELVRCVYGRGYVINIDELVSSYLCKETKNSRL  670

Query  2061  SEARDLLLFSLKNSQSVCI--EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
              +A +LL+F L+N ++  +   +C TVL  LC+     EAF LYYEL+E+  + P NCL 
Sbjct  671   EQAYELLVFLLRNDETAGMSSSLCDTVLFRLCEGKMLSEAFGLYYELLEKDFQGPFNCLI  730

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPRLE  2312
             DLR  LE  G+ KEAEFV+KR+PR E
Sbjct  731   DLRNGLESVGKLKEAEFVSKRIPRGE  756



>ref|XP_006836847.1| hypothetical protein AMTR_s00099p00074160 [Amborella trichopoda]
 gb|ERM99700.1| hypothetical protein AMTR_s00099p00074160 [Amborella trichopoda]
Length=715

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/663 (50%), Positives = 444/663 (67%), Gaps = 5/663 (1%)
 Frame = +3

Query  318   KKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAEQKG  497
             K + ++++LI   PWS Q E SL   A     +T +   +  +KTP KAL FF W   +G
Sbjct  52    KASRSISQLINENPWSSQLELSLMPFASILSLDT-ITRVLYTIKTPSKALLFFKWVHSRG  110

Query  498   FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQ  677
               L +  YFRMLE+LG   NLN+A+N + S+PK  NG +  E RFFNSL++ Y  AG+ Q
Sbjct  111   CELDANTYFRMLEILGRTGNLNSAKNLILSMPK--NG-LYYEDRFFNSLMRGYGRAGMIQ  167

Query  678   ESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNIL  857
             E++K+   MK   ++PSV+T+N LF IL++RGRT MV +L+++M +  G+ PD+YTFNIL
Sbjct  168   EAIKVIRMMKEFRVAPSVLTYNNLFGILLRRGRTNMVKKLYEDMGRE-GISPDVYTFNIL  226

Query  858   IRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGS  1037
             IRG CMNSMVD+ F  F +M  H C PD++TYNT++DGLCRAGKV+ A  +  G+L+KG 
Sbjct  227   IRGFCMNSMVDESFWLFNDMVCHGCVPDMVTYNTLLDGLCRAGKVDNARKLFDGLLRKGD  286

Query  1038  DLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKV  1217
              L PNVVTYTTL+RGYCEK+ + EA+ V++EMV+ G +PN+VTYNTLIQGL EA+K DK+
Sbjct  287   ALVPNVVTYTTLIRGYCEKRLIGEAMKVYEEMVNGGVKPNNVTYNTLIQGLSEAQKLDKI  346

Query  1218  KELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIR  1397
              E+ K       F PDTCTFNTL++ HC+   L+ AL  F K S +    DSATYS+LIR
Sbjct  347   NEILKEIMHSAEFRPDTCTFNTLMNAHCNADRLEDALAIFSKFSEIKVEADSATYSVLIR  406

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQL  1577
              LC +  FE A +  D+L   G LL   GC P+VA Y  + +YLC+N KT+KAE  FRQL
Sbjct  407   NLCLRDRFEEAAELLDDLVDGGVLLKPGGCIPLVAGYKHILEYLCKNRKTEKAEIAFRQL  466

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
              + G QDP +F+ LI+G+  EG  ++G  LLV MLRR+FVPD ETY +LL+G ++   P 
Sbjct  467   HKRGTQDPFSFQILILGHCREGNPKNGFNLLVLMLRRDFVPDVETYLALLKGFIEMRDPI  526

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
              A  TLERML+S H+P+T +F SI+  L++ +   E AD + +ML + IRQNIN+ST+ V
Sbjct  527   FALKTLERMLRSRHVPQTSIFFSIIDMLMRDDKVREAADTIKMMLERGIRQNINVSTNLV  586

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
               LF  GL + AFEIL  LY+N YLV M+ L+ FL + K+  EA+ L LFSL+    + I
Sbjct  587   EALFDGGLSDDAFEILQLLYENDYLVKMERLLSFLCEEKRFLEAKQLSLFSLEKHGDLDI  646

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
                S V+  LCK  R ++AF LYYE+VER  +    CL +L   L  EGR KEAEFVAK 
Sbjct  647   GPYSRVIRGLCKTKRTKDAFSLYYEMVERGRQPDEGCLRELMAALNSEGRLKEAEFVAKL  706

Query  2298  MPR  2306
               R
Sbjct  707   TSR  709



>ref|XP_010497224.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic, partial [Camelina sativa]
Length=513

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/514 (57%), Positives = 381/514 (74%), Gaps = 3/514 (1%)
 Frame = +3

Query  750   FSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHE  929
              SIL+KRGRT M ++LFDEM +T+GV PD +TFNILI G C NSMVD+ FR FKEME + 
Sbjct  1     LSILLKRGRTAMAHDLFDEMRRTYGVTPDSFTFNILINGFCKNSMVDEAFRVFKEMEPYH  60

Query  930   CEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEE  1109
             C+PDV+TYNTI+DGLCRAGKV+IAHNV+ GM+KK +D+ PN+V+YTTL+RGYC KQ ++E
Sbjct  61    CDPDVVTYNTIIDGLCRAGKVKIAHNVLNGMMKKATDVHPNIVSYTTLLRGYCMKQDIDE  120

Query  1110  ALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGED--GRFVPDTCTFNT  1283
             AL VF++M+ RG +PN+VTYNTLI+GL EA+++D++K++  G G+D    F PD CTFN 
Sbjct  121   ALLVFRQMLCRGLKPNAVTYNTLIKGLSEAQRYDEIKDILNG-GDDPFTTFTPDACTFNI  179

Query  1284  LIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTG  1463
             LI  HC  G+L AA++ F +M  +   PDSA+YS+LIR LC + +F+ AE+ F ELF+  
Sbjct  180   LIKVHCDAGHLDAAMKVFHEMVDIKLHPDSASYSVLIRTLCLRNEFDRAERLFTELFEKE  239

Query  1464  TLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEG  1643
              LL   GC P+ AAYNPMF+YLC NGKTK+AEKVFRQLM+ G QDP +++TLIMG+  E 
Sbjct  240   VLLGKDGCLPLAAAYNPMFEYLCANGKTKQAEKVFRQLMKRGAQDPPSYRTLIMGHCRES  299

Query  1644  MSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFH  1823
               +  +ELLV MLRR FVPD ETYE L++GLL+ G+  LA+DTL+RML+SS+LP    FH
Sbjct  300   KFKAAYELLVLMLRREFVPDLETYELLIDGLLKIGEALLAHDTLQRMLRSSYLPVATTFH  359

Query  1824  SILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDN  2003
             S+L ELVK+  A E   LV LML K+IRQNI+LST  VR+LF +  KE+AF I+  LYD+
Sbjct  360   SVLAELVKRKFANESFGLVTLMLEKQIRQNIDLSTHAVRLLFSSAQKEKAFLIVRLLYDD  419

Query  2004  GYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFEL  2183
             GYLV + EL+ FL + +KL +A  L+LF L+ SQ V IE C+TV+  LCK  R  EAF L
Sbjct  420   GYLVKLDELLDFLCENRKLVDAHTLVLFCLEKSQMVDIETCNTVIEGLCKHKRHSEAFSL  479

Query  2184  YYELVERQIELPLNCLEDLRLRLEVEGRSKEAEF  2285
             Y +LVE      L+C   L+  LE  G+ +E +F
Sbjct  480   YNDLVELGNHQQLSCHLILKNSLEAAGKWEELQF  513



>gb|KHN18005.1| Pentatricopeptide repeat-containing protein, chloroplastic, partial 
[Glycine soja]
Length=662

 Score =   544 bits (1401),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 298/619 (48%), Positives = 396/619 (64%), Gaps = 28/619 (5%)
 Frame = +3

Query  414   ETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIP  593
             +TTV+ ++RL+K P KAL FF W +QKGF+ T + YF MLE+LG ERNLN ARNFLFSI 
Sbjct  3     KTTVLRTLRLIKDPSKALCFFKWTQQKGFSHTPESYFIMLEILGRERNLNVARNFLFSIE  62

Query  594   KRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRG  773
             K S G V LE RFFNSLI++YA AGLF+ES+KLF +MK I +SPSVVTFN L SIL+KRG
Sbjct  63    KHSKGTVKLEDRFFNSLIRSYAEAGLFKESMKLFQTMKSIAVSPSVVTFNNLLSILLKRG  122

Query  774   RTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITY  953
             RT M  E++DEML T+GV PD  T+N+LI G C NSMVD+GFRFF+EME   C+ DV+TY
Sbjct  123   RTNMAKEVYDEMLGTYGVSPDTCTYNVLIIGFCKNSMVDEGFRFFREMESFNCDADVVTY  182

Query  954   NTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEM  1133
             NT+VDGLCRAGKV IA N+V GM KK   L+PNVVTYTTL+  YC KQ+VEEAL V +EM
Sbjct  183   NTLVDGLCRAGKVRIARNLVNGMGKKCEGLNPNVVTYTTLIHEYCMKQEVEEALVVLEEM  242

Query  1134  VDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGN  1313
               RG +PN +TYNTL++GL EA K DK+K++ +    DG F  DT TFNT+IH HC  GN
Sbjct  243   TSRGLKPNMITYNTLVKGLCEAHKLDKMKDVLERMKSDGGFSLDTFTFNTIIHLHCCAGN  302

Query  1314  LKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRP  1493
             L  AL+ FE M       DSA+YS L R LCQK D++M E+ FDELF+   LLS  G +P
Sbjct  303   LDEALKVFESMKKFRIPADSASYSTLKRSLCQKWDYDMVEQLFDELFEKEILLSKFGSKP  362

Query  1494  VVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
             + A+YNP+F+ LCE+GKTKKAE+V RQLM+ G QDP ++ T+IMG            LL 
Sbjct  363   LAASYNPIFESLCEHGKTKKAERVIRQLMKRGTQDPQSYTTVIMG------------LLE  410

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLP-RTFVFHSILT-----  1835
              M  R   P+  TY +L++GL +  K     D LERM         TF F++I+      
Sbjct  411   EMTSRGLKPNMITYNTLVKGLCEAHKLDKMKDVLERMKSDGGFSLDTFTFNTIIHLHCSS  470

Query  1836  -----ELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYD  2000
                  E + ++   + A+ V+  L+K+  Q+    T  +    K G  E  +E+L  +  
Sbjct  471   YNPIFESLCEHGKTKKAERVIRQLMKRGTQDPQSYTTVIMGHCKEGAYESGYELLMWMLR  530

Query  2001  NGYL--VNMQELIV--FLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQ  2168
               +L  + + + ++  FL + K L  A++ L   LK+S         +VL+ L +   A 
Sbjct  531   RDFLPDIEIYDYLIDGFLQKDKPLL-AKETLEKMLKSSYQPKTSTWHSVLAKLLEKGCAH  589

Query  2169  EAFELYYELVERQIELPLN  2225
             E+  +   ++E+ +   +N
Sbjct  590   ESSCVIVMMLEKNVRQNIN  608



>ref|XP_010909614.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Elaeis guineensis]
Length=707

 Score =   545 bits (1403),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 300/637 (47%), Positives = 406/637 (64%), Gaps = 19/637 (3%)
 Frame = +3

Query  417   TTVIHSIRLLKTPRKALKFFVWAEQKGFALTS--QCYFRMLELLGTERNLNTARNFLFSI  590
             +T++  + L++TP  AL+ F WA+    +L S  +   + L LL   R+   A +F  S+
Sbjct  74    STLLRVLGLVRTP-AALRLFRWAQSLLPSLLSDRRPAAKTLHLLLRCRDPRPALHFALSL  132

Query  591   PKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKR  770
             P  S     L     N+L+++ A AG  + ++ +F  +     SPSV +FN+L + L+ R
Sbjct  133   PPSS-----LPDHSLNALLRSLARAGRLRSAISVFRLLP----SPSVFSFNSLLAALLHR  183

Query  771   GRTGMVYELFDEMLKTF-GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVI  947
              RT     LFDEML+    ++PD  TFN LIRG C+NSM  + F  F+EM +H C+PD++
Sbjct  184   SRTRAASSLFDEMLRRAPAIRPDACTFNTLIRGLCLNSMPAKAFHLFREMPRHGCQPDLV  243

Query  948   TYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFK  1127
             TYNT++DGLCRAG++  A  ++  M  K S L+PNVV+YTTL+RGYC      EA+ VF+
Sbjct  244   TYNTLLDGLCRAGELRAARGLLDAMRTKSSYLAPNVVSYTTLIRGYCGSLLPAEAVGVFE  303

Query  1128  EMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFK---GAGEDGRFVPDTCTFNTLIHTH  1298
             EMV  G +PN +TYNTLIQGL EA++ D VKE+ +   G   D  F PDTCTFNTLI  H
Sbjct  304   EMVSVGVKPNRITYNTLIQGLCEAKRMDLVKEILEQGNGGNSDSTFRPDTCTFNTLIAAH  363

Query  1299  CSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSD  1478
             C    +  AL+ F++M  L    DSATYS LIR LCQ G+F  AE+  DEL K   L   
Sbjct  364   CKMSRVGDALKMFDRMPELKVKADSATYSTLIRGLCQSGEFGRAEELVDELLKKEVLRRR  423

Query  1479  AGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLM-RMGVQDPLTFKTLIMGNRNEGMSED  1655
              GC P++AAYNPMF+ LC NGK KKA ++F+QL+ R    D   FKTLI G+  EG  + 
Sbjct  424   GGCVPLMAAYNPMFECLCINGKAKKARRLFQQLLDRRATVDVGAFKTLISGHCREGAFKA  483

Query  1656  GHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILT  1835
             G+ELLV M++R+ VPD ETYE+LL G L +GK   A+ TLE ML S H P T  FH++L 
Sbjct  484   GYELLVSMVKRDLVPDEETYEALLVGFLGKGKMDYAFKTLEGMLDSGHRPSTATFHAVLA  543

Query  1836  ELVKQN-CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYL  2012
              L+KQ+ CA E   LV +M+ +KIRQ+I+LSTD +  LF+ GL +RA EI+  LYDNGY 
Sbjct  544   GLLKQDECAKEAGKLVAVMVDRKIRQSIDLSTDVIASLFRKGLSDRALEIVRLLYDNGYY  603

Query  2013  VNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYE  2192
             V M++L   L QG+K  EAR+LLLFSL+ SQ +  ++  T +S LC    A EAF L+YE
Sbjct  604   VKMEKLAGSLCQGQKFLEARELLLFSLEKSQDLDGKVYGTAISGLCVTGNAPEAFGLFYE  663

Query  2193  LVER-QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
             +V++    +P NCL  L+  LE   + KEAEFV K+M
Sbjct  664   MVDKGGANVPSNCLVSLKAALEESRKWKEAEFVWKQM  700



>ref|XP_008777446.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic, partial [Phoenix dactylifera]
Length=722

 Score =   545 bits (1403),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 288/590 (49%), Positives = 391/590 (66%), Gaps = 16/590 (3%)
 Frame = +3

Query  552   RNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSV  731
             R+   A +F  S+P  S     L    FN+L+++ + AG  + SL LF  +     SPS 
Sbjct  131   RDPRPALHFALSLPPSS-----LADHSFNALLRSLSRAGHLRSSLSLFRLLP----SPSA  181

Query  732   VTFNTLFSILMKRGRTGMVYELFDEML-KTFGVKPDLYTFNILIRGCCMNSMVDQGFRFF  908
              +FN+L + L++RGRT     LFDEML +   V+PD  TFN LIRG C+NSM  + FR F
Sbjct  182   FSFNSLLAALLRRGRTRAARSLFDEMLHRAPAVRPDACTFNTLIRGLCLNSMPAEAFRLF  241

Query  909   KEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYC  1088
             +EM +H C+PD++TYNT++DGLCRAG++  A  ++  M  K SDL+PNVV+YTTL+RGYC
Sbjct  242   REMPRHGCQPDLVTYNTLLDGLCRAGELHAARGLLDAMRTKSSDLAPNVVSYTTLIRGYC  301

Query  1089  EKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFK---GAGEDGRFV  1259
              +    EA+ VF++MV  G +PN +TYNTLIQGL EA++ D  KE+ +   GA  D  F 
Sbjct  302   GRLLPAEAVGVFEQMVAVGVKPNRITYNTLIQGLCEAKRMDLGKEILEQGNGANGDSTFR  361

Query  1260  PDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKF  1439
             PDTCTFN LI +HC  G +  AL+ F++M  L    DSATYS LIR LCQ G+F  AE+ 
Sbjct  362   PDTCTFNILIASHCKMGRVGEALKMFDRMPELKVKADSATYSTLIRGLCQSGEFGRAEEL  421

Query  1440  FDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLM-RMGVQDPLTFKT  1616
              DEL +   L    GC P++AAYNP+ +YLC NGK +KA ++F+QL+ R    D   FKT
Sbjct  422   VDELLEKEVLRRRGGCVPLMAAYNPICEYLCNNGKAEKARRLFQQLLDRRATVDVGAFKT  481

Query  1617  LIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSS  1796
             LI G+  EG  ++G+ELLV M++R+ VPD ETYE+L+ G L  GK   A+  LERML S 
Sbjct  482   LISGHCREGAFKEGYELLVSMVKRDLVPDVETYEALVVGFLGNGKVDYAFKALERMLDSG  541

Query  1797  HLPRTFVFHSILTELVKQN-CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERA  1973
             H P T  FHS+L  L++++ CA E   LV +M+ +KIRQ+INLSTD +  LF  GL +RA
Sbjct  542   HRPSTATFHSVLAGLLEKDYCAEEAGKLVAVMIERKIRQSINLSTDVMANLFSNGLSDRA  601

Query  1974  FEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCK  2153
             FEI+  LYDNGY V M++L   L QGKK  EAR+LLLFSL+ SQ +  ++  TV+S LC 
Sbjct  602   FEIVRLLYDNGYYVKMEKLAGSLCQGKKFLEARELLLFSLEKSQELDSKVYGTVISGLCV  661

Query  2154  ACRAQEAFELYYELVERQ-IELPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
             + +A EAF L+Y++++++   +P NCL  L+  LE   + KEAEFV K+M
Sbjct  662   SGKAPEAFGLFYKMIDKKSATVPSNCLVSLKAALEESRKWKEAEFVWKQM  711



>ref|XP_009386447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=705

 Score =   518 bits (1335),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 270/564 (48%), Positives = 378/564 (67%), Gaps = 13/564 (2%)
 Frame = +3

Query  633   FNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEML  812
             FN+L++  A AG  + +++LF  +      PSV ++N+L + L++RGRT     LFDEML
Sbjct  142   FNALVRRLAAAGHLRSAVRLFRLIPF----PSVFSYNSLLAPLLRRGRTRAASALFDEML  197

Query  813   KTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKV  992
              T  V+PD+ TFN LIRG C+NSMVD+ FR F EM +H C PDV+TYNT+VDGLCRAGKV
Sbjct  198   AT-AVRPDVCTFNTLIRGFCLNSMVDEAFRLFNEMPRHGCAPDVVTYNTLVDGLCRAGKV  256

Query  993   EIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYN  1172
              IAHN++ GM  K SDL+PNVV+YTTL+RGYC K   +EA+ +F +MV  G +PN +TYN
Sbjct  257   RIAHNLLNGMRTKSSDLAPNVVSYTTLIRGYCSKLLPDEAVELFHQMVALGLKPNKITYN  316

Query  1173  TLIQGLLEARKFDKVKELFKGAGEDGR---FVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TLIQGL +AR+ D VK + +   + G+   F PDTCTFNTLI  HC+ G++  AL  FE+
Sbjct  317   TLIQGLCDARRMDLVKGIMEPGDDGGKELTFRPDTCTFNTLIAAHCNLGSISDALNVFER  376

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFK  1523
             M+ +    DSATYS +I+ LC+KG+F  AE+  DEL +   +    G  P++AAYNP+F 
Sbjct  377   MAEMRVKRDSATYSTMIKGLCEKGEFVRAEELVDELLEK-EVFRKRGI-PLLAAYNPIFD  434

Query  1524  YLCENGKTKKAEKVFRQLM-RMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
             YLC+NGKT+KA  + +QL+ +    D   FKT+I+G+  E    +G+ELLV M +R+ VP
Sbjct  435   YLCQNGKTEKARMLLQQLLDKQAKVDVAAFKTVILGHCKEERLREGYELLVSMGKRDLVP  494

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN-CALECADL  1877
             D  T+++L+EG +Q+ K   A++   +ML + H P T  FHS+L  L K++  A E  +L
Sbjct  495   DAATFQTLIEGFMQQEKIGFAWEAFRKMLNTWHRPSTGTFHSVLAGLAKKSRYAKEAGEL  554

Query  1878  VVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKK  2057
             V LM+ +KIR NI+LST+ V  LF   L + A +I+G LY NGY V M+ELI  L + +K
Sbjct  555   VTLMVERKIRPNIDLSTNVVSSLFGDNLNDTALKIVGLLYHNGYRVKMEELIPSLCENQK  614

Query  2058  LSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER-QIELPLNCLE  2234
               EA+++LLFSL   ++V  ++   V+  LC + RA EAF + YE+ ER    +  +CL 
Sbjct  615   FLEAKEMLLFSLDKCENVNDDVYGLVIGGLCLSGRASEAFRVLYEMNERASAHVSSSCLY  674

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPR  2306
              L+L LE  GR KEAEFV+++M R
Sbjct  675   ALKLALEESGRWKEAEFVSRQMNR  698



>ref|XP_010089004.1| hypothetical protein L484_020290 [Morus notabilis]
 gb|EXB37231.1| hypothetical protein L484_020290 [Morus notabilis]
Length=415

 Score =   495 bits (1275),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/371 (63%), Positives = 291/371 (78%), Gaps = 0/371 (0%)
 Frame = +3

Query  414   ETTVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIP  593
             +TTV+ ++RL+ +P KA +FF W  Q GF+   Q  F MLE+LG  RNLN ARNFLFSI 
Sbjct  45    KTTVLQTLRLITSPFKAFQFFNWVPQMGFSHNDQSCFMMLEILGRSRNLNAARNFLFSIE  104

Query  594   KRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRG  773
             K+S G+V LE RFFNSLI++Y  AGLFQESL+LF++M+ +GISPS+ TFN+L S+L+KRG
Sbjct  105   KKSIGSVKLEDRFFNSLIRSYGNAGLFQESLELFSTMERLGISPSLATFNSLLSVLLKRG  164

Query  774   RTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITY  953
             RT M   +FDE+L T GV+ D +TFN+LIRG C NSMVD+GF FFKEM + +CEPDV+TY
Sbjct  165   RTNMARNVFDEILGTLGVESDTFTFNVLIRGFCTNSMVDEGFHFFKEMSRFKCEPDVVTY  224

Query  954   NTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEM  1133
             NT++DGLCRAGKV+IA NVV+GM KKG DL+PNVVTYTTL+RGYC KQ+++EAL V KEM
Sbjct  225   NTLIDGLCRAGKVDIARNVVEGMKKKGVDLNPNVVTYTTLIRGYCGKQEIDEALLVLKEM  284

Query  1134  VDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGN  1313
              +RG +PN +T+NTLI+GL EA+K D V+++ +G    G FVPDTCTFNTLIH HC  G 
Sbjct  285   TERGLKPNGITHNTLIKGLCEAQKLDDVRKILEGTMRWGEFVPDTCTFNTLIHAHCQAGC  344

Query  1314  LKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRP  1493
             L  AL+ FE+MS L    D ATY  LIRC CQ+GD+  AE+ FDEL+K   LLSDAGCRP
Sbjct  345   LHEALKVFERMSELQVPHDGATYGALIRCFCQRGDYVRAEELFDELWKKKILLSDAGCRP  404

Query  1494  VVAAYNPMFKY  1526
             +VAAYN MF++
Sbjct  405   LVAAYNLMFEH  415


 Score = 71.2 bits (173),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 83/308 (27%), Positives = 137/308 (44%), Gaps = 47/308 (15%)
 Frame = +3

Query  1311  NLKAA---LEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDA  1481
             NL AA   L + EK SI +   +   ++ LIR     G F+ +     ELF T   +   
Sbjct  92    NLNAARNFLFSIEKKSIGSVKLEDRFFNSLIRSYGNAGLFQESL----ELFST---MERL  144

Query  1482  GCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLM-RMGVQ-DPLTFKTLIMGNRNEGMSED  1655
             G  P +A +N +   L + G+T  A  VF +++  +GV+ D  TF  LI G     M ++
Sbjct  145   GISPSLATFNSLLSVLLKRGRTNMARNVFDEILGTLGVESDTFTFNVLIRGFCTNSMVDE  204

Query  1656  GHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSS-HLPRTFVFHSIL  1832
             G      M R    PD  TY +L++GL + GK  +A + +E M K    L    V +   
Sbjct  205   GFHFFKEMSRFKCEPDVVTYNTLIDGLCRAGKVDIARNVVEGMKKKGVDLNPNVVTY---  261

Query  1833  TELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYL  2012
             T L++  C  +  D  +L+L +                    + ER       L  NG  
Sbjct  262   TTLIRGYCGKQEIDEALLVLKE--------------------MTERG------LKPNG--  293

Query  2013  VNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICS--TVLSALCKACRAQEAFELY  2186
             +    LI  L + +KL + R +L  +++  + V  + C+  T++ A C+A    EA +++
Sbjct  294   ITHNTLIKGLCEAQKLDDVRKILEGTMRWGEFV-PDTCTFNTLIHAHCQAGCLHEALKVF  352

Query  2187  YELVERQI  2210
               + E Q+
Sbjct  353   ERMSELQV  360



>gb|KHN22949.1| Pentatricopeptide repeat-containing protein, chloroplastic, partial 
[Glycine soja]
Length=369

 Score =   470 bits (1209),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 230/370 (62%), Positives = 278/370 (75%), Gaps = 1/370 (0%)
 Frame = +3

Query  462   ALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNS  641
             AL FF W +QKGF+ T + YF MLE+LG ERNLN ARNFLFSI K S G V LE RFFNS
Sbjct  1     ALCFFKWTQQKGFSHTPESYFIMLEILGRERNLNVARNFLFSIEKHSKGTVKLEDRFFNS  60

Query  642   LIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTF  821
             LI++YA AGLF+ES+KLF +MK I +SPSVVTFN L SIL+KRG T M  E++DEML+T+
Sbjct  61    LIRSYAEAGLFKESMKLFQTMKSIAVSPSVVTFNNLLSILLKRGCTNMAKEVYDEMLRTY  120

Query  822   GVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIA  1001
             GV PD  T+N+LI G C NSMVD+GFRFF+EME   C+ DV+TYNT+VDGLCRAGKV IA
Sbjct  121   GVSPDTCTYNVLIIGFCKNSMVDEGFRFFREMESFNCDADVVTYNTLVDGLCRAGKVRIA  180

Query  1002  HNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLI  1181
              N+V GM KK   L+PNVVTYTTL+  YC KQ+VEEAL V +EM  RG +PN VTYNTL+
Sbjct  181   RNLVNGMGKKCEGLNPNVVTYTTLIHEYCMKQEVEEALVVLEEMTSRGLKPN-VTYNTLV  239

Query  1182  QGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
             +GL EA K DK+K++ +    DG F PDT TFNT+IH HC  GNL  AL+ FE M     
Sbjct  240   KGLCEAHKLDKMKDVLERMKSDGGFSPDTFTFNTIIHLHCCAGNLDEALKVFESMKKFRI  299

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
               DSA+YS L R LCQK D++M E+ FDELF+   LLS  G +P+ A+YNP+F+ LCE+G
Sbjct  300   PADSASYSTLKRSLCQKWDYDMVEQLFDELFEKEILLSKFGSKPLAASYNPIFESLCEHG  359

Query  1542  KTKKAEKVFR  1571
              TKKAE+V R
Sbjct  360   NTKKAERVIR  369


 Score = 53.9 bits (128),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 95/213 (45%), Gaps = 14/213 (7%)
 Frame = +3

Query  1311  NLKAA---LEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDA  1481
             NL  A   L + EK S      +   ++ LIR   + G F+ + K    LF+T   +   
Sbjct  32    NLNVARNFLFSIEKHSKGTVKLEDRFFNSLIRSYAEAGLFKESMK----LFQT---MKSI  84

Query  1482  GCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRM-GVQ-DPLTFKTLIMGNRNEGMSED  1655
                P V  +N +   L + G T  A++V+ +++R  GV  D  T+  LI+G     M ++
Sbjct  85    AVSPSVVTFNNLLSILLKRGCTNMAKEVYDEMLRTYGVSPDTCTYNVLIIGFCKNSMVDE  144

Query  1656  GHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSH--LPRTFVFHSI  1829
             G      M   N   D  TY +L++GL + GK R+A + +  M K      P    + ++
Sbjct  145   GFRFFREMESFNCDADVVTYNTLVDGLCRAGKVRIARNLVNGMGKKCEGLNPNVVTYTTL  204

Query  1830  LTELVKQNCALECADLVVLMLVKKIRQNINLST  1928
             + E   +    E   ++  M  + ++ N+  +T
Sbjct  205   IHEYCMKQEVEEALVVLEEMTSRGLKPNVTYNT  237



>ref|XP_006358176.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Solanum tuberosum]
Length=460

 Score =   250 bits (639),  Expect(3) = 6e-131, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  3209  PSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDR  3030
             P+S+AWS D K + VGC SSK+QLWDAETS++VR L+GH+ RVG ++WNGH+LTSGS DR
Sbjct  186   PTSVAWSADGKIVAVGCDSSKLQLWDAETSRLVRDLQGHQSRVGCVSWNGHILTSGSKDR  245

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYLH  2850
             +II+HDVR  ++L+S+ +AH  EVCG+KWS TGN L SGGNDNLVYIWD+FK SSR Y+H
Sbjct  246   AIINHDVRARSNLVSVTRAHRGEVCGVKWSSTGNALASGGNDNLVYIWDSFKTSSRHYMH  305

Query  2849  RFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             RFN+H AAVKALAWCPY+ DVLASGGG  DGC+K+W+ +KG CIS+
Sbjct  306   RFNEHHAAVKALAWCPYSSDVLASGGGIDDGCLKIWNTQKGTCIST  351


 Score =   148 bits (374),  Expect(3) = 6e-131, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHAS--RALHLSQ  2516
             G QICGLQWN+HHKE+LSGHGFG  G+   +LCLW YPSM++I +   HAS  R LHLSQ
Sbjct  355   GAQICGLQWNRHHKEILSGHGFGT-GESHCQLCLWSYPSMARIGEPLRHASSSRILHLSQ  413

Query  2515  SPDGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             SPDGLTVVSAGADETLRFWEIFGPPQ      +  D+LLSLK S +R
Sbjct  414   SPDGLTVVSAGADETLRFWEIFGPPQESSENITHLDDLLSLKASAVR  460


 Score =   122 bits (305),  Expect(3) = 6e-131, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 105/239 (44%), Gaps = 101/239 (42%)
 Frame = -2

Query  3939  MDQKSLERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHE  3760
             M+  SL R+Q  WY PTRL  TP + DFP                               
Sbjct  1     MNDNSLTRIQPDWYSPTRLHDTPLDNDFP-------------------------------  29

Query  3759  LPSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTN-PSKELGKSKYNVSMSFLISLNECF  3583
                          GDRFIPNRSLMDLD+AHTLLTN  + +L K  +N             
Sbjct  30    -------------GDRFIPNRSLMDLDQAHTLLTNRTNNKLRKPNFN-------------  63

Query  3582  WFLPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDE  3403
                                 EYRR++E  LKLD EGRPFRMLVFRGSPK SR+S R IDE
Sbjct  64    -------------------DEYRRKMEENLKLDVEGRPFRMLVFRGSPKSSRQSTRLIDE  104

Query  3402  MRRSDEESFSCTDVNKQSRAFP------------------------KVNILAVLLFRII  3298
             MRRSD+E     + N++ R +P                        K NILAV+L  I+
Sbjct  105   MRRSDKEIPLQINENRRYRKYPLKATRALDAPLLSDDYYSNVMDWGKSNILAVVLGSIL  163



>ref|XP_002451419.1| hypothetical protein SORBIDRAFT_04g001815 [Sorghum bicolor]
 gb|EES04395.1| hypothetical protein SORBIDRAFT_04g001815 [Sorghum bicolor]
Length=613

 Score =   415 bits (1067),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 223/505 (44%), Positives = 318/505 (63%), Gaps = 17/505 (3%)
 Frame = +3

Query  831   PDLYTFNILIRGCCMNSMVDQGFRFFKEM----EKHECEPDVITYNTIVDGLCRAGKVEI  998
             PD+ T N LI G    S        FK      E +   PDVITYN+++  LCRAG +  
Sbjct  105   PDVATLNTLIHGLSTASPRPSAPTLFKLFLFLPETYAFAPDVITYNSMLSALCRAGDLAT  164

Query  999   AHNVVKGMLKKG----SDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVT  1166
             AH +  GM   G    +D  PNVVTYTT++R  C K+  +EAL++FK MV  G  PN +T
Sbjct  165   AHKLFDGMRVSGQGGKADAFPNVVTYTTMIRACCAKRLADEALSLFKMMVADGVPPNRIT  224

Query  1167  YNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             YNT++QG  EA + + VKE+F   G D  F PDTCTFNTL+  HC +G ++ A++ F++M
Sbjct  225   YNTMVQGFCEAGRMELVKEVF---GMDS-FKPDTCTFNTLMAAHCREGRIEDAMKVFDQM  280

Query  1347  SILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKY  1526
               L    DSA+YS++IR LC+ G+F   E+F D+L +   L    GC P++AAY+P+ KY
Sbjct  281   MELRVRRDSASYSMVIRALCENGEFGRVEEFVDDLLEKEVLKKKGGCVPLIAAYSPVLKY  340

Query  1527  LCENGKTKKAEKVFRQLM-RMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPD  1703
              CENGK KKA  +F QL+ R    D L FKTLI+G+  EG  E+G++L++ ML+R+  PD
Sbjct  341   FCENGKAKKARVLFGQLLDRRSKVDFLAFKTLILGHCKEGDFEEGYQLVLSMLKRDLRPD  400

Query  1704  FETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN-CALECADLV  1880
              E Y ++++G +Q+G+ + A++ L RML S   P T  FHS+L  L+K++ CA E  DL+
Sbjct  401   TECYIAVIDGFMQKGRMKSAWEALHRMLNSGLQPSTSTFHSVLLGLLKKDGCAKEAGDLI  460

Query  1881  VLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKL  2060
              +ML +KIRQN++LST+ + +LFK+ L +RA++I   LYDNGY + M+++I  L Q KK 
Sbjct  461   EIMLERKIRQNVDLSTNLIGVLFKSDLNDRAYKITKRLYDNGYYIKMEKVIATLCQDKKF  520

Query  2061  SEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDL  2240
              +A +  LFSL+    + +E+ S VL  LC   R  EAF+L+YEL+E +    +     L
Sbjct  521   IDAAEFTLFSLQKRHELGVEVHSLVLDGLCSDGRTSEAFQLFYELMENRSTSAVAAPRSL  580

Query  2241  RL---RLEVEGRSKEAEFVAKRMPR  2306
              L    LE  G+ KEA+FVAK+M R
Sbjct  581   VLLHHALEEAGKVKEADFVAKQMRR  605



>ref|NP_001045722.1| Os02g0121900 [Oryza sativa Japonica Group]
 dbj|BAD07608.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF07636.1| Os02g0121900 [Oryza sativa Japonica Group]
 gb|EAZ21545.1| hypothetical protein OsJ_05173 [Oryza sativa Japonica Group]
 gb|EEC72375.1| hypothetical protein OsI_05641 [Oryza sativa Indica Group]
Length=624

 Score =   410 bits (1054),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 225/508 (44%), Positives = 313/508 (62%), Gaps = 22/508 (4%)
 Frame = +3

Query  831   PDLYTFNILIRGCCMNS------MVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKV  992
             PD  T N L+ G    S       + + FRF  +   +   PD I+YN+++  LCRAG V
Sbjct  114   PDAATLNTLLHGLSTASPHPSTPALLRLFRFLPD--TYAFAPDAISYNSLLSALCRAGDV  171

Query  993   EIAHNVVKGMLKKGSD----LSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNS  1160
               A  +  GM   G +    + PNV+TYTT+++ YC K+ V EAL +FK MV  G  PN 
Sbjct  172   LTARKLFDGMRVGGEEGRGAVFPNVITYTTMIKAYCAKRLVNEALAIFKLMVADGVAPNR  231

Query  1161  VTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFE  1340
             +TYNT++QG  +A + + VKE+     E   F PDTCTFNTL+  HC +G ++ A++ F 
Sbjct  232   ITYNTMVQGFCDAGRMELVKEVL----EMDSFRPDTCTFNTLVAVHCREGRIEDAMKVFN  287

Query  1341  KMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMF  1520
             +M  L    DSA+YS++IR LC+ G+F  AE+  DEL +   L    GC P++AAYNP+F
Sbjct  288   QMVELRVRRDSASYSMVIRVLCENGEFGQAEELVDELLEKEVLKKRGGCTPLIAAYNPVF  347

Query  1521  KYLCENGKTKKAEKVFRQLM-RMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFV  1697
              YLCE+GKTKKA  +F QL+ R    D   FKTLI+G+  EG  E+G+ LL+ ML+R+ V
Sbjct  348   VYLCEHGKTKKARMLFGQLLDRRSKVDVPAFKTLILGHCREGDFEEGYALLLSMLKRDLV  407

Query  1698  PDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELV-KQNCALECAD  1874
             PD E Y +++EG  Q G+ + A++ L RML S   P T  FHS+L  L+ K  CA E AD
Sbjct  408   PDDECYIAVIEGFSQRGRMKFAWEALHRMLNSGLRPSTSTFHSVLLGLLNKDGCAKEAAD  467

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             L+ +ML +KIRQN++LST+ V  LF+  L +RA++I+  LYD+GY + M++LI  L + K
Sbjct  468   LIEIMLERKIRQNVDLSTNLVDTLFRNNLNDRAYKIVTSLYDHGYYIKMEKLIANLCEEK  527

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPL----  2222
             K  EA D  LFSL+ SQ+  + I S VL  LC   RA EAF L+YEL+E +  L      
Sbjct  528   KFIEAADFTLFSLEKSQNFGVAIPSMVLDGLCMTGRASEAFRLFYELIENRSALASVAAP  587

Query  2223  NCLEDLRLRLEVEGRSKEAEFVAKRMPR  2306
               L  L   LE  G+ KEA+F+A++M R
Sbjct  588   RSLVALHHALEESGKMKEADFIARQMRR  615



>ref|XP_010662225.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
isoform X1 [Vitis vinifera]
 ref|XP_010662226.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
isoform X1 [Vitis vinifera]
Length=455

 Score =   236 bits (602),  Expect(3) = 2e-123, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA   G  Q   + D+Q+DYP+SIAW  D + + VG  SSK+QLWDAET K++R L+G
Sbjct  162   LWNAET-GHSQKLMQVDDQEDYPTSIAWCEDGRRVAVGHLSSKLQLWDAETFKLIRSLEG  220

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RVG  AWNG +LTSGS D+SII+HDVR  NSL   ++ H++EVCGLKWS TGN L S
Sbjct  221   HDDRVGIAAWNGQILTSGSRDKSIINHDVRARNSLTCRVQIHSQEVCGLKWSITGNKLAS  280

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIW+  KM S ++LHRF+ H AAVKALAWCPY  DVLASGGGT DGCIK+W+I
Sbjct  281   GGNENLIYIWEASKMCSSNFLHRFSGHQAAVKALAWCPYQSDVLASGGGTLDGCIKIWNI  340

Query  2735  RKGACISS  2712
             +KG CI+S
Sbjct  341   QKGTCINS  348


 Score =   149 bits (376),  Expect(3) = 2e-123, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   G    +LCLW+YPSMSK+ +   H+SR LHLSQSPDG
Sbjct  354   QICGLEWNRHHKEILSGHGFSATGH-QNELCLWKYPSMSKLGELKCHSSRVLHLSQSPDG  412

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSAGADETLRFWE+FGPP  D SR SD D+LLS K S IR
Sbjct  413   STVVSAGADETLRFWEVFGPPVTDSSRVSDLDSLLSFKRSLIR  455


 Score =   110 bits (274),  Expect(3) = 2e-123, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 91/199 (46%), Gaps = 77/199 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSAN  3745
             + R    WY PTRL  +PT+Y FP                                    
Sbjct  1     MSRFNGDWYSPTRLHDSPTQYHFP------------------------------------  24

Query  3744  GF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPIS  3565
                     GDRFIPNRSLMDLD+AHTLLT+ ++E+  S +                    
Sbjct  25    --------GDRFIPNRSLMDLDQAHTLLTSRTREVCNSTFG-------------------  57

Query  3564  GNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE  3385
                         + EYRR+LE  L  D EGRPFRMLVFRGSPK S+KSIR +DEM++ DE
Sbjct  58    ------------QDEYRRKLEENLFFDSEGRPFRMLVFRGSPKSSKKSIRFLDEMQQQDE  105

Query  3384  -ESFSCTDVNK-QSRAFPK  3334
              E+    ++ + Q R  PK
Sbjct  106   AEALHNKNIKQFQYRHLPK  124



>ref|XP_002277711.2| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
isoform X2 [Vitis vinifera]
Length=454

 Score =   236 bits (601),  Expect(3) = 6e-123, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA   G  Q   + D+Q+DYP+SIAW  D + + VG  SSK+QLWDAET K++R L+G
Sbjct  161   LWNAET-GHSQKLMQVDDQEDYPTSIAWCEDGRRVAVGHLSSKLQLWDAETFKLIRSLEG  219

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RVG  AWNG +LTSGS D+SII+HDVR  NSL   ++ H++EVCGLKWS TGN L S
Sbjct  220   HDDRVGIAAWNGQILTSGSRDKSIINHDVRARNSLTCRVQIHSQEVCGLKWSITGNKLAS  279

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIW+  KM S ++LHRF+ H AAVKALAWCPY  DVLASGGGT DGCIK+W+I
Sbjct  280   GGNENLIYIWEASKMCSSNFLHRFSGHQAAVKALAWCPYQSDVLASGGGTLDGCIKIWNI  339

Query  2735  RKGACISS  2712
             +KG CI+S
Sbjct  340   QKGTCINS  347


 Score =   149 bits (376),  Expect(3) = 6e-123, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   G    +LCLW+YPSMSK+ +   H+SR LHLSQSPDG
Sbjct  353   QICGLEWNRHHKEILSGHGFSATGH-QNELCLWKYPSMSKLGELKCHSSRVLHLSQSPDG  411

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSAGADETLRFWE+FGPP  D SR SD D+LLS K S IR
Sbjct  412   STVVSAGADETLRFWEVFGPPVTDSSRVSDLDSLLSFKRSLIR  454


 Score =   108 bits (271),  Expect(3) = 6e-123, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 90/199 (45%), Gaps = 78/199 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSAN  3745
             + R    WY PTRL  +PT+Y FP                                    
Sbjct  1     MSRFNGDWYSPTRLHDSPTQYHFP------------------------------------  24

Query  3744  GF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPIS  3565
                     GDRFIPNRSLMDLD+AHTLLT+ ++E+  S +                    
Sbjct  25    --------GDRFIPNRSLMDLDQAHTLLTSRTREVCNSTFG-------------------  57

Query  3564  GNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE  3385
                           EYRR+LE  L  D EGRPFRMLVFRGSPK S+KSIR +DEM++ DE
Sbjct  58    -------------DEYRRKLEENLFFDSEGRPFRMLVFRGSPKSSKKSIRFLDEMQQQDE  104

Query  3384  -ESFSCTDVNK-QSRAFPK  3334
              E+    ++ + Q R  PK
Sbjct  105   AEALHNKNIKQFQYRHLPK  123



>ref|XP_003573599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Brachypodium distachyon]
Length=627

 Score =   406 bits (1043),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 329/544 (60%), Gaps = 21/544 (4%)
 Frame = +3

Query  720   SPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQG-  896
             +P+  +FN+L S L++RGR      L    L++    PD  T N L+ G    +      
Sbjct  81    TPTPHSFNSLLSALLRRGRLRAANALLAAFLRSRTASPDAATLNTLLHGLSAAAPRASPP  140

Query  897   -----FRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGS----DLSP  1049
                  FRF  E   +   PD ++YN+++  LCRAG +  A  +   M  + +     + P
Sbjct  141   ALVNLFRFLPE--TYAFAPDAVSYNSLLCALCRAGDLPAARKLFDVMRVRATGGNGSVPP  198

Query  1050  NVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELF  1229
             +VVTYTT++R YC ++  +EAL VF+ M   G  PN +TYNT++QG  E  + D VK L 
Sbjct  199   DVVTYTTMIRAYCARRLADEALAVFRMMAADGVPPNRITYNTMVQGFCEVGRVDLVKGLL  258

Query  1230  KGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQ  1409
                 E   F PDTCTFNTL+ THC +G +K A+E F +M  L  + DSA+YS +IR LC+
Sbjct  259   ----ETDSFKPDTCTFNTLMATHCREGQVKEAMEVFGQMVELRVSRDSASYSTVIRGLCE  314

Query  1410  KGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMG  1589
              G+F  AE+  DEL +   L    GC P++AAYNP+F YLCENGK  KA  +F QL+   
Sbjct  315   NGEFVRAEELVDELVEKEVLKKRGGCVPLIAAYNPVFVYLCENGKANKARVLFGQLLDQR  374

Query  1590  VQ-DPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAY  1766
              + D   FKTLI+G+  EG  E+G++L++ ML+R+ VPD E Y ++++G  + G+ ++A+
Sbjct  375   SKVDFAAFKTLILGHCKEGDFEEGYQLVLSMLKRDLVPDDECYIAVVDGFSRRGRMKIAW  434

Query  1767  DTLERMLKSSHLPRTFVFHSILTELVKQN-CALECADLVVLMLVKKIRQNINLSTDTVRI  1943
             + L RML S   P T  FHS+L  L+K++ CA E ADL+ +ML + IRQN++LST+ +  
Sbjct  435   EALHRMLDSGLRPSTSTFHSVLLGLLKKDGCAKEAADLIEIMLERNIRQNLDLSTNMIDS  494

Query  1944  LFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEI  2123
             L K+ L ERA+ I+  LYD+GY + M+ LI  L + KK  EA +L LFSL+    + + +
Sbjct  495   LLKSNLNERAYRIITSLYDHGYYIKMETLIESLCEEKKFIEAAELTLFSLQKHHELGVAV  554

Query  2124  CSTVLSALCKACRAQEAFELYYELVERQ---IELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
             CS VL  LC A RA +AF L+YEL+E +     +  + L  L   L+ +G+ KEA+F+AK
Sbjct  555   CSMVLDGLCTAGRASDAFRLFYELIENRGTSAAVAPSSLVALYHALKEDGKMKEADFIAK  614

Query  2295  RMPR  2306
             +M R
Sbjct  615   QMRR  618



>emb|CBI38557.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   236 bits (602),  Expect(3) = 3e-121, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA   G  Q   + D+Q+DYP+SIAW  D + + VG  SSK+QLWDAET K++R L+G
Sbjct  162   LWNAET-GHSQKLMQVDDQEDYPTSIAWCEDGRRVAVGHLSSKLQLWDAETFKLIRSLEG  220

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RVG  AWNG +LTSGS D+SII+HDVR  NSL   ++ H++EVCGLKWS TGN L S
Sbjct  221   HDDRVGIAAWNGQILTSGSRDKSIINHDVRARNSLTCRVQIHSQEVCGLKWSITGNKLAS  280

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIW+  KM S ++LHRF+ H AAVKALAWCPY  DVLASGGGT DGCIK+W+I
Sbjct  281   GGNENLIYIWEASKMCSSNFLHRFSGHQAAVKALAWCPYQSDVLASGGGTLDGCIKIWNI  340

Query  2735  RKGACISS  2712
             +KG CI+S
Sbjct  341   QKGTCINS  348


 Score =   142 bits (358),  Expect(3) = 3e-121, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   G    +LCLW+YPSMSK+ +   H+SR LHLSQSPDG
Sbjct  354   QICGLEWNRHHKEILSGHGFSATGH-QNELCLWKYPSMSKLGELKCHSSRVLHLSQSPDG  412

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTS  2384
              TVVSAGADETLRFWE+FGPP  D SR SD D+LL    S
Sbjct  413   STVVSAGADETLRFWEVFGPPVTDSSRVSDLDSLLMFPIS  452


 Score =   110 bits (274),  Expect(3) = 3e-121, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 91/199 (46%), Gaps = 77/199 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSAN  3745
             + R    WY PTRL  +PT+Y FP                                    
Sbjct  1     MSRFNGDWYSPTRLHDSPTQYHFP------------------------------------  24

Query  3744  GF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPIS  3565
                     GDRFIPNRSLMDLD+AHTLLT+ ++E+  S +                    
Sbjct  25    --------GDRFIPNRSLMDLDQAHTLLTSRTREVCNSTFG-------------------  57

Query  3564  GNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE  3385
                         + EYRR+LE  L  D EGRPFRMLVFRGSPK S+KSIR +DEM++ DE
Sbjct  58    ------------QDEYRRKLEENLFFDSEGRPFRMLVFRGSPKSSKKSIRFLDEMQQQDE  105

Query  3384  -ESFSCTDVNK-QSRAFPK  3334
              E+    ++ + Q R  PK
Sbjct  106   AEALHNKNIKQFQYRHLPK  124



>ref|XP_011076552.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Sesamum indicum]
Length=451

 Score =   235 bits (600),  Expect(3) = 3e-119, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 149/195 (76%), Gaps = 2/195 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA NH I+ L E  +N   YP+S++WS DAK L VG   S+IQL+DAE+ K VRCL G
Sbjct  160   LWNAENHKIELLSEATEND--YPASVSWSEDAKMLAVGYRCSRIQLFDAESLKPVRCLNG  217

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RVGSI+W G++LTSGS DR+II+HDVR  NS++  +K H  EVCGLKWS TG+ L S
Sbjct  218   HQKRVGSISWKGNILTSGSCDRAIINHDVRARNSMVCYIKVHKGEVCGLKWSNTGSILAS  277

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             G NDNLV +WD  KMSS  +L+R NDH AAVKALAWCPYNY++LA+GGG+ DG +K+W+ 
Sbjct  278   GANDNLVCLWDACKMSSMHHLYRLNDHRAAVKALAWCPYNYNMLATGGGSTDGSLKIWNT  337

Query  2735  RKGACISSTFSKNLV  2691
             +KG CI+S  +K+ +
Sbjct  338   QKGVCINSIETKSQI  352


 Score =   149 bits (377),  Expect(3) = 3e-119, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGLQWN+HH E+LSGHG+G   +   +LCLWRYPSMS+I  S NH SR LHLSQSPDG
Sbjct  351   QICGLQWNRHHNEILSGHGYG--FECQNQLCLWRYPSMSRIGGSVNHRSRVLHLSQSPDG  408

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAG DETLRFWE+FGP     SR S  ++LLSLKTSPIR
Sbjct  409   LTVVSAGEDETLRFWEVFGPASDGNSRISYLESLLSLKTSPIR  451


 Score = 96.7 bits (239),  Expect(3) = 3e-119, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 82/195 (42%), Gaps = 80/195 (41%)
 Frame = -2

Query  3918  RLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF  3739
             RLQS WY PTRL  +P EYDFP                                      
Sbjct  8     RLQSDWYSPTRLHDSPVEYDFP--------------------------------------  29

Query  3738  *FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGN  3559
                   GDRFIPNRSLMDLD+A  +LTN     G  K  +++                  
Sbjct  30    ------GDRFIPNRSLMDLDQAQGVLTNRINR-GPQKTKLTI------------------  64

Query  3558  WELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEES  3379
                         EY+R L   L LD EGRPF+MLVFRGSPK  RK  R  DEMRRS EE 
Sbjct  65    ------------EYQRNL-GNLTLDAEGRPFQMLVFRGSPKSGRKIGRLTDEMRRSHEEI  111

Query  3378  FSCTDVNKQSRAFPK  3334
              +     K  R FPK
Sbjct  112   LT----RKPLRRFPK  122



>ref|NP_001169582.1| hypothetical protein [Zea mays]
 ref|XP_008644076.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34177.1| unknown [Zea mays]
 gb|AFW69880.1| hypothetical protein ZEAMMB73_684747 [Zea mays]
Length=622

 Score =   395 bits (1016),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 219/509 (43%), Positives = 315/509 (62%), Gaps = 23/509 (5%)
 Frame = +3

Query  822   GVKPDLYTFNILIRGCCMNSMVDQG------FRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             G  PD+ T N LI G    S           FRF  E   +   PD ITYN+++  LCRA
Sbjct  110   GASPDVATLNTLIHGLSTASPRPSSPALLRLFRFLPE--AYAFAPDAITYNSMLAALCRA  167

Query  984   GKVEIAHNVVKGML--KKGSDLS--PNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPE  1151
             G +  A  +  GM   ++G +    PNVV YTT++R  C  +  +EAL++FK M+  G  
Sbjct  168   GDLATARRLFDGMRAGEQGGEAGAFPNVVAYTTMIRACCASRLADEALSLFKMMLADGVR  227

Query  1152  PNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALE  1331
             PN +TYNT++QG  +A + + VKE+F   G D  F PDTCTFNTL+  HC +G ++ A +
Sbjct  228   PNRITYNTMVQGFCQAGRMELVKEVF---GMDS-FKPDTCTFNTLMAAHCREGRIQDAKK  283

Query  1332  AFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYN  1511
              F++M  L    DSA+YSI+ R LC+ G+F  AE+  D L +   L    GC P++A+YN
Sbjct  284   VFDQMMELRVRRDSASYSIVTRALCENGEFGRAEELVDSLLEKEVLKKRGGCVPLIASYN  343

Query  1512  PMFKYLCENGKTKKAEKVFRQLMRMGVQ-DPLTFKTLIMGNRNEGMSEDGHELLVWMLRR  1688
             P+FKYLCENGK KKA  +F QL+ +  + D L FKTLI+G+  EG  E+G+EL++ ML+R
Sbjct  344   PVFKYLCENGKAKKARLLFGQLLDIRSKVDFLAFKTLILGHCKEGDFEEGYELVLSMLKR  403

Query  1689  NFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN-CALE  1865
             + +PD E Y ++++G +Q+G+ + A++ L RML S   P T  FHS+L  L+K++ CA E
Sbjct  404   DLMPDSECYIAVIDGFMQKGRMKSAWEALHRMLNSGLRPSTSTFHSVLLGLLKKDGCAKE  463

Query  1866  CADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLS  2045
              ADL+ +ML +KIRQN++LST+ + +LFK+ L +RA++I   LYDNGY + M++LI  L 
Sbjct  464   AADLIEIMLERKIRQNVDLSTNLIGVLFKSDLNDRAYKITKHLYDNGYYIKMEKLIATLC  523

Query  2046  QGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ----IE  2213
             + KK  +A +  LFSL+    + + + S VL  LC   R  EAF+L+YEL E +    + 
Sbjct  524   EDKKFIDAAEFSLFSLRKRHELGVAVHSQVLDGLCSDRRTSEAFQLFYELNENKRTSAVA  583

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
              P   L  L   LE  G  +EA FVAK+M
Sbjct  584   AP-RSLVFLHHALEEAGMVQEAGFVAKQM  611



>ref|XP_006648252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Oryza brachyantha]
Length=590

 Score =   394 bits (1013),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 218/506 (43%), Positives = 307/506 (61%), Gaps = 18/506 (4%)
 Frame = +3

Query  831   PDLYTFNILIRGCCMNSMVDQG---FRFFKEM-EKHECEPDVITYNTIVDGLCRAGKVEI  998
             PD  T N L+ G    S         R F  + E +   PD I+YN+++  LCRAG +  
Sbjct  80    PDAATLNTLLHGLSTASPQPSPPALLRLFHFLPETYAFAPDAISYNSLLSALCRAGDLVT  139

Query  999   AHNVVKGML---KKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTY  1169
             A  +  GM    +   D+ PNV+TYTT+++ YC K+ V EAL +FK MV  G EPN +TY
Sbjct  140   ARKLFDGMRVGEEGRGDVFPNVITYTTMIKAYCGKRLVSEALAIFKIMVADGVEPNRITY  199

Query  1170  NTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMS  1349
             NT++QG  +A + + VKE+     +   F PDTCTFN L+  HC +G ++ A++ F +M 
Sbjct  200   NTMVQGFCDAGRMELVKEVL----DMDSFKPDTCTFNILVAAHCREGRIEDAMKVFNQMV  255

Query  1350  ILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYL  1529
              L    DSA+YS++IR LC+  +F  AE+  DEL +   L    GC P++AAYNP+F YL
Sbjct  256   ELRVRRDSASYSMVIRALCENEEFAQAEELVDELLEKEVLKKRGGCTPLIAAYNPVFVYL  315

Query  1530  CENGKTKKAEKVFRQLM-RMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDF  1706
             CE+GKTKKA  +F  L+ R    D   FKTLI+G+  EG  E G+EL++ ML+R+ VPD 
Sbjct  316   CEHGKTKKARMLFGLLLDRRSKVDVPAFKTLILGHCREGDFEQGYELVLSMLKRDLVPDN  375

Query  1707  ETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELV-KQNCALECADLVV  1883
             E Y  +++G  Q+G+ + A++ L RML S   P T  FHS+L  L+ K  CA E ADL+ 
Sbjct  376   ECYIGVIDGFSQKGRMKFAWEALHRMLNSGLRPSTSTFHSVLLGLLNKDGCAKEAADLIE  435

Query  1884  LMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLS  2063
             +ML +KIRQN++LST+ +  LF+  L +RA++I+  LYD+GY + M++LI  L + KK  
Sbjct  436   IMLERKIRQNVDLSTNLIDTLFRNCLNDRAYKIVTSLYDHGYYIKMEKLIASLCKEKKFM  495

Query  2064  EARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPL-----NC  2228
             EA DL LFS K  Q++ +   S V+  LC   RA EAF L+YEL+E +            
Sbjct  496   EAADLTLFSFKKCQNLGVAFPSMVMDGLCITGRASEAFWLFYELIENRSSSSSSAAAPRS  555

Query  2229  LEDLRLRLEVEGRSKEAEFVAKRMPR  2306
             L  L   LE  G+ KEA+FVAK+M R
Sbjct  556   LVALHHALEESGKMKEADFVAKQMRR  581


 Score =   114 bits (286),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 105/434 (24%), Positives = 187/434 (43%), Gaps = 54/434 (12%)
 Frame = +3

Query  621   EARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELF  800
             +A  +NSL+     AG    + KLF  M+V                  + GR G V+   
Sbjct  120   DAISYNSLLSALCRAGDLVTARKLFDGMRV-----------------GEEGR-GDVF---  158

Query  801   DEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCR  980
                       P++ T+  +I+  C   +V +    FK M     EP+ ITYNT+V G C 
Sbjct  159   ----------PNVITYTTMIKAYCGKRLVSEALAIFKIMVADGVEPNRITYNTMVQGFCD  208

Query  981   AGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNS  1160
             AG++E+    VK +L   S   P+  T+  LV  +C + ++E+A+ VF +MV+     +S
Sbjct  209   AGRMEL----VKEVLDMDS-FKPDTCTFNILVAAHCREGRIEDAMKVFNQMVELRVRRDS  263

Query  1161  VTYNTLIQGLLEARKFDKVKELFKGAGED------GRFVPDTCTFNTLIHTHCSDGNLKA  1322
              +Y+ +I+ L E  +F + +EL     E       G   P    +N +    C  G  K 
Sbjct  264   ASYSMVIRALCENEEFAQAEELVDELLEKEVLKKRGGCTPLIAAYNPVFVYLCEHGKTKK  323

Query  1323  ALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVA  1502
             A   F  +    +  D   +  LI   C++GDFE   +    + K   L+ D  C     
Sbjct  324   ARMLFGLLLDRRSKVDVPAFKTLILGHCREGDFEQGYELVLSMLKR-DLVPDNEC-----  377

Query  1503  AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPL-TFKTLIMGNRN-EGMSEDGHELLVW  1676
              Y  +     + G+ K A +   +++  G++    TF ++++G  N +G +++  +L+  
Sbjct  378   -YIGVIDGFSQKGRMKFAWEALHRMLNSGLRPSTSTFHSVLLGLLNKDGCAKEAADLIEI  436

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             ML R    + +   +L++ L +      AY  +  +    +  +      ++  L K+  
Sbjct  437   MLERKIRQNVDLSTNLIDTLFRNCLNDRAYKIVTSLYDHGYYIK---MEKLIASLCKEKK  493

Query  1857  ALECADLVVLMLVK  1898
              +E ADL +    K
Sbjct  494   FMEAADLTLFSFKK  507



>ref|XP_011040316.1| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
[Populus euphratica]
Length=460

 Score =   238 bits (606),  Expect(3) = 9e-118, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 148/193 (77%), Gaps = 2/193 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N  +++L E + + D YP+S+AWS  A +L +GC  SK+Q+WD ETSK +R L G
Sbjct  167   LWNAENQEVKKLLEVQGHND-YPTSVAWSEKATSLAIGCMKSKLQIWDPETSKCIRSLGG  225

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ R+ +IAWNGH LT+GS DRSII+HDVRV NS  S ++AHT EVCGLKWS  GN L S
Sbjct  226   HQSRIAAIAWNGHTLTTGSRDRSIINHDVRVRNSPTSRIQAHTEEVCGLKWSSEGNVLAS  285

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHS-AAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             GGN++ +YIW+  KMSS ++LHRFN H+ AAVKALAWCPY ++VLASGGGT DGCIK+W+
Sbjct  286   GGNESFIYIWEASKMSSSNFLHRFNAHNQAAVKALAWCPYQFNVLASGGGTGDGCIKIWN  345

Query  2738  IRKGACISSTFSK  2700
             ++ G C  S  +K
Sbjct  346   MKGGTCTHSIETK  358


 Score =   140 bits (354),  Expect(3) = 9e-118, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHG+G   +    LCLW+YPSM+K+ +   H  R + LSQSPDG
Sbjct  360   QICGLEWNRHHKEILSGHGYGN-SEVQNHLCLWKYPSMTKVGEINRHERRVISLSQSPDG  418

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAG DETLRFWEIFGPP+   S  SDF+NLLS KTS +R
Sbjct  419   LTVVSAGGDETLRFWEIFGPPRVGNS-ASDFENLLSFKTSLVR  460


 Score = 98.2 bits (243),  Expect(3) = 9e-118, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 86/204 (42%), Gaps = 79/204 (39%)
 Frame = -2

Query  3939  MDQ--KSLERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWG  3766
             MDQ  K + +LQ  WY P RL  +PT+Y+FP                             
Sbjct  1     MDQSKKRVVQLQPDWYSPRRLHDSPTQYEFP-----------------------------  31

Query  3765  HELPSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNEC  3586
                            GDRFIPNRSLM+LD+AH LLTN  KE+                  
Sbjct  32    ---------------GDRFIPNRSLMNLDQAHCLLTNKIKEIH-----------------  59

Query  3585  FWFLPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREID  3406
                           +P   KG YR  L  +L LD EGRPFRMLVFRGSPK  RK    ID
Sbjct  60    --------------NPNFGKG-YREMLRESLTLDSEGRPFRMLVFRGSPKSRRKWNYVID  104

Query  3405  EMRRS-DEESFSCTDVNKQSRAFP  3337
             EMRR  D E  S      +SR  P
Sbjct  105   EMRRDIDAEVLSNGIKQHESRHLP  128



>ref|XP_006589022.1| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
[Glycine max]
Length=452

 Score =   226 bits (575),  Expect(3) = 1e-117, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 145/195 (74%), Gaps = 2/195 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWN+ N  + +L +  +N   +P+S++WS D K L +G  +SK+QLWDAETSK +R L+G
Sbjct  160   LWNSENKNVFKLFKATNND--FPTSVSWSEDTKYLAIGFMNSKLQLWDAETSKPIRILQG  217

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  R+ +IAWNG +LTSGS+D+ II+HDVR  N++IS +KAH  EVCGLKW+   N L S
Sbjct  218   HGHRIATIAWNGQILTSGSHDKYIINHDVRARNNVISQVKAHKAEVCGLKWTRRSNMLAS  277

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+N +Y+WD  KMSS ++LH F DH AAVKALAWCPY+  VLASGGGT D CIK+W++
Sbjct  278   GGNENHIYVWDLVKMSSSNFLHCFKDHCAAVKALAWCPYDSSVLASGGGTEDSCIKLWNV  337

Query  2735  RKGACISSTFSKNLV  2691
             +KG+ I S  +K  V
Sbjct  338   KKGSSICSIDTKAQV  352


 Score =   148 bits (374),  Expect(3) = 1e-117, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN+HHKELLSGHGF        +LC+W+YPSM+K+     HASR LHL QSPDG
Sbjct  351   QVCGLEWNRHHKELLSGHGFSTSAHH-NQLCMWKYPSMTKVGGLDRHASRVLHLCQSPDG  409

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAGADE+LRFW++FGPP  + S  SD DNLLSLK SPIR
Sbjct  410   LTVVSAGADESLRFWDVFGPPVNNTSEISDLDNLLSLKVSPIR  452


 Score =   102 bits (253),  Expect(3) = 1e-117, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 87/197 (44%), Gaps = 81/197 (41%)
 Frame = -2

Query  3915  LQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF*  3736
             L+  WY P  LLSTPT YDFP                                       
Sbjct  4     LEHDWYSPKSLLSTPTHYDFP---------------------------------------  24

Query  3735  FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNW  3556
                  GDRFIPNRSLMDLD+AH+LLTN ++++   ++N                      
Sbjct  25    -----GDRFIPNRSLMDLDQAHSLLTNRTRKIQNKEFN----------------------  57

Query  3555  ELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESF  3376
                         YR+ ++  L LD EG PF+MLVFRGSPK SRKSI  IDEMR  +EE+ 
Sbjct  58    ----------DLYRQIVDEKLNLDSEGNPFKMLVFRGSPKSSRKSILHIDEMR--EEEAA  105

Query  3375  SCTDVNKQS---RAFPK  3334
             +  + + Q    R  PK
Sbjct  106   ALQNTSNQHYYRRRLPK  122



>ref|XP_010109151.1| Anaphase-promoting complex subunit cdc20 [Morus notabilis]
 gb|EXC21080.1| Anaphase-promoting complex subunit cdc20 [Morus notabilis]
Length=420

 Score =   200 bits (509),  Expect(3) = 2e-117, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWN+ N  +++L    +N   YP+S+ WS DAKTL VG   SK+QLWDAETSK+VR L+ 
Sbjct  160   LWNSENKKVEKLLAVGEND--YPTSVVWSKDAKTLAVGYMGSKLQLWDAETSKLVRTLED  217

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RV +IAWNGH+LTSGS D+SII+HDVR +++++  ++AH  EVCGLKWS TGN L S
Sbjct  218   HKKRVATIAWNGHILTSGSQDKSIINHDVRAASNVVCRVEAHADEVCGLKWSETGNMLAS  277

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDV  2787
             GGN+N ++IW++ K+SS  +L+RF DH AAVKALAWCPY  ++
Sbjct  278   GGNENHIFIWESAKLSSSKFLYRFKDHRAAVKALAWCPYQSEI  320


 Score =   160 bits (406),  Expect(3) = 2e-117, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             +ICGL+WN+HHKELLSGHGF   G+   +LCLWRYPSM+K+ D   H+SR LHLSQSPDG
Sbjct  319   EICGLEWNRHHKELLSGHGFSS-GERPNQLCLWRYPSMAKVGDLKRHSSRVLHLSQSPDG  377

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTV SAGADETLR WE+FGPP AD SR S+ D LLSLKTSPIR
Sbjct  378   LTVASAGADETLRLWEVFGPPSADNSRLSELDRLLSLKTSPIR  420


 Score =   114 bits (286),  Expect(3) = 2e-117, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 91/199 (46%), Gaps = 77/199 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTP-TEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSA  3748
             +  LQ  WY PTRL S P T+YDFP                                   
Sbjct  1     MSELQCDWYSPTRLRSNPATQYDFP-----------------------------------  25

Query  3747  NGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPI  3568
                      GDRFIPNRSLMDLD+AH+LLTN +K    S +N                  
Sbjct  26    ---------GDRFIPNRSLMDLDQAHSLLTNRTKSQRNSSFN------------------  58

Query  3567  SGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSD  3388
                 E+          YRR++EA L LD EG+PFRMLVFRGSPK SRKSIR +DEMR+ +
Sbjct  59    ----EM----------YRRKVEAKLTLDSEGKPFRMLVFRGSPKSSRKSIRCVDEMRQDE  104

Query  3387  EESFSCTDVNKQSRAFPKV  3331
             EE       +   R  PKV
Sbjct  105   EEELQKHTKHYNLRRLPKV  123



>ref|XP_009362728.1| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
[Pyrus x bretschneideri]
Length=452

 Score =   239 bits (610),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 145/188 (77%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWN+TN  + +L   +D  D +P+S+ WS +AKTL VG   SK+QLWDAETSK+VR  + 
Sbjct  160   LWNSTNREVHKLLHVDDPSD-FPTSVTWSENAKTLAVGYRRSKLQLWDAETSKLVRRFEN  218

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ R+ ++AWNGHVLTSGS D SII+HDVR  N ++S L+AH  EVCGLKWS  GN L S
Sbjct  219   HKDRIATVAWNGHVLTSGSRDASIINHDVRAGNIVVSRLQAHKEEVCGLKWSEGGNVLAS  278

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNL+YIWD+ KM+S  +L RF +HSAAVKALAWCPY  +VLASGGGT DGCIK+W+ 
Sbjct  279   GGNDNLLYIWDSSKMNSSRFLFRFREHSAAVKALAWCPYQSEVLASGGGTEDGCIKLWNT  338

Query  2735  RKGACISS  2712
             +KG CI +
Sbjct  339   KKGTCIKT  346


 Score =   140 bits (353),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN+HHKE+LS HG+        +LC+WRYPSM+ + +   H SR LH+SQSPDG
Sbjct  352   QVCGLEWNRHHKEILSAHGYSRSELIKNQLCIWRYPSMANVGNLNRHTSRILHVSQSPDG  411

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAG DETLRFW+IFGPP  DK   S  D LLSLKTSP+R
Sbjct  412   LTVVSAGGDETLRFWDIFGPPSIDK--ISPLDGLLSLKTSPLR  452


 Score = 92.0 bits (227),  Expect(3) = 2e-116, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 82/198 (41%), Gaps = 77/198 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTP-TEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSA  3748
             ++ LQS W  PTRL ++P   +DFP                                   
Sbjct  1     MQELQSDWCSPTRLQTSPIARFDFP-----------------------------------  25

Query  3747  NGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPI  3568
                      GDRFIP+RSLMDLD+A +LLTN +     S +N                  
Sbjct  26    ---------GDRFIPSRSLMDLDQARSLLTNRTTPTRNSNFN------------------  58

Query  3567  SGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSD  3388
                             YRR LE  L LD +G PFRMLVFRGSPK +RK IR +D MR+ +
Sbjct  59    --------------DVYRRSLEDKLTLDSDGNPFRMLVFRGSPKSNRKPIRSVDLMRQDE  104

Query  3387  EESFSCTDVNKQSRAFPK  3334
              +    +  N Q R  PK
Sbjct  105   AKELDSSIKNVQPRRLPK  122



>gb|EMT16521.1| hypothetical protein F775_33155 [Aegilops tauschii]
Length=443

 Score =   381 bits (979),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 279/429 (65%), Gaps = 9/429 (2%)
 Frame = +3

Query  1035  SDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDK  1214
             + +SPNV+TYTT+++ YC +   +EAL VF  M   G  PN +TYNT+IQG  EA +   
Sbjct  10    ASVSPNVITYTTMIKAYCVRGLADEALAVFNMMSADGVAPNRITYNTMIQGFCEAGRM--  67

Query  1215  VKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILI  1394
               EL KG  E   F PDTCTFNTL+  HC +G +K A+E F +M+ L  + DSA+YS +I
Sbjct  68    --ELVKGLLETDSFKPDTCTFNTLMAAHCGEGRVKEAMEVFGQMAELRVSRDSASYSTVI  125

Query  1395  RCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQ  1574
             R LC   +F  AE   DEL +   L    GC P++AAYNP+F YLCENGK KKA  +F Q
Sbjct  126   RALCDNREFVKAEALVDELLEKEVLTKRGGCVPLIAAYNPVFVYLCENGKAKKARVLFGQ  185

Query  1575  LM-RMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGK  1751
             L+ R    D   FKTLI+G+  EG  E+G++L++ ML+R+ VPD E Y +++EG  Q+G+
Sbjct  186   LLDRRSKVDFAAFKTLILGHCKEGDFEEGYQLVLSMLKRDLVPDDECYIAIVEGFSQKGR  245

Query  1752  PRLAYDTLERMLKSSHLPRTFVFHSILTELV-KQNCALECADLVVLMLVKKIRQNINLST  1928
              ++A++ L RML S   P T  FHS+L  L+ K+ CA E ADL+ +ML +KIRQN++LST
Sbjct  246   MKVAWEALHRMLNSGLRPSTSTFHSVLLGLLKKEGCAKEAADLIEIMLERKIRQNLDLST  305

Query  1929  DTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQS  2108
             +T+  LFK+ L +RA++I+  LYD GY + M++LI  L + KK +EA +L LFSL+    
Sbjct  306   NTIDALFKSNLNDRAYKIITSLYDQGYYIKMEKLIGDLCEEKKFTEAAELTLFSLQKRHD  365

Query  2109  VCIEICSTVLSALCKACRAQEAFELYYELVE---RQIELPLNCLEDLRLRLEVEGRSKEA  2279
             + + + STVL  LC   RA +AF L+YEL+E       +    L  LR  L+ +G+ KEA
Sbjct  366   LGVSVSSTVLDGLCATGRASDAFRLFYELIESGNSSGAVEPRSLVALRHALDEDGKKKEA  425

Query  2280  EFVAKRMPR  2306
             +FVAK+M R
Sbjct  426   DFVAKQMRR  434


 Score =   129 bits (325),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 97/402 (24%), Positives = 189/402 (47%), Gaps = 23/402 (6%)
 Frame = +3

Query  825   VKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAH  1004
             V P++ T+  +I+  C+  + D+    F  M      P+ ITYNT++ G C AG++E+  
Sbjct  12    VSPNVITYTTMIKAYCVRGLADEALAVFNMMSADGVAPNRITYNTMIQGFCEAGRMEL--  69

Query  1005  NVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQ  1184
               VKG+L+  S   P+  T+ TL+  +C + +V+EA+ VF +M +     +S +Y+T+I+
Sbjct  70    --VKGLLETDS-FKPDTCTFNTLMAAHCGEGRVKEAMEVFGQMAELRVSRDSASYSTVIR  126

Query  1185  GLLEARKFDKVKELFKGAGED------GRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
              L + R+F K + L     E       G  VP    +N +    C +G  K A   F ++
Sbjct  127   ALCDNREFVKAEALVDELLEKEVLTKRGGCVPLIAAYNPVFVYLCENGKAKKARVLFGQL  186

Query  1347  SILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKY  1526
                 +  D A +  LI   C++GDFE   +    + K   L+ D  C      Y  + + 
Sbjct  187   LDRRSKVDFAAFKTLILGHCKEGDFEEGYQLVLSMLKR-DLVPDDEC------YIAIVEG  239

Query  1527  LCENGKTKKAEKVFRQLMRMGVQ-DPLTFKTLIMG-NRNEGMSEDGHELLVWMLRRNFVP  1700
               + G+ K A +   +++  G++    TF ++++G  + EG +++  +L+  ML R    
Sbjct  240   FSQKGRMKVAWEALHRMLNSGLRPSTSTFHSVLLGLLKKEGCAKEAADLIEIMLERKIRQ  299

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLV  1880
             + +   + ++ L +      AY  +  +    +  +      ++ +L ++    E A+L 
Sbjct  300   NLDLSTNTIDALFKSNLNDRAYKIITSLYDQGYYIK---MEKLIGDLCEEKKFTEAAELT  356

Query  1881  VLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNG  2006
             +  L K+    +++S+  +  L   G    AF +   L ++G
Sbjct  357   LFSLQKRHDLGVSVSSTVLDGLCATGRASDAFRLFYELIESG  398


 Score =   101 bits (251),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 100/410 (24%), Positives = 175/410 (43%), Gaps = 33/410 (8%)
 Frame = +3

Query  633   FNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEML  812
             + ++IK Y V GL  E+L +F  M   G++P+ +T+NT+     + GR     EL   +L
Sbjct  19    YTTMIKAYCVRGLADEALAVFNMMSADGVAPNRITYNTMIQGFCEAGRM----ELVKGLL  74

Query  813   KTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKV  992
             +T   KPD  TFN L+   C    V +    F +M +     D  +Y+T++  LC   + 
Sbjct  75    ETDSFKPDTCTFNTLMAAHCGEGRVKEAMEVFGQMAELRVSRDSASYSTVIRALCDNREF  134

Query  993   EIAHNVV-----KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPN  1157
               A  +V     K +L K     P +  Y  +    CE  K ++A  +F +++DR  + +
Sbjct  135   VKAEALVDELLEKEVLTKRGGCVPLIAAYNPVFVYLCENGKAKKARVLFGQLLDRRSKVD  194

Query  1158  SVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAF  1337
                + TLI G  +   F++  +L     +    VPD   +  ++      G +K A EA 
Sbjct  195   FAAFKTLILGHCKEGDFEEGYQLVLSMLKRD-LVPDDECYIAIVEGFSQKGRMKVAWEAL  253

Query  1338  EKMSILNAAPDSATY-SILIRCL----CQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVA  1502
              +M      P ++T+ S+L+  L    C K   ++ E   +   +    LS         
Sbjct  254   HRMLNSGLRPSTSTFHSVLLGLLKKEGCAKEAADLIEIMLERKIRQNLDLS-------TN  306

Query  1503  AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWML  1682
               + +FK    +    +A K+   L   G    +  + LI     E    +  EL ++ L
Sbjct  307   TIDALFK----SNLNDRAYKIITSLYDQGYY--IKMEKLIGDLCEEKKFTEAAELTLFSL  360

Query  1683  RRNFVPDFETYESLLEGLLQEGKP----RLAYDTLERMLKSSHL-PRTFV  1817
             ++          ++L+GL   G+     RL Y+ +E    S  + PR+ V
Sbjct  361   QKRHDLGVSVSSTVLDGLCATGRASDAFRLFYELIESGNSSGAVEPRSLV  410



>ref|XP_004952080.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Setaria italica]
Length=620

 Score =   387 bits (995),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 215/508 (42%), Positives = 309/508 (61%), Gaps = 23/508 (5%)
 Frame = +3

Query  831   PDLYTFNILIRGCCMNSMVDQG------FRFFKEMEKHECEPDVITYNTIVDGLCRAGKV  992
             PD+ T N L+ G    S           FRF  E   +   PD ITYN+++  LCR G +
Sbjct  111   PDVTTLNTLLHGLSTASPRPSAHTLLKLFRFLPET--YAFAPDAITYNSLLSALCRGGDL  168

Query  993   EIAHNVVKGMLKKGSDLS----PNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNS  1160
               A  +  GM     D       NVVTYTT++R YC K   +EAL +FK MV  G  PN 
Sbjct  169   ATARKLFDGMHVSEEDSKSGAFANVVTYTTMIRAYCAKGLADEALALFKVMVANGVPPNR  228

Query  1161  VTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFE  1340
             VT+NT++QG  EA + + VKE+F    E   F PDTCTFNTL+  H S+G  + A++ F+
Sbjct  229   VTFNTMVQGFCEAGRMELVKEVF----EMESFKPDTCTFNTLMAAHYSEGRFEDAMKVFD  284

Query  1341  KMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMF  1520
             +M+ L+   DSA+YS++IR LC+  +F  AE+  DE+ +   L    G  P++AAYNP+F
Sbjct  285   QMTELHVRRDSASYSMVIRALCESREFGRAEELVDEILEEELLKKRGGSVPLIAAYNPVF  344

Query  1521  KYLCENGKTKKAEKVFRQLM-RMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFV  1697
              Y CENGK KKA  +F QL+ R    D   FKTLI+G+  EG  E+ +EL++ ML+R+ +
Sbjct  345   VYFCENGKAKKARILFGQLLDRRSKVDFQAFKTLILGHCKEGNFEEAYELVLSMLKRDLI  404

Query  1698  PDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN-CALECAD  1874
             PD E Y ++++G +Q+G+ + A++TL RML S   P T  FHS+L  L+K++ CA E AD
Sbjct  405   PDNECYIAVIDGFMQKGRMKSAWETLHRMLNSGLRPSTSTFHSVLLGLLKKDGCAKEAAD  464

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             L+ +ML +KIRQN++LST+ + +LFK+ L +RA++I   LYDNGY + M++LI  L + K
Sbjct  465   LIEIMLERKIRQNVDLSTNLIDVLFKSDLNDRAYKITKRLYDNGYYIKMEKLIETLCEDK  524

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER----QIELPL  2222
             K  +A +  LFSL+    + + + S VL  L    +A EAF L+YEL+E      +  P 
Sbjct  525   KFIDAAEFTLFSLQKHHELGVAVHSLVLDGLSMDGKASEAFRLFYELIENGSTSAVAAPR  584

Query  2223  NCLEDLRLRLEVEGRSKEAEFVAKRMPR  2306
             + +  L   LE  G+ KEA+FV K+M R
Sbjct  585   SVIL-LHHALEEAGKMKEADFVGKQMSR  611



>ref|XP_010662227.1| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
isoform X3 [Vitis vinifera]
Length=421

 Score =   236 bits (603),  Expect(3) = 7e-115, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA   G  Q   + D+Q+DYP+SIAW  D + + VG  SSK+QLWDAET K++R L+G
Sbjct  128   LWNAET-GHSQKLMQVDDQEDYPTSIAWCEDGRRVAVGHLSSKLQLWDAETFKLIRSLEG  186

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RVG  AWNG +LTSGS D+SII+HDVR  NSL   ++ H++EVCGLKWS TGN L S
Sbjct  187   HDDRVGIAAWNGQILTSGSRDKSIINHDVRARNSLTCRVQIHSQEVCGLKWSITGNKLAS  246

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIW+  KM S ++LHRF+ H AAVKALAWCPY  DVLASGGGT DGCIK+W+I
Sbjct  247   GGNENLIYIWEASKMCSSNFLHRFSGHQAAVKALAWCPYQSDVLASGGGTLDGCIKIWNI  306

Query  2735  RKGACISS  2712
             +KG CI+S
Sbjct  307   QKGTCINS  314


 Score =   149 bits (377),  Expect(3) = 7e-115, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   G    +LCLW+YPSMSK+ +   H+SR LHLSQSPDG
Sbjct  320   QICGLEWNRHHKEILSGHGFSATGH-QNELCLWKYPSMSKLGELKCHSSRVLHLSQSPDG  378

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSAGADETLRFWE+FGPP  D SR SD D+LLS K S IR
Sbjct  379   STVVSAGADETLRFWEVFGPPVTDSSRVSDLDSLLSFKRSLIR  421


 Score = 80.9 bits (198),  Expect(3) = 7e-115, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 66/121 (55%), Gaps = 33/121 (27%)
 Frame = -2

Query  3690  MDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNWELWVSPFCMKGEYRR  3511
             MDLD+AHTLLT+ ++E+  S +                                + EYRR
Sbjct  1     MDLDQAHTLLTSRTREVCNSTFG-------------------------------QDEYRR  29

Query  3510  RLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE-ESFSCTDVNK-QSRAFP  3337
             +LE  L  D EGRPFRMLVFRGSPK S+KSIR +DEM++ DE E+    ++ + Q R  P
Sbjct  30    KLEENLFFDSEGRPFRMLVFRGSPKSSKKSIRFLDEMQQQDEAEALHNKNIKQFQYRHLP  89

Query  3336  K  3334
             K
Sbjct  90    K  90



>ref|XP_008368038.1| PREDICTED: cell division cycle 20.3, cofactor of APC complex-like 
[Malus domestica]
Length=451

 Score =   228 bits (582),  Expect(3) = 2e-111, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWN+TN  + +L   +D +D +P+S+AWS +AKTL VG   SK+QLWD ETSK+VR  + 
Sbjct  160   LWNSTNSEVHKLLHVDDQRD-FPTSVAWSENAKTLAVGYRRSKLQLWDVETSKLVRRFEN  218

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ R+ ++AWNGHVLTSGS D SII+HDVR  +++ S L+AH +EVCGLKWS  GN L S
Sbjct  219   HKDRIATVAWNGHVLTSGSRDTSIINHDVRAGSNVASRLQAH-KEVCGLKWSEGGNVLAS  277

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIW++ KM+S  +L RF +H AAVKALAWCPY  +VLASGGGT DGCIK+W+ 
Sbjct  278   GGNENLLYIWBSSKMNSSRFLFRFREHCAAVKALAWCPYQSEVLASGGGTEDGCIKLWNT  337

Query  2735  RKGACISS  2712
             +KG CI +
Sbjct  338   KKGTCIKT  345


 Score =   138 bits (347),  Expect(3) = 2e-111, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN+HHKE+LS HG+        +LC+WRYPSM  + +   H SR LH+SQSP+G
Sbjct  351   QVCGLEWNRHHKEILSAHGYSRXELIKNQLCIWRYPSMENVGNLNRHRSRILHVSQSPBG  410

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA  DETLRFWEIFGPP  DK   S  D+LLSLKTSP+R
Sbjct  411   LTVVSAVGDETLRFWEIFGPPSIDK--ISPLDSLLSLKTSPLR  451


 Score = 89.0 bits (219),  Expect(3) = 2e-111, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 81/198 (41%), Gaps = 77/198 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTP-TEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSA  3748
             ++ LQS W  PTRL ++P   +DFP                                   
Sbjct  1     MQELQSDWCSPTRLQTSPIARFDFP-----------------------------------  25

Query  3747  NGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPI  3568
                      GDRFIP+RSLMDLD+A +LLTN +     S +N                  
Sbjct  26    ---------GDRFIPSRSLMDLDQARSLLTNRTTPTRNSNFN------------------  58

Query  3567  SGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSD  3388
                             YRR LE  L LD +G PFRMLVFRGSPK +RK IR +D MR+ +
Sbjct  59    --------------DVYRRSLEDKLTLDSDGNPFRMLVFRGSPKSNRKPIRSVDLMRQDE  104

Query  3387  EESFSCTDVNKQSRAFPK  3334
              +    +  N   R  PK
Sbjct  105   AKELDGSVKNVLPRRMPK  122



>emb|CDP13865.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   223 bits (567),  Expect(3) = 6e-111, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -3

Query  3272  WNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGH  3093
             WN +N  I +L + +   D YP+S+AWS DA+ + VG   S +QLWDAETSK+VR L+GH
Sbjct  164   WNPSNRAIHKLLDVDSQCD-YPTSLAWSGDARKIAVGHMCSDVQLWDAETSKLVRSLRGH  222

Query  3092  EGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSG  2913
             + +V S+ WNGH+LTSG  D++II+HDVR   SL   L+ HTR VC LKWS   N L SG
Sbjct  223   QNKVVSVEWNGHILTSGGNDKAIINHDVRAKKSLTCYLRVHTRGVCSLKWSRRSNILASG  282

Query  2912  GNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIR  2733
             G+DNLVYIW   KMSS  Y++R N HSA VKALAWCPYN DVLASGGG  DG +K+W+++
Sbjct  283   GDDNLVYIWHASKMSSSHYMYRLNAHSAGVKALAWCPYNSDVLASGGGLLDGSLKLWNVQ  342

Query  2732  KGACISS  2712
             KG CI+S
Sbjct  343   KGVCINS  349


 Score =   135 bits (340),  Expect(3) = 6e-111, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFG-ERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPD  2507
             Q+C LQWN+H KE+LSGHGF     D   +LCLW+YPSMSKI  S    SR LHL+QSPD
Sbjct  355   QVCALQWNRHQKEILSGHGFSWGNADCGNQLCLWKYPSMSKIGGSSKSDSRVLHLTQSPD  414

Query  2506  GLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             GL V SAGA+ET+  WE+FGPPQA++ R+S  D+LL+ + SPIR
Sbjct  415   GLRVASAGANETISIWEVFGPPQANEPRSSGLDSLLAFRASPIR  458


 Score = 95.5 bits (236),  Expect(3) = 6e-111, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 92/195 (47%), Gaps = 79/195 (41%)
 Frame = -2

Query  3915  LQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF*  3736
             LQS  Y PTRL S P EYDFP                                       
Sbjct  9     LQSGGYSPTRLRS-PVEYDFP---------------------------------------  28

Query  3735  FSLMKGDRFIPNRSLMDLDRAHTLLTN-PSKELGKSKYNVSMSFLISLNECFWFLPISGN  3559
                  GDRFIPNRSLMDLD A +LLTN  +KEL K KY+                     
Sbjct  29    -----GDRFIPNRSLMDLDHAKSLLTNRTTKELEKPKYSE--------------------  63

Query  3558  WELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEES  3379
                         EY R+L+  L LD EGRP+RMLVFRGSPK SRKS R IDEMRRSDE+ 
Sbjct  64    ------------EYSRKLKENLTLDVEGRPYRMLVFRGSPKSSRKSSRLIDEMRRSDEDK  111

Query  3378  FSCTDVNKQSRAFPK  3334
              +  D NK +R+FPK
Sbjct  112   TNTRDSNK-NRSFPK  125



>emb|CAN72563.1| hypothetical protein VITISV_011377 [Vitis vinifera]
Length=455

 Score =   192 bits (487),  Expect(3) = 7e-110, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 132/189 (70%), Gaps = 2/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA   G  Q   + D+Q+DYP+SIAW  D + + VG  SSK+QLWDAET K++R L+G
Sbjct  161   LWNAET-GHSQKLMQVDDQEDYPTSIAWCEDGRRVAVGHLSSKLQLWDAETFKLIRSLEG  219

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHD-VRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             H+ RVG  AWNG +LTSGS D+SII+HD   +  S I     +  +   +      N L 
Sbjct  220   HDDRVGIAAWNGQILTSGSRDKSIINHDGTSILTSQIQNNGDNNSKCSCINVHIGRNKLA  279

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGN+NL+YIW+  KM S ++LHRF+ H AAVKALAWCPY  DVLASGGGT DGCIK+W+
Sbjct  280   SGGNENLIYIWEASKMCSSNFLHRFSGHQAAVKALAWCPYQSDVLASGGGTLDGCIKIWN  339

Query  2738  IRKGACISS  2712
             I+KG CI+S
Sbjct  340   IQKGTCINS  348


 Score =   149 bits (376),  Expect(3) = 7e-110, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   G    +LCLW+YPSMSK+ +   H+SR LHLSQSPDG
Sbjct  354   QICGLEWNRHHKEILSGHGFSATGH-QNELCLWKYPSMSKLGELKCHSSRVLHLSQSPDG  412

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSAGADETLRFWE+FGPP  D SR SD D+LLS K S IR
Sbjct  413   STVVSAGADETLRFWEVFGPPVTDSSRVSDLDSLLSFKRSLIR  455


 Score =   109 bits (272),  Expect(3) = 7e-110, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 90/199 (45%), Gaps = 78/199 (39%)
 Frame = -2

Query  3924  LERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSAN  3745
             + R    WY PTRL  +PT+Y FP                                    
Sbjct  1     MSRFNGDWYSPTRLHDSPTQYHFP------------------------------------  24

Query  3744  GF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPIS  3565
                     GDRFIPNRSLMDLD+AHTLLT+ ++E+  S +                    
Sbjct  25    --------GDRFIPNRSLMDLDQAHTLLTSRTREVCNSTFG-------------------  57

Query  3564  GNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE  3385
                           EYRR+LE  L  D EGRPFRMLVFRGSPK S+KSIR +DEM++ DE
Sbjct  58    -------------DEYRRKLEENLFFDSEGRPFRMLVFRGSPKSSKKSIRFLDEMQQQDE  104

Query  3384  -ESFSCTDVNK-QSRAFPK  3334
              E+    ++ + Q R  PK
Sbjct  105   AEALHNKNIKQFQYRHLPK  123



>ref|XP_007220389.1| hypothetical protein PRUPE_ppa023058mg [Prunus persica]
 gb|EMJ21588.1| hypothetical protein PRUPE_ppa023058mg [Prunus persica]
Length=424

 Score =   239 bits (610),  Expect(3) = 2e-109, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N  + +L + +D  D +PSS+AWS DAKT+ VG   SK+QLWDAETSK+VR L+ 
Sbjct  130   LWNAENREVHKLLQVDDLND-FPSSVAWSQDAKTVAVGFRRSKLQLWDAETSKLVRSLEN  188

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ R+ SI WNGH LTSGS D+SII+HDVR  +++   L+ HT EVCGLKWSG GN L S
Sbjct  189   HKDRIASITWNGHTLTSGSRDKSIINHDVRAGSNVTCRLRTHTEEVCGLKWSGEGNVLAS  248

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIWD+ KM+S+ +L R  DH AAVKALAWCPY  +VLASG GT DGCIK+W+ 
Sbjct  249   GGNENLLYIWDSSKMNSQRFLFRLKDHRAAVKALAWCPYQSEVLASGAGTKDGCIKIWNT  308

Query  2735  RKGACISSTFSKNLV  2691
             +KG CI S  ++  V
Sbjct  309   KKGTCIKSIATEAQV  323


 Score =   141 bits (355),  Expect(3) = 2e-109, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN+HHKE++SGHG+        +LCLWRYPSM K+     + SR LHLSQSPDG
Sbjct  322   QVCGLEWNRHHKEIMSGHGYSASELIKNQLCLWRYPSMDKVGSLNRYTSRVLHLSQSPDG  381

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA AD +LRF E+FGPP  DKSR S  D LLSLK SPIR
Sbjct  382   LTVVSAVADGSLRFLEVFGPPSIDKSRISPLDGLLSLKISPIR  424


 Score = 68.9 bits (167),  Expect(3) = 2e-109, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  3519  YRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESFSCTDVNKQSRAF  3340
             YR+ +E  L LD EG PFRMLVFRGSPK +RKSIR +D MR+ + +       + Q R  
Sbjct  26    YRKSIEDKLTLDSEGNPFRMLVFRGSPKSNRKSIRCVDLMRQDEAKELDGNGKHHQPRRL  85

Query  3339  PKVNIL  3322
             PK  +L
Sbjct  86    PKCGML  91



>ref|XP_006846806.1| hypothetical protein AMTR_s00148p00070260 [Amborella trichopoda]
 gb|ERN08387.1| hypothetical protein AMTR_s00148p00070260 [Amborella trichopoda]
Length=755

 Score =   374 bits (961),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 215/616 (35%), Positives = 332/616 (54%), Gaps = 6/616 (1%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEA  626
             K  ++AL FF W E+ GF      + +++E+LG    LN AR  LF++ ++    V  + 
Sbjct  127   KKAQQALNFFRWVEKTGFHHDYSTHLKIIEILGRFGMLNHARCILFAMREK---GVEWDE  183

Query  627   RFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDE  806
             R FN LI +Y  AG+ QES+K+F  MK +GI P+V ++N  FS+++KRGRT M    F+ 
Sbjct  184   RLFNMLINSYGNAGIVQESVKIFNKMKELGIDPTVRSYNNFFSVILKRGRTFMAKRYFNA  243

Query  807   MLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAG  986
             M++  GV P++YT+NILI G C+++ +    RFF +M +    PD+ITYNT++ G CR G
Sbjct  244   MIRN-GVSPNIYTYNILIWGFCLSTKMATANRFFSDMRERGISPDIITYNTMISGCCRVG  302

Query  987   KVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVT  1166
              +E A      + +KG  ++P+ +TYT L++G+    ++EEAL+ F+EM     + N++ 
Sbjct  303   DMENALKSFNELNEKG--MAPDEITYTHLIKGFVGAGRIEEALDFFREMGGLKLKSNALI  360

Query  1167  YNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             Y  L+ GL E  K D  + L K   +      D   F T++   C  GNL  A++  + M
Sbjct  361   YQALVLGLYENGKMDDAQTLLKEMMKRNFRPSDPSIFLTVMKAQCDVGNLDEAMDILKGM  420

Query  1347  SILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKY  1526
               L  +P+SA Y +LI   C KG  + A K  DE+ + G LL+  G     + YNP+ +Y
Sbjct  421   KNLRISPESAHYGVLIEGHCNKGLHDKAGKLLDEVMEDGILLNPGGSPLEPSVYNPIIRY  480

Query  1527  LCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDF  1706
             LCE G T+KAE  FRQLM++GVQDPL+F  LI G+  E M E G ELL  M RR    D 
Sbjct  481   LCEIGHTQKAELFFRQLMKLGVQDPLSFNNLIAGHSRERMPEHGFELLKIMARRGIPSDS  540

Query  1707  ETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVL  1886
               Y SL+E  L+  +P  A   L+ M++S HLP   +F S++  L         + ++  
Sbjct  541   NAYSSLVESYLKICEPADAKTALDSMIESGHLPSPSLFRSVMDSLFSDGRVQTASRVMYT  600

Query  1887  MLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSE  2066
             ML K + +N++L    +  L   G  E A   +  +   G   +   L+  L + +K   
Sbjct  601   MLDKDVLENLDLVAKILEALLLRGHVEEALGRIDLMLRKGCYPDFNHLLTTLCKKEKTIA  660

Query  2067  ARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRL  2246
             A  LL + L+   +V       VL AL  A +   A+ +  ++ E+         E L  
Sbjct  661   ALKLLDYCLERDCNVNFSSYDLVLDALISAGKTLNAYSILCKITEKGGMKKPTSFESLIK  720

Query  2247  RLEVEGRSKEAEFVAK  2294
              L  EG +K+A+ +++
Sbjct  721   TLSEEGNTKQADILSR  736



>gb|EYU20148.1| hypothetical protein MIMGU_mgv1a026617mg [Erythranthe guttata]
Length=415

 Score =   245 bits (625),  Expect(3) = 6e-108, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA +  I+ L E  +  D YP S++WS DAKT+ VG  SS+I L+DAE+ K VR L G
Sbjct  121   LWNANSREIELLSEVSEIND-YPGSVSWSKDAKTIAVGYNSSRIILYDAESLKPVRSLNG  179

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H G+VGSIAWNGH+LTSGS DR+II+HDVR  NS++  +KAH  EVCGLKWS TGN L S
Sbjct  180   HRGKVGSIAWNGHILTSGSRDRAIINHDVRARNSVVCRVKAHEGEVCGLKWSRTGNILAS  239

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNL+Y+WD+ KMSS + L+RF+DH AAVKALAWCPYNY+VLASGGG+ D  IKMW +
Sbjct  240   GGNDNLLYLWDSCKMSSMNNLYRFDDHCAAVKALAWCPYNYNVLASGGGSSDCSIKMWDM  299

Query  2735  RKGACISSTFSK  2700
             +KGACI ST +K
Sbjct  300   QKGACIRSTDTK  311


 Score =   142 bits (359),  Expect(3) = 6e-108, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGLQWN+HH+E+LSGHG+G   +   +LCLW YPSM+++ +S +  +R LHLSQSPDG
Sbjct  313   QICGLQWNRHHQEILSGHGYGNGSESQNRLCLWSYPSMTRLGESIDLGARILHLSQSPDG  372

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAG DET+RFW++FGP      R S  D+LLSL+ SPIR
Sbjct  373   LTVVSAGEDETIRFWDVFGPASNANPRVSYLDSLLSLRESPIR  415


 Score = 56.2 bits (134),  Expect(3) = 6e-108, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 57/125 (46%), Gaps = 36/125 (29%)
 Frame = -2

Query  3690  MDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNWELWVSPFCMKGEYRR  3511
             MDLD+AH +LTN   +L     N  +                              +YRR
Sbjct  1     MDLDQAHGVLTNKITKLPSKTTNFKIE-----------------------------QYRR  31

Query  3510  RLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESFSCTDVNKQSRAFPKV  3331
              L+  L +  EGRPF+MLVFRGSPK +RK  REI   +RS E+  S    N   R FPK 
Sbjct  32    NLKN-LTVSAEGRPFQMLVFRGSPKSNRKLSREI---QRSSEDLPS---YNNPPRQFPKK  84

Query  3330  NILAV  3316
               L +
Sbjct  85    ETLVL  89



>ref|XP_002321776.2| hypothetical protein POPTR_0015s12180g [Populus trichocarpa]
 gb|EEF05903.2| hypothetical protein POPTR_0015s12180g [Populus trichocarpa]
Length=432

 Score =   237 bits (604),  Expect(3) = 1e-106, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 147/193 (76%), Gaps = 2/193 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N  +++L E + + D YP+S+AWS  A +L +GC  SK+Q+WD ETSK +R L G
Sbjct  126   LWNAENQEVKKLLEVQGDND-YPTSVAWSEKATSLAIGCMKSKLQIWDPETSKCIRSLGG  184

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ R+ +IAWNGH LT+GS DRSII+HDVRV NS  S ++AHT EVCGLKWS  GN L S
Sbjct  185   HQSRIAAIAWNGHTLTTGSRDRSIINHDVRVRNSPTSRIQAHTEEVCGLKWSSEGNVLAS  244

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHS-AAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             GGN++ +YIW+  KMSS ++LHRFN H+ AAVKALAWCPY ++VLASGGGT DGCIK+W+
Sbjct  245   GGNESFIYIWEASKMSSSNFLHRFNAHNQAAVKALAWCPYQFNVLASGGGTGDGCIKIWN  304

Query  2738  IRKGACISSTFSK  2700
             I  G C  S  +K
Sbjct  305   ITGGTCTHSIETK  317


 Score =   136 bits (342),  Expect(3) = 1e-106, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 82/116 (71%), Gaps = 15/116 (13%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQ----  2516
             QICGL+WN+HHKE+LSGHG+G  G     LCLW+YPSM+K+ +   H  R ++LSQ    
Sbjct  319   QICGLEWNRHHKEILSGHGYGNSGV-QNHLCLWKYPSMTKVGEINRHGRRVINLSQLNTS  377

Query  2515  ---------SPDGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
                      SPDGLTVVSAG DETLRFWEIFGPP+ + S  SDF+NLLS KTS IR
Sbjct  378   WTLTIGLLQSPDGLTVVSAGGDETLRFWEIFGPPRVENS-ASDFENLLSFKTSLIR  432


 Score = 66.6 bits (161),  Expect(3) = 1e-106, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 55/119 (46%), Gaps = 33/119 (28%)
 Frame = -2

Query  3690  MDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNWELWVSPFCMKGEYRR  3511
             M+LD+AH LLTN  KE+                                +P   KG YR 
Sbjct  1     MNLDQAHCLLTNKIKEVH-------------------------------NPNFGKG-YRE  28

Query  3510  RLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRS-DEESFSCTDVNKQSRAFP  3337
              L  +L LD EGRPFRMLVFRGSPK  RK    IDEMRR  D E  S      +SR  P
Sbjct  29    MLRESLTLDSEGRPFRMLVFRGSPKSRRKWNYVIDEMRRDIDAEVLSNGIKQHESRRLP  87



>emb|CDO97701.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   367 bits (941),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 209/623 (34%), Positives = 337/623 (54%), Gaps = 18/623 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F  T + + +++E+LG    LN AR  L  +P++    V  +
Sbjct  125   KNSEHALQFFRWVERAGLFQHTRETHLKIIEILGRASKLNHARCILLDLPQK---GVEWD  181

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  LI++Y  AG+ QES++LF  M+ +G+  ++ T++ LF ++M+RGR GM    F+
Sbjct  182   EDMWVLLIESYGSAGIVQESVQLFQKMEELGVQRTIKTYDALFKVIMRRGRYGMAKRYFN  241

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +MLK  G++P  +T+N++I G  ++S V+   RFF+EM+  E  PDV+TYNT+++G CR 
Sbjct  242   KMLKE-GIEPTRHTYNLMIWGFFLSSKVESAVRFFEEMKSREISPDVVTYNTMINGYCRV  300

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
               +E A      M  KG +L P+V+TYTTL++G+     V+ AL   +EM   G +PN++
Sbjct  301   KNMEEAEKYFVEM--KGRNLEPSVITYTTLIKGFVSAGGVDNALRFLEEMKKFGIKPNAI  358

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL +A K  +  ++ K   E      D   F  L+   C  G+L AA +  + 
Sbjct  359   TYSTLLPGLCDADKMSEADKILKEMVERHIAPNDDSIFTRLLSGQCKAGHLDAAADVLKA  418

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV------AA  1505
             M  L+   ++  Y ILI   C+ G ++ A +  D+L +   +L     RP        +A
Sbjct  419   MIRLSIPTEAGHYGILIENFCKAGAYQRAVQLLDKLIEKEIIL-----RPQTTLQMEPSA  473

Query  1506  YNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLR  1685
             YNP+ ++LC NG+T+KAE + RQLM+MGVQDP+ F  LI G+  EG  E   ELL  M+R
Sbjct  474   YNPVIEHLCNNGQTRKAEMLLRQLMKMGVQDPVAFNYLIRGHSKEGTPESASELLTIMVR  533

Query  1686  RNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALE  1865
             R  V +   + SL+E  L +G P  A   L+ M+++ HLP + ++ S++  L        
Sbjct  534   RKVVSEASAHVSLIESYLTKGDPADAKSALDTMIENGHLPDSSLYRSVMESLFADGRVQT  593

Query  1866  CADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLS  2045
              + +++ ML K ++++++L    +  L   G  E A   +  L  NG   N   L+  L 
Sbjct  594   ASRVMMTMLEKGVKEHMDLIAKILEALLLRGHVEEALGRIELLMQNGLAPNFDNLLSILC  653

Query  2046  QGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLN  2225
             +  K   A  LL   L+   SV       VL  L  A +   A+ +  ++ E+      N
Sbjct  654   EKGKTIAALKLLDHCLQRDYSVDFSSYDKVLDGLLAAGKTLNAYSILCKITEKGGVTDKN  713

Query  2226  CLEDLRLRLEVEGRSKEAEFVAK  2294
               EDL   L  EG +K+A+ +++
Sbjct  714   SYEDLIKTLNAEGNTKQADILSR  736



>ref|XP_009599440.1| PREDICTED: cell division cycle 20.3, cofactor of APC complex-like 
[Nicotiana tomentosiformis]
Length=463

 Score =   257 bits (656),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S+AWS DAK + VGC SSK+QLWDAETSK+VR L+GH+ RVG +AWNGH+LTSGS D
Sbjct  188   YPTSVAWSDDAKIVAVGCISSKLQLWDAETSKLVRDLQGHQSRVGCVAWNGHILTSGSKD  247

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             ++II+HDVR  NSLISL++AH  EVCG+KWS T N L SGGNDN VYIWD  KMSSR Y+
Sbjct  248   KAIINHDVRARNSLISLMRAHRGEVCGVKWSSTANVLASGGNDNFVYIWDFCKMSSRHYM  307

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISST  2709
             H+FN+H+AAVKA+AWCPY  DVLASGGG  DGC+K+W+ +KG CIS+T
Sbjct  308   HKFNEHNAAVKAIAWCPYKSDVLASGGGINDGCLKIWNTKKGTCISTT  355


 Score =   149 bits (375),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHA--SRALHLSQ  2516
             G QICG+QWN+HHKE+LSGHGFG    G  +LCLW YPSM++I +   HA  SR LHL+Q
Sbjct  358   GSQICGIQWNRHHKEILSGHGFGTTERGC-RLCLWSYPSMARIGEPLRHANSSRVLHLTQ  416

Query  2515  SPDGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             SP+GLTVVS GADET+RFWEIFGPPQ D    +D DNLLSLK S +R
Sbjct  417   SPNGLTVVSGGADETIRFWEIFGPPQDDSGNNTDLDNLLSLKASAVR  463


 Score =   129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 99/205 (48%), Gaps = 77/205 (38%)
 Frame = -2

Query  3948  ISRMDQKSLERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFW  3769
             ++ ++   L RL+  WY PTRLLS P +YDFP                            
Sbjct  1     MNEINDSPLRRLEPDWYSPTRLLSNPVDYDFP----------------------------  32

Query  3768  GHELPSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKE-LGKSKYNVSMSFLISLN  3592
                             GDRFIPNRSLMDLD+AHTLLTN +K  LGK K+N          
Sbjct  33    ----------------GDRFIPNRSLMDLDQAHTLLTNRTKNILGKPKFNY---------  67

Query  3591  ECFWFLPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIRE  3412
                                    EYR+++E  LKLD EGRPFRMLVFRGSPK SR+S R 
Sbjct  68    -----------------------EYRKKMEENLKLDVEGRPFRMLVFRGSPKSSRQSTRL  104

Query  3411  IDEMRRSDEESFSCTDVNKQSRAFP  3337
             IDEMRRSDEE    T  +++   FP
Sbjct  105   IDEMRRSDEEIPFQTHDHRRHHKFP  129



>ref|XP_010318209.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Solanum lycopersicum]
Length=433

 Score =   251 bits (642),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  3209  PSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDR  3030
             P+S+AWS D K + VGC SSK+QLWDAETS++VR L+GH+ RVG +AW GHVLTSGS DR
Sbjct  159   PTSVAWSDDGKIVAVGCDSSKLQLWDAETSRLVRDLQGHQSRVGCVAWKGHVLTSGSKDR  218

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYLH  2850
             +II+HDVR  ++L+S+ +AH  EVCG+KWS TGN L SGGNDNLVYIWD+FKMSSR Y H
Sbjct  219   AIINHDVRARSNLVSVTRAHRGEVCGVKWSSTGNALASGGNDNLVYIWDSFKMSSRHYTH  278

Query  2849  RFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             RFN+H AAVKALAWCPY+ DVLASGGG  DGC+K+W+ +KG CIS+
Sbjct  279   RFNEHQAAVKALAWCPYSSDVLASGGGIDDGCLKIWNTQKGTCIST  324


 Score =   152 bits (383),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHAS--RALHLSQ  2516
             G QICGLQWN+HHKE+LSGHGFG RG+   +LCLW YPSM++I +   HAS  R LHLSQ
Sbjct  328   GAQICGLQWNRHHKEILSGHGFG-RGESHCQLCLWSYPSMARIGEPLRHASSSRILHLSQ  386

Query  2515  SPDGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             SPDGLTVVSAGADETLRFWEIFGPPQ      +  DNLLS K S +R
Sbjct  387   SPDGLTVVSAGADETLRFWEIFGPPQESSENVTHLDNLLSFKASAVR  433


 Score =   110 bits (274),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 80/138 (58%), Gaps = 33/138 (24%)
 Frame = -2

Query  3726  MKGDRFIPNRSLMDLDRAHTLLTN-PSKELGKSKYNVSMSFLISLNECFWFLPISGNWEL  3550
             M+GDRFIPNRSLMDL +AHTLLTN  + +L K  +N                        
Sbjct  1     MQGDRFIPNRSLMDLHQAHTLLTNRTNNKLQKPNFN------------------------  36

Query  3549  WVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESFSC  3370
                      EYRR++E +LKLD EGRPFRMLVFRGSPK SR S R IDEMRRSD+E    
Sbjct  37    --------DEYRRKMEESLKLDVEGRPFRMLVFRGSPKWSRNSTRLIDEMRRSDKEIPLQ  88

Query  3369  TDVNKQSRAFPKVNILAV  3316
              + N++ R FP   I A+
Sbjct  89    INENRRYRKFPLKAIRAL  106



>ref|XP_009759177.1| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
isoform X1 [Nicotiana sylvestris]
Length=464

 Score =   253 bits (647),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S+AWS DAK + VGC SSK+QLWDAETSK+VR L+GH+ RVG +AWNGH+LTSGS D
Sbjct  189   YPTSVAWSDDAKIVAVGCISSKLQLWDAETSKLVRDLQGHKSRVGCVAWNGHILTSGSKD  248

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             ++I++HDVR  NS++SL + H  EVCG+KWS TGN L SGGNDNLVYIWD  KMSSR ++
Sbjct  249   KAIVNHDVRARNSVVSLTRVHRGEVCGVKWSSTGNVLASGGNDNLVYIWDFRKMSSRHHM  308

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISST  2709
             H+FN+H+AAVKA+AWCPY  DVLASGGG  DGC+K+W+ +KG CIS+T
Sbjct  309   HKFNEHNAAVKAIAWCPYKSDVLASGGGINDGCLKIWNTKKGTCISTT  356


 Score =   147 bits (372),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHA--SRALHLSQ  2516
             G QICG+QWN+HHKE+LSGHGFG    G  KLCLW YPSM++I +  +HA  SR LHL+Q
Sbjct  359   GSQICGIQWNRHHKEILSGHGFGTTERGC-KLCLWSYPSMARIGEPLHHANSSRVLHLTQ  417

Query  2515  SPDGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             SPDGLTVVS GADET+RFWEIF P Q D    +D DNLLSLK S +R
Sbjct  418   SPDGLTVVSGGADETIRFWEIFAPSQNDSGNNTDLDNLLSLKASAVR  464


 Score =   127 bits (320),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 89/183 (49%), Gaps = 77/183 (42%)
 Frame = -2

Query  3927  SLERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSA  3748
             SL RL+  WY PTRLLS P +YDFP                                   
Sbjct  9     SLRRLEQDWYSPTRLLSNPVDYDFP-----------------------------------  33

Query  3747  NGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKE-LGKSKYNVSMSFLISLNECFWFLP  3571
                      GDRFIPNRSLMDLD+AHTLLTN +   LGK K+N                 
Sbjct  34    ---------GDRFIPNRSLMDLDQAHTLLTNRTNNILGKPKFN-----------------  67

Query  3570  ISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRS  3391
                             EYRR++E  LKLD EGRPFRMLVFRGSPK SR+S R IDEMRRS
Sbjct  68    ---------------DEYRRKMEENLKLDVEGRPFRMLVFRGSPKSSRQSTRLIDEMRRS  112

Query  3390  DEE  3382
             DEE
Sbjct  113   DEE  115



>ref|XP_009630943.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Nicotiana tomentosiformis]
Length=721

 Score =   352 bits (903),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 204/619 (33%), Positives = 340/619 (55%), Gaps = 10/619 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F    + +F+++++LG    LN AR  L  +P   N  V  +
Sbjct  91    KNSEHALQFFRWVERSGLFRHDRETHFKIIQILGRSEKLNHARCILLDMP---NKGVDWD  147

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  +V ++N LF+++ +RGR  M    F+
Sbjct  148   EDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTVKSYNALFNVITRRGRYMMAKRYFN  207

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +M+   G++P  +T+N+LI G  ++S +D   RFF+ M+  E  PDV+TYNT+++G  RA
Sbjct  208   KMVSE-GIEPTRHTYNLLIWGFFLSSKLDTAIRFFEAMKSREIIPDVVTYNTMINGYNRA  266

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  K  +++PNV++YTTL++GY    +V++AL +F+EM   G +PN++
Sbjct  267   KKIEEAEKYFVEM--KARNIAPNVISYTTLIKGYSLVGRVDDALRLFEEMKSFGIKPNAI  324

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+  L E RK  + + + K   E      D   F  LI   C  G+L AA +  + 
Sbjct  325   TYSTLLPSLCEGRKMSEARMILKEMEEKYIAPKDNSVFIRLISGQCEAGDLDAATDVLKA  384

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFK  1523
             M  L+   ++  Y ILI   C+ G ++ A K  D+L +   +LS     P  +AYN +  
Sbjct  385   MIRLSVPTEAGHYGILIENFCKAGVYDRAVKLLDKLIEKEIILSSLPMEP--SAYNLIID  442

Query  1524  YLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPD  1703
             YLC NG+T KAE +FRQLM++G+QDP+ F  L+ G+  EG  +   ELL  M RR  + D
Sbjct  443   YLCNNGQTSKAETLFRQLMKIGIQDPVAFNNLVCGHSREGAPDSAFELLKIMGRRKVLSD  502

Query  1704  FETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVV  1883
                +++L+E  L++G+P  A   L+ ML+  H P + ++ S++  L+        + ++ 
Sbjct  503   GIAHKALVESYLKKGEPADAKTALDNMLEQGHEPDSLLYRSVMESLMGDGRVQTASRVMK  562

Query  1884  LMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLS  2063
             +ML K ++Q+++L +  +  L   G  E A   +  L  +G   ++  L+  L    K +
Sbjct  563   IMLDKGVKQHMDLISTMLEALLMRGHVEEALGRIELLLHSGLSPDIDALLSALCDKGKTA  622

Query  2064  EARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLR  2243
              A  LL F L+   ++       VL +L  A +   A+ +  +++E+         E+L 
Sbjct  623   AALKLLDFGLERDCTIDFSSYDKVLDSLVAAGKTLNAYSMLCKMMEKGGVKDHKSCEELI  682

Query  2244  LRLEVEGRSKEAEFVAKRM  2300
               L  EG +K+A+ + KRM
Sbjct  683   KSLNQEGNTKQAD-ILKRM  700



>ref|XP_009759178.1| PREDICTED: cell division cycle 20.5, cofactor of APC complex-like 
isoform X2 [Nicotiana sylvestris]
Length=391

 Score =   253 bits (645),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S+AWS DAK + VGC SSK+QLWDAETSK+VR L+GH+ RVG +AWNGH+LTSGS D
Sbjct  116   YPTSVAWSDDAKIVAVGCISSKLQLWDAETSKLVRDLQGHKSRVGCVAWNGHILTSGSKD  175

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             ++I++HDVR  NS++SL + H  EVCG+KWS TGN L SGGNDNLVYIWD  KMSSR ++
Sbjct  176   KAIVNHDVRARNSVVSLTRVHRGEVCGVKWSSTGNVLASGGNDNLVYIWDFRKMSSRHHM  235

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISST  2709
             H+FN+H+AAVKA+AWCPY  DVLASGGG  DGC+K+W+ +KG CIS+T
Sbjct  236   HKFNEHNAAVKAIAWCPYKSDVLASGGGINDGCLKIWNTKKGTCISTT  283


 Score =   147 bits (372),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHA--SRALHLSQ  2516
             G QICG+QWN+HHKE+LSGHGFG    G  KLCLW YPSM++I +  +HA  SR LHL+Q
Sbjct  286   GSQICGIQWNRHHKEILSGHGFGTTERGC-KLCLWSYPSMARIGEPLHHANSSRVLHLTQ  344

Query  2515  SPDGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             SPDGLTVVS GADET+RFWEIF P Q D    +D DNLLSLK S +R
Sbjct  345   SPDGLTVVSGGADETIRFWEIFAPSQNDSGNNTDLDNLLSLKASAVR  391


 Score = 70.1 bits (170),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  3507  LEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEE  3382
             +E  LKLD EGRPFRMLVFRGSPK SR+S R IDEMRRSDEE
Sbjct  1     MEENLKLDVEGRPFRMLVFRGSPKSSRQSTRLIDEMRRSDEE  42



>ref|XP_010275217.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Nelumbo nucifera]
Length=775

 Score =   348 bits (892),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 207/626 (33%), Positives = 332/626 (53%), Gaps = 10/626 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
              V+H  R       AL+FF W  + G+        +M+E+LG    LN AR  LF +PK+
Sbjct  137   NVLHGAR---NWEHALQFFRWVVKTGYRHDRSTTLKMMEILGRHSKLNHARCILFDMPKK  193

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +  +  FF  LI +Y  AG+ QES+K+F  M  +G+  ++ +++ LF ++M+RGR 
Sbjct  194   ---GIEWDEDFFVVLINSYGQAGIVQESVKIFQKMNELGVERTIKSYDALFKVIMRRGRY  250

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M   +F+ ML+  GV P  +T+NI++ G  ++  V+   RFF +M+    +PDVITYNT
Sbjct  251   MMAKRVFNAMLRE-GVTPTRHTYNIMLWGFFLSLRVETANRFFDDMKNRGIDPDVITYNT  309

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  R   +E A  +   M  K  +L PNV++YTT+++GY    +V++AL +F EM  
Sbjct  310   MINGYFRVKMLEEAEKLFMEM--KARNLIPNVISYTTMIKGYVSMGRVDDALRLFDEMGS  367

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G +PNS TY+TL+ GL +A K  + + L K   E      D   F  LI + C  GNL+
Sbjct  368   FGIKPNSNTYSTLLPGLCDAEKMTEARNLVKEMMERHLAPKDNSVFLRLISSQCESGNLE  427

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV  1499
                +  + M  L+   ++A Y +LI   C+ G F+ A K  D++ +   LL+ +    + 
Sbjct  428   WGDDVLKAMIRLHIPTEAAHYGVLIENFCKAGAFDRAVKLLDKVIEKEILLNPSSSSEME  487

Query  1500  A-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
               AYNP+ +YLC NG+T KAE  FR LM+ GVQDP+ F  LI G+  EG  E   E+L  
Sbjct  488   PSAYNPIIEYLCNNGQTGKAETFFRHLMKRGVQDPVAFNNLICGHSKEGNPESALEILKI  547

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR      + Y  L+EG L++G+P  A   L+ M++S HLP   +F S++  L     
Sbjct  548   MNRRAVPSVADAYRLLVEGFLRKGEPADAKTALDGMIESGHLPDPSLFRSVMESLFDDGR  607

Query  1857  ALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIV  2036
                 + ++  M+ K +++NI+L    +  L   G  E A   +  L  N  + +   L+ 
Sbjct  608   VQTASRVMKSMIEKGVKENIDLVPKILEALLMRGHVEEALGRIELLMINDCIPDFDSLLS  667

Query  2037  FLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIEL  2216
              L +  K   A  LL F L    ++       VL AL  A ++  A+ +  +++++    
Sbjct  668   VLCEKGKTIAAFKLLDFGLDRDCNISFSTYDKVLGALLAAGKSLNAYAIMCKIMQKGGIS  727

Query  2217  PLNCLEDLRLRLEVEGRSKEAEFVAK  2294
               +  EDL   L  EG +K+A+ +++
Sbjct  728   DRSSCEDLIRSLNAEGNTKQADVLSR  753



>gb|KHN05551.1| Anaphase-promoting complex subunit cdc20 [Glycine soja]
Length=374

 Score =   224 bits (570),  Expect(3) = 5e-99, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 142/188 (76%), Gaps = 2/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWN+ N  + +L +  +N   +P+S++WS D K L +G  +SK+QLWDAETSK +R L+G
Sbjct  82    LWNSENKNVFKLFKATNND--FPTSVSWSEDTKYLAIGFMNSKLQLWDAETSKPIRILQG  139

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  R+ +IAWNG +LTSGS+D+ II+HDVR  N++IS +KAH  EVCGLKW+   N L S
Sbjct  140   HGHRIATIAWNGQILTSGSHDKYIINHDVRARNNVISQVKAHKAEVCGLKWTRRSNMLAS  199

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+N +Y+WD  KMSS ++LH F DH AAVKALAWCPY+  VLASGGGT D CIK+W++
Sbjct  200   GGNENHIYVWDLVKMSSSNFLHCFKDHCAAVKALAWCPYDSSVLASGGGTEDSCIKLWNV  259

Query  2735  RKGACISS  2712
             +KG+ I S
Sbjct  260   KKGSSICS  267


 Score =   147 bits (371),  Expect(3) = 5e-99, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN+HHKELLSGHGF        +LC+W+YPS++K+     HASR LHL QSPDG
Sbjct  273   QVCGLEWNRHHKELLSGHGFSTSAHH-NQLCMWKYPSLTKVGGLDRHASRVLHLCQSPDG  331

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAGADE+LRFW++FGPP  + S  SD DNLLSLK SPIR
Sbjct  332   LTVVSAGADESLRFWDVFGPPVNNTSEISDLDNLLSLKVSPIR  374


 Score = 43.1 bits (100),  Expect(3) = 5e-99, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 5/46 (11%)
 Frame = -2

Query  3462  MLVFRGSPKGSRKSIREIDEMRRSDEESFSCTDVNKQS---RAFPK  3334
             MLVFRGSPK SRKSI  IDEMR  +EE+ +  + + Q    R  PK
Sbjct  1     MLVFRGSPKSSRKSILHIDEMR--EEEAAALQNTSNQHYYRRRLPK  44



>ref|XP_004251992.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Solanum lycopersicum]
Length=731

 Score =   344 bits (882),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 203/636 (32%), Positives = 345/636 (54%), Gaps = 11/636 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+HS    K    AL+FF W E+ G F    + +F+++++LG    LN AR  L  +P  
Sbjct  93    VLHSA---KNSEHALQFFRWVERSGLFRHDRETHFKIIQILGRAEKLNHARCILLDMP--  147

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
              N  V  +   +  +I +Y  AG+ QES+KLF  M+ +G+  +V ++N LF+++ +RGR 
Sbjct  148   -NKGVDWDEDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTVKSYNALFNVITRRGRY  206

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F+ M+   G++P  +T+N+LI G  ++S VD   RFF++M+     PDV+TYNT
Sbjct  207   MMAKRYFNRMVNQ-GIEPTGHTYNLLIWGFFLSSKVDTAIRFFEDMKGKGIMPDVVTYNT  265

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G     K+E A      M  K  ++ PNV++YTTL++GY   +++++AL +F+EM  
Sbjct  266   MINGYNCVKKIEEAEKYFVEM--KARNIEPNVISYTTLIKGYSAVERIDDALKLFEEMKS  323

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G +PN++TY+TL+ GL +A+K  +   + K   E      D   F  LI   C  G+L 
Sbjct  324   FGIKPNAITYSTLLPGLCDAQKMSEAGTILKEMEERYIAPKDNSIFIRLISGQCEAGDLD  383

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-  1496
             AA +  + M  L+   ++  Y +LI   C+ G ++ A KF D+L +   +L       + 
Sbjct  384   AAADVLKTMIRLSVPTEAGHYGVLIENFCKAGIYDRAVKFLDKLIEKEIVLRPQSSSSME  443

Query  1497  VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
              +AYN +  YLC NG+T KAE +FRQLM+ G+QDP+ F  L+ G+  EG+ +   ELL  
Sbjct  444   TSAYNLIIDYLCNNGQTGKAETLFRQLMKTGIQDPIAFNNLVCGHSREGVPDSAFELLKI  503

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR  + D   ++SL+E  L++G+P  A   L+ ML+  H P + ++ S++  L+    
Sbjct  504   MGRRKVLSDSIAHKSLVESYLKKGEPADAKAALDNMLEHGHDPDSLLYRSVMESLMGDGR  563

Query  1857  ALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIV  2036
                 + ++ +ML K ++++++L +  +  L   G  E AF  +  L  N    ++  L+ 
Sbjct  564   VQTASRVMKIMLEKGVKEHMDLISTILEALLMRGHVEEAFGRIELLLHNSLSPDLDGLLS  623

Query  2037  FLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIEL  2216
              L +  K + A  LL F L+ + ++       VL +L  A +   A+ +  +++E     
Sbjct  624   VLCEKGKTTAALKLLDFILERNCNIDFSSYDKVLDSLLAAGKTLNAYSILCKMMENGGVK  683

Query  2217  PLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGALD  2324
                  E+L   L  EG +K+A+ + + +   E  LD
Sbjct  684   DHKSCEELIKSLNDEGNTKQADILRRMILGKETTLD  719



>ref|XP_010242034.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Nelumbo nucifera]
Length=775

 Score =   345 bits (885),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 204/626 (33%), Positives = 331/626 (53%), Gaps = 10/626 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
              V+H  R       AL+FF W  + G+        +M+E+LG    LN AR  LF +PK+
Sbjct  137   NVLHGAR---NWEHALQFFRWVVKTGYRHDRSTTLKMMEILGRHSKLNHARCILFDMPKK  193

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +  +   F  LI +Y  AG+ QES+K+F  M  +G+  ++ +++ LF ++M+RGR 
Sbjct  194   ---GIEWDEDLFVVLINSYGQAGIVQESVKIFQKMNELGVERTIKSYDALFKVIMRRGRY  250

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M   +F+ ML+  GV P  +T+NI++ G  ++  V+   RFF +M+    +PDVITYNT
Sbjct  251   MMAKRVFNAMLRE-GVTPTRHTYNIMLWGFFLSLRVETANRFFDDMKNRGIDPDVITYNT  309

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  R   +E A  +   M  K  +L PNV++YTT+++GY    +V++AL +F EM  
Sbjct  310   MINGYFRVKMLEEAEKLFMEM--KARNLIPNVISYTTMIKGYVSMGRVDDALRLFDEMGS  367

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
                +PNS TY+TL+ GL +A K  + + L K   E      D   F  LI + C  GNL+
Sbjct  368   FAIKPNSNTYSTLLPGLCDAEKMAEAQNLVKEMMERHLAPKDNSIFLRLISSQCKSGNLE  427

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV  1499
                +  + M  L+   ++A Y +LI   C+ G F+ A K  D++ +   LL+ +    + 
Sbjct  428   WGADVLKAMIRLHIPTEAAHYGVLIENFCKAGAFDRAVKLLDKVIEKEILLNPSSSSEME  487

Query  1500  A-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
               AYNP+ +YLC NG+T KAE  FR LM+ GVQDP++F  LI G+  EG  E   E+L  
Sbjct  488   PSAYNPIIEYLCNNGQTGKAEAFFRDLMKRGVQDPVSFNNLICGHSKEGNPESALEILKI  547

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR      + Y  L+E  L++G+P  A   L+ M++S HLP   +F S++  L     
Sbjct  548   MNRRAVPSVADAYRLLVESFLRKGEPADAKTALDGMIESGHLPDPPLFRSVMESLFDDGR  607

Query  1857  ALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIV  2036
                 + ++  M+ K +++NI+L    +  L   G  E A   +  L +N  + +   L+ 
Sbjct  608   VQTASRVMKSMIEKGVKENIDLVPKILEALLMRGHVEEALGRIELLMNNDCIPDFDSLLS  667

Query  2037  FLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIEL  2216
              L +  K   A  LL F L    ++    C   L AL  A ++  A+ +  +++++    
Sbjct  668   VLCEKGKTIAAFKLLDFGLDRDCNISFSTCDKALDALLAAGKSLNAYAIMCKIMQKGGIT  727

Query  2217  PLNCLEDLRLRLEVEGRSKEAEFVAK  2294
               +  EDL   L  EG +K+A+ +++
Sbjct  728   DKSSCEDLIRSLNAEGNTKQADVLSR  753



>gb|KDP29122.1| hypothetical protein JCGZ_16511 [Jatropha curcas]
Length=760

 Score =   344 bits (882),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 214/734 (29%), Positives = 380/734 (52%), Gaps = 23/734 (3%)
 Frame = +3

Query  150   PFSHCLSTLSQLFS----PPSTAAAASQLFSGPSnaaaaaaaddndaKLPDVAKPKLSSR  317
             P   C ST  Q+ S    PP+     SQ+         A   + +  ++P + + K    
Sbjct  29    PVHFCTSTQDQISSAAEIPPANPQQESQV-----ETPNAVQENQSQQRIPRIPRGKRPEP  83

Query  318   KK-ALALAELIKFQPWSP--QTEsslsalagpslsETTVIHSIRLLKTPRKALKFFVWAE  488
             +K    + +++  +PW+   Q                 V+H  R       AL+FF W E
Sbjct  84    EKLEDIICKMMASRPWTTRLQNSIRDLVPEFDHSLVYNVLHGAR---NYEHALQFFRWVE  140

Query  489   QKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVA  665
             + G F    + + +++E+LG    LN AR  L  +PK+    V  +   F  LI++Y  A
Sbjct  141   RAGLFRHDRETHMKIIEILGRASKLNHARCILLDMPKK---GVEWDEDMFVVLIESYGKA  197

Query  666   GLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYT  845
             G+ QE++K+F  M  +G+  S+ +++ +F ++++RGR  M    F++ML   G++P  +T
Sbjct  198   GIVQEAVKIFQKMNELGVGRSIKSYDAVFKVILRRGRYMMAKRFFNKMLSE-GIEPTRHT  256

Query  846   FNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGML  1025
             +NI++ G  ++  ++   RF+++M+     PDV+TYNT+++G  R  K++ A  +   M 
Sbjct  257   YNIMLWGFFLSLRLETAMRFYEDMKSRGISPDVVTYNTMINGYYRFKKMDDAEKLFVEM-  315

Query  1026  KKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARK  1205
              KGS+++P V++YTT+++GY    +V++ L + +EM + G +PN+ TY+TL+  L +A K
Sbjct  316   -KGSNIAPTVISYTTMIKGYFAVDRVDDGLRLLEEMKEFGIQPNAYTYSTLLPALCDAGK  374

Query  1206  FDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYS  1385
               + K++ K          D   F  L+ + C  G+L+AA +  + M  L+   ++  Y 
Sbjct  375   MTEAKDILKEMVGRHLAPKDNAIFMKLLSSQCKAGDLRAAEDVLKAMIRLSIPTEAGHYG  434

Query  1386  ILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVA-AYNPMFKYLCENGKTKKAEK  1562
             +LI   C+  ++++A KF D+L +   +L       + + AYNPM +YLC +G+T KAE 
Sbjct  435   VLIENFCKAEEYDLAVKFLDKLIEKEIILRPQSTLEIESNAYNPMIQYLCSHGQTGKAEI  494

Query  1563  VFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQ  1742
              FRQLM+ GVQDP  F  LI G+  EG  +   E+L  M RR    D + Y  L+E  L+
Sbjct  495   FFRQLMKKGVQDPDAFNNLIRGHAKEGSPDSAFEILKIMGRRGVPRDADAYRLLIESYLR  554

Query  1743  EGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINL  1922
             +G+P  A   L+ M++  H+P + VF S++  L         + ++  M+ K +++NI+L
Sbjct  555   KGEPADAKTALDGMIEDGHVPDSSVFRSVMQSLFDDGRVQTASRVMKSMIEKGVKENIDL  614

Query  1923  STDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNS  2102
             +   +  L   G  E A   +  L  +G  VN   L+  LS+  K   A  LL F+L+  
Sbjct  615   TAKILEALLMRGHVEEALGRIELLMHSGCSVNFDALLSVLSEKSKTIAAVKLLDFALERD  674

Query  2103  QSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAE  2282
              +V  +    VL +L  A +   A+ +  +++E+      +  ++L   L  EG +K+A+
Sbjct  675   FNVDFKSYDKVLDSLLAAGKTLNAYSILCKILEKGGATDWSSSDNLIKSLNQEGNTKQAD  734

Query  2283  FVAKRMPRLEGALD  2324
              +++ +   E + D
Sbjct  735   ILSRMIKGGEKSRD  748



>ref|XP_006353112.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
isoform X1 [Solanum tuberosum]
Length=731

 Score =   342 bits (877),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 206/640 (32%), Positives = 347/640 (54%), Gaps = 17/640 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    K    AL+FF W E+ G F    + +F+++++LG    LN AR  L  +P 
Sbjct  92    NVLHSA---KNSEHALQFFRWVERSGLFRHDRETHFKIIQILGRAEKLNHARCILLDMP-  147

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
               N  V  +   +  +I +Y  AG+ QES+KLF  M+ +G+  +V ++N LF+++ +RGR
Sbjct  148   --NKGVDWDEDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTVKSYNALFNVITRRGR  205

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+   G++P  +T+N+LI G  ++S VD   RFF++M+     PDV+TYN
Sbjct  206   YMMAKRYFNKMVNQ-GIEPTGHTYNLLIWGFFLSSKVDTAIRFFEDMKSKGIMPDVVTYN  264

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  K  ++ P V++YTTL++GY   +++++A+ +F+EM 
Sbjct  265   TMINGYIRVKKIEEAEKYFVEM--KARNIEPTVISYTTLIKGYSAVERIDDAVRLFEEMK  322

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGN  1313
               G +PN++TY+TL+ GL +A+K  +   + K   ED    P D   F  LI   C  G+
Sbjct  323   SFGIKPNAITYSTLLPGLCDAQKMSEAGAILKEM-EDKYIAPKDNSIFIRLISGQCEAGD  381

Query  1314  LKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAG  1484
             L AA +  + M  L+   ++  Y +LI   C+ G ++ A KF D+L +   +L   S + 
Sbjct  382   LDAAADVLKTMIRLSVPTEAGHYGVLIENFCKAGIYDRAVKFLDKLIEKEIVLRPQSSSS  441

Query  1485  CRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHE  1664
               P  +AYN +  YLC NG+T KAE  FRQLM+ GVQDP+ F  L+ G+  EG+ +   E
Sbjct  442   MEP--SAYNLIIDYLCNNGQTGKAETFFRQLMKTGVQDPIAFNNLVCGHSREGVPDSAFE  499

Query  1665  LLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELV  1844
             LL  M RR  + D   ++SL+E  L++ +P  A   L+ ML+  H P + ++ S++  L+
Sbjct  500   LLKIMGRRKVLSDGIAHKSLVESYLKKREPADAKAALDNMLEHGHDPDSLLYRSVMESLM  559

Query  1845  KQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
                     + ++ +ML K ++++++L +  +  L   G  E A   +  L  N    ++ 
Sbjct  560   GDGRVQTASRVMKIMLEKGVKEHMDLISTILEALLMRGHVEEALGRIELLLHNSLSPDLD  619

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  L +  K S A  LL F L+ + ++       VL +L  A +   A+ +  +++E 
Sbjct  620   GLLSVLCEKGKTSAALKLLDFILERNCNIDFSSYDKVLDSLLAAGKTLNAYSILCKMMEN  679

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGALD  2324
                      E+L   L  EG +K+A+ + + +   E  LD
Sbjct  680   GGVKDHKSCEELIKSLNDEGNTKQADILRRMILGKETTLD  719



>ref|XP_011094657.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Sesamum indicum]
Length=756

 Score =   343 bits (879),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 199/620 (32%), Positives = 335/620 (54%), Gaps = 12/620 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  122   KKSEHALQFFRWVERSNLFQHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  178

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  S+ +++ LF ++++RGR  M    F+
Sbjct  179   EDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERSIKSYDALFKVILRRGRYMMAKRYFN  238

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML + G++P  +TFNI+I G  ++  V+   RFF++M+  E  PDV+TYNT+++G  R 
Sbjct  239   KML-SEGIEPTRHTFNIMIWGFFLSGKVETANRFFEDMKNREIMPDVVTYNTLINGYYRV  297

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  298   KKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDRVDDALRLMEEMKGFGIKPNAI  355

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL +A K  + + + K   E      D   F  LI   C  GNL AA +  + 
Sbjct  356   TYSTLLPGLCDAEKMSEAQTILKEMVEKYIAPKDNSIFMRLISGQCKVGNLDAAADVLKA  415

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G+++   K  D+L +   +L   S     P  +AYNP
Sbjct  416   MIRLSVPTEAGHYGVLIENCCKAGEYDRGVKLLDKLIEKDIILRPQSTLHMEP--SAYNP  473

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG++ KAE + RQLM++GVQDP+   TLI G   EG  +   E+L  MLRRN 
Sbjct  474   LIEYLCNNGQSAKAETLLRQLMKLGVQDPIALNTLICGRSQEGNPDSAFEILKIMLRRNV  533

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECAD  1874
               +   Y+SL++  L++  P  A   L+ M+++ HLP + ++ S++  L +       + 
Sbjct  534   RSEKSAYDSLVKSYLRKSNPADAKAALDSMVENGHLPDSSLYRSVMESLFEDGRVQTASR  593

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             ++ +ML K +  + +L    +  LF  G  E A   +  L  +G   +   L+  L +  
Sbjct  594   VMKMMLEKGVTDHEDLIAKILEALFMRGHVEEACGRIELLMQSGIAPDFDSLLSVLCEKG  653

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
             K   A  LL + L+    + +     VL AL  A +   A+ +  +++E+      +  +
Sbjct  654   KTIAALKLLDYGLERDYKIDVSSYEKVLDALLAAGKTLNAYSILLKIMEKGGVTDWSSCK  713

Query  2235  DLRLRLEVEGRSKEAEFVAK  2294
             +L   L  EG +K+A+ +A+
Sbjct  714   ELIKSLNEEGNTKQADILAR  733



>ref|XP_009782844.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Nicotiana sylvestris]
 ref|XP_009782850.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Nicotiana sylvestris]
 ref|XP_009782863.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Nicotiana sylvestris]
Length=722

 Score =   340 bits (873),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/628 (32%), Positives = 342/628 (54%), Gaps = 10/628 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K   +AL+FF W E+ G F    + +F+++++LG    LN AR  L  +P   N  V  +
Sbjct  91    KNSEQALQFFRWVERSGLFRHDRETHFKIIQILGRSEKLNHARCILLDMP---NKGVDWD  147

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ ++N LF+++ +RGR  M    F+
Sbjct  148   EDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYNALFNVITRRGRYMMAKRYFN  207

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +M+   G++P  +T+N+LI G  ++S  D   RFF+ M+  E  PDV+TYNT+++G  RA
Sbjct  208   KMVNE-GIEPTTHTYNLLIWGFFLSSKPDTAIRFFEAMKSREISPDVVTYNTMINGYNRA  266

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  K  ++ PNV++YTTL++GY    +V++AL +F+EM   G +PN++
Sbjct  267   KKIEEAEKYFVEM--KARNIEPNVISYTTLIKGYSLVVRVDDALRLFEEMKSFGIKPNAI  324

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+  L E +K  + + + K   E      D   F  LI   C  G+L AA +  + 
Sbjct  325   TYSTLLPSLCEGQKMSEARMILKEMEEKYIAPKDNSVFIRLISGQCEAGDLDAAADVLKA  384

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-VAAYNPMF  1520
             M  L+   ++  Y +LI   C+ G  + A K  D+L +   +LS +   P+  +AYN + 
Sbjct  385   MIRLSVPTEAGHYGVLIENFCKAGVCDRAVKLLDKLIEKEIILSSS--LPMEQSAYNLII  442

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
              YLC NG+T KAE +FRQLM++G+QDP+ F  L+ G+  EG  +   E+L  M RR  + 
Sbjct  443   DYLCNNGQTSKAETLFRQLMKIGIQDPVAFNNLVCGHSREGAPDSAFEILKIMGRRKVLS  502

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLV  1880
             D   ++SL+E  L++G+P  A   L+ ML+  H P + ++ S++  L+        + ++
Sbjct  503   DGIAHKSLVESYLKKGEPADAKAALDNMLEQGHEPDSLLYRSVMESLMGDGRVQTASRVM  562

Query  1881  VLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKL  2060
              +ML K ++++++L +  +  L   G  E A   +  L  +G   ++  L+  L    K 
Sbjct  563   KIMLEKGVKEHMDLISTILEALLMRGHVEEALGRIELLLHSGLSPDIDGLLSALCDKGKT  622

Query  2061  SEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDL  2240
             + A  LL F L+   ++       VL +L  A +   A+ +  +++E+         E+L
Sbjct  623   AAALKLLDFGLERDCTIDFSSYDKVLDSLVAAGKTLNAYSMLCKMMEKGGVKDHKSCEEL  682

Query  2241  RLRLEVEGRSKEAEFVAKRMPRLEGALD  2324
                L  EG +K+A+ + + +   +  LD
Sbjct  683   IKSLNQEGNTKQADILRRMIIGKDTTLD  710



>ref|XP_006296196.1| hypothetical protein CARUB_v10025361mg [Capsella rubella]
 gb|EOA29094.1| hypothetical protein CARUB_v10025361mg [Capsella rubella]
Length=757

 Score =   341 bits (875),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 196/637 (31%), Positives = 348/637 (55%), Gaps = 15/637 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  + L+    AL+FF W E+ G     +  + +M+++LG  + +N AR  L  +P+
Sbjct  122   NVLHGAKKLE---HALQFFRWTERSGLIRHDRDTHMKMIKMLGEVQKVNYARCILLDMPE  178

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    VP +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ ++NTLF ++M+RGR
Sbjct  179   K---GVPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYNTLFKVIMRRGR  235

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + GV+P  +T+N+++ G  ++  ++   RFF++M+     PD +TYN
Sbjct  236   YMMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLSLRLETALRFFEDMKTRGISPDAVTYN  294

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G CR  K++ A  +   M  KG+++ P+VV+YTT+++GY    +V++ L +F+EM 
Sbjct  295   TMINGYCRFKKMDEAEKLFVEM--KGNNIEPSVVSYTTMIKGYLSVDRVDDGLRIFEEMR  352

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G EPN+ TY+T++ GL +A K  + K + K          D   F  L+ +    G++
Sbjct  353   SSGIEPNATTYSTVLPGLCDAGKMVEAKNILKNMMAKHIAPKDNSIFLKLLVSQSKAGDM  412

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       +
Sbjct  413   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAIKLLDTLLEKEIILRHQDTLEM  472

Query  1497  V-AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  473   EPSAYNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLISGHAKEGNPDSSYEILK  532

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  533   IMSRRGVPREANAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSSLFRSVIESLF-ED  591

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   I +N++L    +  L   G  E A   +  L  NG+  ++ 
Sbjct  592   GRVQTASRVMMIMIDKNVGIEENMDLIAKILEALLMRGHVEEALGRIDLLNQNGHAADLD  651

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++E+
Sbjct  652   SLLSVLSEKGKTIAALKLLDFGLERDLSLDFSSYEKVLDALLGAGKTLNAYSVLCKIMEK  711

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
                      ++L   L  EG +K+A+ +++ + + +G
Sbjct  712   GSATDWKSSDELIKSLNQEGNTKQADVLSRMIKKGQG  748



>gb|KHN46063.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=671

 Score =   338 bits (868),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/628 (32%), Positives = 341/628 (54%), Gaps = 13/628 (2%)
 Frame = +3

Query  450   TPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEA  626
             +P  AL+F+ W E+ G F  T +   +++++LG    LN AR  LF   +       +  
Sbjct  36    SPEHALQFYRWVERAGLFTHTPETTLKIVQILGRYSKLNHARCILFDDTRGGVSRAAVTE  95

Query  627   RFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDE  806
               F SLI +Y  AG+ QES+KLF  MK +G+  +V +++ LF ++++RGR  M    ++ 
Sbjct  96    DAFVSLIDSYGRAGIVQESVKLFKKMKELGLDRTVKSYDALFKVILRRGRYMMAKRYYNA  155

Query  807   MLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAG  986
             ML+  GV P  +TFNIL+ G  ++  +D   RF+++M+     PDV+TYNT+++G  R  
Sbjct  156   MLRE-GVDPTRHTFNILLWGMFLSLRLDTAVRFYEDMKSRGILPDVVTYNTLINGYFRFK  214

Query  987   KVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVT  1166
             KV+ A  +   M  KG D+ PNV+++TT+++GY    ++++AL VF+EM   G +PN VT
Sbjct  215   KVDEAEKLFVEM--KGRDIVPNVISFTTMLKGYVAAGRIDDALKVFEEMKGCGVKPNVVT  272

Query  1167  YNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAFE  1340
             ++TL+ GL +A K  + +++     E  R++   D   F  ++   C  G+L AA +  +
Sbjct  273   FSTLLPGLCDAEKMAEARDVLGEMVE--RYIAPKDNALFMKMMSCQCKAGDLDAAADVLK  330

Query  1341  KMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYN  1511
              M  L+   ++  Y +LI   C+   ++ AEK  D+L +   +L   +D+   P  +AYN
Sbjct  331   AMVRLSIPTEAGHYGVLIESFCKANVYDKAEKLLDKLIEKEIVLRPQNDSEMEP--SAYN  388

Query  1512  PMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRN  1691
              M  YLCE+G+T KAE  FRQL++ GVQD + F  LI G+  EG  +   E++  M RR 
Sbjct  389   LMIGYLCEHGRTGKAETFFRQLLKKGVQDSVAFNNLIRGHSKEGNPDSAFEIMKIMGRRG  448

Query  1692  FVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECA  1871
                D ++Y  L+E  L++G+P  A   L+ ML+S HLP + ++ S++  L         +
Sbjct  449   VARDVDSYRLLIESYLRKGEPADAKTALDGMLESGHLPESSLYRSVMESLFDDGRVQTAS  508

Query  1872  DLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQG  2051
              ++  M+ K +++N++L    +  L   G  E A   +  L  NG   +   L+  L + 
Sbjct  509   RVMKSMVEKGVKENMDLVLKILEALLLRGHVEEALGRIDLLMHNGCEPDFDHLLSVLCEK  568

Query  2052  KKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCL  2231
             +K   A  LL F L+    +   I   VL AL  A +   A+ +  +++E+      +  
Sbjct  569   EKTIAALKLLDFVLERDCIIDFSIYDKVLDALLAAGKTLNAYSILCKILEKGGSTDWSSR  628

Query  2232  EDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
             ++L   L  EG +K+A+ +++ +   +G
Sbjct  629   DELIKSLNQEGNTKQADVLSRMIKGTDG  656



>ref|XP_002881498.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57757.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=756

 Score =   341 bits (874),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 199/636 (31%), Positives = 344/636 (54%), Gaps = 15/636 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+H  + L+    AL+FF W E+ G     +  + +M+++LG  + LN AR  L  +P++
Sbjct  122   VLHGAKKLE---HALQFFRWTERSGLIRHDRDTHMKMIKMLGEVQKLNHARCILLDMPEK  178

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 VP +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ ++NTLF ++++RGR 
Sbjct  179   ---GVPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYNTLFKVILRRGRY  235

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++M+ + GV+P  +T+N+++ G  ++  ++   RFF +M+     PD +TYNT
Sbjct  236   MMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLSLRLETALRFFDDMKTRGISPDAVTYNT  294

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             I++G CR  K++ A  +   M  KG++  P+VVTYTT+++GY    +V++ L +F+EM  
Sbjct  295   IINGYCRFKKMDEAEKLFVEM--KGNNSEPSVVTYTTMIKGYLSVDRVDDGLRIFEEMRS  352

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G EPN+ TY+TL+ GL +  K  + K + K          D   F  L+ +    G++ 
Sbjct  353   FGIEPNATTYSTLLPGLCDVGKMVEAKNILKNMMAKHIAPKDNSIFLKLLVSQSKAGDMA  412

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-  1496
             AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       + 
Sbjct  413   AATEVLKAMATLNVPAEAGHYGVLIENQCKASAYNRAIKLLDTLIEKEIILRHQDTLEME  472

Query  1497  VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
              +AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  E  +E+L  
Sbjct  473   PSAYNPIIEYLCNNGQTAKAEVLFRQLMKRGVQDQDALNNLIRGHAKEGNPESSYEILKI  532

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++ 
Sbjct  533   MSRRGVPREANAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSALFRSVIESLF-EDG  591

Query  1857  ALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
              ++ A  V+++++ K   I  N++L    +  L   G  E A   +  L  NG+  ++  
Sbjct  592   RVQTASRVMMIMIDKNVGIEDNMDLIAKILEALLMRGHVEEALGRIDLLNQNGHTADLDS  651

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++E+ 
Sbjct  652   LLSVLSEKGKTIAALKLLDFGLERDLSLDFSSYDKVLDALLGAGKTLNAYSVLCKIMEKG  711

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
                     ++L   L  EG +K+A+ +++ + + +G
Sbjct  712   SSTDWKSSDELIKSLNQEGNTKQADVLSRMIKKGQG  747



>ref|XP_006410903.1| hypothetical protein EUTSA_v10017966mg [Eutrema salsugineum]
 gb|ESQ52356.1| hypothetical protein EUTSA_v10017966mg [Eutrema salsugineum]
Length=761

 Score =   340 bits (871),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 199/637 (31%), Positives = 342/637 (54%), Gaps = 15/637 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R L     AL+FF W+E+ G     +  + +M+E+LG    LN AR  L  +P+
Sbjct  123   NVLHGARKLD---HALQFFRWSERSGLIRHDRDTHMKMIEMLGQASKLNHARCILLDMPE  179

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +P +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ +++TLF ++++RGR
Sbjct  180   K---GIPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYDTLFKVILRRGR  236

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + G++P  +T+N+++ G  ++  ++   RF+++M      PDV+TYN
Sbjct  237   YMMAKRYFNKMV-SEGIEPTRHTYNLMLWGFFLSLRLETALRFYEDMISRGISPDVVTYN  295

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G CR  K++ A  V   M  KG ++ P+VV+YTT+++GY   ++V++ L +F EM 
Sbjct  296   TMINGYCRFKKMDEAEKVFVEM--KGKNIEPSVVSYTTMIKGYLAVERVDDGLRIFDEMR  353

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G EPN+ TY+TL+ GL +A K  + K + K          D   F  L+ +    G++
Sbjct  354   SFGIEPNATTYSTLLPGLCDAGKMVEAKSILKNMMAKHIAPKDNSIFLKLLVSQSKAGDM  413

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+      A K  D L +   +L       +
Sbjct  414   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAHNRAIKLLDILVEKEIILRHQDTLEM  473

Query  1497  VA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
                AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  474   EPNAYNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQEALNNLIRGHAKEGNPDSSYEILK  533

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    D   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  534   IMSRRGVPRDANAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSSLFRSVIESLF-ED  592

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   I  N++L    +  L   G  E A   +  L  NG+  ++ 
Sbjct  593   GRVQTASRVMMIMIDKNVGIEDNMDLVAKILEALLMRGHVEEALGRIDLLNQNGHSADLD  652

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++ +
Sbjct  653   SLLSVLSEKGKTIAALKLLDFGLERDLSLDFSSYDKVLDALLGAGKTLNAYSVLCKIMAK  712

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
                      +DL   L  EG +K+A+ +++ + + EG
Sbjct  713   GSVTDWKSCDDLIKSLNQEGNTKQADVLSRMIKKGEG  749



>gb|KHG02661.1| Anaphase-promoting complex subunit cdc20 [Gossypium arboreum]
 gb|KHG24422.1| Anaphase-promoting complex subunit cdc20 [Gossypium arboreum]
Length=375

 Score =   231 bits (589),  Expect(3) = 6e-97, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWN+ +  + +L +     D +P+S+ WS DA+TL VG   S +QLWD E+SK++R L+G
Sbjct  80    LWNSEDQAVHKLLQVRGGND-WPTSVTWSEDARTLAVGYMCSNLQLWDVESSKLIRSLQG  138

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H GR+ S AWNGH+LTSGS D+SII+HDVR +NSL S +K H  EVCGLKWS  GN L S
Sbjct  139   HSGRIASTAWNGHILTSGSRDKSIINHDVRAANSLASCIKRHADEVCGLKWSTEGNRLAS  198

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL+YIW+  KMSS  +LHR +DH AAVKALAWCPY  +VLASGGG  DGCIK+W+ 
Sbjct  199   GGNENLLYIWEASKMSSSKFLHRLSDHCAAVKALAWCPYQNNVLASGGGLSDGCIKIWNT  258

Query  2735  RKGACISSTFSK  2700
              KG CI++  +K
Sbjct  259   EKGICINNIETK  270


 Score =   138 bits (347),  Expect(3) = 6e-97, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHG+  R +   KLCLWRYPSM+K+ +  NH SR ++L QSPDG
Sbjct  272   QICGLEWNRHHKEILSGHGYSIR-ENQNKLCLWRYPSMTKVGELGNHKSRIINLCQSPDG  330

Query  2503  LTVVSAGADETLRFWEIFGPPQ--ADKSRTSDFDNLLSLKTSPIR  2375
             +TV+SAGADETLRFW++FGPP   A  S  SD   LLS +TS +R
Sbjct  331   ITVISAGADETLRFWDVFGPPTAGAGNSMVSDLQGLLSFRTSLLR  375


 Score = 37.7 bits (86),  Expect(3) = 6e-97, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 0/42 (0%)
 Frame = -2

Query  3459  LVFRGSPKGSRKSIREIDEMRRSDEESFSCTDVNKQSRAFPK  3334
             +VFRGSPK SRKSIR +DE+R+     F         R  PK
Sbjct  1     MVFRGSPKSSRKSIRFVDELRQEVAAIFEKDCKQTPYRCIPK  42



>ref|XP_010516983.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Camelina sativa]
Length=750

 Score =   337 bits (864),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 194/639 (30%), Positives = 347/639 (54%), Gaps = 15/639 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGF-ALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  + L+    AL+FF W E+ G  +     + +M+++LG    +N AR  L  +P+
Sbjct  120   NVLHGAKKLE---HALQFFRWTERSGLISHDRDTHMKMIKMLGEVHKVNYARCILLDMPE  176

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    VP +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ ++NTLF ++++RGR
Sbjct  177   K---GVPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYNTLFKVILRRGR  233

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + GV+P  +T+N+++ G  ++  ++   RFF++M+     PD +TYN
Sbjct  234   YMMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLSLRLETALRFFEDMKTRGISPDAVTYN  292

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G CR  K++ A  +   M  KG ++ P+VV+YTT+++GY    +V++ L +F+EM 
Sbjct  293   TMINGYCRFKKMDEAEKLFVEM--KGDNIEPSVVSYTTMIKGYLSVDRVDDGLRIFEEMR  350

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G EPN+ TY+TL+ GL +A K  + K + K          D   F  L+ +    G++
Sbjct  351   SSGIEPNATTYSTLLPGLCDAGKMVEAKNILKNMMAKHIAPKDNSIFLKLLVSQSKAGDM  410

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       +
Sbjct  411   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAIKLLDTLLEKEIILRHQDTLEM  470

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +A+NP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  471   EPSAFNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLIRGHAKEGNPDSSYEILK  530

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  531   IMSRRGVPRESNAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSSLFRSVIGSLF-ED  589

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   I +N++L    +  L   G  E A   +  L  NG+  ++ 
Sbjct  590   GRVQTASRVMMIMIDKNVGIEENMDLIAKILEALLMRGHVEEALGRIDLLNQNGHTADLD  649

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++ +
Sbjct  650   SLLSVLSEKGKTIAALKLLDFGLERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIMGK  709

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGAL  2321
                      ++L   L  EG +K+A+ +++ + + +G++
Sbjct  710   GSATDWKSCDELIKSLNQEGNTKQADVLSRMIKKGQGSV  748



>ref|XP_009420793.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Musa acuminata subsp. malaccensis]
Length=453

 Score =   225 bits (573),  Expect(3) = 5e-96, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNATN+ +Q L    D  D +P+SIAWS DAKT+ VG A S++++WDA   + VR L+G
Sbjct  163   LWNATNNSVQLLLTAADEDD-HPTSIAWSMDAKTVAVGFARSRVEIWDAIELQQVRILEG  221

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS++WN +VLTSGS+D SII+HDVR S+ L S L+AH+ EVCGLKWSG GN L S
Sbjct  222   HSARVGSLSWNQNVLTSGSHDASIINHDVRSSHHLASRLRAHSEEVCGLKWSGGGNLLAS  281

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNLV++W++ KM S  YLHR++DH AAV+ALAWCP+    LASGGGT D CIK+W+ 
Sbjct  282   GGNDNLVHVWESSKMGSSKYLHRYSDHCAAVRALAWCPFRSSTLASGGGTADQCIKIWNT  341

Query  2735  RKGACISS  2712
             + G C  S
Sbjct  342   QTGKCTDS  349


 Score =   110 bits (275),  Expect(3) = 5e-96, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C L+WN+H KE+LS HG+ +      +L LW YPSM+KI D   H +R LHLSQSPDG
Sbjct  355   QVCALEWNRHEKEILSAHGYSQ-----NQLSLWAYPSMTKIADLTGHTARVLHLSQSPDG  409

Query  2503  LTVVSAGADETLRFWEIFG-PPQADKSRTSDFDNLLSLKTSPIR  2375
              TV SA ADET+RFW++F   P+   S+  D D L S   + IR
Sbjct  410   CTVASAAADETIRFWKVFEHQPRRGSSKLDDEDRLFSFNRTHIR  453


 Score = 68.6 bits (166),  Expect(3) = 5e-96, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 65/129 (50%), Gaps = 28/129 (22%)
 Frame = -2

Query  3720  GDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNWELWVS  3541
             GDRFIP R LM+LD A + LT   +                        P + +  + ++
Sbjct  25    GDRFIPTRCLMNLDFARSSLTERRRRE----------------------PAAIDSPVILT  62

Query  3540  PFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESFSCTDV  3361
             P   K EYRRR+E  ++LD EG+P RMLVFRGSP+ S+ S+  +DEM +  +      D 
Sbjct  63    P---KDEYRRRVEENMRLDSEGKPRRMLVFRGSPRNSKPSVLLVDEMMKDQQARLRPID-  118

Query  3360  NKQSRAFPK  3334
               + R  PK
Sbjct  119   --RIRHVPK  125



>ref|XP_003524868.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Glycine max]
Length=733

 Score =   335 bits (860),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 200/628 (32%), Positives = 340/628 (54%), Gaps = 13/628 (2%)
 Frame = +3

Query  450   TPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEA  626
             +P  AL+F+ W E+ G F  T +   +++++LG    LN AR  LF+  +       +  
Sbjct  98    SPEHALQFYRWVERAGLFTHTPETTLKIVQILGRYSKLNHARCILFNDTRGGVSRAAVTE  157

Query  627   RFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDE  806
               F SLI +Y  AG+ QES+KLF  MK +G+  +V +++ LF ++++RGR  M    ++ 
Sbjct  158   DAFVSLIDSYGRAGIVQESVKLFKKMKELGLDRTVKSYDALFKVILRRGRYMMAKRYYNA  217

Query  807   MLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAG  986
             ML   GV P  +TFNIL+ G  ++  +D   RF+++M+     PDV+TYNT+++G  R  
Sbjct  218   MLLE-GVDPTRHTFNILLWGMFLSLRLDTAVRFYEDMKSRGILPDVVTYNTLINGYFRFK  276

Query  987   KVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVT  1166
             KV+ A  +   M  KG D+ PNV+++TT+++GY    ++++AL VF+EM   G +PN VT
Sbjct  277   KVDEAEKLFVEM--KGRDIVPNVISFTTMLKGYVAAGRIDDALKVFEEMKGCGVKPNVVT  334

Query  1167  YNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAFE  1340
             ++TL+ GL +A K  + +++     E  R++   D   F  ++   C  G+L AA +  +
Sbjct  335   FSTLLPGLCDAEKMAEARDVLGEMVE--RYIAPKDNALFMKMMSCQCKAGDLDAAADVLK  392

Query  1341  KMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYN  1511
              M  L+   ++  Y +LI   C+   ++ AEK  D+L +   +L   +D+   P  +AYN
Sbjct  393   AMVRLSIPTEAGHYGVLIESFCKANVYDKAEKLLDKLIEKEIVLRPQNDSEMEP--SAYN  450

Query  1512  PMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRN  1691
              M  YLCE+G+T KAE  FRQL++ GVQD + F  LI G+  EG  +   E++  M RR 
Sbjct  451   LMIGYLCEHGRTGKAETFFRQLLKKGVQDSVAFNNLIRGHSKEGNPDSAFEIMKIMGRRG  510

Query  1692  FVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECA  1871
                D ++Y  L+E  L++G+P  A   L+ ML+S HLP + ++ S++  L         +
Sbjct  511   VARDVDSYRLLIESYLRKGEPADAKTALDGMLESGHLPESSLYRSVMESLFDDGRVQTAS  570

Query  1872  DLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQG  2051
              ++  M+ K  ++N++L    +  L   G  E A   +  L  NG   +   L+  L + 
Sbjct  571   RVMKSMVEKGAKENMDLVLKILEALLLRGHVEEALGRIDLLMHNGCEPDFDHLLSVLCEK  630

Query  2052  KKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCL  2231
             +K   A  LL F L+    +   I   VL AL  A +   A+ +  +++E+      +  
Sbjct  631   EKTIAALKLLDFVLERDCIIDFSIYDKVLDALLAAGKTLNAYSILCKILEKGGSTDWSSR  690

Query  2232  EDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
             ++L   L  EG +K+A+ +++ +   +G
Sbjct  691   DELIKSLNQEGNTKQADVLSRMIKGTDG  718



>ref|XP_002315730.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF01901.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=760

 Score =   336 bits (861),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 198/629 (31%), Positives = 339/629 (54%), Gaps = 14/629 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTS-QCYFRMLELLGTERNLNTARNFLF-SIP  593
              V+H  R    P  AL+FF W E+ G      + + +++++LG    LN AR  +   +P
Sbjct  120   NVLHGAR---KPDHALQFFRWVERAGLIQHDRETHMKIIQILGRYSMLNHARCIVLEDMP  176

Query  594   KRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRG  773
             K+      L+   F  LI +Y  AG+ QES+K+F+ MK +G+  SV ++N LF +++++G
Sbjct  177   KK---GFELDEDMFVLLIDSYGKAGIVQESVKMFSKMKELGVERSVKSYNALFKVIVRKG  233

Query  774   RTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITY  953
             R  M    F++ML   G+ P  +T+N+LI G  ++  +    RF+++M+     PDV+TY
Sbjct  234   RYMMAKRFFNKMLDE-GIGPTRHTYNVLIWGFFLSMRLRTAVRFYEDMKVRGISPDVVTY  292

Query  954   NTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEM  1133
             NT+++G  R  ++E A  +   M  K  D++P V++YTT+++GY    ++ + L + +EM
Sbjct  293   NTMINGYYRHKRMEEAEKLFAEM--KAKDIAPTVISYTTMIKGYFAVDRINDGLRLLEEM  350

Query  1134  VDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDG  1310
                G +PN+VTY TL+  L +A K  + K++ K      R  P D   F  L+++ C  G
Sbjct  351   KSVGIKPNNVTYTTLLPDLCDAGKMTEAKDILKEMVRR-RIAPKDNSIFLKLLNSQCKAG  409

Query  1311  NLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCR  1490
             +LKAA++  + M  L+   ++  Y +LI   C+  +++ A KF D+L +   +L      
Sbjct  410   DLKAAVDVLDGMIKLSIPSEAGHYGVLIENFCKAEEYDQAVKFVDKLIENDIILRPQSTL  469

Query  1491  PV-VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              +   AYNP+ +YLC +G+T KAE +FRQL++ GV+DPL F  LI G+  EG  +   E+
Sbjct  470   EMESGAYNPVIQYLCSHGQTGKAEILFRQLLKKGVEDPLAFNNLICGHAKEGTPDSAFEI  529

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVK  1847
             L  M R+    D + Y  L+E  L++G+P  A   L+ M++  HLP + VF S++  L +
Sbjct  530   LKIMGRKGIPRDADAYRLLIESYLRKGEPADAKTALDSMIEDGHLPDSSVFRSVMESLYE  589

Query  1848  QNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
                    + ++  M+ K +++N++L    +  L   G +E A   +  L  +   VN   
Sbjct  590   DGRVQTASRVMKSMVEKGVKENMDLVAKILEALLMRGHEEEALGRIDLLMSSQCNVNFDS  649

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  LS+  K   A  LL F L+    +  +    VL AL  A +   A+ +  +++E+ 
Sbjct  650   LLSILSEKGKTIAALKLLDFGLQRDCDIDFKSYDKVLDALLAAGKTLNAYSILCKIMEKG  709

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                     EDL   L  EG +K+A+ +++
Sbjct  710   GVTSWRSYEDLIKSLNQEGNTKQADILSR  738



>ref|XP_011030581.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Populus euphratica]
Length=760

 Score =   335 bits (858),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 198/629 (31%), Positives = 339/629 (54%), Gaps = 14/629 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTS-QCYFRMLELLGTERNLNTARNFLF-SIP  593
              V+H  R    P  AL+FF W E+ G      + + +++++LG    LN AR  +   +P
Sbjct  120   NVLHGAR---KPDHALQFFRWVERAGLIQHDRETHMKIIQILGRYSMLNHARCIVLEDMP  176

Query  594   KRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRG  773
             K+      L+   F  LI +Y  AG+ QES+K+F+ MK +G+  S+ +++ LF +++++G
Sbjct  177   KK---GFELDEDMFVLLIDSYGKAGIVQESVKMFSKMKELGVERSIKSYDALFKVIVRKG  233

Query  774   RTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITY  953
             R  M    F++ML   G+ P  +T+N+LI G  ++  +    RF+++M+     PDVITY
Sbjct  234   RYMMAKRFFNKMLDE-GIGPTRHTYNVLIWGFFLSMRLRTAVRFYEDMKVRGISPDVITY  292

Query  954   NTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEM  1133
             NT+++G  R  ++E A  +   M  K   ++P V++YTT+++GY    ++ + L + +EM
Sbjct  293   NTMINGYYRLKRMEEAEKLFAEM--KAKYIAPTVISYTTMIKGYFAVDRINDGLRLLEEM  350

Query  1134  VDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDG  1310
                G +PN+VTY TL+  L +A K  + K++ K      R  P D   F  L+++HC  G
Sbjct  351   KSVGIKPNNVTYTTLLPDLCDAGKMTEAKDILKEMVRR-RIAPKDNSIFLKLLNSHCKAG  409

Query  1311  NLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCR  1490
             +LKAA++  + M  L+   ++  Y +LI   C+  +++ A KF D+L +   +L      
Sbjct  410   DLKAAVDVLDGMIKLSIPSEAGHYGVLIENFCKAEEYDQAVKFVDKLIENDIILRPQSTL  469

Query  1491  PV-VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              +   AYNP+ +YLC +G+T KAE +FRQL++ GV+DPL F  LI G+  EG  +   EL
Sbjct  470   EMKSGAYNPVIQYLCSHGQTGKAEILFRQLLKKGVEDPLAFNNLICGHAKEGTPDSAFEL  529

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVK  1847
             L  M R+    D + Y  L+E  L++G+P  A   L+ M++  HLP + VF S++  L +
Sbjct  530   LKIMGRKGIPRDADAYRLLIESYLRKGEPADAKTALDSMIEDGHLPESSVFRSVMESLYE  589

Query  1848  QNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
                    + ++  M+ K +++N++L    +  L   G +E A   +  L  +   VN   
Sbjct  590   DGRVQTASRVMKSMVEKGVKENMDLVAKILEALLMRGHEEEALGRIDLLMSSQCNVNFDS  649

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  LS+  K   A  LL F L+    +  +    VL AL  A +   A+ +  +++E+ 
Sbjct  650   LLSILSEKGKTIAALKLLDFGLQRDCDIDFKSYDKVLDALLAAGKTLNAYSILCKIMEKG  709

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                     EDL   L  EG +K+A+ +++
Sbjct  710   GVTGWRSYEDLIRSLNQEGNTKQADILSR  738



>gb|KFK36611.1| hypothetical protein AALP_AA4G146200 [Arabis alpina]
Length=763

 Score =   334 bits (857),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 194/638 (30%), Positives = 350/638 (55%), Gaps = 15/638 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R L+    AL+FF W+E+ G     +  + +M+E+LG  + LN AR  +  +P+
Sbjct  125   NVLHGARKLE---HALQFFRWSERSGLIRHDRDTHMKMIEMLGQAQKLNHARCIVLEMPE  181

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    VP +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ +++TLF ++++RGR
Sbjct  182   K---GVPWDEDMFKVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYDTLFKVILRRGR  238

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + G++P  +T+N+++ G  ++  ++   RFF++M+     PDV+TYN
Sbjct  239   YMMAKRYFNKMV-SEGIEPTRHTYNLMLWGFFLSLRLETALRFFEDMKSRGISPDVVTYN  297

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K++ A  +   M  KG ++ P+VV+YTT+++GY E  +V++ L VF+EM 
Sbjct  298   TMINGYVRFKKMDEAEKLFVEM--KGKNIEPSVVSYTTMIKGYLEVDRVDDGLRVFEEMR  355

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G EP + TY+TL+ GL +A K  + + + K          D   F  L+ +    G++
Sbjct  356   SFGIEPTATTYSTLLPGLCDAGKMVEARNILKSMMAKHIAPKDNSIFLKLLVSQSKAGDM  415

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       +
Sbjct  416   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAIKLLDILLEKEIILRHQDTLEM  475

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC +G+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  476   EPSAYNPIIEYLCNSGQTAKAEVLFRQLMKRGVQDQNALNNLIRGHAKEGDPDSSYEILK  535

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +  TYE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  536   IMSRRGVPREANTYELLIKSYMSKGEPGDAKTALDSMIEDGHVPDSSLFRSVIESLF-ED  594

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   + +N++L    +  LF  G  E A   +  L  +G+  ++ 
Sbjct  595   GRVQTASRVMMIMIDKNVGVEENMDLVAKILEALFMRGHVEEALGRIDLLNQSGHSADLD  654

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++ +
Sbjct  655   SLLSVLSEKGKTIAALKLLDFGLERDLSLDFSSYDKVLDALLGAGKTLNAYSVLCKIMGK  714

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGA  2318
                      ++L   L  EG +K+A+ +++ + + +G+
Sbjct  715   GSISDWKSCDELIKSLNQEGNTKQADVLSRMIKKGQGS  752



>ref|NP_181260.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9ZUU3.1|PP190_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g37230 
[Arabidopsis thaliana]
 gb|AAC98044.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64144.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00321.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09370.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=757

 Score =   334 bits (857),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 195/636 (31%), Positives = 344/636 (54%), Gaps = 15/636 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+H  + L+    AL+FF W E+ G     +  + +M+++LG    LN AR  L  +P++
Sbjct  123   VLHGAKKLE---HALQFFRWTERSGLIRHDRDTHMKMIKMLGEVSKLNHARCILLDMPEK  179

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 VP +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ ++N+LF ++++RGR 
Sbjct  180   ---GVPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYNSLFKVILRRGRY  236

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++M+ + GV+P  +T+N+++ G  ++  ++   RFF++M+     PD  T+NT
Sbjct  237   MMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLSLRLETALRFFEDMKTRGISPDDATFNT  295

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G CR  K++ A  +   M  KG+ + P+VV+YTT+++GY    +V++ L +F+EM  
Sbjct  296   MINGFCRFKKMDEAEKLFVEM--KGNKIGPSVVSYTTMIKGYLAVDRVDDGLRIFEEMRS  353

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G EPN+ TY+TL+ GL +A K  + K + K          D   F  L+ +    G++ 
Sbjct  354   SGIEPNATTYSTLLPGLCDAGKMVEAKNILKNMMAKHIAPKDNSIFLKLLVSQSKAGDMA  413

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV  1499
             AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       + 
Sbjct  414   AATEVLKAMATLNVPAEAGHYGVLIENQCKASAYNRAIKLLDTLIEKEIILRHQDTLEME  473

Query  1500  -AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
              +AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L  
Sbjct  474   PSAYNPIIEYLCNNGQTAKAEVLFRQLMKRGVQDQDALNNLIRGHAKEGNPDSSYEILKI  533

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++ 
Sbjct  534   MSRRGVPRESNAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSSLFRSVIESLF-EDG  592

Query  1857  ALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
              ++ A  V+++++ K   I  N++L    +  L   G  E A   +  L  NG+  ++  
Sbjct  593   RVQTASRVMMIMIDKNVGIEDNMDLIAKILEALLMRGHVEEALGRIDLLNQNGHTADLDS  652

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++E+ 
Sbjct  653   LLSVLSEKGKTIAALKLLDFGLERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIMEKG  712

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
                     ++L   L  EG +K+A+ +++ + + +G
Sbjct  713   SSTDWKSSDELIKSLNQEGNTKQADVLSRMIKKGQG  748



>ref|XP_008338950.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Malus domestica]
Length=763

 Score =   334 bits (856),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 204/632 (32%), Positives = 338/632 (53%), Gaps = 16/632 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ G F    + + +++E+LG    LN AR  L  +PK
Sbjct  119   NVLHGAR---NWEHALQFFRWVERSGLFKHDRETHLKIIEILGRNLKLNHARCILLDMPK  175

Query  597   RSNGAVPLEARFFNSLIKNYAVAG-----LFQESLKLFTSMKVIGISPSVVTFNTLFSIL  761
             +    V L+   F +LI  Y  AG     + QES+KLF SMK +G+  S+ ++  LF  +
Sbjct  176   K---GVQLDEDLFLALIDGYGKAGYGKAGIIQESVKLFDSMKELGVQRSLKSYEALFKAI  232

Query  762   MKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPD  941
             M+RGR  M    F+ ML   G++PD +T+N++I G  M+  ++   RF+++M+     PD
Sbjct  233   MRRGRYMMAKRYFNAMLSE-GIEPDRHTYNVMIWGFFMSKRLETAKRFYEDMKSRGISPD  291

Query  942   VITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNV  1121
             ++TYNT++ G  R   ++ A  +   +  KG ++ PNV+ YTT+++GY +  +V++AL +
Sbjct  292   LVTYNTMIHGYNRFKMMDEAEQLFVEL--KGRNIEPNVICYTTMIKGYVDVGRVDDALRL  349

Query  1122  FKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHC  1301
             F+EM   G +PN+VT++TL+ GL EA K D+   + K   +      D   F  L+   C
Sbjct  350   FQEMKSFGIKPNAVTFSTLLPGLCEAEKKDEAVNMLKEMVQRYIAPKDNAIFEKLLTLMC  409

Query  1302  SDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDA  1481
               G+L +A +  + M  L+   +   Y ILI   C+ G ++ A K  D+L +   +L   
Sbjct  410   KSGDLDSAADVLKAMIRLSIPTEPGHYGILIENFCKAGVYDRAIKLLDKLIEKEIILRPQ  469

Query  1482  GCRPVVA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDG  1658
                 + A AYNPM ++LC +G+T+KAE  FRQLM+ GVQD + F  L+ G+  EG S+  
Sbjct  470   SSIELEASAYNPMIEHLCNHGQTEKAEVFFRQLMKKGVQDSVAFNNLMCGHAKEGNSDSA  529

Query  1659  HELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTE  1838
              E+L  M RR    + ++Y  L+   L +G+P  A   L+ ML+S H+P + +F S+L  
Sbjct  530   FEILRIMGRRGVPGEADSYRLLINSYLSKGEPADAKTALDSMLESGHIPESPLFRSVLES  589

Query  1839  LVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVN  2018
             L +       + ++  M+ K +++N++L    +  LF  G  E A   +  L  +G    
Sbjct  590   LFEDGRVQTASRVMKSMVEKGVKENMDLVAKILEALFMRGHVEEALGRIDLLMQSGCTPQ  649

Query  2019  MQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELV  2198
                L+  L++  K   A  LL F L+   SV       VL AL +A +   A+ +  +++
Sbjct  650   FDSLLSVLAEKGKTIGALKLLDFCLERDCSVDFSSYDKVLDALLEAGKTLNAYSILCKIM  709

Query  2199  ERQIELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
             E+      +  +DL   L  EG +K+A+ +++
Sbjct  710   EKGEASDWSSTKDLIKSLNQEGNTKQADILSR  741



>ref|XP_003532699.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Glycine max]
Length=738

 Score =   333 bits (853),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 198/632 (31%), Positives = 339/632 (54%), Gaps = 14/632 (2%)
 Frame = +3

Query  450   TPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEA  626
             +P  AL+F+ W E+ G F  T +   +++++LG    LN AR  LF   +       +  
Sbjct  98    SPEHALQFYRWVERAGLFTHTPETTLKIVQILGRYSKLNHARCILFDDTRGGASRATVTE  157

Query  627   RFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDE  806
               F SLI +Y  AG+ QES+KLF  MK +G+  +V +++ LF ++++RGR  M    ++ 
Sbjct  158   DAFVSLIDSYGRAGIVQESVKLFKKMKELGVDRTVKSYDALFKVILRRGRYMMAKRYYNA  217

Query  807   MLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAG  986
             ML    V+P  +T+NIL+ G  ++  +D   RF+++M+     PDV+TYNT+++G  R  
Sbjct  218   MLNE-SVEPTRHTYNILLWGMFLSLRLDTAVRFYEDMKSRGILPDVVTYNTLINGYFRFK  276

Query  987   KVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVT  1166
             KVE A  +   M  KG D+ PNV+++TT+++GY    ++++AL VF+EM   G +PN+VT
Sbjct  277   KVEEAEKLFVEM--KGRDIVPNVISFTTMLKGYVAAGQIDDALKVFEEMKGCGVKPNAVT  334

Query  1167  YNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAFE  1340
             ++TL+ GL +A K  + +++     E  R++   D   F  L+   C  G+L AA +  +
Sbjct  335   FSTLLPGLCDAEKMAEARDVLGEMVE--RYIAPKDNAVFMKLMSCQCKAGDLDAAGDVLK  392

Query  1341  KMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV------VA  1502
              M  L+   ++  Y +LI   C+   ++ AEK  D++ +   +L               +
Sbjct  393   AMIRLSIPTEAGHYGVLIENFCKANLYDKAEKLLDKMIEKEIVLRQKNAYETELFEMEPS  452

Query  1503  AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWML  1682
             AYN M  YLCE+G+T KAE  FRQLM+ GVQD ++F  LI G+  EG  +   E++  M 
Sbjct  453   AYNLMIGYLCEHGRTGKAETFFRQLMKKGVQDSVSFNNLICGHSKEGNPDSAFEIIKIMG  512

Query  1683  RRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCAL  1862
             RR    D ++Y  L+E  L++G+P  A   L+ ML+S HLP + ++ S++  L       
Sbjct  513   RRGVARDADSYRLLIESYLRKGEPADAKTALDGMLESGHLPESSLYRSVMESLFDDGRVQ  572

Query  1863  ECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFL  2042
               + ++  M+ K +++N++L +  +  L   G  E A   +  L  NG   +   L+  L
Sbjct  573   TASRVMKSMVEKGVKENMDLVSKVLEALLMRGHVEEALGRIHLLMLNGCEPDFDHLLSVL  632

Query  2043  SQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPL  2222
              + +K   A  LL F L+    +   I   VL AL  A +   A+ +  +++E+      
Sbjct  633   CEKEKTIAALKLLDFVLERDCIIDFSIYDKVLDALLAAGKTLNAYSILCKILEKGGSTDW  692

Query  2223  NCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGA  2318
             +  ++L   L  EG +K+A+ +++ +   +G 
Sbjct  693   SSRDELIKSLNQEGNTKQADVLSRMIKGTDGG  724



>ref|XP_004299746.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Fragaria vesca subsp. vesca]
Length=763

 Score =   333 bits (855),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 197/631 (31%), Positives = 340/631 (54%), Gaps = 11/631 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQ-KGFALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             KT  +AL+FF W E+ + F    + + +++E+LG    LN AR  L  +PK+    V  +
Sbjct  129   KTSDQALQFFRWVERSRLFQHDRETHLKIIEILGRASKLNHARCILLDMPKK---GVQWD  185

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI +Y  AG+ QES+KLF  MK +G+  S+ ++  LF  +++RGR  M    F+
Sbjct  186   EDLFIHLIDSYGKAGIVQESVKLFNQMKELGVERSLKSYEALFKSILRRGRYMMGKRYFN  245

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
              ML   G++P  +T+NI+I G  ++  ++   RFF++M+     PDV+TYNT+++G  R 
Sbjct  246   HMLAE-GIEPTRHTYNIMIWGFFLSLRLETAKRFFEDMKTRGLSPDVVTYNTMINGYNRF  304

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
               ++ A  +   +  KG ++ PNV++YTT+++GY    KV++   +F+EM   G +PN V
Sbjct  305   KMMDEAEQLFVEL--KGKNIQPNVISYTTMIKGYVSVGKVDDGYRLFQEMKSFGIKPNDV  362

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             T++TL+ GL +A K D+ + L     E      D   F  L++  C  G+L AA    + 
Sbjct  363   TFSTLLPGLCDAEKKDEAQNLLSEMVERHIAPKDNSVFEKLLYCQCKSGDLDAAANVLKA  422

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL-SDAGCRPVVAAYNPMF  1520
             M  L+   ++  Y ILI   C+ G ++ A    D L +   ++ S +      +AYNPM 
Sbjct  423   MIRLHIPTEAGHYGILIENFCKAGVYDRAVHLLDRLIEKEIIMRSQSSMELEASAYNPMI  482

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
             +YLC++G+T KAE +FRQLM+ GVQD + F  LI G+  EG S+   E+L  M RR    
Sbjct  483   EYLCDHGQTDKAEVLFRQLMKKGVQDSVAFNNLIRGHAKEGNSDSAFEILKIMGRRGVPR  542

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLV  1880
             + ++Y+ L++  L +G+P  A   L+ M+++ H+P + +F S++  L +       + ++
Sbjct  543   EADSYKLLIKSYLSKGEPADAKTALDSMIENGHVPESSLFRSVMESLFEDGRVQTASRIM  602

Query  1881  VLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKL  2060
               M+ K + +N++L    +  LF  G  E A   +  L  +G       L+  L++  K 
Sbjct  603   KSMVEKGVNENMDLVAKILEALFIRGHVEEALGRIDLLMQSGCAPEFDSLLSVLAEKGKT  662

Query  2061  SEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDL  2240
               A  LL F L+    V  +    VL AL ++ +   A+ +  +++++         +DL
Sbjct  663   IAAVKLLDFCLERDCMVDFKSYDKVLDALLESGKTLNAYSILCKIMDKGGVTDWRSTDDL  722

Query  2241  RLRLEVEGRSKEAEFVAKRMPRLEGALDYIG  2333
                L +EG +K+A+ +++   +++G  D  G
Sbjct  723   IKSLNLEGNTKQADVLSR---KIKGGEDMAG  750



>ref|XP_009133136.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Brassica rapa]
Length=751

 Score =   333 bits (853),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 196/638 (31%), Positives = 346/638 (54%), Gaps = 15/638 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  + L     AL+FF W+E+ G     +  + +M+E+LG  + LN AR  L  +P+
Sbjct  116   NVLHGAKKLD---HALQFFRWSERSGLIRHDRDTHMKMIEMLGQGQKLNHARCILLDMPE  172

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    VP +   F  LI++Y  AG+ QES+K+F  MK +G+  +V +++TLF ++++RGR
Sbjct  173   K---GVPWDEDMFKVLIESYGKAGIVQESVKIFQKMKELGVERTVKSYDTLFKVILRRGR  229

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + GV+P  +T+N+++ G  +   ++   RF+ +M      PDV+TYN
Sbjct  230   YMMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLCLRLETALRFYDDMISRGTSPDVVTYN  288

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G CR  K++ A  +   M  KG ++ P+VV+YTT+++GY   ++V++ L +F+EM 
Sbjct  289   TMINGYCRFKKMDEAEKLFVEM--KGKNIEPSVVSYTTMIKGYVAVERVDDGLRIFEEMR  346

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G E N+ TY+TL+ GL +A K  + + + K          D   F  L+ +    G++
Sbjct  347   SVGIEANATTYSTLLPGLCDAGKMVEARNVLKSMMAKHIAPNDNSIFLKLLVSQSKAGDM  406

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       +
Sbjct  407   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAVKLLDVLVEKEIILRHQDTLEM  466

Query  1497  V-AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  467   EPSAYNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLISGHAKEGNPDASYEILK  526

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  527   IMSRRGVPREANAYELLIKSYMSKGEPGDAKTALDSMIEDGHVPDSSLFRSVIESLF-ED  585

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   + +N++L    +  L   G  E A   +  L  NG+  ++ 
Sbjct  586   GRVQTASRVMMIMIDKNVGVEENMDLVAKILEALLMRGHVEEALGRIDLLNQNGHTADVD  645

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F+L+   S+       VL AL  A +   A+ +  ++V +
Sbjct  646   RLLSVLSEKGKTIAALKLLDFALERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIVGK  705

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGA  2318
                      E+L   L  EG +K+A+ +++ + + +G+
Sbjct  706   GSGSDWKSCEELIKSLNQEGNTKQADVLSRMIKKGQGS  743



>emb|CDY46765.1| BnaA03g17090D [Brassica napus]
Length=751

 Score =   332 bits (850),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 195/638 (31%), Positives = 346/638 (54%), Gaps = 15/638 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  + L     AL+FF W+E+ G     +  + +M+E+LG  + LN AR  L  +P+
Sbjct  116   NVLHGAKKLD---HALQFFRWSERSGLIRHDRDTHMKMIEMLGQGQKLNHARCILLDMPE  172

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    VP +   F  LI++Y  AG+ QES+K+F  MK +G+  +V +++TLF ++++RGR
Sbjct  173   K---GVPWDEDMFKVLIESYGKAGIVQESVKIFQKMKELGVERTVKSYDTLFKVILRRGR  229

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + GV+P  +T+N+++ G  +   ++   RF+ +M      PDV+TYN
Sbjct  230   YMMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLCLRLETALRFYDDMISRGISPDVVTYN  288

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G CR  K++ A  +   M  KG ++ P+VV+YTT+++GY   ++V++ L +F+EM 
Sbjct  289   TMINGYCRFKKMDEAEKLFVEM--KGKNIEPSVVSYTTMIKGYVAVERVDDGLRIFEEMR  346

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G E N+ TY+TL+ GL +A K  + + + K          D   F  L+ +    G++
Sbjct  347   SVGIEANATTYSTLLPGLCDAGKMVEARNVLKSMMAKHIAPNDNSIFLKLLVSQSKAGDM  406

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       +
Sbjct  407   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAVKLLDVLVEKEIILRHQDTLEM  466

Query  1497  V-AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  467   EPSAYNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLISGHAKEGNPDASYEILK  526

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  527   IMSRRGVPREANAYELLIKSYMSKGEPGDAKTALDSMIEDGHVPDSSLFRSVIESLF-ED  585

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   + +N++L    +  L   G  E A   +  L  NG+  ++ 
Sbjct  586   GRVQTASRVMMIMIDKNVGVEENMDLVAKILEALLMRGHVEEALGRIDLLNQNGHTADVD  645

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F+L+   S+       VL AL  A +   A+ +  +++ +
Sbjct  646   RLLSVLSEKGKTIAALKLLDFALERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIMGK  705

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGA  2318
                      E+L   L  EG +K+A+ +++ + + +G+
Sbjct  706   GSGSDWKSCEELIKSLNQEGNTKQADVLSRMIKKGQGS  743



>ref|XP_002530985.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF31397.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=753

 Score =   332 bits (850),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 192/627 (31%), Positives = 337/627 (54%), Gaps = 11/627 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H+ R       AL+FF W E+ G F      + +++E+LG    LN AR  L  +PK
Sbjct  114   NVLHAAR---NSEHALQFFRWVERAGLFKNDRDTHMKIIEILGRASKLNHARCILLDMPK  170

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    V  +   F  LI++Y  AG+ QE++K+F  M  +G+  S+ +++ LF ++++RGR
Sbjct  171   K---GVEWDEYMFVVLIESYGKAGIVQEAVKIFNKMNELGVERSIKSYDALFKVILRRGR  227

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M   +F++ML   G++P  +T+NI++ G  ++  ++   RF+ +M+     PDV+TYN
Sbjct  228   YMMAKRVFNKMLND-GIQPTRHTYNIMLWGFFLSLRLETAMRFYDDMKNRGISPDVVTYN  286

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A  +   M  KG +++P V++YTT+++GY    +V++ L + +EM 
Sbjct  287   TMINGFYRFKKMEEAEKLFVEM--KGKNIAPTVISYTTMIKGYVAVDRVDDGLRLLEEMK  344

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
                 +PN  TY+TL+ GL +A K  + K++            D   F  L+   C  G+L
Sbjct  345   SFNIKPNVHTYSTLLPGLCDAWKMTEAKDILIEMVARHLAPKDNSIFLRLLSCQCKAGDL  404

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
             +AA +    M  L+   ++  Y +LI   C+  +++ A K+ D+L +   +L       +
Sbjct  405   RAAEDVLNTMMRLHIPTEAGHYGVLIENFCKAEEYDRAVKYLDKLIEKEIILRPQSTLEI  464

Query  1497  VA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
              + AYNPM +YLC +G+T KAE  FRQLM+ GVQDPL F  LI G+  EG  +   E+  
Sbjct  465   ESNAYNPMIQYLCSHGQTGKAEIFFRQLMKKGVQDPLAFNNLICGHAKEGYPDSAFEIFK  524

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M +R    D + Y  ++E  L++G+P  A   L+ ML+  H+P   VF S++  L +  
Sbjct  525   IMGKRGVPRDADAYRLIIESYLRKGEPADAKTALDGMLEDGHVPDPSVFRSVMESLFEDG  584

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
                  + ++  M+ K +++N++L    +  L   G  E A   +  L  +G+ VN  +L+
Sbjct  585   RVQTASRVMKSMVEKGVKENMDLVGKILEALLMRGHVEEALGRIELLMQSGFHVNFDDLL  644

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               LS+  K   A  LL F+L+   ++  +    VL AL  A +   A+ +  +++++   
Sbjct  645   SVLSEKGKTIAALKLLDFALERDFNLDFKSYDKVLDALLAAGKTLNAYSILCKIMQKGGV  704

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                +  +DL   L  EG +K+A+ +++
Sbjct  705   SDWSSSKDLIKSLNQEGNTKQADILSR  731



>ref|XP_007038204.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY22705.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=1029

 Score =   237 bits (605),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = -3

Query  3209  PSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDR  3030
             P+S+ WS DAKTL VG   S +QLWDAE+ K++R L+GH GR+ S AWNGH+LTSGS D+
Sbjct  757   PTSVNWSEDAKTLAVGYMCSNLQLWDAESFKLIRSLQGHSGRIASTAWNGHILTSGSRDK  816

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYLH  2850
             SII+HDVR  N+L S ++ HT EVCGLKWS  GN L +GGN+NL+YIW+  KMSS  YLH
Sbjct  817   SIINHDVRAVNNLASCIRKHTDEVCGLKWSTEGNMLATGGNENLLYIWEASKMSSSKYLH  876

Query  2849  RFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSK  2700
             R +DH AAVKALAWCPY ++VLASGGG  DGCIK+W+ +KG CI+S  +K
Sbjct  877   RLSDHCAAVKALAWCPYQHNVLASGGGLSDGCIKIWNTQKGTCINSVETK  926


 Score =   139 bits (349),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHG+    +   KLCLWRYPSM+K+ +  NH+SR ++L QSPDG
Sbjct  928   QICGLEWNRHHKEILSGHGYST-SENQNKLCLWRYPSMTKVGELGNHSSRIINLCQSPDG  986

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             +TVVSA ADETLRFW++FGPP A     +D   LLSL+T+ IR
Sbjct  987   VTVVSAEADETLRFWDVFGPPTAGSLSFTDLQGLLSLRTTLIR  1029


 Score = 99.4 bits (246),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 87/204 (43%), Gaps = 77/204 (38%)
 Frame = -2

Query  3942  RMDQKSL-ERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWG  3766
             +MDQ ++ + L+S WY P RL  +PTEYDFP                             
Sbjct  572   KMDQSAMWKLLESDWYSPRRLHDSPTEYDFP-----------------------------  602

Query  3765  HELPSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNEC  3586
                            GDRF+PNRSLM+LD+AH+LLTN +KE   SK +            
Sbjct  603   ---------------GDRFLPNRSLMNLDKAHSLLTNRTKEFNTSKCDQV----------  637

Query  3585  FWFLPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREID  3406
                                   YR++L   L L  E RP R++VFRGSPK SRKSIR +D
Sbjct  638   ----------------------YRQKLIEHLSLHSEERPSRIMVFRGSPKSSRKSIRFVD  675

Query  3405  EMRRSDEESFSCTDVNKQSRAFPK  3334
             EMR+ +             R  PK
Sbjct  676   EMRQEEAAMLDTDGKKTHYRCIPK  699



>emb|CBI32743.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   332 bits (851),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 198/627 (32%), Positives = 331/627 (53%), Gaps = 11/627 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ G F      + +++E+LG    LN AR  L  +PK
Sbjct  124   NVLHGSR---NSDHALQFFRWVERAGLFRHDRDTHLKIIEILGRASKLNHARCILLDMPK  180

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    V  +   F  LI +Y  AG+ QES+K+F  MK +G+  ++ +++ LF ++++RGR
Sbjct  181   K---GVEWDEDLFVLLIDSYGKAGIVQESVKVFQKMKELGVERTIKSYDALFKVILRRGR  237

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F+ ML   GV P  +T+NI+I G  ++  V+   RFF+EM++    PDV+TYN
Sbjct  238   YMMAKRYFNAMLNE-GVMPTCHTYNIMIWGFFLSLKVETANRFFEEMKERRISPDVVTYN  296

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P V++YTT+++GY    +V++ L +F+EM 
Sbjct  297   TMINGYYRIKKMEEAEKFFVEM--KGRNIEPTVISYTTMIKGYVSVGRVDDGLRLFEEMK  354

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN+VTY+TL+ GL +  K  + + + K   E      D   F  LI   C  G L
Sbjct  355   SFGIKPNAVTYSTLLPGLCDGEKMLEAQNVVKEMVERYIAPKDNSIFMRLITCQCKAGQL  414

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L       +
Sbjct  415   DAAADVLKAMIRLSIPTEAGHYGVLIENFCKSGVYDRAVKLLDKLIEKEIILRPQNSLEM  474

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               + YN + +YLC +G+T KAE +FRQLM+ GVQDP+ F  LI G+  EG  E   E+L 
Sbjct  475   ESSGYNLIIEYLCNSGQTSKAETLFRQLMKKGVQDPIAFNNLIRGHSKEGAPESAFEILK  534

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    + + Y  L+E  L++G+P  A   L+ M+++ H+P + +F S++  L +  
Sbjct  535   IMGRREVPREADAYRLLIESFLKKGEPADAKTALDGMIENGHIPDSSLFRSVMESLFEDG  594

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
                  + ++  M+ K +++N++L    +  L   G  E A   +  L +NG   +   L+
Sbjct  595   RIQTASRVMNNMVEKGVKENMDLVAKILEALLLRGHVEEALGRIDLLMNNGCEPDFDGLL  654

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               L    K   A  LL F L+   ++       VL AL  A +   A+ +  +++++   
Sbjct  655   SVLCAKGKTIAALKLLDFGLERDYNISFSSYENVLDALLTAGKTLNAYSILCKIMQKGGA  714

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                +  +DL   L  EG +K+A+ +++
Sbjct  715   TDWSSCKDLIRSLNEEGNTKQADILSR  741



>ref|XP_002276355.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Vitis vinifera]
Length=763

 Score =   331 bits (849),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 198/627 (32%), Positives = 331/627 (53%), Gaps = 11/627 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ G F      + +++E+LG    LN AR  L  +PK
Sbjct  124   NVLHGSR---NSDHALQFFRWVERAGLFRHDRDTHLKIIEILGRASKLNHARCILLDMPK  180

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    V  +   F  LI +Y  AG+ QES+K+F  MK +G+  ++ +++ LF ++++RGR
Sbjct  181   K---GVEWDEDLFVLLIDSYGKAGIVQESVKVFQKMKELGVERTIKSYDALFKVILRRGR  237

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F+ ML   GV P  +T+NI+I G  ++  V+   RFF+EM++    PDV+TYN
Sbjct  238   YMMAKRYFNAMLNE-GVMPTCHTYNIMIWGFFLSLKVETANRFFEEMKERRISPDVVTYN  296

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P V++YTT+++GY    +V++ L +F+EM 
Sbjct  297   TMINGYYRIKKMEEAEKFFVEM--KGRNIEPTVISYTTMIKGYVSVGRVDDGLRLFEEMK  354

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN+VTY+TL+ GL +  K  + + + K   E      D   F  LI   C  G L
Sbjct  355   SFGIKPNAVTYSTLLPGLCDGEKMLEAQNVVKEMVERYIAPKDNSIFMRLITCQCKAGQL  414

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L       +
Sbjct  415   DAAADVLKAMIRLSIPTEAGHYGVLIENFCKSGVYDRAVKLLDKLIEKEIILRPQNSLEM  474

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               + YN + +YLC +G+T KAE +FRQLM+ GVQDP+ F  LI G+  EG  E   E+L 
Sbjct  475   ESSGYNLIIEYLCNSGQTSKAETLFRQLMKKGVQDPIAFNNLIRGHSKEGAPESAFEILK  534

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    + + Y  L+E  L++G+P  A   L+ M+++ H+P + +F S++  L +  
Sbjct  535   IMGRREVPREADAYRLLIESFLKKGEPADAKTALDGMIENGHIPDSSLFRSVMESLFEDG  594

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
                  + ++  M+ K +++N++L    +  L   G  E A   +  L +NG   +   L+
Sbjct  595   RIQTASRVMNNMVEKGVKENMDLVAKILEALLLRGHVEEALGRIDLLMNNGCEPDFDGLL  654

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               L    K   A  LL F L+   ++       VL AL  A +   A+ +  +++++   
Sbjct  655   SVLCAKGKTIAALKLLDFGLERDYNISFSSYENVLDALLTAGKTLNAYSILCKIMQKGGA  714

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                +  +DL   L  EG +K+A+ +++
Sbjct  715   TDWSSCKDLIRSLNEEGNTKQADILSR  741



>ref|XP_006484268.1| PREDICTED: cell division cycle 20.1, cofactor of APC complex-like 
[Citrus sinensis]
Length=462

 Score =   242 bits (618),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 141/174 (81%), Gaps = 3/174 (2%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWN---GHVLTSG  3042
             +P+SI+WS DAKTL VG  +SK+QLWDAETSK++R L+GH+ RV + +WN   GH+LTSG
Sbjct  187   FPTSISWSQDAKTLAVGYMASKLQLWDAETSKLIRNLEGHDKRVATASWNHWNGHILTSG  246

Query  3041  SYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR  2862
             S D+SII+HDVRVSN++ S + AHT EVCGLKWS  GN L SGG+DNLV++WD  KMSS 
Sbjct  247   SQDKSIINHDVRVSNNVTSRINAHTAEVCGLKWSNEGNLLASGGDDNLVHVWDHSKMSSS  306

Query  2861  DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSK  2700
               LHRF DH AAVKALAWCPY ++VLASGGGT DGCIK+W+++KG CI S  +K
Sbjct  307   KCLHRFRDHRAAVKALAWCPYQFNVLASGGGTQDGCIKIWNVQKGTCIHSVDTK  360


 Score =   133 bits (334),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   GDG  KLCLW+YP M+K  +  +  SR L LSQSPDG
Sbjct  362   QICGLEWNRHHKEILSGHGFSSSGDGQ-KLCLWKYPHMTKWGELQHQTSRILELSQSPDG  420

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA ADETLRFWE FGP        S  D LLSLK SPIR
Sbjct  421   LTVVSAAADETLRFWEAFGPS-GSGDFVSHLDGLLSLKVSPIR  462


 Score =   103 bits (258),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 94/205 (46%), Gaps = 79/205 (39%)
 Frame = -2

Query  3939  MDQKS-LERL-QSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWG  3766
             MD +S L RL ++ WY P RLL +PT++DF                              
Sbjct  1     MDHQSRLSRLLETDWYSPRRLLGSPTDFDF------------------------------  30

Query  3765  HELPSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNEC  3586
                           +GDRFIPNRSLM+LD+AH LLTN +KE     +N +          
Sbjct  31    --------------QGDRFIPNRSLMNLDQAHGLLTNTTKEFRNPNFNDA----------  66

Query  3585  FWFLPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREID  3406
                                   YR+++   L LD EG+PFRMLVFRGSPK  RKS R ID
Sbjct  67    ----------------------YRQKVAENLNLDSEGKPFRMLVFRGSPKSRRKSYRLID  104

Query  3405  EMRRSDEESF-SCTDVNKQSRAFPK  3334
             E+RR D E+  + T+  ++ R  PK
Sbjct  105   ELRREDAEALRNSTEQIQRRRQLPK  129



>ref|XP_006437839.1| hypothetical protein CICLE_v10031460mg [Citrus clementina]
 gb|ESR51079.1| hypothetical protein CICLE_v10031460mg [Citrus clementina]
Length=462

 Score =   242 bits (617),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 141/174 (81%), Gaps = 3/174 (2%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWN---GHVLTSG  3042
             +P+SI+WS DAKTL VG  +SK+QLWDAETSK++R L+GH+ RV + +WN   GH+LTSG
Sbjct  187   FPTSISWSQDAKTLAVGYMASKLQLWDAETSKLIRNLEGHDKRVATASWNHWNGHILTSG  246

Query  3041  SYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR  2862
             S D+SII+HD+RVSN++ S + AHT EVCGLKWS  GN L SGG+DNLV++WD  KMSS 
Sbjct  247   SQDKSIINHDIRVSNNVTSRINAHTAEVCGLKWSNEGNLLASGGDDNLVHVWDHSKMSSS  306

Query  2861  DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSK  2700
               LHRF DH AAVKALAWCPY ++VLASGGGT DGCIK+W+++KG CI S  +K
Sbjct  307   KCLHRFRDHRAAVKALAWCPYQFNVLASGGGTQDGCIKIWNVQKGTCIRSVDTK  360


 Score =   133 bits (334),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   GDG  KLCLW+YP M+K  +  +  SR L LSQSPDG
Sbjct  362   QICGLEWNRHHKEILSGHGFSSSGDGQ-KLCLWKYPHMTKWGELQHQTSRILELSQSPDG  420

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA ADETLRFWE FGP        S  D LLSLK SPIR
Sbjct  421   LTVVSAAADETLRFWEAFGPS-GSGDFVSHLDGLLSLKVSPIR  462


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 92/205 (45%), Gaps = 79/205 (39%)
 Frame = -2

Query  3939  MDQKS-LERL-QSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWG  3766
             MD +S L RL ++ WY P RLL +PT++DF                              
Sbjct  1     MDHQSRLSRLLETDWYSPRRLLGSPTDFDF------------------------------  30

Query  3765  HELPSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNEC  3586
                           +GDRFIPNRSLM+LD+AH LLTN +KE     +N +          
Sbjct  31    --------------QGDRFIPNRSLMNLDQAHGLLTNTTKEFRNPNFNDA----------  66

Query  3585  FWFLPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREID  3406
                                   YR+++   L LD EG+PFRMLVFR SPK  RKS R ID
Sbjct  67    ----------------------YRQKVAENLNLDSEGKPFRMLVFRASPKSRRKSYRLID  104

Query  3405  EMRRSDEESF-SCTDVNKQSRAFPK  3334
             E+RR D E+  + T+  +  R  PK
Sbjct  105   ELRREDAEALRNSTEQIQCRRQLPK  129



>emb|CDX79725.1| BnaC03g20610D [Brassica napus]
Length=751

 Score =   330 bits (847),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 194/638 (30%), Positives = 346/638 (54%), Gaps = 15/638 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  + L     AL+FF W+E+ G     +  + +M+E+LG  + LN AR  L  +P+
Sbjct  113   NVLHGAKKLD---HALQFFRWSERSGLIRHDRDTHMKMIEMLGQGQKLNHARCILLDMPE  169

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    VP +   F  LI++Y  AG+ QES+K+F  MK +G+  +V +++TLF ++++RGR
Sbjct  170   K---GVPWDEDMFKVLIESYGKAGIVQESVKIFQKMKELGVERTVKSYDTLFKVILRRGR  226

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++M+ + GV+P  +T+N+++ G  +   ++   RF+ +M      PDV+TYN
Sbjct  227   YMMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLCLRLETALRFYDDMISRGISPDVVTYN  285

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G CR  K++ A  +   M  KG ++ P+VV+YTT+++GY   ++V++ L +F+EM 
Sbjct  286   TMINGYCRFKKMDEAEKLFVEM--KGKNIEPSVVSYTTMIKGYVSVERVDDGLRIFEEMR  343

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G E N+ TY+TL+ GL +A K  + + + K          D   F  L+ +    G++
Sbjct  344   SFGIEANATTYSTLLPGLCDAGKMVEARNVLKSMMAKHIAPNDNSIFLKLLVSQSKAGDM  403

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       +
Sbjct  404   AAATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAIKLLDVLVEKEIILRHQDTLEM  463

Query  1497  V-AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L 
Sbjct  464   EPSAYNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLISGHAKEGNPDASYEILK  523

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++
Sbjct  524   IMSRRGVPREANAYELLIKSYMSKGEPGDAKTALDSMIEDGHVPDSTLFRSVIESLF-ED  582

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+++++ K   + +N++L    +  L   G  E A   +  L  NG+  ++ 
Sbjct  583   GRVQTASRVMMIMIDKNVGVEENMDLVAKILEALLMRGHVEEALGRIDLLNQNGHTADVD  642

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F+L+   S+       VL AL  A +   A+ +  +++ +
Sbjct  643   RLLSVLSEKGKTIAALKLLDFALERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIMGK  702

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEGA  2318
                      ++L   L  EG +K+A+ +++ + + +G+
Sbjct  703   GSGSDWKSCDELIKSLNQEGNTKQADVLSRMIKKEQGS  740



>ref|XP_007033459.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY04385.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=743

 Score =   329 bits (843),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 196/626 (31%), Positives = 334/626 (53%), Gaps = 8/626 (1%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKGFALTS-QCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K   +AL+FF W E+ G      + + +++++LG    LN AR  L  +PK+    V  +
Sbjct  110   KNSEQALQFFRWVERAGLIRHDREAHMKIIQILGRASKLNHARCILLDMPKK---GVEWD  166

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI +Y  AG+ QE++K+F  M  +G+  ++ +++  F ++++RGR  M    F+
Sbjct  167   EDLFVVLIDSYGKAGIVQEAVKIFQKMNELGVERTIKSYDAFFKVILRRGRYMMAKRYFN  226

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G+ P  +T+NI++ G  ++  +D   RF+++M+     PDV+TYNT+++G  R 
Sbjct  227   KMLSE-GIVPTRHTYNIMLWGFFLSLRLDTANRFYEDMKTRGISPDVVTYNTMINGYSRF  285

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A  +   M  KG +L+P V++YTT+++GY   ++V++ L + +EM   G +PN+ 
Sbjct  286   KKMEEAEKLFVEM--KGKNLAPTVISYTTMIKGYVAVEQVDDGLRLLEEMKSFGIKPNAT  343

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL +A K  + K + K   E      D   F  L+++ C  G+L AA +  + 
Sbjct  344   TYSTLLPGLCDAGKMTEAKSILKEMVEWYIAPKDNSIFINLLNSQCKSGDLDAAADVLKA  403

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVA-AYNPMF  1520
             M  L+   ++  Y +LI   C+   F+ A K  D+L +   +L       + A AYN M 
Sbjct  404   MIRLSIPTEAGHYGVLIENFCKANLFDRAIKLLDKLVEKEIILRPQNSLDMEASAYNAMI  463

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
             +YLC +G+T KAE  FRQLM+ GV DP  F  LI G+  EG      E+L  M RR    
Sbjct  464   QYLCHHGQTGKAEVFFRQLMKKGVLDPTAFNNLIRGHAKEGNPGLAFEILKIMGRRGVPK  523

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLV  1880
             D + Y+ L+E  L++G+P  A  +L+ M++   LP + +F S++  L +       + ++
Sbjct  524   DADAYKLLIESYLRKGEPADAKTSLDSMIEDGLLPESGIFKSVMESLFEDGRIQTASRVM  583

Query  1881  VLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKL  2060
               M+ K ++++++L    +  L   G  E A   +  L  NG   N+  L+  LS+  K 
Sbjct  584   KSMVEKGVKEHMDLVAKILEALLMRGHVEEALGRIELLMQNGCAPNLDSLLSVLSEKGKT  643

Query  2061  SEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDL  2240
               A  LL F L+   S+       VL AL  A +   A+ +  +++E+      + LEDL
Sbjct  644   IAALKLLDFGLERDCSIDFSSYEKVLDALLAAGKTLNAYSILCKIMEKGGITNWSSLEDL  703

Query  2241  RLRLEVEGRSKEAEFVAKRMPRLEGA  2318
                L  EG +K+A+ +++ +   E A
Sbjct  704   IKSLNQEGNTKQADILSRMIKGGEAA  729



>gb|KDO70258.1| hypothetical protein CISIN_1g040533mg [Citrus sinensis]
Length=364

 Score =   240 bits (612),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 141/174 (81%), Gaps = 3/174 (2%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWN---GHVLTSG  3042
             +P+SI+WS DAKTL VG  +SK+QLWDAETSK++R L+GH+ RV + +WN   GH+LTSG
Sbjct  89    FPTSISWSQDAKTLAVGYMASKLQLWDAETSKLIRNLEGHDKRVATASWNHWNGHILTSG  148

Query  3041  SYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR  2862
             S D+SII+HDVRVSN++ S + AHT EVCGLKWS  GN L SGG+DNLV++WD  KMSS 
Sbjct  149   SQDKSIINHDVRVSNNVTSRINAHTAEVCGLKWSNEGNLLASGGDDNLVHVWDHSKMSSS  208

Query  2861  DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSK  2700
               LHRF DH AAVKALAWCPY ++VLASGGGT DGCIK+W+++KG CI S  +K
Sbjct  209   KCLHRFRDHRAAVKALAWCPYQFNVLASGGGTQDGCIKIWNVQKGTCIHSVDTK  262


 Score =   132 bits (333),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   GDG  KLCLW+YP M+K  +  +  SR L LSQSPDG
Sbjct  264   QICGLEWNRHHKEILSGHGFSSSGDGQ-KLCLWKYPHMTKWGELQHQTSRILELSQSPDG  322

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA ADETLRFWE FGP        S  D LLSLK SPIR
Sbjct  323   LTVVSAAADETLRFWEAFGPS-GSGDFVSHLDGLLSLKVSPIR  364



>gb|ACU25632.1| pentatricopeptide repeat-containing protein [Neosparton ephedroides]
Length=484

 Score =   320 bits (820),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/469 (36%), Positives = 270/469 (58%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++M+RGR  M    F+
Sbjct  80    EDMWVLMIDSYGKEGIVQESVKLFQKMEELGVERTIKSYDALFKVIMRRGRFMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDVITYNT+++G CR 
Sbjct  140   KMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVITYNTMINGYCRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFVEM--KGKNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMKGYGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSILKEMVDKYIAPTDNSIFMRLISSHCKVGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G ++ A K  D+L +   ++   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGQYDQAVKLLDKLIEKDIIVRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GVQDP    TLI G+  EG  +   ELL  MLRR  
Sbjct  375   IVEYLCNNGQTSKAEALVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  435   DSEKSAYDSLVQSYLKKSEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>ref|XP_010509363.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Camelina sativa]
Length=752

 Score =   328 bits (842),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 192/633 (30%), Positives = 341/633 (54%), Gaps = 15/633 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKGF-ALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+H  + L+    AL+FF W E+ G  +     + +M+++LG    +N AR  L  +P++
Sbjct  118   VLHGAKKLE---HALQFFRWTERSGLISHDRDNHMKMIKMLGEVHKVNYARCILLDMPEK  174

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 VP +   F  LI++Y  AG+ QES+K+F  MK +G+  ++ ++NTLF ++++RGR 
Sbjct  175   ---GVPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTIKSYNTLFKVILRRGRY  231

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++M+ + GV+P  +T+N+++ G  ++  ++   RFF++M+     PD +TYNT
Sbjct  232   MMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLSLRLETALRFFEDMKTRGISPDAVTYNT  290

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G CR  K++ A  +   M  KG ++ P+VV+YTT+++GY    +V++ L +F+EM  
Sbjct  291   MINGYCRFKKMDEAEKLFVEM--KGDNIEPSVVSYTTMIKGYISVDRVDDGLRIFEEMRS  348

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G EPN+ TY+TL+ GL +A K  + K + K          D   F  L+      G++ 
Sbjct  349   SGIEPNATTYSTLLPGLCDAGKMVEAKGILKSMMAKHIAPKDNSIFLKLLVAQSKAGDMA  408

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV  1499
             AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       + 
Sbjct  409   AATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAIKLLDTLLEKEIILRHQDTLEME  468

Query  1500  -AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
              +A+NP+ +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L  
Sbjct  469   PSAFNPIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLIRGHAKEGNPDSSYEILKI  528

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +  S++  L  ++ 
Sbjct  529   MSRRGVPRESNAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSSLSRSVIESLF-EDG  587

Query  1857  ALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
              ++ A  V+++++ K   I +N++L    +  L   G  E A   +  L  NG+  ++  
Sbjct  588   RVQTASRVMMIMIDKNVGIEENMDLIAKILEALLMRGHVEEALGRIDLLNQNGHTADLDS  647

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++ + 
Sbjct  648   LLSVLSEKGKTIAALKLLDFGLERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIMGKG  707

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPR  2306
                     ++L   L  EG +K+A+ +++ + +
Sbjct  708   SATDWKSCDELIKSLNQEGNTKQADVLSRMIKK  740



>gb|ACU25622.1| pentatricopeptide repeat-containing protein [Junellia uniflora]
Length=484

 Score =   320 bits (819),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/478 (36%), Positives = 273/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  IPK
Sbjct  17    NVLHSA---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDIPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             TI++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TIINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI + C+ GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMTEARSILKEMMDKYLAPTDNSIFMRLISSQCNSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGVLIENFCKAGQYDQAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAEALVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYDSLVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>ref|XP_006481496.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Citrus sinensis]
Length=751

 Score =   328 bits (841),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 196/626 (31%), Positives = 336/626 (54%), Gaps = 13/626 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F    + + +M+E+LG    LN AR  L  +PK+    V  +
Sbjct  119   KNSEHALQFFRWVERAGLFNHDRETHLKMIEILGRVGKLNHARCILLDMPKK---GVQWD  175

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI++Y   G+ QES+K+F  MK +G+  SV +++ LF ++++RGR  M    F+
Sbjct  176   EDMFEVLIESYGKKGIVQESVKIFDIMKQLGVERSVKSYDALFKLILRRGRYMMAKRYFN  235

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +T+N+++ G  ++  ++   RFF++M+     PDV+TYNT+++G  R 
Sbjct  236   KMLSE-GIEPTRHTYNVMLWGFFLSLKLETAIRFFEDMKSRGISPDVVTYNTMINGYNRF  294

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A  +   M +K  ++ P V++YTT+++GY   ++ ++AL +F EM     +PN+V
Sbjct  295   KKMDEAEKLFAEMKEK--NIEPTVISYTTMIKGYVAVERADDALRIFDEMKSFDVKPNAV  352

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAF  1337
             TY  L+ GL +A K  +V+++ +   E  R++P  D   F  L+   C  G+L AA +  
Sbjct  353   TYTALLPGLCDAGKMVEVQKVLREMVE--RYIPPKDNSVFMKLLGVQCKSGHLNAAADVL  410

Query  1338  EKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAA-YNP  1514
             + M  L+   ++  Y ILI   C+   ++ A K  D+L +   +L       + A+ YNP
Sbjct  411   KAMIRLSIPTEAGHYGILIENFCKAEMYDRAIKLLDKLVEKEIILRPQSTLDMEASSYNP  470

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M ++LC NG+T KAE  FRQLM+ GV DP+ F  LI G+  EG  +   E++  M RR  
Sbjct  471   MIQHLCHNGQTGKAEIFFRQLMKKGVLDPVAFNNLIRGHSKEGNPDSAFEIVKIMGRRGV  530

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECAD  1874
               D + Y  L+E  L++G+P  A   L+ M++  H P + +F S++  L +       + 
Sbjct  531   PRDADAYICLIESYLRKGEPADAKTALDSMIEDGHSPASSLFRSVMESLFEDGRVQTASR  590

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             ++  M+ K +++N++L    +  L   G  E A   +  +  +G + N   L+  LS+  
Sbjct  591   VMKSMVEKGVKENLDLVAKILEALLMRGHVEEALGRIDLMMQSGSVPNFDSLLSVLSEKG  650

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
             K   A  LL F L     + +     VL AL  A +   A+ + ++++E+         +
Sbjct  651   KTIAAVKLLDFCLGRDCIIDLASYEKVLDALLAAGKTLNAYSILFKIMEKGGVTDWKSSD  710

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPRLE  2312
              L   L  EG +K+A+ ++ RM R E
Sbjct  711   KLIAGLNQEGNTKQADILS-RMIRGE  735



>ref|XP_004309007.1| PREDICTED: anaphase-promoting complex subunit cdc20-like [Fragaria 
vesca subsp. vesca]
Length=451

 Score =   237 bits (605),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             +P+S++WS DAK L VG   SKIQLWDAE SK+VR LKGH  RV +IAWNG+ LTSGS D
Sbjct  177   HPTSLSWSQDAKYLAVGYQGSKIQLWDAEASKLVRSLKGHHRRVATIAWNGNTLTSGSRD  236

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             RSII+HDVR  N++   L+AH++EVCGLKWS TGN L SGGN+NL+YIW++ KM+S  YL
Sbjct  237   RSIINHDVRARNNVTCHLRAHSQEVCGLKWSETGNLLASGGNENLLYIWESSKMNSSKYL  296

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             +RF DH AAVKALAWCPY   VLASGGGT DGCIK+W+ +KG CI++
Sbjct  297   YRFKDHCAAVKALAWCPYQSSVLASGGGTEDGCIKLWNTQKGTCINT  343


 Score =   134 bits (338),  Expect(2) = 7e-93, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN HHKE+LSGHG+        +LCLWRYPSM K+     H SR L LSQSPDG
Sbjct  349   QVCGLEWNMHHKEILSGHGYSPSEHIKNQLCLWRYPSMEKVGYLKRHTSRVLQLSQSPDG  408

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA AD TLRFW+IFGPP AD  R S  D+ LS KTS IR
Sbjct  409   LTVVSAVADGTLRFWDIFGPPCADNLRLSALDSFLSNKTSLIR  451


 Score = 89.4 bits (220),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 83/194 (43%), Gaps = 79/194 (41%)
 Frame = -2

Query  3912  QSHWYYPTRLLSTP-TEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF*  3736
             QS WY PTRL  +P T+Y+FP                                       
Sbjct  5     QSDWYSPTRLNMSPNTQYEFP---------------------------------------  25

Query  3735  FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNW  3556
                  GDRFIPNRSLMDLD+A +LLT+ +     S +N +                    
Sbjct  26    -----GDRFIPNRSLMDLDQAQSLLTDRTIPNQNSNFNEA--------------------  60

Query  3555  ELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESF  3376
                         YR+ L+  L LD EG PF+MLVFRGSPK +RK IR +DE+R SDE  F
Sbjct  61    ------------YRKILQDQLTLDSEGNPFKMLVFRGSPKSNRKPIRCVDEIRWSDE--F  106

Query  3375  SCTDVNKQSRAFPK  3334
                    Q R+ PK
Sbjct  107   DSNVRPIQLRSLPK  120



>ref|XP_010505300.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Camelina sativa]
Length=760

 Score =   328 bits (841),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 192/633 (30%), Positives = 341/633 (54%), Gaps = 15/633 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKGF-ALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+H  + L+    AL+FF W E+ G  +     + +M+++LG    +N AR  +  +P++
Sbjct  126   VLHGAKKLE---HALQFFRWTERSGLISHDRDTHMKMIKMLGEVHKVNYARCIILEMPEK  182

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 VP +   F  LI++Y  AG+ QES+K+F  MK +G+  +V ++NTLF ++++RGR 
Sbjct  183   ---GVPWDEDMFVVLIESYGKAGIVQESVKIFQKMKDLGVERTVKSYNTLFKVILRRGRY  239

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++M+ + GV+P  +T+N+++ G  ++  ++   RFF++M+     PD +TYNT
Sbjct  240   MMAKRYFNKMV-SEGVEPTRHTYNLMLWGFFLSLRLETALRFFEDMKTRGISPDAVTYNT  298

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G CR  K++ A  +   M  KG ++ P+VV+YTT+++GY    +V++ L +F+EM  
Sbjct  299   MINGYCRFKKMDEAEKLFVEM--KGDNIEPSVVSYTTMIKGYLSVYRVDDGLRIFEEMRS  356

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G EPN+ TY+TL+ GL +A K  + K + K          D   F  L+      G++ 
Sbjct  357   SGIEPNATTYSTLLPGLCDAGKMVEAKNILKNMMAKHIAPKDNSIFLKLLVAQSKAGDMA  416

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV  1499
             AA E  + M+ LN   ++  Y +LI   C+   +  A K  D L +   +L       + 
Sbjct  417   AATEVLKAMATLNVPAEAGHYGVLIENQCKANAYNRAIKLLDTLLEKEVILRHQDTLEME  476

Query  1500  -AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
              +A+N + +YLC NG+T KAE +FRQLM+ GVQD      LI G+  EG  +  +E+L  
Sbjct  477   PSAFNRIIEYLCNNGQTSKAEVLFRQLMKRGVQDQDALNNLIRGHAKEGNPDSSYEILKI  536

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNC  1856
             M RR    +   YE L++  + +G+P  A   L+ M++  H+P + +F S++  L  ++ 
Sbjct  537   MSRRGVPRESNAYELLIKSYMSKGEPGDAKTALDSMVEDGHVPDSSLFRSVIESLF-EDG  595

Query  1857  ALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
              ++ A  V+++++ K   I +N++L    +  L   G  E A   +  L  NG+  ++  
Sbjct  596   RVQTASRVMMIMIDKNVGIEENMDLIAKILEALLMRGHVEEALGRIDLLNQNGHTADLDS  655

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  LS+  K   A  LL F L+   S+       VL AL  A +   A+ +  +++ + 
Sbjct  656   LLSVLSEKGKTIAALKLLDFGLERDLSLEFSSYDKVLDALLGAGKTLNAYSVLCKIMGKG  715

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPR  2306
                     ++L   L  EG +K+A+ +++ + +
Sbjct  716   SATDWKSCDELIKSLNQEGNTKQADVLSRMIKK  748



>ref|XP_008378595.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Malus domestica]
Length=760

 Score =   328 bits (840),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 200/632 (32%), Positives = 336/632 (53%), Gaps = 16/632 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGF-ALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ GF     + + +++E+LG    LN AR  L  +PK
Sbjct  116   NVLHGAR---NWEHALQFFRWVERSGFFKHDRETHLKIIEILGRNLKLNHARCILLDMPK  172

Query  597   RSNGAVPLEARFFNSLIKNYAVAG-----LFQESLKLFTSMKVIGISPSVVTFNTLFSIL  761
             +      L+   F +LI  Y  AG     + QES+KLF SMK +G+  S+ ++  LF  +
Sbjct  173   KGE---QLDEDLFLALIDGYGKAGYGKAGIIQESVKLFDSMKELGVQRSLKSYEALFKAI  229

Query  762   MKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPD  941
             M+RGR  M    F+ ML   G++P+ +T+N++I G  M+  ++   RF+++M+     PD
Sbjct  230   MRRGRYMMAKRYFNAMLSE-GIEPNRHTYNVMIWGFFMSKRLETAKRFYEDMKSRGILPD  288

Query  942   VITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNV  1121
             ++TYNT++ G  R   ++ A  +   +  KG +L PNV+ YTT+++GY +  +V++AL +
Sbjct  289   LVTYNTMIHGYNRFKMMDEAEQLFVEL--KGRNLEPNVICYTTMIKGYVDVGRVDDALRL  346

Query  1122  FKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHC  1301
             F+EM   G +PN+VT++TL+ GL EA K ++   + K   +      D   F  L++  C
Sbjct  347   FQEMKSFGIKPNAVTFSTLLPGLCEAEKKNEAVNMLKEMVQRYIAPKDNSIFEKLLYLMC  406

Query  1302  SDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLS-D  1478
               G+L AA +  + M  L+   +   Y ILI   C+ G ++ A K  D+L +   +L   
Sbjct  407   KSGDLDAAADVLKAMIRLSIPTEPGHYGILIENFCKAGVYDRAIKLLDKLIEKEIILRPQ  466

Query  1479  AGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDG  1658
             +      +AYNPM +YLC +G+T+KAE  FRQLM+ GVQD + F  L+ G+  EG S+  
Sbjct  467   SSIELEASAYNPMIEYLCNHGQTEKAEVFFRQLMKKGVQDSVAFNNLMCGHAKEGNSDSA  526

Query  1659  HELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTE  1838
              E+L  M RR    + ++Y  L+   L +G+P  A   L+ ML+  H+P   +F S++  
Sbjct  527   FEILRIMGRRGVPGEADSYRLLINSYLSKGEPADAKTALDSMLEGGHIPEASLFGSVMES  586

Query  1839  LVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVN  2018
             L +       + ++  M+ K +++N++L    +  LF  G  E A   +  L  +G    
Sbjct  587   LFEDGRVQTASRVMKSMVEKGVKENMDLVAKILETLFMRGHVEEALGRIDLLMQSGCTPQ  646

Query  2019  MQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELV  2198
                L+  L++  K   A  LL F L+   +V       VL AL +A +   A+ +  +++
Sbjct  647   FDSLLSVLAEKGKTIAALKLLDFCLERDCNVDFSSYDKVLDALLEAGKTLNAYSILCKIM  706

Query  2199  ERQIELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
             E+      +  +DL   L  EG +K+A+ +++
Sbjct  707   EKGGLSDWSSTKDLIKSLNQEGNTKQADILSR  738



>gb|ACU25601.1| pentatricopeptide repeat-containing protein [Verbena perennis]
Length=484

 Score =   318 bits (816),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 171/478 (36%), Positives = 273/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFLRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA++  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAVDVLKAMIRLSVPTEAGHYGLLIENFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQASKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPADAKAALDSMIENDHLPDSALFRSVMESL  483



>ref|XP_009376212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Pyrus x bretschneideri]
Length=757

 Score =   327 bits (838),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 202/636 (32%), Positives = 337/636 (53%), Gaps = 17/636 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ G F    + + +++++LG    LN AR  L  +PK
Sbjct  113   NVLHGTR---NWEHALQFFRWVERSGLFNHDRETHLKIIDVLGRNLKLNHARCILLDMPK  169

Query  597   RSNGAVPLEARFFNSLIKNYAVAG-----LFQESLKLFTSMKVIGISPSVVTFNTLFSIL  761
             +      L+   F +LI  Y  AG     + QES+KLF SMK +G+  S+ ++  LF  +
Sbjct  170   KGE---QLDEDLFLALIDGYGKAGYGKAGIIQESVKLFDSMKELGVQRSLKSYEALFKAI  226

Query  762   MKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPD  941
             M+RGR  M    F+ ML   G++P+ +T+N++I G  ++  ++   RF+++M+     PD
Sbjct  227   MRRGRYTMAKRYFNAMLSE-GIEPNRHTYNVMIWGFFLSKRLETAKRFYEDMKNRGILPD  285

Query  942   VITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNV  1121
             ++TYNT++ G  R   ++ A  +   +  KG +L PNV+ YTT+++GY +  KV++AL +
Sbjct  286   LVTYNTMIHGYNRFKMMDEAEQLFVEL--KGRNLEPNVICYTTMIKGYVDVGKVDDALRL  343

Query  1122  FKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHC  1301
             F+EM   G +PN+VT++TL+ GL EA K D+   + K   +      D   F  L+   C
Sbjct  344   FQEMKSFGIKPNAVTFSTLLPGLCEAEKKDEAVNMLKEMVQRYIAPKDNSIFEKLLSLMC  403

Query  1302  SDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLS-D  1478
               G+L AA +  + M  L+   +   Y ILI   C+ G ++ A K  D+L +   ++   
Sbjct  404   KSGDLDAAADVLKAMIRLSIPTEPGHYGILIENFCKAGVYDRAIKLLDKLIEKEIIMRPQ  463

Query  1479  AGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDG  1658
             +      +AYNPM +YLC +G+T+KAE  FRQLM+ GVQD + F  L+ G+  EG S+  
Sbjct  464   SSIELEASAYNPMIEYLCNHGQTEKAEVFFRQLMKKGVQDSVAFNNLMCGHAKEGNSDSA  523

Query  1659  HELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTE  1838
              E+L  M RR    + ++Y  L+   L +G+P  A   L+ ML+  H+P   +F S++  
Sbjct  524   FEILRIMGRRGVPGEADSYRLLINSYLSKGEPADAKTALDSMLEGGHIPEASLFRSVMES  583

Query  1839  LVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVN  2018
             L +       + ++  M+ K +++N++L    +  LF  G  E A   +  L  +G    
Sbjct  584   LFQDGRVQTASRVMKSMVEKGVKENMDLVAKILETLFMRGHVEEALGRIDLLMQSGCTPQ  643

Query  2019  MQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELV  2198
                L+  L++  K   A  LL F L+   +V       VL AL +A +   A+ +  +++
Sbjct  644   FDSLLSVLAEKGKTIAALKLLDFCLERDCNVDFSSYDKVLDALLEAGKTLNAYSILCKIM  703

Query  2199  ERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPR  2306
             E+      +  +DL   L  EG +K+A+ ++ RM R
Sbjct  704   EKGGVSDWSSTKDLIKSLNQEGNTKQADILS-RMIR  738



>gb|ACU25618.1| pentatricopeptide repeat-containing protein [Glandularia dissecta]
Length=484

 Score =   318 bits (815),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 272/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKZGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMXRLSVPTEAGHYGVLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAETLVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSSLFRSVMESL  483



>ref|XP_010529884.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Tarenaya hassleriana]
Length=756

 Score =   326 bits (836),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 192/637 (30%), Positives = 343/637 (54%), Gaps = 15/637 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKGFALTSQ-CYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R ++    AL+FF W+E+ G     +  + +M+E+LG  + LN AR  L  +P+
Sbjct  119   NVLHGARKVE---HALQFFRWSERSGLIRHDRDTHMKMIEMLGRVQKLNHARCILLEMPE  175

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    V  +   F  LI +Y  AG+ QES+K+F  MK +G++ ++ +++ LF ++++RGR
Sbjct  176   K---GVEWDEDMFVVLIDSYGKAGIIQESVKIFQKMKELGVNRTIKSYDALFKVILRRGR  232

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F+ ML + G++P  +T+NI++ G  ++  ++   RF+++M      PDV+TYN
Sbjct  233   YMMAKRYFNAMLSS-GIEPTRHTYNIMLWGFFLSLRLETATRFYEDMNNRGILPDVVTYN  291

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+  A  +   M  KG ++ P+VV+YTT+++GY   ++V++ L + +EM 
Sbjct  292   TMINGFYRFKKMGEAEKLFVEM--KGKNIEPSVVSYTTMIKGYVAVERVDDGLRMLEEMK  349

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G EPN+ TY+TL+ GL  A K  + K + K          D   F  L+ + C  G+L
Sbjct  350   SFGIEPNATTYSTLLPGLCAAGKMTEAKNILKEMMARHIAPNDNSIFLDLLVSQCKAGDL  409

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA +  + M+ LN   ++  Y +LI   C+   +  A K  D+L +   +L       +
Sbjct  410   VAASDVLKAMATLNVPAEAGHYGVLIENFCKANAYNRAVKLLDKLVEKEIVLRHQSSLEM  469

Query  1497  VA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
              A AYNP+ +YLC NG+T KAE  FRQLM+ GVQD   F +L+ G+  EG  +  +E+L 
Sbjct  470   EASAYNPIIEYLCNNGQTSKAEVFFRQLMKKGVQDQEAFNSLLRGHAKEGNPDSSYEILK  529

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    +   YE L+E  + +G+P  A   ++ M++  H+P   +F S++  L  ++
Sbjct  530   IMSRRGVPREANAYEMLIESYMSKGEPADAKTAMDSMIEDGHIPDASLFRSVMDSLF-ED  588

Query  1854  CALECADLVVLMLVKK---IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
               ++ A  V+ ++++K   +++N+ L    +  L   G  E A   +  L  NG+ +++ 
Sbjct  589   GRVQTASRVMTVMIEKNVGVKENMELVAKILEALLMRGHVEEALGRIDLLTQNGHSLDLD  648

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  LS+  K   A  LL F L+   ++       VL +L  + +   A+    +++E+
Sbjct  649   GLLSVLSEKGKTIPALKLLDFGLERDYNIEFSSYDKVLDSLLASGKTLNAYSALCKIMEK  708

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAKRMPRLEG  2315
                      ++L   L  EG +K+A+ +++ +   +G
Sbjct  709   GGITDWKSCDELIKSLNQEGNTKQADVLSRMIKNKKG  745



>ref|XP_007158766.1| hypothetical protein PHAVU_002G180100g [Phaseolus vulgaris]
 gb|ESW30760.1| hypothetical protein PHAVU_002G180100g [Phaseolus vulgaris]
Length=728

 Score =   325 bits (833),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 194/630 (31%), Positives = 339/630 (54%), Gaps = 18/630 (3%)
 Frame = +3

Query  450   TPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEA  626
             +P  AL+F+ W E+ G FA T     +++++LG    LN AR  L     R+  A   +A
Sbjct  96    SPEHALQFYRWVERAGLFAHTPDTTLKIVQILGRYSKLNHARCILLD-NTRAREAATEDA  154

Query  627   RFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDE  806
               F SLI +Y  AG+ QES+KLF  MK +G+  ++ +++ LF ++++RGR  M    ++ 
Sbjct  155   --FVSLIDSYGRAGIVQESVKLFQKMKELGVERTIKSYDALFKVILRRGRYMMAKRYYNA  212

Query  807   MLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAG  986
             ML+  GV+P  +T+NIL+ G  ++  +D   RF++EM      PDV+TYNT+++G  R  
Sbjct  213   MLRE-GVEPTRHTYNILLWGMFLSLRLDTAVRFYEEMNSRGVLPDVVTYNTLINGYFRFK  271

Query  987   KVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVT  1166
             KVE A  +   M  KG D+ PNV+++TT+++GY    ++++A+ VF++M + G +PN+VT
Sbjct  272   KVEDAEKLFVEM--KGRDIVPNVISFTTMLKGYVAAGRIDDAMKVFEDMKNCGIKPNAVT  329

Query  1167  YNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             ++TL+ GL +A K  + +++ +   E      D   F  L+      G+L AA +  + M
Sbjct  330   FSTLLPGLCDAEKTVEARDVLREMVERYIAPKDNSVFMKLLSVQSKSGDLDAAADVLKAM  389

Query  1347  SILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVA------AY  1508
               L+   ++  Y +LI   C+  + + AEK  D+L +   +      RP  A      +Y
Sbjct  390   IRLSIPTEAGHYGVLIESFCKANEHDKAEKLLDKLIEKEIV-----SRPQNAFEMEASSY  444

Query  1509  NPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRR  1688
             N M +YLC++G+T KAE+ FRQL++ GVQD + F +LI G+  EG  +   E++  M RR
Sbjct  445   NLMIEYLCDHGRTSKAERFFRQLLKKGVQDSVAFNSLIRGHSKEGNPDSAFEIIKIMGRR  504

Query  1689  NFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALEC  1868
                 D ++Y  L+E  L++G+P  A   L+ ML+S HLP + ++  ++  L         
Sbjct  505   AVPRDADSYRLLIESYLRKGEPADAKTALDSMLESGHLPESSLYRLVMESLFNDGRVQTA  564

Query  1869  ADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQ  2048
             + ++  M+ K ++++++L +  +  L   G  E A   +  L  NG   +   L+  L +
Sbjct  565   SRVMKSMVEKGVKEHMDLVSKILEALLMRGHVEEALGRIDLLMHNGCEPDFDHLLSILCE  624

Query  2049  GKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNC  2228
              +K   A  LL F L+    +   +   VL  L    +   A+ +  +++E++       
Sbjct  625   KEKTIAALKLLDFVLERDCIIDFSLYDKVLDTLLAVGKTLNAYSILCKILEKRGSTDWRS  684

Query  2229  LEDLRLRLEVEGRSKEAEFVAKRMPRLEGA  2318
              E+L   L  EG +K+A+ +++     +G 
Sbjct  685   REELIKSLNHEGNTKQADVLSRMFKGTDGG  714



>ref|XP_010274571.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
isoform X1 [Nelumbo nucifera]
Length=458

 Score =   224 bits (572),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S+AWS +AK L VG + S++QLWDAETS++VR L+GHE RVG +AWNGH+LTSGS D
Sbjct  184   YPTSVAWSQNAKMLAVGLSCSELQLWDAETSQLVRRLEGHENRVGILAWNGHLLTSGSRD  243

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             R II+HDVR   +L S ++AH  EVCGLKWS  GN L SGGNDN+++IW+   M S  +L
Sbjct  244   RYIINHDVRSRRNLTSCIRAHNEEVCGLKWSSRGNLLASGGNDNIIHIWEASNMRSSSFL  303

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSKNLV  2691
             HRF +H +AVKA AW PY +++LASGGGT D CIK+W+ + G C++S  +K  V
Sbjct  304   HRFTEHHSAVKAFAWSPYEFNILASGGGTNDRCIKIWNSQTGKCLNSIDTKAQV  357


 Score =   144 bits (364),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGLQWN+HH E+LSGHGF        KLCLW+YPS+SKI  S  H SR LHL+QSPDG
Sbjct  356   QVCGLQWNRHHNEILSGHGFSLHQHDQTKLCLWKYPSLSKIGASPRHESRVLHLAQSPDG  415

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA  DETLRFWE FGPP+ D SR +D D+LLS K   IR
Sbjct  416   LTVVSAETDETLRFWETFGPPRTDNSRLTDLDSLLSFKRFQIR  458


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 83/197 (42%), Gaps = 75/197 (38%)
 Frame = -2

Query  3918  RLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF  3739
             RL+  WY P RLLS+P +YDFP                                      
Sbjct  3     RLELDWYSPRRLLSSPMKYDFP--------------------------------------  24

Query  3738  *FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGN  3559
                   GDRFIPNRSLMDLD   +LLT+ +KE   S  +                     
Sbjct  25    ------GDRFIPNRSLMDLDHVRSLLTSTTKESSGSMLD---------------------  57

Query  3558  WELWVSPFCMKGE--YRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE  3385
                  SP   K    YR+R+E  L LD EG+PFRMLVFRGSPK  R+S+   D  ++   
Sbjct  58    -----SPANSKFNDLYRKRVEENLTLDSEGKPFRMLVFRGSPKTCRRSLCTTDSTQQEKL  112

Query  3384  ESFSCTDVNKQSRAFPK  3334
             ES       KQ R FPK
Sbjct  113   ESLENA---KQFRQFPK  126



>gb|KDO50689.1| hypothetical protein CISIN_1g005856mg [Citrus sinensis]
Length=662

 Score =   323 bits (828),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 195/626 (31%), Positives = 335/626 (54%), Gaps = 13/626 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F    + + +M+E+LG    LN AR  L  +PK+    V  +
Sbjct  34    KNSEHALQFFRWVERAGLFNHDRETHLKMIEILGRVGKLNHARCILLDMPKK---GVQWD  90

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI++Y   G+ QES+K+F  MK +G+  SV +++ LF ++++RGR  M    F+
Sbjct  91    EDMFEVLIESYGKKGIVQESVKIFDIMKQLGVERSVKSYDALFKLILRRGRYMMAKRYFN  150

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +T+N+++ G  ++  ++   RFF++M+      DV+TYNT+++G  R 
Sbjct  151   KMLSE-GIEPTRHTYNVMLWGFFLSLKLETAIRFFEDMKSRGISLDVVTYNTMINGYNRF  209

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A  +   M +K  ++ P V++YTT+++GY   ++ ++AL +F EM     +PN+V
Sbjct  210   KKMDEAEKLFAEMKEK--NIEPTVISYTTMIKGYVAVERADDALRIFDEMKSFDVKPNAV  267

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAF  1337
             TY  L+ GL +A K  +V+++ +   E  R++P  D   F  L+   C  G+L AA +  
Sbjct  268   TYTALLPGLCDAGKMVEVQKVLREMVE--RYIPPKDNSVFMKLLGVQCKSGHLNAAADVL  325

Query  1338  EKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAA-YNP  1514
             + M  L+   ++  Y ILI   C+   ++ A K  D+L +   +L       + A+ YNP
Sbjct  326   KAMIRLSIPTEAGHYGILIENFCKAEMYDRAIKLLDKLVEKEIILRPQSTLDMEASSYNP  385

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M ++LC NG+T KAE  FRQLM+ GV DP+ F  LI G+  EG  +   E++  M RR  
Sbjct  386   MIQHLCHNGQTGKAEIFFRQLMKKGVLDPVAFNNLIRGHSKEGNPDSAFEIVKIMGRRGV  445

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECAD  1874
               D + Y  L+E  L++G+P  A   L+ M++  H P + +F S++  L +       + 
Sbjct  446   PRDADAYICLIESYLRKGEPADAKTALDSMIEDGHSPASSLFRSVMESLFEDGRVQTASR  505

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             ++  M+ K +++N++L    +  L   G  E A   +  +  +G + N   L+  LS+  
Sbjct  506   VMKSMVEKGVKENLDLVAKILEALLMRGHVEEALGRIDLMMQSGSVPNFDSLLSVLSEKG  565

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
             K   A  LL F L     + +     VL AL  A +   A+ + ++++E+         +
Sbjct  566   KTIAAVKLLDFCLGRDCIIDLASYEKVLDALLAAGKTLNAYSILFKIMEKGGVTDWKSSD  625

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPRLE  2312
              L   L  EG +K+A+ ++ RM R E
Sbjct  626   KLIAGLNQEGNTKQADILS-RMIRGE  650



>gb|KDO50690.1| hypothetical protein CISIN_1g005856mg [Citrus sinensis]
Length=666

 Score =   323 bits (828),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 195/626 (31%), Positives = 335/626 (54%), Gaps = 13/626 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F    + + +M+E+LG    LN AR  L  +PK+    V  +
Sbjct  34    KNSEHALQFFRWVERAGLFNHDRETHLKMIEILGRVGKLNHARCILLDMPKK---GVQWD  90

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI++Y   G+ QES+K+F  MK +G+  SV +++ LF ++++RGR  M    F+
Sbjct  91    EDMFEVLIESYGKKGIVQESVKIFDIMKQLGVERSVKSYDALFKLILRRGRYMMAKRYFN  150

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +T+N+++ G  ++  ++   RFF++M+      DV+TYNT+++G  R 
Sbjct  151   KMLSE-GIEPTRHTYNVMLWGFFLSLKLETAIRFFEDMKSRGISLDVVTYNTMINGYNRF  209

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A  +   M +K  ++ P V++YTT+++GY   ++ ++AL +F EM     +PN+V
Sbjct  210   KKMDEAEKLFAEMKEK--NIEPTVISYTTMIKGYVAVERADDALRIFDEMKSFDVKPNAV  267

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAF  1337
             TY  L+ GL +A K  +V+++ +   E  R++P  D   F  L+   C  G+L AA +  
Sbjct  268   TYTALLPGLCDAGKMVEVQKVLREMVE--RYIPPKDNSVFMKLLGVQCKSGHLNAAADVL  325

Query  1338  EKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAA-YNP  1514
             + M  L+   ++  Y ILI   C+   ++ A K  D+L +   +L       + A+ YNP
Sbjct  326   KAMIRLSIPTEAGHYGILIENFCKAEMYDRAIKLLDKLVEKEIILRPQSTLDMEASSYNP  385

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M ++LC NG+T KAE  FRQLM+ GV DP+ F  LI G+  EG  +   E++  M RR  
Sbjct  386   MIQHLCHNGQTGKAEIFFRQLMKKGVLDPVAFNNLIRGHSKEGNPDSAFEIVKIMGRRGV  445

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECAD  1874
               D + Y  L+E  L++G+P  A   L+ M++  H P + +F S++  L +       + 
Sbjct  446   PRDADAYICLIESYLRKGEPADAKTALDSMIEDGHSPASSLFRSVMESLFEDGRVQTASR  505

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             ++  M+ K +++N++L    +  L   G  E A   +  +  +G + N   L+  LS+  
Sbjct  506   VMKSMVEKGVKENLDLVAKILEALLMRGHVEEALGRIDLMMQSGSVPNFDSLLSVLSEKG  565

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
             K   A  LL F L     + +     VL AL  A +   A+ + ++++E+         +
Sbjct  566   KTIAAVKLLDFCLGRDCIIDLASYEKVLDALLAAGKTLNAYSILFKIMEKGGVTDWKSSD  625

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPRLE  2312
              L   L  EG +K+A+ ++ RM R E
Sbjct  626   KLIAGLNQEGNTKQADILS-RMIRGE  650



>ref|XP_010274573.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
isoform X3 [Nelumbo nucifera]
Length=372

 Score =   224 bits (571),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S+AWS +AK L VG + S++QLWDAETS++VR L+GHE RVG +AWNGH+LTSGS D
Sbjct  98    YPTSVAWSQNAKMLAVGLSCSELQLWDAETSQLVRRLEGHENRVGILAWNGHLLTSGSRD  157

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             R II+HDVR   +L S ++AH  EVCGLKWS  GN L SGGNDN+++IW+   M S  +L
Sbjct  158   RYIINHDVRSRRNLTSCIRAHNEEVCGLKWSSRGNLLASGGNDNIIHIWEASNMRSSSFL  217

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSKNLV  2691
             HRF +H +AVKA AW PY +++LASGGGT D CIK+W+ + G C++S  +K  V
Sbjct  218   HRFTEHHSAVKAFAWSPYEFNILASGGGTNDRCIKIWNSQTGKCLNSIDTKAQV  271


 Score =   144 bits (364),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGLQWN+HH E+LSGHGF        KLCLW+YPS+SKI  S  H SR LHL+QSPDG
Sbjct  270   QVCGLQWNRHHNEILSGHGFSLHQHDQTKLCLWKYPSLSKIGASPRHESRVLHLAQSPDG  329

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSA  DETLRFWE FGPP+ D SR +D D+LLS K   IR
Sbjct  330   LTVVSAETDETLRFWETFGPPRTDNSRLTDLDSLLSFKRFQIR  372



>ref|XP_010111755.1| hypothetical protein L484_008414 [Morus notabilis]
 gb|EXC31617.1| hypothetical protein L484_008414 [Morus notabilis]
Length=768

 Score =   326 bits (835),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 194/627 (31%), Positives = 331/627 (53%), Gaps = 11/627 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ G F    + + +++E+L     LN AR  L  +PK
Sbjct  129   NVLHGAR---NSDHALQFFRWVERSGLFNHDRETHLKIIEILTRASKLNHARCILLDMPK  185

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +S   V  +   F   I  Y  AG+ QES+++F  MK +G+  SV +++ LF ++++RGR
Sbjct  186   KS---VQWDEDLFVLFIDGYGKAGIVQESVRMFNKMKELGVERSVKSYDALFKVILRRGR  242

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F+ M+   G++P  +T+NI++ G  ++  ++   RF+++M+     PDV+TYN
Sbjct  243   YMMAKRYFNAMINE-GIEPTKHTYNIMLWGFFLSLRLETAKRFYEDMKNRGVWPDVVTYN  301

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R   ++ A  +   M  KG +++P V++YTT+++GY    +V++ L +F+EM 
Sbjct  302   TMINGYNRFKMMDEAEKMFVEM--KGRNIAPTVISYTTMIKGYVSIGRVDDGLRLFEEMK  359

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN+VTY TL+ GL +A K  + + + K   +      D   F  L+ + C  G+L
Sbjct  360   SFGIKPNAVTYTTLLPGLCDAEKMSEARTMLKEMVDRYIAPKDNSIFLRLLSSQCKVGDL  419

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA +  + M  L+   ++  Y ILI   C+   ++ A K  D+L +   +L       +
Sbjct  420   DAAADVLKAMIRLSIPTEAGHYGILIENFCKAAVYDRAVKLLDKLIEKEIVLRPQSSTEM  479

Query  1497  VA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
              A AYN M ++LC +G+T KAE  FRQLM+ GVQDP+ F  LI G+  EG  +   E+L 
Sbjct  480   EASAYNAMIQFLCNHGQTGKAEIFFRQLMKKGVQDPVAFNNLIRGHSKEGNPDSAFEILK  539

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    D ++Y  L++  L +G+P  A   L+ M+++ HLP + +F S++  L +  
Sbjct  540   IMGRRGVARDADSYRLLIKSYLSKGEPADAKTALDSMIENDHLPESSLFRSVMESLYEDG  599

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
              A   + ++  M+ K +++N++L    +  L   G  E A   +  L  +G   N   L+
Sbjct  600   RAQTASRVMKSMIEKGVKENMDLVAKILEALLVRGHVEEALGRIDLLMQSGCAPNFDSLL  659

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               L +  K   A  LL F L+    V       VL AL  A +   A+ +  +++ +   
Sbjct  660   SVLCEKGKTIAALKLLDFCLERDYVVDFSSYDKVLDALLAAGKTLNAYSILCKIMGKGGV  719

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                +  EDL   L  EG +K+A+ +++
Sbjct  720   TDWSGCEDLIKSLNKEGNTKQADIISR  746



>gb|KDO50688.1| hypothetical protein CISIN_1g005856mg [Citrus sinensis]
Length=673

 Score =   323 bits (827),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 195/626 (31%), Positives = 335/626 (54%), Gaps = 13/626 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F    + + +M+E+LG    LN AR  L  +PK+    V  +
Sbjct  34    KNSEHALQFFRWVERAGLFNHDRETHLKMIEILGRVGKLNHARCILLDMPKK---GVQWD  90

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI++Y   G+ QES+K+F  MK +G+  SV +++ LF ++++RGR  M    F+
Sbjct  91    EDMFEVLIESYGKKGIVQESVKIFDIMKQLGVERSVKSYDALFKLILRRGRYMMAKRYFN  150

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +T+N+++ G  ++  ++   RFF++M+      DV+TYNT+++G  R 
Sbjct  151   KMLSE-GIEPTRHTYNVMLWGFFLSLKLETAIRFFEDMKSRGISLDVVTYNTMINGYNRF  209

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A  +   M +K  ++ P V++YTT+++GY   ++ ++AL +F EM     +PN+V
Sbjct  210   KKMDEAEKLFAEMKEK--NIEPTVISYTTMIKGYVAVERADDALRIFDEMKSFDVKPNAV  267

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAF  1337
             TY  L+ GL +A K  +V+++ +   E  R++P  D   F  L+   C  G+L AA +  
Sbjct  268   TYTALLPGLCDAGKMVEVQKVLREMVE--RYIPPKDNSVFMKLLGVQCKSGHLNAAADVL  325

Query  1338  EKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAA-YNP  1514
             + M  L+   ++  Y ILI   C+   ++ A K  D+L +   +L       + A+ YNP
Sbjct  326   KAMIRLSIPTEAGHYGILIENFCKAEMYDRAIKLLDKLVEKEIILRPQSTLDMEASSYNP  385

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M ++LC NG+T KAE  FRQLM+ GV DP+ F  LI G+  EG  +   E++  M RR  
Sbjct  386   MIQHLCHNGQTGKAEIFFRQLMKKGVLDPVAFNNLIRGHSKEGNPDSAFEIVKIMGRRGV  445

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECAD  1874
               D + Y  L+E  L++G+P  A   L+ M++  H P + +F S++  L +       + 
Sbjct  446   PRDADAYICLIESYLRKGEPADAKTALDSMIEDGHSPASSLFRSVMESLFEDGRVQTASR  505

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             ++  M+ K +++N++L    +  L   G  E A   +  +  +G + N   L+  LS+  
Sbjct  506   VMKSMVEKGVKENLDLVAKILEALLMRGHVEEALGRIDLMMQSGSVPNFDSLLSVLSEKG  565

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
             K   A  LL F L     + +     VL AL  A +   A+ + ++++E+         +
Sbjct  566   KTIAAVKLLDFCLGRDCIIDLASYEKVLDALLAAGKTLNAYSILFKIMEKGGVTDWKSSD  625

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPRLE  2312
              L   L  EG +K+A+ ++ RM R E
Sbjct  626   KLIAGLNQEGNTKQADILS-RMIRGE  650



>gb|ACU25615.1| pentatricopeptide repeat-containing protein [Glandularia araucana]
Length=481

 Score =   317 bits (811),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 169/475 (36%), Positives = 270/475 (57%), Gaps = 15/475 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFXWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKQGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + +   K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVXLKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMXRLSVPTEAGHYGVLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAETLVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  426   LKIMLRRKVDSEKSXYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSSLFRSVM  480



>gb|ACU25607.1| pentatricopeptide repeat-containing protein [Verbena hastata]
Length=484

 Score =   316 bits (810),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 270/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS     T   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---NTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GSGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGLLIEKFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P   AYNPM +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--NAYNPMIEYLCNNGQASKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25614.1| pentatricopeptide repeat-containing protein [Glandularia microphylla]
Length=484

 Score =   316 bits (810),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 272/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKQGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMVRLSVPTEAGHYGVLIENFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAETLVRQLLKLGVQDPTALNTLIRGHSQEGSPDSXFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25620.1| pentatricopeptide repeat-containing protein [Junellia spathulata]
Length=484

 Score =   316 bits (809),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 272/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSA---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFXVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI + C+ GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMTEARSILKEMMDKYLAPTDNSIFMRLISSQCNSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGVLIENFCKAGQYDQAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAEALVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25617.1| pentatricopeptide repeat-containing protein [Glandularia subincana]
Length=484

 Score =   315 bits (808),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 271/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNXIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGVLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25603.1| pentatricopeptide repeat-containing protein [Verbena macdougalii]
Length=484

 Score =   315 bits (808),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 271/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGLLIENFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQASKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y  L++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNLLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>ref|XP_010669847.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Beta vulgaris subsp. vulgaris]
Length=782

 Score =   325 bits (832),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 200/634 (32%), Positives = 335/634 (53%), Gaps = 13/634 (2%)
 Frame = +3

Query  414   ETTVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSI  590
             +  V++ I   ++   +L+FF W E+ G F    + + +++E LG    +N AR  L  +
Sbjct  139   QNLVLNVIENARSSEHSLQFFRWVERSGLFKHDRETHMKIIERLGRASKVNHARCILMDM  198

Query  591   PKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKR  770
             P +S   V  +   F  LI +Y   G+ QES+K+F  MK +G+  SV +++ LF  +++R
Sbjct  199   PSKS---VEWDEDMFVVLIDSYGRNGIVQESVKIFQQMKEMGVERSVKSYDALFKAILRR  255

Query  771   GRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVIT  950
             GR  M    +++ML   G+ P  +TFN+L+ G  +   V+   RF+++M      PDV+T
Sbjct  256   GRYMMAKRYYNKMLGE-GIAPTKHTFNLLLWGFFLCQKVETANRFYEDMSSRGIMPDVVT  314

Query  951   YNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKE  1130
             YNT+++G  R  K+E A      M  KG +++P V++YTT+++GY    KV++AL +F+E
Sbjct  315   YNTMINGFYRLKKLEEAEKFFIEM--KGRNIAPTVISYTTMIKGYVSMGKVDDALRMFEE  372

Query  1131  MVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDG  1310
             M   G  PN++TY TL+ GL +A K   V+ +     E      D   F  L++  C  G
Sbjct  373   MKGFGINPNALTYTTLLPGLCDAMKMSDVQMILNEMVERHTPPKDNSVFIKLLNCQCESG  432

Query  1311  NLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDA  1481
             NL AA +  + M  L+   ++  Y +LI   C    ++ A K  D+L +   +L   S  
Sbjct  433   NLDAAADVLKAMIRLSIPTEAGHYGVLIENFCNAKVYDRAVKLVDKLIEKDIILRPQSTL  492

Query  1482  GCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGH  1661
               +P   +YN + +YLC NG+T+KAE +FRQLM+ GVQDP+ F  LI G+  E   E   
Sbjct  493   DMQPT--SYNGIIEYLCNNGQTEKAEILFRQLMKKGVQDPVAFNNLIRGHSREHNPEGAF  550

Query  1662  ELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             E+L  M+RR    + + Y  L+   L++G+P  A   L+ M+++ HLP + +F +++  L
Sbjct  551   EMLNIMIRRGVSSEADAYRLLIHSFLEKGEPADAKTVLDSMIENDHLPDSALFRTVMEGL  610

Query  1842  VKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNM  2021
              K       + ++  ML K + +N++L+T  +  LF  G  E A   +  L  +G    +
Sbjct  611   FKDERVQTASRVMKTMLEKGVTENMDLATKILEALFMRGHVEEALGRIELLMQSGCAPEI  670

Query  2022  QELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVE  2201
              +L+  LSQ  K   A  LL F+L+   ++       VL AL  A +   A+ +  ++  
Sbjct  671   DKLLSVLSQKGKTIAALKLLDFALERDFTLDFSSYDQVLDALLSAGKTLNAYSILCKISM  730

Query  2202  RQIEL-PLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
             +   L      + L   L  EG +K+A+ +++ M
Sbjct  731   KGGGLTDQKSFKSLIKTLNEEGNTKQADVLSRMM  764



>gb|ACU25604.1| pentatricopeptide repeat-containing protein [Verbena halei]
Length=476

 Score =   315 bits (807),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 270/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   A  FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  9     NVLHSS---KTSEHAFHFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  65

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  66    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  122

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  123   YMMGKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETAIRFFEDMKSREISPDVVTYN  181

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  182   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  239

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  240   GFGTKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  299

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  300   DAAADVLKAMIRLSVPTEAGHYGLLIENFCKAGQYDKAVKLLDKLIEKDIMLRPQSTLHL  359

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +A+NPM +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  360   EP--SAHNPMIEYLCNNGQASKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  417

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  418   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  475



>gb|ACU25636.1| pentatricopeptide repeat-containing protein [Tamonea boxiana]
Length=484

 Score =   315 bits (808),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 170/469 (36%), Positives = 268/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KKSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN++I G  +   V+   RFF++M+  E  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNVMIWGFFLCGKVETANRFFEDMKXREISPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKIEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDRVDDALTLLEEMKGFGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  +   + K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEASGILKEMVDKYIAPKDNSIFLRLISGQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ GD+E A K  D+L +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGDYEKAIKLLDKLIEKDIVLRPQSSLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GVQDP    TLI G+  EG  +   ELL  MLRR  
Sbjct  375   LVEYLCNNGQTAKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFELLKIMLRRKI  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +  +Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  435   DSEKSSYDSLVQSYLKKSEPADAKAALDSMIENGHLPDSSLFRSVMESL  483



>gb|ACU25640.1| pentatricopeptide repeat-containing protein [Stachytarpheta cayennensis]
Length=484

 Score =   315 bits (807),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 273/476 (57%), Gaps = 11/476 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSA---KNSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y  AG+ QES+K+F  M+ +G+  ++ +++ LF ++++RGR
Sbjct  74    K---GLEWDEDLWVLMIDSYGKAGIVQESVKMFQKMEELGVERTIKSYDALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN+++ G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMMWGFFLSGKVETANRFFEDMKSREIMPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+V+G CR  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMVNGYCRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDRVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   E      D   F  LI   C  G+L
Sbjct  248   GFGMKPNAITYSTLLPGLCNAEKMSEARSILKEMVEKYIAPTDNSIFMRLISGQCKAGDL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA    + M  L+   ++  Y +LI   C+ G+++ A K  D++ +   +L       +
Sbjct  308   DAAANVLKAMIRLSVPTEAGHYGVLIENYCKAGEYDKAIKLLDKVIEKDIILRPQSTLHM  367

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC NG+T KAE + RQLM++GVQDP    TLI G+  EG  +   ELL 
Sbjct  368   ESSAYNPLIEYLCNNGQTAKAEALVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFELLK  427

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
              MLRR    +  +Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  428   IMLRRKVDSEQSSYDSLVQSYLKKNEPADAKAALDSMIENGHLPDSSLFRSVMESL  483



>gb|ACU25606.1| pentatricopeptide repeat-containing protein [Verbena canescens]
Length=484

 Score =   315 bits (807),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 171/478 (36%), Positives = 271/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFLRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y ILI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGILIENFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYN M +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNLMIEYLCNNGQASKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>ref|XP_006428766.1| hypothetical protein CICLE_v10011107mg [Citrus clementina]
 gb|ESR42006.1| hypothetical protein CICLE_v10011107mg [Citrus clementina]
Length=787

 Score =   324 bits (830),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 195/626 (31%), Positives = 335/626 (54%), Gaps = 13/626 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+ G F    + + +M+E+LG    LN AR  L  +PK+    V  +
Sbjct  155   KNSEHALQFFRWVERAGLFNHDRETHLKMIEILGRVGKLNHARCILLDMPKK---GVQWD  211

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                F  LI++Y   G+ QES+K+F  MK +G+  SV +++ LF ++++RGR  M    F+
Sbjct  212   EDLFEVLIESYGKKGIVQESVKIFDIMKQLGVERSVKSYDALFKLILRRGRYMMAKRYFN  271

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +T+N+++ G  ++  ++   RFF++M+     PDV+TYNT+++G  R 
Sbjct  272   KMLSE-GIEPTRHTYNVMLWGFFLSLKLETAIRFFEDMKSRGISPDVVTYNTMINGYNRF  330

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A  +   M +K  ++ P V++YTT+++GY   ++ ++AL +F EM     +PN+V
Sbjct  331   KKMDEAEKLFAEMKEK--NIEPTVISYTTMIKGYVAVERADDALRIFDEMKSFDVKPNAV  388

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAF  1337
             TY  L+ GL +A K  +V+++ +   E  R++P  D   F  L+   C  G+L AA +  
Sbjct  389   TYTALLPGLCDAGKMVEVQKVLREMVE--RYIPPKDNSVFMKLLDVQCKSGHLNAAADVL  446

Query  1338  EKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAA-YNP  1514
             + M  L+   ++  Y ILI   C+   ++ A K  D+L +   +L       + A+ YN 
Sbjct  447   KAMIRLSIPTEAGHYGILIENFCKAEMYDRAIKLLDKLVEKEIILRPQSTLDMEASSYNL  506

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M ++LC NG+T KAE  FRQLM+ GV DP+ F  LI G+  EG  +   E++  M RR  
Sbjct  507   MIQHLCHNGQTGKAEIFFRQLMKKGVLDPVAFNNLIRGHSKEGNPDSAFEIVKIMGRRGV  566

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECAD  1874
               D + Y  L+E  L++G+P  A   L+ M++  H P + +F S++  L +       + 
Sbjct  567   PRDADAYICLIESYLRKGEPADAKTALDSMIEDGHSPASSLFRSVMESLFEDGRVQTASR  626

Query  1875  LVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGK  2054
             ++  M+ K +++N++L    +  L   G  E A   +  +  +G + N   L+  LS+  
Sbjct  627   VMKSMVEKGVKENLDLVAKILEALLMRGHVEEALGRIDLMMQSGSVPNFDSLLSVLSEKG  686

Query  2055  KLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLE  2234
             K   A  LL F L     + +     VL AL  A +   A+ + ++++E+         +
Sbjct  687   KTIAAVKLLDFCLGRDCIIDLASYEKVLDALLAAGKTLNAYSILFKIMEKGGVTDWKSSD  746

Query  2235  DLRLRLEVEGRSKEAEFVAKRMPRLE  2312
              L   L  EG +K+A+ ++ RM R E
Sbjct  747   KLIAGLNQEGNTKQADILS-RMIRGE  771



>gb|ACU25631.1| pentatricopeptide repeat-containing protein [Lampayo castellani]
Length=484

 Score =   314 bits (805),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 167/469 (36%), Positives = 269/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++M+RGR  M    F+
Sbjct  80    EDMWVLMIDSYGKEGIVQESVKLFQKMEELGVERTIKSYDALFKVIMRRGRFMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML + G++P  +TFN++I G  ++  V+   RFF++M+  E  PDVITYNT+++G  R 
Sbjct  140   KML-SXGIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFVEM--KGKNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMKGYGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI + C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSILKEMVDKYIAPTDNSIFMRLISSQCKAGNLDAAADVLKS  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G ++ A K  D+L +   ++   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGQYDQAVKLLDKLIEKDIIVRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GVQDP    TLI G+  EG  +   ELL  MLRR  
Sbjct  375   IVEYLCNNGQTSKAEALVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  435   GSEKSAYDSLVQSYLKKSEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25619.1| pentatricopeptide repeat-containing protein [Glandularia incisa]
Length=481

 Score =   314 bits (805),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 169/475 (36%), Positives = 268/475 (56%), Gaps = 15/475 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKZGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T ++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V+ AL + +EM 
Sbjct  190   TXINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDXALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCXSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMXRLSVPTEAGHYGVLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNP  +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPXIEYLCNNGQAXKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSSLFRSVM  480



>gb|ACU25612.1| pentatricopeptide repeat-containing protein [Verbena intermedia]
Length=484

 Score =   314 bits (805),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 270/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQXXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVBSEKSAYNSLVQSXLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25609.1| pentatricopeptide repeat-containing protein [Verbena bonariensis]
Length=484

 Score =   314 bits (805),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 270/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNXLFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVBSEKSAYNSLVQSXLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25610.1| pentatricopeptide repeat-containing protein [Verbena montevidensis]
Length=484

 Score =   313 bits (803),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 270/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIENFCKVGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMEXL  483



>gb|ACU25621.1| pentatricopeptide repeat-containing protein [Junellia seriphioides]
Length=484

 Score =   313 bits (802),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 272/478 (57%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSA---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF  +++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKAILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPARHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI + C+ GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAGKMIEARSILKEMMDKYLAPTDNSIFMRLISSQCNSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGVLIENFCKAGQYDQAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAEALVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYDSLVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25630.1| pentatricopeptide repeat-containing protein [Dipyrena glaberrima]
Length=484

 Score =   313 bits (801),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/469 (36%), Positives = 268/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNAEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    XDMWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ PNVVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFVEM--KGKNIEPNVVTYTTLIKGYVSVDQVDDALRLVEEMKGYGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI + C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSILKEMLDKYIAPTDNSIFMRLISSQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S     P  +AYN 
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGQYDQAVKLLDKLIEKDIILRPQSTLHMEP--SAYNX  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   ELL  MLRR  
Sbjct  375   MIEYLCNNGQXAKAETLVRQLLKLGVQDPTALNTLIRGHSREGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  435   DSEKSAYDSLVQSYLKKSEPXDAKAALDSMIENDHLPDSSLFRSVMESL  483



>ref|XP_004163187.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g37230-like [Cucumis sativus]
Length=760

 Score =   321 bits (823),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 193/627 (31%), Positives = 331/627 (53%), Gaps = 10/627 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V + +   K    AL FF W E+ G F    + +F+++E+LG    LN AR  L  +P  
Sbjct  124   VYNVLHAAKKSEHALNFFRWVERAGLFQHDRETHFKIIEILGRASKLNHARCILLDMP--  181

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
              N  V  +   F  LI++Y  AG+ QE++K+F  MK +G+  SV +++ LF  +M+RGR 
Sbjct  182   -NKGVQWDEDLFVVLIESYGKAGIVQEAVKIFQKMKELGVERSVKSYDALFKEIMRRGRY  240

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F+ ML   G++P  +T+N+++ G  ++  ++   RF+++M+     PDV+TYNT
Sbjct  241   MMAKRYFNAMLNE-GIEPIRHTYNVMLWGFFLSLRLETAKRFYEDMKSRGISPDVVTYNT  299

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G CR   +E A      M  KG +++P V++YTT+++GY    + ++AL +F+EM  
Sbjct  300   MINGYCRFKMMEEAEQFFTEM--KGKNIAPTVISYTTMIKGYVSVSRADDALRLFEEMKA  357

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGNL  1316
              G +PN +TY+TL+ GL +A K  + +++         F P D   F  L+   C  G+L
Sbjct  358   AGEKPNDITYSTLLPGLCDAEKLPEARKILTEMVTR-HFAPKDNSIFMRLLSCQCKHGDL  416

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA+   + M  L+   ++  Y ILI   C+ G ++ A K  + L +   +L       +
Sbjct  417   DAAMHVLKAMIRLSIPTEAGHYGILIENCCKAGMYDQAVKLLENLVEKEIILRPQSTLEM  476

Query  1497  VA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
              A AYN + +YLC +G+T KA+  FRQL++ G+QD + F  LI G+  EG  +   E+L 
Sbjct  477   EASAYNLIIQYLCNHGQTGKADTFFRQLLKKGIQDEVAFNNLIRGHAKEGNPDLAFEMLK  536

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    D E+Y+ L++  L +G+P  A   L+ M+++ H P + +F S++  L    
Sbjct  537   IMGRRGVSRDAESYKLLIKSYLSKGEPADAKTALDSMIENGHSPDSALFRSVMESLFADG  596

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
                  + ++  ML K I +N++L    +  LF  G  E A   +  L +     +   L+
Sbjct  597   RVQTASRVMNSMLDKGITENLDLVAKILEALFMRGHDEEALGRINLLMNCNCPPDFNSLL  656

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               L +  K + A  LL F L+   ++       VL AL  A +   A+ +  +++E+   
Sbjct  657   SVLCEKGKTTSAFKLLDFGLERECNIEFSSYEKVLDALLGAGKTLNAYAILCKIMEKGGA  716

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                +  +DL   L  EG +K+A+ +++
Sbjct  717   KDWSSCDDLIKSLNQEGNTKQADILSR  743



>ref|XP_004149878.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Cucumis sativus]
 gb|KGN65270.1| hypothetical protein Csa_1G293020 [Cucumis sativus]
Length=760

 Score =   321 bits (823),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 193/627 (31%), Positives = 331/627 (53%), Gaps = 10/627 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V + +   K    AL FF W E+ G F    + +F+++E+LG    LN AR  L  +P  
Sbjct  124   VYNVLHAAKKSEHALNFFRWVERAGLFQHDRETHFKIIEILGRASKLNHARCILLDMP--  181

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
              N  V  +   F  LI++Y  AG+ QE++K+F  MK +G+  SV +++ LF  +M+RGR 
Sbjct  182   -NKGVQWDEDLFVVLIESYGKAGIVQEAVKIFQKMKELGVERSVKSYDALFKEIMRRGRY  240

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F+ ML   G++P  +T+N+++ G  ++  ++   RF+++M+     PDV+TYNT
Sbjct  241   MMAKRYFNAMLNE-GIEPIRHTYNVMLWGFFLSLRLETAKRFYEDMKSRGISPDVVTYNT  299

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G CR   +E A      M  KG +++P V++YTT+++GY    + ++AL +F+EM  
Sbjct  300   MINGYCRFKMMEEAEQFFTEM--KGKNIAPTVISYTTMIKGYVSVSRADDALRLFEEMKA  357

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGNL  1316
              G +PN +TY+TL+ GL +A K  + +++         F P D   F  L+   C  G+L
Sbjct  358   AGEKPNDITYSTLLPGLCDAEKLPEARKILTEMVTR-HFAPKDNSIFMRLLSCQCKHGDL  416

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA+   + M  L+   ++  Y ILI   C+ G ++ A K  + L +   +L       +
Sbjct  417   DAAMHVLKAMIRLSIPTEAGHYGILIENCCKAGMYDQAVKLLENLVEKEIILRPQSTLEM  476

Query  1497  VA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
              A AYN + +YLC +G+T KA+  FRQL++ G+QD + F  LI G+  EG  +   E+L 
Sbjct  477   EASAYNLIIQYLCNHGQTGKADTFFRQLLKKGIQDEVAFNNLIRGHAKEGNPDLAFEMLK  536

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    D E+Y+ L++  L +G+P  A   L+ M+++ H P + +F S++  L    
Sbjct  537   IMGRRGVSRDAESYKLLIKSYLSKGEPADAKTALDSMIENGHSPDSALFRSVMESLFADG  596

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
                  + ++  ML K I +N++L    +  LF  G  E A   +  L +     +   L+
Sbjct  597   RVQTASRVMNSMLDKGITENLDLVAKILEALFMRGHDEEALGRINLLMNCNCPPDFNSLL  656

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               L +  K + A  LL F L+   ++       VL AL  A +   A+ +  +++E+   
Sbjct  657   SVLCEKGKTTSAFKLLDFGLERECNIEFSSYEKVLDALLGAGKTLNAYAILCKIMEKGGA  716

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                +  +DL   L  EG +K+A+ +++
Sbjct  717   KDWSSCDDLIKSLNQEGNTKQADILSR  743



>ref|XP_010061750.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Eucalyptus grandis]
 gb|KCW68745.1| hypothetical protein EUGRSUZ_F02345 [Eucalyptus grandis]
Length=764

 Score =   321 bits (822),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 191/627 (30%), Positives = 330/627 (53%), Gaps = 11/627 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R       AL+FF W E+ G F    + + +++E LG    LN AR  L  +PK
Sbjct  125   NVLHGAR---NSEHALQFFRWVERAGLFRHDRETHLKIIETLGRASKLNHARCILLDMPK  181

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    V  +   F  +I++Y  AG+ QE++K+F  MK +G+S +V +++ +F ++++ GR
Sbjct  182   K---GVEWDEDLFIVMIESYGKAGIVQEAVKMFMKMKELGVSRTVNSYDAVFKVILRCGR  238

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M   LF+ ML   G++P  +T+NI+I G  ++  +    RFF++M      PDV+TYN
Sbjct  239   YMMAKRLFNAMLNE-GIEPARHTYNIMIWGFFLSMRLRTALRFFEDMSSRGISPDVVTYN  297

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K++ A  +   M  KG +++P V++YTT+++GY    +V++ L +  EM 
Sbjct  298   TMINGYYRFKKMDEAEKLFVEM--KGKNIAPTVISYTTMIKGYVSLGRVDDGLRLLDEMK  355

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN VTY+TL+ GL EA K  + + + K   E      D   F  L+   C+ G++
Sbjct  356   SYGIKPNDVTYSTLLPGLCEAEKMAEARSILKEIVERYMAPKDNSIFLRLLTCQCTSGDM  415

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA++  + M  L+   ++  Y +LI   C+   ++ A K  D+L +   +L       +
Sbjct  416   DAAVDVLKAMIRLSIPTEAGHYGVLIENFCKNNAYDRAIKLLDKLIEKEIILRPQNTLEM  475

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
                AYNPM +YLC +G+T KAE  FRQL++ GVQD + F ++I G+  EG      E+L 
Sbjct  476   GPEAYNPMIQYLCNHGQTGKAEIFFRQLLKKGVQDSVAFNSIICGHSKEGNPNAAFEILK  535

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQN  1853
              M RR    D  +Y+ L+E  L++G+P  A   L+ M++S ++P + V+ S++  L +  
Sbjct  536   IMDRRGVPRDAHSYKLLIESYLRKGEPADAKTALDNMIESGYVPDSSVYRSVMQSLFEDG  595

Query  1854  CALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELI  2033
                  +  +  M+ K + +N++L    +  L   G  E A   +  L  +G   +   L+
Sbjct  596   RVQTASRAMKSMVEKGVHENMDLVAKILEALLMRGHVEEAIGRMDLLMQSGCSPDFDNLL  655

Query  2034  VFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIE  2213
               LS+  K   A  LL F+L    ++       VL AL  + +   A+ +  +++E+   
Sbjct  656   SVLSEKGKTIAALKLLDFALDRDCTIDFSSYDKVLDALLGSGKTLNAYSILCKIMEKGGV  715

Query  2214  LPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                    DL   L  EG +K+A+ +++
Sbjct  716   SDWRSCGDLIKSLNQEGYTKQADVLSR  742



>gb|ACU25639.1| pentatricopeptide repeat-containing protein [Stachytarpheta cayennensis]
Length=484

 Score =   312 bits (799),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/476 (35%), Positives = 271/476 (57%), Gaps = 11/476 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSA---KNSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y  AG+ QES+K+F  M+ +G+  ++ +++ LF ++++RGR
Sbjct  74    K---GLEWDEDLWVLMIDSYGKAGIVQESVKMFQKMEELGVERTIKSYDALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN+++ G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMMWGFFLSGKVETANRFFEDMKSREIMPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+V+G CR  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL   +EM 
Sbjct  190   TMVNGYCRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDRVDDALRFVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI   C  G+L
Sbjct  248   GFGMKPNAITYSTLLPGLCNAEKMSEARSILKEMVDKYIAPTDNSIFMRLISGQCKAGDL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV  1496
              AA    + M  L+   ++  Y +LI   C+ G+++ A K  D++ +   +L       +
Sbjct  308   DAAANVLKAMIRLSVPTEAGHYGVLIENYCKAGEYDKAIKLLDKVIEKDIILRPQSTLHM  367

Query  1497  -VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLV  1673
               +AYNP+ +YLC NG+T KAE + RQLM++GVQDP    TLI G+  EG  +   ELL 
Sbjct  368   ESSAYNPLIEYLCNNGQTAKAEALVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFELLK  427

Query  1674  WMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
              MLRR    +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  428   IMLRRKVDSEQSAYDSLVQSYLKKNEPADAKAALDSMIENGHLPDSSLFRSVMESL  483



>gb|ACU25608.1| pentatricopeptide repeat-containing protein [Verbena hispida]
Length=484

 Score =   311 bits (798),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 269/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++ L + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDXLRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIENFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVBSEKSAYISLVQSXLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25616.1| pentatricopeptide repeat-containing protein [Glandularia flava]
Length=481

 Score =   311 bits (797),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 168/475 (35%), Positives = 268/475 (56%), Gaps = 15/475 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKQGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETXNRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGVLIENFCKVGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNP  +YLC NG+  KAE + RQL ++GVQDP    TLI G   EG  +   EL
Sbjct  368   EP--SAYNPXIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGXSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSXLFRSVM  480



>gb|ACU25629.1| pentatricopeptide repeat-containing protein [Aloysia virgata]
Length=484

 Score =   311 bits (797),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 266/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDMWVLMIDSYGKEGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGRFMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  + FN++I G  ++  V+   RFF++M+  E  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHXFNVMIWGFFLSGKVETANRFFEDMKSREISPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMDEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMKGYGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI + C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSILKEMVDKYMAPTDNSIFXRLISSQCKTGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G  + A K  D+L +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENFCKAGQHDKAVKLLDKLIEKDIILRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M +YLC NG+T KAE + RQL+++GVQDP    TLI G+  EG  +   ELL  MLRR  
Sbjct  375   MIEYLCNNGQTAKAEALVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S+   L
Sbjct  435   DSEKSAYDSLVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVXESL  483



>gb|ACU25602.1| pentatricopeptide repeat-containing protein [Verbena bracteata]
Length=484

 Score =   311 bits (796),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 269/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GN 
Sbjct  248   GFGIKPNTITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNP  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIXNFCKVGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|KEH37314.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=745

 Score =   319 bits (817),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 198/629 (31%), Positives = 334/629 (53%), Gaps = 19/629 (3%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             ++HS      P +ALKF+ W E+   F   +    +ML++L     LN AR  L  +PK+
Sbjct  109   ILHST-AAANPDQALKFYRWLERSNLFIHDTNTTLKMLQILTRYNKLNHARCILLDLPKK  167

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +P +   F +LI+ Y  AG+ QE++K+F          SV  ++ LF ++++RGR 
Sbjct  168   ---GLPYDEDMFVALIEGYGRAGIVQEAVKIFQKCD----QKSVKAYDALFKVILRRGRY  220

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M   +++ ML+  G++P  +T+NIL+ G  ++  +D   RF+ +M+    EPDV+TYNT
Sbjct  221   MMAKRVYNAMLRE-GIEPTRHTYNILLWGMFLSLKLDTAVRFYDDMKSRGIEPDVVTYNT  279

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             ++ G  R  KV+ A ++   M  KG +L PNV++YTT+++G+ +  KV+ A  VF+EM D
Sbjct  280   LIHGFFRFKKVDEAESLFVEM--KGKNLMPNVISYTTMLKGFVDVGKVDRAFEVFEEMKD  337

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGE-DGRFVP--DTCTFNTLIHTHCSDG  1310
              G +PN+VT+ TL+ GL +A   DK+ E     GE   R++   D   F  L+   C  G
Sbjct  338   CGIKPNAVTFTTLLPGLCDA---DKMVEAGNVLGEMVERYIAPKDNSVFMKLMECQCKGG  394

Query  1311  NLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL-SDAGC  1487
             NL AA++    M  L+   ++  Y +LI   C+   ++ AEK  D+L +   +L  +   
Sbjct  395   NLDAAVDVLNAMIRLSIPTEAGHYGVLIENFCKANVYDRAEKLLDKLIEKDIVLRPETSY  454

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
                 +AYN M  YLC+NGKT KAE  FRQLM+ GV DP+ F  L+ G+  EG  +   E+
Sbjct  455   EMEASAYNRMIGYLCDNGKTAKAEMFFRQLMKKGVLDPVAFNNLMCGHSKEGNPDSAFEI  514

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVK  1847
                M RR    D  +Y  L+E  L++G+P  A   L+ ML+  H P + ++ S++  L +
Sbjct  515   ATIMSRRKVHSDEYSYRLLIESYLRKGEPADAKTALDHMLEGGHEPNSSLYRSVMESLFE  574

Query  1848  QNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
                    + ++  M+ K ++ N++L +  +  LF  G  E A   +  L ++G   +   
Sbjct  575   DGRVQTASRVMKNMVEKGVKNNMDLVSKILEALFIRGHVEEALGRIDLLMNSGCEPDFDH  634

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  L + +K   A  LL F L+    +       VL  L  A +   A+ +  +++E++
Sbjct  635   LLSILCEKEKRIAALRLLDFVLERDIIIDFSNYDKVLDTLLAAGKTLNAYSILCKIMEKR  694

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                  +  ++L   L  +G +K+A+ +++
Sbjct  695   GATDWSSRDELIKSLNQQGNTKQADVLSR  723



>ref|XP_004488235.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Cicer arietinum]
Length=739

 Score =   318 bits (816),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 200/672 (30%), Positives = 357/672 (53%), Gaps = 23/672 (3%)
 Frame = +3

Query  297   KPKLSSRKKALALAELIKFQPWSPQTEsslsalagpslsETTVIHSI-RLLKTPRKALKF  473
             +P LS+ +  L +  +I  + W+  T    S  +     +++++++I   +  P +ALKF
Sbjct  63    QPTLSNPE--LTVIRMITNRAWT--TRLQNSIRSVVPKFDSSIVYNILHAITNPDQALKF  118

Query  474   FVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLEARFFNSLIK  650
             + W E+   F   +    +ML +L     LN AR  L  +PK++   +P +   F +LI+
Sbjct  119   YRWIERSNLFTHDTNTTLKMLHILTRYSKLNHARCILLDLPKKN---LPYDEDMFVALIE  175

Query  651   NYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVK  830
              Y  AG+ QE++K+F  +       S+ +++ LF ++++RGR  M    ++ ML+  G++
Sbjct  176   GYGRAGIVQEAVKIFQKLD----QKSIKSYDALFKVILRRGRYMMAKRYYNAMLRE-GIE  230

Query  831   PDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNV  1010
             P  +T+NIL+ G  ++  +D   RF+++M+     PDV+TYNT+++G  R  K + A N+
Sbjct  231   PTRHTYNILLWGMFLSLRLDTAIRFYEDMKSRGIVPDVVTYNTLINGYFRFKKFDEAENL  290

Query  1011  VKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGL  1190
                M  K  ++ PNV++YTT+++G  +  KV+ A+  F+EM   G +PN+VT+ TL+ GL
Sbjct  291   FAEM--KERNIVPNVISYTTMLKGCIDVGKVDRAIEFFEEMKSCGIKPNAVTFTTLLPGL  348

Query  1191  LEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSILNA  1361
              +    DK+ E  K  GE  +    P D   F  L++  C  GNL AA +  + M  L+ 
Sbjct  349   CDG---DKMVEAGKVLGEMVESYVAPKDNSVFMKLMNCQCKAGNLDAAADVLKAMIRLSI  405

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-VAAYNPMFKYLCEN  1538
               ++  Y +LI   C+   ++ AEK  D+L +   +L       +  +AYNPM +YLC+N
Sbjct  406   PTEAGHYGVLIENFCKVNGYDRAEKLLDKLIEKEIVLRPENSFEIEPSAYNPMIEYLCDN  465

Query  1539  GKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYE  1718
             G+T KAE  FRQLM+ GV D + F  LI G+  EG  +   E+   M RR    D ++Y+
Sbjct  466   GRTGKAETFFRQLMKKGVLDSVAFNNLIRGHSKEGNPDSALEIAKIMSRREVPRDEDSYK  525

Query  1719  SLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVK  1898
              L+E  L++G+P  A    + ML+  H P + ++ S++  L +       + ++  M+ K
Sbjct  526   LLVESYLRKGEPADAKTAFDHMLEGGHQPDSSLYRSVMESLFEDGRVQTASRVMKSMVEK  585

Query  1899  KIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDL  2078
              +++N++L +  +  L   G  E A   +  L  NG+  +   L+  L + +K   A  L
Sbjct  586   GVKENMDLVSKILEALLMRGHVEEALGRIALLMQNGFEPDFDHLLSILCEKEKTIAALRL  645

Query  2079  LLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEV  2258
             L F L+    +   I   VL AL  A +   A+ +  +++E++     +  ++L   L  
Sbjct  646   LDFVLEKDIIINFSIYDKVLDALFAAGKTLNAYSILCKILEKRGATDWSSRDELIKSLNQ  705

Query  2259  EGRSKEAEFVAK  2294
             +G +K+A+ +++
Sbjct  706   DGNTKQADILSR  717



>gb|ACU25628.1| pentatricopeptide repeat-containing protein [Xeroaloysia ovatifolia]
Length=484

 Score =   310 bits (795),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 167/469 (36%), Positives = 266/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  +  +++TLF ++++RGR  M    F+
Sbjct  80    EDMWVLMIDSYGKAGIVQESVKLFQKMEELGVERTTKSYDTLFKVILRRGRFMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN++I G  ++  V+   RFF +M+  E  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFDDMKSREISPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMDEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMKGYGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSVLKEMVDKYIAPTDNSIFMRLISGQCKTGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+    + A K  D+L +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENFCKADQHDKAVKLLDKLIEKDIILRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M +YLC NG+T KAE + RQL+++GVQDP    TL+ G+  EG  +   ELL  MLRR  
Sbjct  375   MIEYLCNNGQTAKAEALVRQLLKLGVQDPTALNTLVRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  435   DSEKSAYDSLVQSYLKKNEPADAKXALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25600.1| pentatricopeptide repeat-containing protein [Verbena orcuttiana]
Length=484

 Score =   310 bits (794),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/478 (35%), Positives = 269/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D      LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIIMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGLLIENFCKAGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYN M +YLC NG+  KAE + RQLM++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNSMIEYLCNNGQASKAETLVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y  L++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNLLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25627.1| pentatricopeptide repeat-containing protein [Lantana canescens]
Length=484

 Score =   310 bits (793),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 168/469 (36%), Positives = 267/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             KT   AL+FF W E+   F      + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KTSEHALQFFRWVERSNLFEHNRDTHLKIIEILGRALKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++M+RGR  M    F+
Sbjct  80    EDMWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVIMRRGRFMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN+LI G  ++  VD   RFF++M+  E  PDV+TYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNVLIWGFFLSGKVDTANRFFEDMKSREISPDVVTYNTMINGCYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K++ A      M  KG ++ P VV+YTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMDEAEKYFVEM--KGRNIEPTVVSYTTLIKGYVSVDQVDDALRLVEEMKGYGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL +A K  + + + K   +      D   F  LI + C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCDAGKMSEAQSILKEMVDKYIAPKDNSIFMRLISSQCEAGNLGAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G  + A K  D+L +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENFCKAGQHDKAVKLLDKLIEKDIILRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M +YLC NG+T KAE + RQL+++GVQD     TLI G+  EG  +   ELL  MLRR  
Sbjct  375   MIEYLCNNGQTAKAEALVRQLLKLGVQDSTALNTLIRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L  M+++ HLP + +F S++  L
Sbjct  435   DSEKSAYDSLVQSYLKKNEPADAKAALGSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25613.1| pentatricopeptide repeat-containing protein [Verbena rigida]
Length=481

 Score =   310 bits (793),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/475 (35%), Positives = 268/475 (56%), Gaps = 15/475 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELGVERTIKSYNXLFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEKMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQD     TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQXXKAETLVRQLXKLGVQDXTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVM  480



>gb|ACU25625.1| pentatricopeptide repeat-containing protein [Mulguraea aspera]
Length=481

 Score =   309 bits (792),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 270/474 (57%), Gaps = 15/474 (3%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+
Sbjct  18    VLHSA---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK  74

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +  +   +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR 
Sbjct  75    ---GLEWDEDMWVMMIDSYGKQGIVQESVKLFDRMEELGVERTIKSYDALFKVILRRGRY  131

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++ML   G++P  +TFN+LI G  ++  V+   RFF++M+  E  PDV+TYNT
Sbjct  132   MMAKRYFNKMLSE-GIEPTRHTFNVLIWGFFLSGKVETANRFFEDMKSREISPDVVTYNT  190

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  R  K+  A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM  
Sbjct  191   MINGYYRVKKMXEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMKG  248

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI + C  G+L 
Sbjct  249   FGIKPNAITYSTLLPGLCNAEKMSEARSILKEMMDKYLAPTDNSIFMRLITSQCKSGHLD  308

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCR  1490
             AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D++ +   +L   S     
Sbjct  309   AASDVLKAMIRLSVPTEAGHYGVLIENFCKAGQYDQAVKLLDKVIEKDIILRPQSTLHLE  368

Query  1491  PVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELL  1670
             P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   ELL
Sbjct  369   P--SAYNPMIEYLCNNGQAAKAETLVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFELL  426

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
               MLRR    +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  427   KIMLRRKVDSEKSAYDSLVQSYLKKNEPADAKAALDSMIENDHLPDSALFRSVM  480



>gb|ACU25611.1| pentatricopeptide repeat-containing protein [Verbena litoralis]
Length=484

 Score =   309 bits (792),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/478 (35%), Positives = 268/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y    + QES+K+F  M+ +G+  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEXIVQESVKMFQKMEELGVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A    + + + K   +      D   F  LI +HC  GNL
Sbjct  248   GFGIKPNAITYSTLLPGLCNAEXMSEARVILKEMMDKYLAPTDNSIFMRLISSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y  LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHYGXLIENFCKXGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25634.1| pentatricopeptide repeat-containing protein [Priva cordifolia]
Length=484

 Score =   309 bits (791),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/467 (35%), Positives = 266/467 (57%), Gaps = 8/467 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKGF-ALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+        + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNAEHALQFFRWVERSNLLEHNREIHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++ +RGR  M    F+
Sbjct  80    EDMWVMMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVISRRGRYMMSKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +M+   G++P  +TFN+LI G  ++  V+   RFF++M+  E  PDVITYNT+++G  R 
Sbjct  140   KMVNE-GIEPTRHTFNVLIWGFFLSGKVETANRFFEDMKSREITPDVITYNTMINGYNRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  K   + P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFLEM--KERKIDPTVVTYTTLIKGYASVDRVDDALRLVEEMKGLGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI + C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSILKEMVDKYVAPTDNSIFMRLISSQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-VAAYNPMF  1520
             M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L       + ++AYNP+ 
Sbjct  317   MIRLSVPTEAGHYGVLIEYYCKAGQYDKAVKLLDKLIEKDIILRPQSTLHMELSAYNPLI  376

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
             +YLC NG+T KAE + RQLM++GVQDP +  TLI G+  EG  +   ELL  MLRR    
Sbjct  377   EYLCNNGQTAKAETLVRQLMKLGVQDPTSLNTLIRGHSQEGSPDSAFELLKIMLRRKVDS  436

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  437   EKSAYDSLVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25626.1| pentatricopeptide repeat-containing protein [Phyla dulcis]
Length=481

 Score =   308 bits (790),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 268/474 (57%), Gaps = 12/474 (3%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V + +   KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+
Sbjct  15    VYNVLHAAKTSEHALQFFRWVERSNLFEHDRETHLKIIEILGRASKLNHARCILLDMPKK  74

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +  +   +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++M+RGR 
Sbjct  75    ---GLEWDEDMWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVIMRRGRF  131

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++ML   G++P  +TFN++I G  ++  +D   RFF++M+  E  PDV+TYNT
Sbjct  132   MMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKMDTAMRFFEDMKSREISPDVVTYNT  190

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  R  K++ A      M  KG ++ P VVTYTTL++GY    +V +AL + +EM  
Sbjct  191   MINGCYRVKKMDEAEKYFVEM--KGKNIEPTVVTYTTLIKGYVSVDQVHDALRLVEEMKG  248

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI + C  GNL 
Sbjct  249   YGIKPNAITYSTLLPGLCNAGKMSEAQSILKEMVDKYIAPKDNSIFMRLISSQCEAGNLD  308

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCR  1490
             AA +  + M  L+   ++  Y +LI   C+ G  + A K  D+L +   +L   S     
Sbjct  309   AAADVLKAMIRLSVPTEAGHYGVLIENFCKAGQHDRAVKLLDKLIEKDIILRPQSTLHME  368

Query  1491  PVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELL  1670
             P  +AYNPM +YLC NG+T KAE + RQL+++GVQD     TLI G   EG  +   ELL
Sbjct  369   P--SAYNPMIEYLCSNGQTAKAEALVRQLLKLGVQDTTALNTLIRGYAQEGSPDSAFELL  426

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
               MLRR    +   Y++L++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  427   KIMLRRKVDSEKSAYDALVQSYLKKNEPADAKAALDSMIENDHLPDSSLFRSVM  480



>gb|ACU25623.1| pentatricopeptide repeat-containing protein [Mulguraea asparagoides]
Length=481

 Score =   308 bits (789),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/474 (35%), Positives = 268/474 (57%), Gaps = 15/474 (3%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+
Sbjct  18    VLHSA---KTSEHALQFFRWVERSNLFEHBRETHLKIIEILGRASKLNHARCILLDMPKK  74

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +  +   +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR 
Sbjct  75    ---GLEWDEDMWVMMIDSYGKQGIVQESVKLFQKMEELGVERTLKSYDALFKVILRRGRY  131

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++ML   G++P    FN+LI G  ++  V+   RFF++M+  E  PDV+TYNT
Sbjct  132   MMAKRYFNKMLSE-GIEPTRXXFNVLIWGFFLSGKVETANRFFEDMKSREISPDVVTYNT  190

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM  
Sbjct  191   MINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLXEEMKG  248

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G +PN++TY+TL+ GL  A K  + + + K   +      D   F  LI + C+ G+L 
Sbjct  249   FGIKPNAITYSTLLPGLCNAEKMSEARSILKEMVDKYLAPTDNSIFMRLITSQCTSGHLD  308

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCR  1490
             AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S     
Sbjct  309   AASDVLKAMIRLSVPTEAGHYGVLIENFCKXGQYDQAVKLLDKLIEKDIILRPQSTLHLE  368

Query  1491  PVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELL  1670
             P  +AYNPM +YLC NG+  KAE + RQL+++GVQDP    TLI G+  EG  +   ELL
Sbjct  369   P--SAYNPMIEYLCNNGQAAKAETLVRQLLKLGVQDPTALNTLIRGHSQEGSPDSAFELL  426

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
               MLRR    +   Y SL++  L+  +P  A   L+ M+++ HLP + +F S++
Sbjct  427   KIMLRRKVDSEKSAYNSLVQSYLKRNEPADAKAALDSMIENDHLPDSALFRSVM  480



>gb|ACU25624.1| pentatricopeptide repeat-containing protein [Mulguraea scoparia]
Length=484

 Score =   308 bits (789),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 168/478 (35%), Positives = 267/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS    KT   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSA---KTSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKQGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P   TF +LI G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRXTFXVLIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKXEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++ Y+TL+ GL  A K  + + + K   +      D   F  LI + C  GNL
Sbjct  248   GFGIKPNAIXYSTLLPGLCNAEKMSEARSILKEMMDKYLAPTDNSIFMRLITSQCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAASDVLKAMIRLSVPTEAGHYGVLIENFCKAGQYDQAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL++ GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAAKAETLVRQLLKWGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKSAYDSLVQSYLKKNEPADAKAALDSMIENDHLPDSALFRSVMESL  483



>ref|XP_008443807.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Cucumis melo]
Length=760

 Score =   316 bits (810),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 191/628 (30%), Positives = 329/628 (52%), Gaps = 12/628 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V + +   K    AL FF W E+ G F    + + +++E+LG    LN AR  L  +P  
Sbjct  124   VYNVLHAAKKSEHALNFFRWVERAGLFQHDRETHLKIIEILGGASKLNHARCILLDMP--  181

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
              N  V  +   F  LI +Y  AG+ QE++K+F  MK +G+  S  +++ LF ++++RGR 
Sbjct  182   -NKGVEWDEDLFVVLIDSYGKAGIVQEAVKIFRKMKELGVERSNKSYDALFKVILRRGRY  240

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F+ ML   G++P  +T+N+++ G  ++  ++   RF+++M+     PDV+TYNT
Sbjct  241   MMAKRYFNAMLNE-GLEPTRHTYNVMLWGFFLSLRLETAKRFYEDMKSRGISPDVVTYNT  299

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G CR   +E A      M  KG +++P V++YTT+++GY    +V++ L +F+EM  
Sbjct  300   MINGYCRFKMMEEAEQFFTEM--KGKNIAPTVISYTTMIKGYVSVGRVDDGLRLFEEMKA  357

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVP--DTCTFNTLIHTHCSDGN  1313
              G +PN +TY+TL+ GL +A K  + +++        R++   D   F  L+   C  G+
Sbjct  358   AGEKPNDITYSTLLPGLCDAEKLPEARKILTEMV--ARYIAPKDNSIFMRLLSCQCKHGD  415

Query  1314  LKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRP  1493
             L AA+   + M  L+   ++  Y ILI   C+ G ++ A K  D+L +   +L       
Sbjct  416   LDAAMHVLKAMLRLSIPTEAGHYGILIENCCKAGMYDKAVKLLDQLVEKEIILKPQSTLE  475

Query  1494  VVA-AYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELL  1670
             + A AYN + +YLC +G+T KAE  FRQL++ G+QD + F  LI G+  EG  E   E+L
Sbjct  476   MEASAYNLIIQYLCNHGQTGKAEIFFRQLLKKGIQDEVAFNNLIRGHAKEGNPEFAFEML  535

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQ  1850
               M RR    D E+Y+ L++  L +G+P  A   L+ M+++ H P + +F S++  L   
Sbjct  536   KIMGRRGVSRDAESYKLLIKSYLSKGEPADAKTALDSMIENGHSPDSALFRSVMESLFAD  595

Query  1851  NCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQEL  2030
                   + ++  ML K I +N++L    +  LF  G  E     +  L +     +   L
Sbjct  596   GRVQTASRVMNSMLDKGITENLDLVAKILEALFMRGHDEEGLGRINLLMNCNCPPDFDSL  655

Query  2031  IVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQI  2210
             +  L +  K   A  LL F L+   ++       VL AL  A +   A+ +  +++E+  
Sbjct  656   LSVLCEKGKTIAAFKLLNFGLERECNIQFSSYEKVLDALMGAGKTLNAYAILCKIMEKGG  715

Query  2211  ELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                 +  +DL   L  EG +K+A+ +++
Sbjct  716   AKDWSSCDDLIKTLNQEGNTKQADILSR  743



>gb|ACU25643.1| pentatricopeptide repeat-containing protein [Petrea racemosa]
Length=484

 Score =   308 bits (788),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 266/469 (57%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KKAEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN +I G  ++  VD   RFF+ M+  E  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNFMIWGFFLSGKVDTANRFFEXMKSREIMPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E   N    M  KG ++ P VVTYTTL++GY    ++++AL + +EM   G  PN++
Sbjct  199   KKMEEXENYFMEM--KGRNIEPTVVTYTTLIKGYVSVDRIDDALRLVEEMKGFGINPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEAQSILKEMVDKYIAPKDNSIFLRLISGQCKVGNLDAAADVLKV  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G ++ A KF D++ +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENCCKAGQYDRAVKFLDKVIEKDIILRPQSSLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GV DP+   TLI G+  EG  +   ELL  MLRR  
Sbjct  375   LIEYLCNNGQTAKAETLVRQLMKLGVLDPIALNTLIRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + ++ S++  L
Sbjct  435   DSEESAYDSLVQSYLRKNEPADAKAALDSMVENGHLPDSSLYRSVMESL  483



>gb|ACU25635.1| pentatricopeptide repeat-containing protein [Rhaphithamnus venustus]
Length=484

 Score =   307 bits (787),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 165/467 (35%), Positives = 261/467 (56%), Gaps = 8/467 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNSEHALQFFRWVERSNLFQHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y   G+ QES+KLF  M  +G+  ++ +++ LF ++ +RGR  M    F+
Sbjct  80    EDMWVLMIDSYGNGGIVQESVKLFQKMDELGVERTIKSYDALFKVISRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFNI+I G  ++  V+   RFF++M+  E  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNIMIWGFFLSGKVETANRFFEDMKNREITPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G + N++
Sbjct  199   KKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVEEMKGYGIKANAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSILKEMVDKYIAPTDNSIFMRLISGQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-VAAYNPMF  1520
             M  L+   ++  Y +LI   C+ G ++ A K  D+L +   +L       +  +AYNP+ 
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGQYDQAVKLLDKLIEKDIILRPQSTLHMESSAYNPLI  376

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
              YLC NG+T KAE + RQLM++GVQDP    TLI G+  EG  +   ELL  MLRR    
Sbjct  377   GYLCNNGQTAKAEALVRQLMKLGVQDPTALNTLIRGHSQEGSPDSAFELLKIMLRRKVDS  436

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             +   Y+SL++  L+  +P  A   L+ M+++ HLP + +F S++  L
Sbjct  437   EKSAYDSLVQSYLKRSEPADAKAALDSMIENDHLPDSSLFRSVMESL  483



>gb|ACU25605.1| pentatricopeptide repeat-containing protein [Verbena officinalis]
Length=484

 Score =   306 bits (785),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/478 (35%), Positives = 266/478 (56%), Gaps = 15/478 (3%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+HS     T   AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK
Sbjct  17    NVLHSS---NTXEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPK  73

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
             +    +  +   +  +I +Y   G+ QES+K+F  M+ + +  ++ ++N LF ++++RGR
Sbjct  74    K---GLEWDEDMWVMMIDSYGKEGIVQESVKMFQKMEELXVERTIKSYNALFKVILRRGR  130

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M    F++ML   G++P  +TFN++I G  ++  V+   RFF++M+  E  PDV+TYN
Sbjct  131   YMMAKRYFNKMLSE-GIEPTRHTFNVMIWGFFLSGKVETANRFFEDMKSREISPDVVTYN  189

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
             T+++G  R  K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM 
Sbjct  190   TMINGYYRVKKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDQVDDALRLVZEMK  247

Query  1137  DRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNL  1316
               G +PN++TY+TL+ GL  A K  + +   K   +      D   F  LI +HC  GNL
Sbjct  248   GXGIKPNAITYSTLLPGLCNAEKMSEARVJLKEMMDKYLAPTDNSIFMRLIXSHCKSGNL  307

Query  1317  KAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGC  1487
              AA +  + M  L+   ++     LI   C+ G ++ A K  D+L +   +L   S    
Sbjct  308   DAAADVLKAMIRLSVPTEAGHXGXLIENFCKVGQYDKAVKLLDKLIEKDIILRPQSTLHL  367

Query  1488  RPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              P  +AYNPM +YLC NG+  KAE + RQL ++GVQDP    TLI G+  EG  +   EL
Sbjct  368   EP--SAYNPMIEYLCNNGQAXKAETLVRQLXKLGVQDPTALNTLIRGHSQEGSPDSAFEL  425

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
             L  MLRR    +   Y SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  426   LKIMLRRKVDSEKXAYNSLVQSYLKKNEPXDAKAALDSMIENDHLPDSALFRSVMESL  483



>gb|ACU25642.1| pentatricopeptide repeat-containing protein [Duranta serratifolia]
Length=484

 Score =   306 bits (785),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/469 (36%), Positives = 264/469 (56%), Gaps = 12/469 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNXEHALQFFRWVERSNLFEHNRETHHKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  LI +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLLIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G +P  +TFNI+I G  ++  V+   RFF++M+  E  PDV+TYNT++ G  R 
Sbjct  140   KMLSE-GNEPTRHTFNIMIWGFFLSGKVETANRFFEDMKSREIMPDVVTYNTMIXGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFVEM--KGRNIEPTVVTYTTLIKGYVSVDRVDDALRLVEEMKGFGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A+K  + + + K   E      D   F  LI   C  G+L AA +  + 
Sbjct  257   TYSTLLPGLCNAQKMSEARSILKEMVEKYITPTDNSIFLRLISGQCKAGDLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G ++ A K  D L +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGQYDQAVKLLDRLIEKDIILRPQSTLHLEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GVQDP     LI G+  EG  +   ELL  MLRR  
Sbjct  375   LIEYLCNNGQTAKAESLVRQLMKLGVQDPTALNALIRGHSQEGSPDSAFELLKIMLRRKA  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
               +   Y+SL++  L++ +P  A   L+ M+++ HLP   +F S++  L
Sbjct  435   RSEKSAYDSLVQSYLKKSEPADAKAALDSMIENGHLPDPALFRSVMESL  483



>gb|ACU25633.1| pentatricopeptide repeat-containing protein [Pitraea cuneato-ovata]
Length=481

 Score =   306 bits (783),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/466 (35%), Positives = 267/466 (57%), Gaps = 12/466 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNAEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++ +RGR  M    F+
Sbjct  80    EDMWVLMIDSYGKEGIVQESVKLFQKMEELGVERTIKSYDALFKVISRRGRYMMSKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +M+   G++P  +TFN+LI G  ++  V+   RFF++++  E  PDV+TYNT+++G  R 
Sbjct  140   KMVNE-GIEPTRHTFNVLIWGFFLSGKVETANRFFEDLKSREITPDVVTYNTMINGYTRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M +K  D  P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFLEMKEKKID--PTVVTYTTLIKGYASIDRVDDALRLVEEMKGLGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL +A K  + + L K   +      D   F  LI + C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCDAEKMSEARSLLKEMVDKYIAPKDNSIFIRLISSQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+ G ++ A K FD+L +   +L   S     P  +AYNP
Sbjct  317   MIRLSIPTEAGHYGVLIENYCKAGKYDQAVKLFDKLIEKDIILRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GVQD ++  TLI G+  EG  +   E+L  MLRR  
Sbjct  375   LIEYLCNNGQTGKAETLVRQLMKLGVQDSISLNTLIRGHSQEGSPDSAFEILKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
               +   Y+SL++  L+  +P  A   L+ M+++ HLP + +F S++
Sbjct  435   DSEKSAYDSLVQSYLKRNEPADAKAALDXMIENDHLPDSSLFRSVM  480



>ref|XP_004497861.1| PREDICTED: anaphase-promoting complex subunit cdc20-like [Cicer 
arietinum]
Length=452

 Score =   208 bits (530),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S++WS D+K L  G   S + L+DAETSK +R L+GH  R+ ++AWNGH+LTSGS+D
Sbjct  179   YPTSVSWSEDSKYLATGFMHSNLHLFDAETSKTIRKLEGHSQRIATLAWNGHILTSGSHD  238

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             +SII+HDVR  +++ S +K H  EVCGLKWS   N L SGGN+N +YIW++ KM+S ++L
Sbjct  239   KSIINHDVRAKSNVTSRVKGHKAEVCGLKWSKRRNILASGGNENHIYIWESNKMNSSNFL  298

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSKNLV  2691
             H F  H AAVKALAWCPY+  VLASGGGT D CIK+W+++KG  I S  +K  V
Sbjct  299   HCFKGHCAAVKALAWCPYDSSVLASGGGTDDRCIKLWNVQKGTNICSIDTKAQV  352


 Score =   145 bits (365),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGL+WN+HHKE+LSGHGF    +   +LCLW YPSM+K+     HASR LHLSQSPDG
Sbjct  351   QVCGLEWNRHHKEILSGHGFSTSAE-YNQLCLWEYPSMTKVGGLDPHASRVLHLSQSPDG  409

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LT VSAGADETLRFW++FGPP       S  DNLLSLK SPIR
Sbjct  410   LTTVSAGADETLRFWDVFGPPATKTKEASVLDNLLSLKISPIR  452


 Score =   101 bits (251),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 83/195 (43%), Gaps = 77/195 (39%)
 Frame = -2

Query  3915  LQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF*  3736
             L   WY P  LLSTPT+Y FP                                       
Sbjct  4     LDCDWYTPRSLLSTPTDYHFP---------------------------------------  24

Query  3735  FSLMKGDRFIPNRSLMDLDRAHTLLTN-PSKELGKSKYNVSMSFLISLNECFWFLPISGN  3559
                  GDRFIPNRSLMDLD+AHT LTN P+++     +N                     
Sbjct  25    -----GDRFIPNRSLMDLDQAHTFLTNKPTQKFHNKHFN---------------------  58

Query  3558  WELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEES  3379
                          YR++L+  L LD EG+PFRMLVFRGSPK S+KSIR +D +R+ +E +
Sbjct  59    -----------DAYRQKLDEKLTLDSEGKPFRMLVFRGSPKVSKKSIRHMDVIRQEEEAA  107

Query  3378  FSCTDVNKQSRAFPK  3334
             F         R  PK
Sbjct  108   FQNNRNQLIRRRLPK  122



>gb|ACU25637.1| pentatricopeptide repeat-containing protein [Citharexylum ligustrinum]
Length=484

 Score =   303 bits (775),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 163/467 (35%), Positives = 262/467 (56%), Gaps = 8/467 (2%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KKSEHALQFFRWVERSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLMIDSYGKAGIVQESVKLFQKMEELGVERTIKSYDVLFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFNI+I G  ++  V+   RFF++M+     PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNIMIWGFFLSGKVETANRFFEDMKSRXITPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVT TTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFVEM--KGRNIEPTVVTXTTLIKGYVSVDRVDDALRLXEEMKGFGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + +   K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEARSXLKEMVDKYIAPTDNSIFLRLISGQCKAGNLDAAADVLQA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV-VAAYNPMF  1520
             M  L+   ++  Y +LI   C+ G ++ A    D+L +   +L       +   AYNP+ 
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAGQYDKAINLLDKLIEKDIILRPQSTLHMEXIAYNPLI  376

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
             +YLC NG+T KAE + RQLM++GVQD +   TLI+G+  EG  +   ELL  MLRR    
Sbjct  377   EYLCNNGRTAKAETLVRQLMKLGVQDSIALNTLILGHSQEGSPDSAFELLKIMLRRKIDS  436

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTEL  1841
                 Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++  L
Sbjct  437   AKSAYDSLVQSYLKKNEPADAKAALDSMIENGHLPDSSLFRSVMESL  483



>ref|XP_008219256.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Prunus mume]
Length=752

 Score =   309 bits (792),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 190/631 (30%), Positives = 326/631 (52%), Gaps = 14/631 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+H  R   +   AL+FF W E+ G F    + + +++E+L     LN AR  L  +PK+
Sbjct  111   VLHGTR---SWEHALQFFRWVERSGLFKHDRETHLKIIEILSRNSKLNHARCILLDMPKK  167

Query  600   SNGAVPLEARFFNSLIKNYAVAG---LFQESLKLFTSMKVIGISPSVVTFNTLFSILMKR  770
                 V L+   F  LI  Y  +    + QES+KLF  MK +G+  S+ ++  L+  +M+ 
Sbjct  168   ---GVRLDEDLFIGLIDGYGKSDKGCIIQESVKLFIKMKELGVERSLKSYEALYKAIMRW  224

Query  771   GRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVIT  950
             GR  M    F+ ML   G++P  +T+N++I G   +  ++   RFF++M+     PD++T
Sbjct  225   GRCMMAKRYFNAMLSE-GIEPTRHTYNVMIWGFLKSRKLETAKRFFEDMKSRGISPDLVT  283

Query  951   YNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKE  1130
             YNT++ G  R  K++ +  +   +  KG ++ PNV++YTT+++GY    +V++ L +F+E
Sbjct  284   YNTMIHGYIRVDKMDESEQLFVEL--KGRNIEPNVISYTTMIKGYVSVGRVDDGLRLFEE  341

Query  1131  MVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDG  1310
             M   G  PN+VT++TL+ GL EA K +   ++            D   F  L+   C  G
Sbjct  342   MKSFGIRPNAVTFSTLLPGLCEAEKKNAAHKILMEMVSKYISPMDNSIFERLLSLQCKSG  401

Query  1311  NLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCR  1490
             ++ AA    + M  L    ++  Y ILI   C+ G ++ A K  D+L +   +L      
Sbjct  402   DMDAAAYVLKAMIRLRIPTEAGHYGILIENFCKAGVYDHAVKLLDKLIEKEIILRPQNSI  461

Query  1491  PVV-AAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHEL  1667
              +  +A++PM +YLC +G+T KAE  FRQLM+ GV+D + F  L+ G+  EG S+   E+
Sbjct  462   ELERSAFHPMIEYLCNHGQTGKAEAFFRQLMKKGVEDSVAFNNLLRGHAKEGNSDSAFEI  521

Query  1668  LVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVK  1847
             L  M RR    + ++Y  L++  L +G+P  A   L+ M++  H P + +F S++  L +
Sbjct  522   LRIMNRRGIPGEADSYILLIKSYLSKGEPADAKTALDSMIEGGHFPESSLFRSVIESLFE  581

Query  1848  QNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
                    + ++  M+ K + +N++L    +  LF  G  E A   +  L  +G  +    
Sbjct  582   DGRVQTASRVMKSMVEKGVMENMDLVAKILEALFMRGHVEEALGRIDLLMQSGCALQFDS  641

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  L++  K   A  LL F L+   SV       VL AL  + +   A+ +  +L+E+ 
Sbjct  642   LLSVLAEKGKTIAALKLLDFCLERDCSVDFSSYDKVLDALLASGKTLNAYSILCKLMEKG  701

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAKRM  2300
                  +  EDL   L  EG +K+A+ +++ M
Sbjct  702   GITDWSSTEDLIKSLNQEGNTKQADILSRMM  732



>ref|XP_007225233.1| hypothetical protein PRUPE_ppa001877mg [Prunus persica]
 gb|EMJ26432.1| hypothetical protein PRUPE_ppa001877mg [Prunus persica]
Length=749

 Score =   309 bits (792),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 189/630 (30%), Positives = 324/630 (51%), Gaps = 14/630 (2%)
 Frame = +3

Query  420   TVIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
              V+H  R   +   AL+FF W E+ G F    + + +++E+L     LN AR  L  +PK
Sbjct  107   NVLHGAR---SWEHALQFFRWVERSGLFKHDRETHLKIIEILSRNSKLNHARCILLDMPK  163

Query  597   RSNGAVPLEARFFNSLIKNYAVAG---LFQESLKLFTSMKVIGISPSVVTFNTLFSILMK  767
             +    V L+   F  LI  Y  +    + QES+KLF  MK +G+  S+ ++  L+  +++
Sbjct  164   K---GVQLDEDLFIGLIDGYGKSDKGCIIQESVKLFIKMKELGVERSLKSYEALYKAILR  220

Query  768   RGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVI  947
              GR  M    F+ ML   G++P  +T+N++I G   +  ++   RFF++M+     PD++
Sbjct  221   WGRCMMAKRYFNAMLSE-GIEPTRHTYNVMIWGFLKSRKLETAKRFFEDMKSRGISPDLV  279

Query  948   TYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFK  1127
             TYNT++ G  R  K++ +  +   +  KG ++ PNV++YTT+++GY    +V++ L +F 
Sbjct  280   TYNTMIHGYIRVDKMDESEQLFVEL--KGRNIEPNVISYTTMIKGYVSVGRVDDGLRLFG  337

Query  1128  EMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSD  1307
             EM   G  PN+VT++TL+ GL +A K D   ++            D   F  L+   C  
Sbjct  338   EMKSFGIRPNAVTFSTLLPGLCDAEKKDAAHKVLMEMVSKYIAPIDNSIFERLLSLQCKS  397

Query  1308  GNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGC  1487
             G++ AA    + M  L    ++  Y ILI   C+ G ++ A K  D+L +   +L     
Sbjct  398   GDMDAAAYVLKAMIRLRIPTEAGHYGILIENFCKAGVYDQAVKLLDKLIEKEIILRPQNS  457

Query  1488  RPV-VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHE  1664
               +  +A+NPM +YLC +G+T KAE  FRQLM+ GV+D + F  L+ G+  EG S+   E
Sbjct  458   IELEPSAFNPMIEYLCNHGQTGKAEAFFRQLMKKGVEDSVAFNNLLRGHAKEGNSDSAFE  517

Query  1665  LLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELV  1844
             +L  M RR    + ++Y  L++  L +G+P  A   L+ M++  H+P + +F S++  L 
Sbjct  518   ILRIMNRRGIPGEADSYILLIKSYLSKGEPADAKTALDSMIEGGHIPESSLFRSVIESLF  577

Query  1845  KQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQ  2024
             +       + ++  M+ K + +N++L    +  LF  G  E A   +  L  +G  +   
Sbjct  578   EDGRVQTASRVMKSMVEKGVMENMDLVAKILEALFMRGHVEEALGRIDLLMQSGCALQFD  637

Query  2025  ELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER  2204
              L+  L+   K   A  LL F L+   SV       VL AL  + +   A+ +  +L+E+
Sbjct  638   SLLSVLADKGKTIAALKLLDFCLERDCSVDFSSYDKVLDALLASGKTLNAYSILCKLMEK  697

Query  2205  QIELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
                   +  EDL   L  EG +K+A+ +++
Sbjct  698   GGITDWSSTEDLIKSLNQEGNTKQADILSR  727



>ref|XP_002511051.1| cell division cycle, putative [Ricinus communis]
 gb|EEF51653.1| cell division cycle, putative [Ricinus communis]
Length=459

 Score =   226 bits (575),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 143/195 (73%), Gaps = 2/195 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N        E ++  DYP+SI+WS D ++L VG   SK+QLWD E  + VR + G
Sbjct  167   LWNAENKS-TLKLLEVESDSDYPTSISWSEDNRSLAVGYMQSKLQLWDTEALRCVRQMDG  225

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H+ RV ++AWNGH LTSGS D++I++ DVRV NS   +L AHT EVCGLKWS  GN L S
Sbjct  226   HKNRVATLAWNGHTLTSGSRDKTILNRDVRVRNSTSRIL-AHTEEVCGLKWSTEGNLLAS  284

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGN+NL++IW+  KMSS ++LH+F  H +AVKALAWCPY ++VLASGGGT DGCIK+W++
Sbjct  285   GGNENLIHIWEASKMSSSNFLHQFKGHRSAVKALAWCPYQFNVLASGGGTKDGCIKIWNV  344

Query  2735  RKGACISSTFSKNLV  2691
             RKG+CI S  + + +
Sbjct  345   RKGSCIHSIHTNSQI  359


 Score =   124 bits (310),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QIC L+WN+HHKE+LSGHG+   G     LCLW+YPS++K+ +   H++R L LSQSPDG
Sbjct  358   QICALEWNRHHKEILSGHGYS-LGPLQNHLCLWKYPSLTKVGEIQRHSNRILGLSQSPDG  416

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAGAD+TLRFW+IFGPP A+ S+ S  ++LLSLKTSPIR
Sbjct  417   LTVVSAGADQTLRFWDIFGPPCAENSKLSGLESLLSLKTSPIR  459


 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 80/187 (43%), Gaps = 76/187 (41%)
 Frame = -2

Query  3936  DQKSLERLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHEL  3757
             +QK +++LQS WY P RL  +PT+YDFP                                
Sbjct  4     NQKKIQQLQSDWYSPRRLHDSPTKYDFP--------------------------------  31

Query  3756  PSANGF*FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWF  3577
                         GDRFIPNRSLM+LD+AH+LLTN SK+                      
Sbjct  32    ------------GDRFIPNRSLMNLDQAHSLLTNRSKQ----------------------  57

Query  3576  LPISGNWELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMR  3397
                       V        Y++ L   L LD EGRP +MLVFRGSPK SRK    ID+MR
Sbjct  58    ----------VPDLIFNEVYQQLLMENLTLDTEGRPLKMLVFRGSPKLSRKWTHLIDQMR  107

Query  3396  RSDEESF  3376
               D E+ 
Sbjct  108   TDDAEAL  114



>ref|XP_009392129.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Musa acuminata subsp. malaccensis]
Length=753

 Score =   308 bits (790),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 201/671 (30%), Positives = 334/671 (50%), Gaps = 19/671 (3%)
 Frame = +3

Query  309   SSRKKALALAELIKF----QPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFF  476
             +S KK   L E I +    +PW+  T    S  +     ++ V+  +R  + P  AL FF
Sbjct  73    NSTKKEEQLHETICYMMARRPWT--TRLQNSIRSLAPFDQSLVLAVLRGARHPDHALHFF  130

Query  477   VWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFS-IPKRSNGAVPLEARFFNSLIKN  653
              W E+ GF      Y  ++ LL     LN AR  L   +P R    VP     F +LI+ 
Sbjct  131   RWVEKTGFRHDPDTYREIILLLARASMLNHARCILLDDMPDR---LVPPSEDMFATLIEG  187

Query  654   YAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKP  833
             Y  A + QE++K+F  +  +G++ +V +++ +F  +++ GR  M   LF+ M+   GV P
Sbjct  188   YGCARIPQEAVKIFRRLPELGVTRTVRSYDAVFKAILRSGRVAMARRLFNAMIAE-GVLP  246

Query  834   DLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVV  1013
              L T+N L+ G C++  ++   RFF +M++    PD++TYNTI++G  RA K++ A  V 
Sbjct  247   GLSTYNTLLWGFCLSIKMETAQRFFADMKERGIAPDLVTYNTILNGWARAKKMDDAEKVF  306

Query  1014  KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLL  1193
               M   G   +PN ++Y  +++GY    +V++ L +F EM ++G   +  T+  L+ GL 
Sbjct  307   AEMTAAG--FAPNSISYNIMIKGYVCSGRVDDGLRMFSEMGEKGLTFSEKTFAALMPGLC  364

Query  1194  EARKFDKVKELFKGAGEDG--RFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSILN-A  1361
             +     +  E  K   E    R  P D   F  L+ + C  G+L+ ALE   K S  N  
Sbjct  365   D--DVGRAAEAQKALNEMAKLRLTPNDKSIFLRLVTSLCESGDLEGALEVHRKTSQFNHV  422

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
               D   Y +L+  LC+    E A    DEL + GT+ S        +AYNPM +YLC++G
Sbjct  423   VVDPMQYGVLLESLCKGEKHESAIALLDELLEKGTMQSPQYPTLEPSAYNPMIEYLCDHG  482

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
              TKKAE  FRQLM+ GV D + F +LI G+  EGM E   E+L  M       D ++Y  
Sbjct  483   DTKKAEAFFRQLMKKGVDDKVAFNSLIRGHAKEGMPEAASEILTIMTHHGVPTDADSYVL  542

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L+E  L++ +P  A   L  M++  HLP   +F S++  L         + ++  M+ K 
Sbjct  543   LVESFLKKSEPADARTALGSMMEQGHLPSASLFRSVMVALFDDGRVQTASRVMKSMIEKG  602

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             +++N+++    +  LF  G  E A   +  +  N    ++  L++ L    K +EA+ L+
Sbjct  603   VKENMDMVHKILEALFMRGHVEEALGRINLMIMNDCTPDIDHLLITLCDSDKATEAQKLV  662

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
              F+L+    V       VL  L  A +   A+ +  ++  +   +     +D+   L  E
Sbjct  663   EFALERDCDVSFSSYDRVLDVLYTAGKTMPAYSILCKIKAKGGVVDKKGCDDIIKSLIAE  722

Query  2262  GRSKEAEFVAK  2294
             G++K+A+ +++
Sbjct  723   GKTKQADILSR  733



>gb|ACU25644.1| pentatricopeptide repeat-containing protein [Casselia glaziovii]
Length=481

 Score =   300 bits (768),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 161/466 (35%), Positives = 265/466 (57%), Gaps = 12/466 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KKTEHALQFFRWVERSNLFQHDRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y   G+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLMIDSYGKKGIVQESVKLFQKMEELGVERTIKSYDALFKVILRRGRFMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN++I G  ++  V+    FF++M+  +  PDVITYNT+++G  R 
Sbjct  140   KMLNE-GIEPTRHTFNVMIWGFFLSGKVETANXFFEDMKSRDITPDVITYNTLINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P V+TYTTL++GY    +V++AL++ +EM   G +PN++
Sbjct  199   KKMEEAERYFVEM--KGRNIEPTVITYTTLIKGYVSVDRVDDALSLMEEMKGFGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A K  + + + K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTLLPGLCNAEKMSEAQSILKEMVDKYIAPTDNSIFLKLISGQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+   ++ A    D+L +   +L   S     P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAEKYDKAVNLLDKLIEKDIILRPQSTLHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             M +YLC+NG+T KAE + RQLM++GVQ+P    TLI G+  EG  +   ELL  MLRR  
Sbjct  375   MIEYLCDNGQTAKAETLVRQLMKLGVQEPTALNTLIRGHSQEGSPDSAFELLKIMLRRKV  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
               +   Y+SL++  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  435   DSEKSAYDSLVQSYLKKNEPADAKAALDSMIENGHLPDSSLFRSVM  480



>gb|EYU34455.1| hypothetical protein MIMGU_mgv1a002067mg [Erythranthe guttata]
Length=719

 Score =   307 bits (787),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 165/474 (35%), Positives = 274/474 (58%), Gaps = 11/474 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKR  599
             V+H+ R       AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+
Sbjct  124   VLHASR---NSEHALQFFRWVERSSLFQHNRETHHKIIEILGRASKLNHARCILLDMPKK  180

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 +  +   +  +I +Y  AG+ QES+KLF  M+ +G+   + ++NTLF ++ +RGR 
Sbjct  181   ---GLEWDEDLWVMMIDSYGKAGIVQESVKLFQKMEELGVERGIKSYNTLFKVISRRGRY  237

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M    F++ML + G++P+ +TFN+LI G  ++  V+   RFF++M+  E  PDV+TYNT
Sbjct  238   MMAKRYFNKML-SEGIEPNRHTFNLLIWGFFLSGKVETANRFFEDMKTREITPDVVTYNT  296

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  R  K++ A      M  KG ++ PNVVTYTTL++GY   ++V++AL + +EM  
Sbjct  297   LINGYYRVKKMDEAVKYFTEM--KGRNIEPNVVTYTTLIKGYVSVEQVDDALRLVEEMKG  354

Query  1140  RGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLK  1319
              G +PN++TY+TL+ GL +A K  + K + +   +      +   F  L++  C  G+L 
Sbjct  355   FGIKPNAITYSTLLPGLCDAEKMSEAKTILREMVDKHIGPLENSIFMRLLYGQCKVGDLD  414

Query  1320  AALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL-SDAGCRPV  1496
             AA +  + M  L+   ++  Y ILI   C+ G ++ A K  D+L +   +L S++     
Sbjct  415   AAADVLKAMIKLSVPTEAGHYGILIENFCKAGQYDRAVKLLDKLVEKDIILRSESTLHME  474

Query  1497  VAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVW  1676
               +YNP+  YLC+NG+T KAE + RQLM++GV+D +   TLI G+  EG  +   ELL  
Sbjct  475   PTSYNPIIDYLCQNGQTAKAEALVRQLMKLGVRDSVALNTLIRGHAQEGSPDSAFELLKI  534

Query  1677  MLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTE  1838
             MLRRN   D   Y+SL++  L +  P  A   ++ M+++ H+P + +F   + E
Sbjct  535   MLRRNVPTDKTAYDSLVQSYLTKNDPAEAKAVIDSMVENGHIPDSSLFRGHVEE  588


 Score =   132 bits (331),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 129/534 (24%), Positives = 221/534 (41%), Gaps = 92/534 (17%)
 Frame = +3

Query  441   LLKTPRKALKFF--VWA------EQKGFALTSQCYFRMLELLGTERNLNTARNFLFSIPK  596
             LL  P+K L++   +W        + G    S   F+ +E LG ER + +  N LF +  
Sbjct  174   LLDMPKKGLEWDEDLWVMMIDSYGKAGIVQESVKLFQKMEELGVERGIKSY-NTLFKVIS  232

Query  597   RSNGAVPLEARFFNS---------------LIKNYAVAGLFQESLKLFTSMKVIGISPSV  731
             R  G   +  R+FN                LI  + ++G  + + + F  MK   I+P V
Sbjct  233   R-RGRYMMAKRYFNKMLSEGIEPNRHTFNLLIWGFFLSGKVETANRFFEDMKTREITPDV  291

Query  732   VTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFK  911
             VT+NTL +   +  +     + F EM K   ++P++ T+  LI+G      VD   R  +
Sbjct  292   VTYNTLINGYYRVKKMDEAVKYFTEM-KGRNIEPNVVTYTTLIKGYVSVEQVDDALRLVE  350

Query  912   EMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCE  1091
             EM+    +P+ ITY+T++ GLC A K+  A  +++ M+ K      N + +  L+ G C+
Sbjct  351   EMKGFGIKPNAITYSTLLPGLCDAEKMSEAKTILREMVDKHIGPLENSI-FMRLLYGQCK  409

Query  1092  KQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGE---------  1244
                ++ A +V K M+       +  Y  LI+   +A ++D+  +L     E         
Sbjct  410   VGDLDAAADVLKAMIKLSVPTEAGHYGILIENFCKAGQYDRAVKLLDKLVEKDIILRSES  469

Query  1245  ------------------DGRF--------------VPDTCTFNTLIHTHCSDGNLKAAL  1328
                               +G+               V D+   NTLI  H  +G+  +A 
Sbjct  470   TLHMEPTSYNPIIDYLCQNGQTAKAEALVRQLMKLGVRDSVALNTLIRGHAQEGSPDSAF  529

Query  1329  EAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTG---------------  1463
             E  + M   N   D   Y  L++    K D   A+   D + + G               
Sbjct  530   ELLKIMLRRNVPTDKTAYDSLVQSYLTKNDPAEAKAVIDSMVENGHIPDSSLFRGHVEEA  589

Query  1464  ----TLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQ-LMRMGVQDPLTFKTLIMG  1628
                  LL  +G  P +   + +   LCE GKT  A KV    L R    D  +++ ++  
Sbjct  590   LGRIDLLMQSGIEPDL---DGLLSVLCEKGKTIAALKVVDYGLERDYTIDVSSYEKVLDA  646

Query  1629  NRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLK  1790
                 G + + + +L  ++ +  V D+ + + L++ L  EG  + A D L RM+K
Sbjct  647   QLAAGKTLNAYSILCKIMGKGGVSDWSSCKDLIKSLNDEGNTKQA-DILRRMIK  699



>ref|XP_006485044.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Citrus sinensis]
Length=462

 Score =   216 bits (550),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWN---GHVLTSG  3042
             YP+S++WS DAKTL VG   SK+QLWDAETSK+VR L+GH  RV + +WN    H+LTSG
Sbjct  187   YPASVSWSHDAKTLAVGYMDSKLQLWDAETSKLVRNLEGHHRRVATSSWNHWNSHILTSG  246

Query  3041  SYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR  2862
             S ++SII+H VRVSN++ S +KAH+ EVCGLKWS  GN L SGG+ N+V+IW+  KMSS 
Sbjct  247   SKEKSIINHHVRVSNNVTSRIKAHSGEVCGLKWSNEGNLLASGGDHNVVHIWERSKMSSS  306

Query  2861  DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSK  2700
               LHRF DH   VKALAW P+  +VLASGGG  DGCIK+W+++KG CI S  +K
Sbjct  307   KSLHRFTDHCGGVKALAWSPHQVNVLASGGGKEDGCIKIWNVQKGTCIHSVDAK  360


 Score =   128 bits (322),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 2/103 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGL+WN+HHKE+LSGHGF   GDG  KLCLW+YP+M+K+ +  +  SR L LSQSPD 
Sbjct  362   QICGLEWNRHHKEILSGHGFSASGDGN-KLCLWKYPNMTKVGELQSSNSRILDLSQSPDV  420

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             +TV +AGADET+RFWE FG P  D+   S    L+SLKTS IR
Sbjct  421   VTVATAGADETIRFWEAFG-PSGDEDSVSHLAGLVSLKTSVIR  462


 Score = 95.9 bits (237),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 69/125 (55%), Gaps = 33/125 (26%)
 Frame = -2

Query  3720  GDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNWELWVS  3541
             GDRFIPNRSLM+LD+AH LLT+ +K   K                               
Sbjct  32    GDRFIPNRSLMNLDQAHGLLTHTTKHYHK-------------------------------  60

Query  3540  PFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESFSCTDV  3361
              F +  EYR+++E  L LD EGRPFRMLVFRG+ K SRKS R IDE+R+ D E+   + V
Sbjct  61    -FTIPDEYRKKIEEKLTLDSEGRPFRMLVFRGTQKSSRKSNRLIDELRKEDAEALRNS-V  118

Query  3360  NKQSR  3346
              K SR
Sbjct  119   TKTSR  123



>dbj|BAG70980.1| pentatricopeptide (PPR) repeat-containing protein [Musa balbisiana]
Length=788

 Score =   305 bits (780),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 202/671 (30%), Positives = 339/671 (51%), Gaps = 18/671 (3%)
 Frame = +3

Query  309   SSRKKALALAELIKF----QPWSPQTEsslsalagpslsETTVIHSIRLLKTPRKALKFF  476
             +S KK   L E I +    +PW+ + ++S+ +LA     ++ V+  +R  + P  AL FF
Sbjct  107   NSTKKEEQLHETICYMMARRPWTTRLQNSIRSLARSFD-QSLVLAVLRGARHPDHALHFF  165

Query  477   VWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFS-IPKRSNGAVPLEARFFNSLIKN  653
              W E+ GF      Y  ++ LL     LN AR  L   +P R    VP     F SLI+ 
Sbjct  166   RWVEKTGFRHDPDTYREIILLLARASMLNHARCILLDDMPDR---LVPPSEDMFASLIEG  222

Query  654   YAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKP  833
             Y  A + QE++K+F  +  +G++ +V +++ +F  +++ GR  M   LF+ M+   GV P
Sbjct  223   YGCARIPQEAVKIFRRLPELGVTRTVRSYDAVFKAILRSGRVAMARRLFNAMIAE-GVLP  281

Query  834   DLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVV  1013
              L T+N L+ G C++  ++   RFF +M++    PD++TYNTI++G  RA K++ A  V 
Sbjct  282   VLSTYNTLLWGFCLSIKMETAQRFFADMKERGIAPDLVTYNTILNGWARAKKMDDAEKVF  341

Query  1014  KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLL  1193
               M   G   +PN ++Y  +++GY    +V++ L +F EM ++G   +  T+  L+ GL 
Sbjct  342   AEMTAAG--FAPNSISYNIMIKGYVCSGRVDDGLRMFSEMGEKGLRFSEKTFAALMPGLC  399

Query  1194  EARKFDKVKELFKGAGEDGRF--VP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSILN-A  1361
             +     +  E  K   E  +    P D   F  L+ + C  G+L+ ALE   K S  N  
Sbjct  400   D--DVGRAAEARKALNEMAKLQLTPSDKSIFLRLVTSLCESGDLEGALEVHRKTSQFNHV  457

Query  1362  APDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENG  1541
               D   Y +L+  LC+    E A    DEL + GT+ S        +AYNPM +YLC++G
Sbjct  458   VVDPMQYGVLLESLCKGEKHESAIALLDELLEKGTMQSPQYPTLEPSAYNPMIEYLCDHG  517

Query  1542  KTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYES  1721
              TKKAE  FRQLM+ GV D + F +LI G+  EGM E   E+L  M R     D ++Y  
Sbjct  518   DTKKAEAFFRQLMKKGVDDKVAFNSLIRGHAKEGMPEAASEILTIMTRHGVPTDADSYVL  577

Query  1722  LLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKK  1901
             L+E  L++ +P  A   L+ M++  HLP   +F S++  L         + ++  M+ K 
Sbjct  578   LVESFLKKSEPADARTALDSMMEQGHLPSASLFRSVMVALFDDGRVQTASRVMKSMIEKG  637

Query  1902  IRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLL  2081
             +++N+++    +  LF  G  E A   +  +  N    ++  L++ L    K +EA+ L+
Sbjct  638   VKENMDMVHKILDALFMRGHVEEALGRINLMIMNDCTPDIDHLLITLCDSDKATEAQKLV  697

Query  2082  LFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVE  2261
              F+L+    V       VL  L  A +   A+ +  ++  +   +     + +   L  E
Sbjct  698   EFALERDCDVSFSSYDRVLDVLYTAGKTLPAYSILCKIKAKGGVVDKKGCDAIIKSLIAE  757

Query  2262  GRSKEAEFVAK  2294
             G +K+A+ +++
Sbjct  758   GNTKQADILSR  768



>ref|XP_008807561.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Phoenix dactylifera]
Length=752

 Score =   303 bits (775),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 187/628 (30%), Positives = 317/628 (50%), Gaps = 11/628 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLF-SIPKR  599
             V+  +R  + P  AL+FF W E+ GF   +  Y  ++ +L     LN AR  +   +P R
Sbjct  111   VLAVLRGARHPDHALRFFRWVERTGFRHDAATYGEIVSILTRNSMLNHARCLILEDMPTR  170

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 V  +      LI  Y  AG+ QE++K+F  M  +G++ +V +++ LF  +++ GR 
Sbjct  171   ---LVERDEDMIADLIAGYGRAGIPQEAVKIFRRMPELGVARTVRSYDALFKAILRSGRV  227

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M   +F+ M++  GV P   T+N LI G C++  ++   RFF +M++    P++ TYNT
Sbjct  228   MMAKRVFNSMIRD-GVAPAASTYNTLIWGFCLSVKMETAKRFFADMKERGLAPELATYNT  286

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             ++DG  RA K++ A  V + M   G  L+PN ++Y  +++GY    KV++ L +F EM  
Sbjct  287   LLDGWVRAKKMDDAEKVFEEMAAAG--LAPNSISYNIMIKGYVSAGKVDDGLRLFGEMSA  344

Query  1140  RGPEPNSVTYNTLIQGLLE-ARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGN  1313
             +G  P+  T+  L+ GL +   + ++ ++++    E  R  P D   F  L+ + C  G+
Sbjct  345   KGLRPSEKTFAGLMPGLCDDVGRTEEARKVWNEMAER-RLTPKDKSIFLRLVSSLCKSGD  403

Query  1314  LKAALEAFEKMSIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCR  1490
             L  ALE   KM    +   D   YS+L+  LC+ G +E A    DEL + GTL       
Sbjct  404   LDGALEVHRKMGQFKHVVKDPVQYSVLLESLCKGGKYEDAIATLDELLEKGTLQDPRTPA  463

Query  1491  PVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELL  1670
                +AYNPM +YLC +G+TKKAE   RQLM+ G+ D + F  LI G+  EG+ E   E+L
Sbjct  464   LGDSAYNPMIEYLCGHGQTKKAEAFLRQLMKKGIDDKIAFSNLIRGHAEEGVPESAFEML  523

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQ  1850
               M RR    D ++Y  L+E  L++G+P  A   L+ M++  HLP   +F S++  L   
Sbjct  524   GIMTRRGVAADADSYALLVESFLKKGEPADARTALDSMIEQGHLPSPSLFRSVMVGLFDD  583

Query  1851  NCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQEL  2030
                   + ++  M+ K +++N ++    +  L   G  E A   +  +  N  + +   L
Sbjct  584   GRVQTASRVMKSMIEKGVKENRDVVHKILEALLMRGHVEEALGRINLMMMNDSVPDFDGL  643

Query  2031  IVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQI  2210
             +  L    K  EA  L    L+    +       +L +L  A +   A+ +  ++  +  
Sbjct  644   LAALCDSGKAIEALKLADLGLERDCDISFSSYDRLLDSLYTAGKILPAYSILCKIKAKGG  703

Query  2211  ELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
              +     E L  RL  +G +K+A+ +++
Sbjct  704   VVDKKGCEALITRLNEQGNTKQADILSR  731



>ref|XP_003595776.1| Cell division cycle protein-like protein [Medicago truncatula]
 gb|AES66027.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=452

 Score =   208 bits (530),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 132/175 (75%), Gaps = 1/175 (1%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGH-VLTSGSY  3036
             YP+S++WS DAK +  G   S++Q+WDAETSK+VR L+GH  R+ ++AWN + +LTSG +
Sbjct  178   YPTSVSWSEDAKYVATGFVHSQLQIWDAETSKLVRNLEGHAQRIATLAWNNNRILTSGGH  237

Query  3035  DRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDY  2856
             D+SII+HDVR   + +  +K H  E+CGLKWS  GN L SGGN+N VY+WD+ KM+S ++
Sbjct  238   DKSIINHDVRARRNEVLRIKTHRAEICGLKWSKRGNLLASGGNENHVYVWDSNKMNSSNF  297

Query  2855  LHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSKNLV  2691
             LH F +H+AAVKAL WCPY+ DVLASGGGT D CIK+W++++G  I S  +K  V
Sbjct  298   LHCFKEHTAAVKALDWCPYDSDVLASGGGTDDRCIKLWNVQRGTNICSIDTKAQV  352


 Score =   134 bits (336),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+CGLQWN+H+KE+LSGHGF    +   +LCLW+YPSM+K+     H SR LHLSQSPDG
Sbjct  351   QVCGLQWNRHYKEILSGHGFSTSPEH-NQLCLWQYPSMTKVGGLDPHTSRVLHLSQSPDG  409

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             LTVVSAG DETLRFW+IFGP   D   +S   NLLS+K S IR
Sbjct  410   LTVVSAGGDETLRFWDIFGPAVNDTRESSVLGNLLSMKASQIR  452


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 82/194 (42%), Gaps = 76/194 (39%)
 Frame = -2

Query  3915  LQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF*  3736
             L   WY P  LLS PT YDFP                                       
Sbjct  4     LDRDWYSPKHLLSPPTLYDFP---------------------------------------  24

Query  3735  FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNW  3556
                  GDRFIPNRSLMDLD+A +LLTN +K+     +N +                    
Sbjct  25    -----GDRFIPNRSLMDLDQATSLLTNKTKKFHNKNFNEA--------------------  59

Query  3555  ELWVSPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEESF  3376
                         YR++L+  L LD EGRPFRMLVFRGSPK S+KSIR ID++R  D  + 
Sbjct  60    ------------YRQKLDDKLNLDSEGRPFRMLVFRGSPKSSKKSIRYIDQLREEDAAAL  107

Query  3375  SCTDVNKQSRAFPK  3334
               +   +  R  PK
Sbjct  108   QNSSNQRIHRRLPK  121



>gb|ACU25638.1| pentatricopeptide repeat-containing protein [Citharexylum montevidense]
Length=481

 Score =   293 bits (751),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 160/466 (34%), Positives = 261/466 (56%), Gaps = 12/466 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W ++   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KKSEHALQFFRWVZRSNLFEHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLQWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+KLF  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLMIDSYGKAGIVQESVKLFHKMEELGVERTIKSYDVLFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFNI+I G  ++  V+   RFF++M+  +  PDVITYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNIMIWGFFLSGKVETAXRFFEDMKSRDITPDVITYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E A      M  KG ++ P VVT+TTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   KKMEEAEKYFVEM--KGRNIEPTVVTHTTLIKGYVAVDRVDDALRLVEEMKGFGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+T + GL  A K  + +   K   +      D   F  LI   C  GNL AA +  + 
Sbjct  257   TYSTXLPGLCNAEKMSEARSXLKEMVDKYIAPTDNSIFLRLISGQCKAGNLDAAADVLKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLL---SDAGCRPVVAAYNP  1514
             M  L+   ++  Y +LI   C+   ++ A    D+L +   +L   S +   P  +AYNP
Sbjct  317   MIRLSVPTEAGHYGVLIENYCKAVQYDKAISLLDKLIEKDIILRPQSTSHMEP--SAYNP  374

Query  1515  MFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNF  1694
             + +YLC NG+T KAE + RQLM++GVQD     TLI G+  EG  +   ELL  MLRR  
Sbjct  375   LIEYLCNNGQTAKAETLVRQLMKLGVQDATALNTLIRGHSQEGSPDSAFELLKIMLRRKX  434

Query  1695  VPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
               +   Y SL++  L++ +P  A   L+ M+++ HLP + +F  ++
Sbjct  435   DSEKSAYNSLVQCYLKKSEPADAKTALDSMIENGHLPDSSLFRLVM  480



>ref|XP_010906524.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Elaeis guineensis]
Length=753

 Score =   299 bits (766),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 188/629 (30%), Positives = 321/629 (51%), Gaps = 12/629 (2%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQKGFALTSQCYFRMLELLGTERNLNTARNFLFS-IPKR  599
             V+  +R    P  AL+FF W E+ GF   +  Y  ++ +L     LN AR  +   +PKR
Sbjct  111   VLAVLRGAHHPDHALRFFRWVERTGFRHDAATYGEIVSILTRNSMLNHARCLILDDMPKR  170

Query  600   SNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRT  779
                 V  +     +LI  Y  AG+ QE++K+F  M  +G++ +V +++ LF  +++ GR 
Sbjct  171   ---LVDRDEDMIAALIAGYGRAGIPQEAVKIFRRMPELGVTRTVSSYDALFKAILRSGRV  227

Query  780   GMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNT  959
              M   +F+ M++  GV     T+N LI G C++  ++   RFF +M++    P+++TYNT
Sbjct  228   MMAKRIFNSMIRD-GVAAAASTYNTLIWGFCLSVKMETANRFFADMKERGIAPELVTYNT  286

Query  960   IVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVD  1139
             +++G  RA K++ A  + + M   G  L+PN ++Y  +++GY    KV++ L +F EM  
Sbjct  287   LLNGWVRAKKMDDAEKMFEEMSTVG--LAPNSISYNIMIKGYVSVGKVDDGLRLFGEMSA  344

Query  1140  RGPEPNSVTYNTLIQGLLE-ARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGN  1313
             +G  P+  T+  L+ GL +   + ++ +++     E  R  P D   F  L+ + C  G+
Sbjct  345   KGLRPSEKTFAALMPGLCDDVGRAEEARKVLNEMAER-RLTPKDKSIFLRLVSSLCKSGD  403

Query  1314  LKAALEAFEKMSIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCR  1490
             L  ALE   KM    +   D A Y +L+  LC+ G  E A    DEL + GTLL      
Sbjct  404   LDGALEVHRKMEQFKHVVKDPAQYGVLLESLCKGGKHEDAIATLDELLEKGTLLDPRTPA  463

Query  1491  PVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELL  1670
                +AY+PM +YLC +G+T+KAE +FRQLM+ G+ D + F  LI G+  EG+ E   E+L
Sbjct  464   LEDSAYDPMIEYLCGHGQTQKAEDLFRQLMKKGIDDKMAFNNLIRGHAKEGVPESALEML  523

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQ  1850
               M RR    D ++Y  L+E  L++G+P  A   L+ M++  HLP   +F S++  L   
Sbjct  524   NIMTRRGVATDADSYALLVESFLKKGEPADARTALDGMIEQGHLPSPSLFRSVMVGLFDD  583

Query  1851  NCALECADLVVLMLVKKIR-QNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQE  2027
                   + ++  M+ K ++ +N+++    +  L   G  E A   +  +  N  L +   
Sbjct  584   GRVQTASRVMKSMIEKGVKEENMDMVHKILEALLMRGHVEEALGRINLMMMNDSLPDFDG  643

Query  2028  LIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQ  2207
             L+  L    K  EA  L+ F L+    +       VL AL  A +   A+ +  ++  + 
Sbjct  644   LLAALCDSGKAIEALKLVDFGLERDCDISFSSYDRVLDALYTAGKILPAYSILCKIKAKG  703

Query  2208  IELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
               +     E L   L  +G +K+A+ +++
Sbjct  704   GVVDKKGCEALIKSLNEQGNTKQADILSR  732



>gb|ACF79319.1| unknown [Zea mays]
Length=671

 Score =   293 bits (750),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 190/617 (31%), Positives = 316/617 (51%), Gaps = 14/617 (2%)
 Frame = +3

Query  462   ALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFF  635
             AL+FF +A ++G F+     +  ++  L + R LN AR  +  ++P  S   V  +    
Sbjct  43    ALQFFRFAYRRGGFSPEGATFALLVPALASRRMLNHARCLVLDTMPSFS---VAPDEPTL  99

Query  636   NSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLK  815
              +LI  Y  A + QE++KLF  M  IG+  + +++N +   ++ RGR  M   +++ M+ 
Sbjct  100   AALISAYGRAAIPQEAVKLFRMMPNIGVPRTALSYNAVLKAILCRGREAMARRIYNAMIA  159

Query  816   TFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVE  995
               GV PD+ T+N LI G  +   ++   R F +M+ H   PDV TYNT+++   RAG +E
Sbjct  160   D-GVAPDVSTYNTLIWGFGLCKKMETAVRVFGDMKGHGVTPDVTTYNTLLNAWVRAGDLE  218

Query  996   IAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNT  1175
              A  V   M  +G++   N V+Y  +++GY E  +VEEA+ +F EM ++G   +  T+  
Sbjct  219   SARKVFDEMAGEGTER--NSVSYNVMIKGYVEGNRVEEAVALFAEMAEKGLRLSEKTFAA  276

Query  1176  LIQGLLEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             L+ GL + +   +V E  K   +  + R  P D   F  L+ T C  G+L  ALE   K 
Sbjct  277   LMPGLCDDQ--GRVAEARKAVDDMAERRLTPKDKSVFLRLVTTLCKAGDLDGALEVHWKS  334

Query  1347  SIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFK  1523
                 +   D   Y +L+  LC  G  E A +  DEL + GTLLS        +AYNP+ +
Sbjct  335   GQFKHVLVDPRQYGVLMEGLCAGGKCETAIEVLDELMEKGTLLSPKSPVLEASAYNPVIE  394

Query  1524  YLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPD  1703
             +LC NG T KAE  FRQLM+ GV D   F +LI G+  EG+ E   E+L  M RR    D
Sbjct  395   FLCSNGSTAKAETFFRQLMKKGVDDKAAFNSLIRGHAKEGVPEAAQEILAIMTRREVPTD  454

Query  1704  FETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVV  1883
              E++  L++  L++ +P  A   L+ M++  HLP   +F S++  L         + ++ 
Sbjct  455   PESHALLVDSFLKKNEPADAKTALDSMMQQGHLPSPALFKSVMEALFNDGRVQTASRVMK  514

Query  1884  LMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLS  2063
              M+ K + +N++++   +  LF  G  E A   +  + +NG + ++ +L+V L    ++ 
Sbjct  515   SMIEKGVTENMDVAHKILEALFTRGHVEEAIGRVNLMVENGCMPDLDKLLVGLCDNGRVM  574

Query  2064  EARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLR  2243
             EA+ L  F+L     V       VL AL    +   A+ +  ++  +   +     +DL 
Sbjct  575   EAQKLADFALDRDFDVSFSTYDRVLEALYAEEKTLPAYSMLCKIKNKGGVVSQKGCDDLM  634

Query  2244  LRLEVEGRSKEAEFVAK  2294
               L+ EG SK+A+ +++
Sbjct  635   ESLKSEGYSKQADILSR  651



>gb|ACU25641.1| pentatricopeptide repeat-containing protein [Bouchea fluminensis]
Length=481

 Score =   286 bits (733),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 159/469 (34%), Positives = 260/469 (55%), Gaps = 18/469 (4%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             K    AL+FF W E+   F    + + +++E+LG    LN AR  L  +PK+    +  +
Sbjct  23    KNSEHALQFFRWVERSNLFXHNRETHLKIIEILGRASKLNHARCILLDMPKK---GLEWD  79

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                +  +I +Y  AG+ QES+K+F  M+ +G+  ++ +++ LF ++++RGR  M    F+
Sbjct  80    EDLWVLMIDSYGKAGIVQESVKMFQKMEELGVXRTIKSYDALFKVILRRGRYMMAKRYFN  139

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFN++I G  ++  V+   RFF +M   E  PDV+TYNT+++G  R 
Sbjct  140   KMLSE-GIEPTRHTFNVMIWGFFLSGKVETSNRFFXDMXSREITPDVVTYNTMINGYYRV  198

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              K+E        M  KG ++ P VVTYTTL++GY    +V++AL + +EM   G +PN++
Sbjct  199   BKMEEXEKYFVEM--KGRNIEPTVVTYTTLIKGYXSVDRVDBALXLXEEMKXFGIKPNAI  256

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL +A K  + + + K          D   F  LI   C  G+L AA +  + 
Sbjct  257   TYSTLLPGLCDAEKMSEARSILKEMVXKYXAPTDNSIFMRLISGQCKVGDLDAAADVJKA  316

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPV------VAA  1505
             M  L+   ++  Y +LI   C+ G ++ A K  D++ +      D   RP        +A
Sbjct  317   MIRLSIPTEAGHYGVLIEXYCKAGQYDKAVKLLDKVIE-----KDIISRPQNTLXMEPSA  371

Query  1506  YNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLR  1685
             YN + +YLC NG+T KAE + R+LM++GVQDP    TLI G+  EG  +   ELL  MLR
Sbjct  372   YNXLIEYLCNNGQTAKAETLVRZLMKLGVQDPTALNTLIRGHSXEGSPDSAFELLKIMLR  431

Query  1686  RNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSIL  1832
             R    +   Y+ L +  L++ +P  A   L+ M+++ HLP + +F S++
Sbjct  432   RKVDSEQXAYDXLXQSYLKKXEPAXAKAALDSMIENGHLPDSSLFRSVM  480



>ref|NP_001130930.1| uncharacterized protein LOC100192035 [Zea mays]
 gb|ACG28903.1| hypothetical protein [Zea mays]
 gb|ACL53228.1| unknown [Zea mays]
 gb|AFW69759.1| hypothetical protein ZEAMMB73_548432 [Zea mays]
Length=748

 Score =   293 bits (751),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 190/617 (31%), Positives = 316/617 (51%), Gaps = 14/617 (2%)
 Frame = +3

Query  462   ALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFF  635
             AL+FF +A ++G F+     +  ++  L + R LN AR  +  ++P  S   V  +    
Sbjct  120   ALQFFRFAYRRGGFSPEGATFALLVPALASRRMLNHARCLVLDTMPSFS---VAPDEPTL  176

Query  636   NSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLK  815
              +LI  Y  A + QE++KLF  M  IG+  + +++N +   ++ RGR  M   +++ M+ 
Sbjct  177   AALISAYGRAAIPQEAVKLFRMMPNIGVPRTALSYNAVLKAILCRGREAMARRIYNAMIA  236

Query  816   TFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVE  995
               GV PD+ T+N LI G  +   ++   R F +M+ H   PDV TYNT+++   RAG +E
Sbjct  237   D-GVAPDVSTYNTLIWGFGLCKKMETAVRVFGDMKGHGVTPDVTTYNTLLNAWVRAGDLE  295

Query  996   IAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNT  1175
              A  V   M  +G++   N V+Y  +++GY E  +VEEA+ +F EM ++G   +  T+  
Sbjct  296   SARKVFDEMAGEGTER--NSVSYNVMIKGYVEGNRVEEAVALFAEMAEKGLRLSEKTFAA  353

Query  1176  LIQGLLEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             L+ GL + +   +V E  K   +  + R  P D   F  L+ T C  G+L  ALE   K 
Sbjct  354   LMPGLCDDQ--GRVAEARKAVDDMAERRLTPKDKSVFLRLVTTLCKAGDLDGALEVHWKS  411

Query  1347  SIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFK  1523
                 +   D   Y +L+  LC  G  E A +  DEL + GTLLS        +AYNP+ +
Sbjct  412   GQFKHVLVDPRQYGVLMEGLCAGGKCETAIEVLDELMEKGTLLSPKSPVLEASAYNPVIE  471

Query  1524  YLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPD  1703
             +LC NG T KAE  FRQLM+ GV D   F +LI G+  EG+ E   E+L  M RR    D
Sbjct  472   FLCSNGSTAKAETFFRQLMKKGVDDKAAFNSLIRGHAKEGVPEAAQEILAIMTRREVPTD  531

Query  1704  FETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVV  1883
              E++  L++  L++ +P  A   L+ M++  HLP   +F S++  L         + ++ 
Sbjct  532   PESHALLVDSFLKKNEPADAKTALDSMMQQGHLPSPALFKSVMEALFNDGRVQTASRVMK  591

Query  1884  LMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLS  2063
              M+ K + +N++++   +  LF  G  E A   +  + +NG + ++ +L+V L    ++ 
Sbjct  592   SMIEKGVTENMDVAHKILEALFTRGHVEEAIGRVNLMVENGCMPDLDKLLVGLCDNGRVM  651

Query  2064  EARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLR  2243
             EA+ L  F+L     V       VL AL    +   A+ +  ++  +   +     +DL 
Sbjct  652   EAQKLADFALDRDFDVSFSTYDRVLEALYAEEKTLPAYSMLCKIKNKGGVVSQKGCDDLM  711

Query  2244  LRLEVEGRSKEAEFVAK  2294
               L+ EG SK+A+ +++
Sbjct  712   ESLKSEGYSKQADILSR  728



>ref|XP_003571864.2| PREDICTED: pentatricopeptide repeat-containing protein At2g37230 
[Brachypodium distachyon]
Length=753

 Score =   293 bits (750),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 199/635 (31%), Positives = 322/635 (51%), Gaps = 24/635 (4%)
 Frame = +3

Query  423   VIHSIRLLKTPRKALKFFVWAEQK-GFALTSQCYFRMLELLGTERNLNTARNFLF-SIPK  596
             VI S         AL+FF +A ++ GF      +  ++ +L + R LN AR  L  ++P 
Sbjct  112   VISSAAAANRADLALQFFRFAYRRAGFRPEPATFSLLIPVLASNRMLNHARCILLETMPA  171

Query  597   RSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGR  776
              S    P EA    +L+  Y  A + QE++KLF  M  +GI+ + +++N +   ++ RGR
Sbjct  172   FS--VSPDEATV-AALVAAYGKARIPQEAVKLFRLMPELGITRTALSYNAVLKAILCRGR  228

Query  777   TGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
               M   +++ M+   GV PDL T+N LI G  ++  ++   R F +M+ H   PDV TYN
Sbjct  229   EAMARRIYNAMIAD-GVAPDLSTYNTLIWGFGLSEKMEAAVRVFGDMKGHGVTPDVTTYN  287

Query  957   TIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMV  1136
              +++   R G +E A  V   M   G+    N V+Y  +++GY E +KVEEA+ +FKEM 
Sbjct  288   NLINAWVRNGDLESARKVFDEM--PGAGFERNSVSYNVMIKGYVEAKKVEEAVGLFKEMG  345

Query  1137  DRGPEPNSVTYNTLIQGL-------LEARKFDKVKELFKGAGEDGRFVP-DTCTFNTLIH  1292
             ++G   +  T+  L+ GL        EARK   V+++      + R  P D   F  L+ 
Sbjct  346   EKGLRSSEKTFAALMPGLCDDQGRTAEARK--AVEDM-----AERRLTPKDKTVFLRLVT  398

Query  1293  THCSDGNLKAALEAFEKMSIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTL  1469
             T C  G+L  ALE  +K     +   D   Y +L++ LC  G  + A +  DEL + GTL
Sbjct  399   TLCKAGDLDGALEVHKKSGQFKHVLVDPRQYGVLMQSLCAGGKCDGAVEVLDELLEKGTL  458

Query  1470  LSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMS  1649
             LS         AYNP+ +YLC NG TKKAE  FRQLM+ GV D L F +LI G+  EG+ 
Sbjct  459   LSPKSPVLEAPAYNPVIEYLCNNGNTKKAETFFRQLMKKGVDDKLAFNSLIRGHAKEGVL  518

Query  1650  EDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSI  1829
             E   E+L  M RR    D  ++  L++  L++ +P  A   L+ M++  HLP   +F S+
Sbjct  519   EAAQEILAIMTRRGVPTDPISHTLLVDSFLKKNEPADAKTALDSMMEQGHLPSPALFKSV  578

Query  1830  LTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGY  2009
             +  L         + ++  M+ K + +N++++   +  LF  G  + A   +  + +NG 
Sbjct  579   MVALFDDGRVQTASRVMRSMIEKGVTENMDMAHKILEALFMRGHVDEAIGRVNLMVENGC  638

Query  2010  LVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYY  2189
             + ++ +L+V L Q  K+ EA  L  F+L     V       VL AL    +   A+ +  
Sbjct  639   MPDLDKLLVALCQKDKVMEAHKLADFALDRDFEVSFSTYDKVLEALYTEEKTLPAYSMLC  698

Query  2190  ELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAK  2294
             ++  +   +     + L   L+ EG SK+A+ +++
Sbjct  699   KIKHKGGVVDQKGCDALMDSLKAEGYSKQADILSR  733



>gb|KHG24728.1| Anaphase-promoting complex subunit cdc20 [Gossypium arboreum]
Length=339

 Score =   206 bits (525),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 139/202 (69%), Gaps = 11/202 (5%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIV-----  3111
             LWN+ +  I +L    +  + +P+SI WS +A+TL VG   S +QLWDAE+SK+V     
Sbjct  36    LWNSVDQRIHKLFHVREEDN-WPTSITWSEEARTLAVGYTCSNLQLWDAESSKLVSSLFL  94

Query  3110  -----RCLKGHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLK  2946
                  R L+GH  R+ S AWNGH+LTSGS D+SII+HD+R  N L S +K H+ EVCGLK
Sbjct  95    YSFTIRSLQGHSERITSTAWNGHILTSGSRDKSIINHDIRARNHLASCIKKHSDEVCGLK  154

Query  2945  WSGTGNFLVSGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGT  2766
             WS  G+ L SGG++  +YIW+  KMSS  +LH F DH AAVKALAWCPY ++VLASGGG 
Sbjct  155   WSNEGDRLASGGSEKQLYIWEASKMSSSKFLHLFTDHYAAVKALAWCPYQHNVLASGGGW  214

Query  2765  FDGCIKMWSIRKGACISSTFSK  2700
              D CI++W+ +KG CI S  +K
Sbjct  215   NDRCIRIWNTQKGICIHSIETK  236


 Score =   124 bits (311),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QI GL+WN+HHKE+LS HG+   G+   KLCLW+YPSM+K+ +  NH  R ++L QSPDG
Sbjct  238   QISGLEWNRHHKEILSSHGYST-GEDQNKLCLWKYPSMTKVGEFGNHEPRIINLCQSPDG  296

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
             +TVVSA ADETLRFW++FGPP    S  S+   L S + S IR
Sbjct  297   VTVVSAVADETLRFWDVFGPPMTGTSMASNLQGLFSSRNSLIR  339



>ref|XP_008780268.1| PREDICTED: cell division cycle 20.1, cofactor of APC complex-like 
[Phoenix dactylifera]
Length=416

 Score =   210 bits (535),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             +P+S+AWS D K L VG ASS+I+LWD  +S+ VR L+GH  RVGS++WN ++LTSGS +
Sbjct  145   HPTSVAWSGDGKRLAVGFASSRIELWDVASSRQVRILEGHTSRVGSLSWNQNILTSGSLE  204

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
              SII+HDVR     ++ L+ HT EVCGL+WSG G+ L SGGNDNLV++W++  M S  YL
Sbjct  205   ASIINHDVRSIGRSVTRLQGHTDEVCGLRWSGAGDLLASGGNDNLVHVWESSSMGSSKYL  264

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             H+F DH AAV+ALAWCP+  ++LASGGGT D CIK+W+ R G C  S
Sbjct  265   HKFTDHCAAVRALAWCPFQSNILASGGGTADRCIKIWNARTGKCTKS  311


 Score =   116 bits (291),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 7/105 (7%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C L+WNKH KE+LS HG+ +      +L LW YPSMSKI D   H +R LHLSQSPDG
Sbjct  317   QVCALEWNKHQKEILSAHGYSQ-----NQLSLWSYPSMSKIVDLRGHEARVLHLSQSPDG  371

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDN--LLSLKTSPIR  2375
              TV SA ADE++RFW++F PP +  SR  D D+  LLSLK   IR
Sbjct  372   STVASAAADESIRFWKVFEPPPSAFSRKRDEDDTSLLSLKRLHIR  416



>ref|XP_006646772.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37230-like 
[Oryza brachyantha]
Length=744

 Score =   289 bits (739),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 204/661 (31%), Positives = 332/661 (50%), Gaps = 20/661 (3%)
 Frame = +3

Query  342   LIKFQPWSPQTEsslsalagpslsETT--VIHSIRLLKTPRKALKFFVWAEQK-GFALTS  512
             +I+ +PW+ + E+S+  L+    +     VI           AL+FF +A ++ GF+   
Sbjct  74    MIRRRPWTTRLENSIRLLSPTFAAPLVHDVISGAAAAGRADLALQFFRFAYRRAGFSPEP  133

Query  513   QCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLK  689
               +  ++ +L + R LN AR  L  ++P  S    P EA    +LI  Y  A + QES+K
Sbjct  134   ATFSLLIPILASRRMLNHARCLLLETMPSFS--IAPEEATV-AALIAAYGKANIPQESVK  190

Query  690   LFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGC  869
             LF  M  +GI+ + +++N +   ++ RGR  M   +++ M+   GV PDL T+N LI G 
Sbjct  191   LFRLMPELGIARTALSYNAVLKAILCRGREAMARRIYNSMIAD-GVTPDLSTYNTLIWGF  249

Query  870   CMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSP  1049
              +   ++   R F +M+ H   PDV TYNT+++   RAG +E A  V   M   G+  + 
Sbjct  250   GLCKKMEAALRVFGDMKGHGVTPDVTTYNTLLNAWVRAGDLESARKVFDEM--PGAGFAQ  307

Query  1050  NVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLL--EARKFDKVKE  1223
             N V Y  +++GY E  KVEEA+ +F EM ++G   +  T+  L+ GL   E R  +  K 
Sbjct  308   NSVAYNVMIKGYVEAGKVEEAVGLFSEMGEKGLRLSEKTFAALMPGLCDDEGRVAEARKA  367

Query  1224  LFKGAGEDGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSIL-NAAPDSATYSILIR  1397
             L   A  + R  P D   F  L+ T C  G+L  ALE   K     +   D   Y +L+ 
Sbjct  368   LDDMA--ERRLTPKDKSVFLRLVTTFCRAGDLDGALEVHRKSGQFKHVLVDPRQYGVLME  425

Query  1398  CLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV--AAYNPMFKYLCENGKTKKAEKVFR  1571
              LC  G  + A +  DEL + G+LLS     PV+   AYNP+ +YLC NG T KAE  FR
Sbjct  426   SLCAGGKCDGAVEVLDELLEKGSLLSPKS--PVLEGPAYNPVIEYLCSNGNTNKAETFFR  483

Query  1572  QLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGK  1751
             QLM+ G+ D   F +LI G+  EG+ E   E+L  M RR    D E++  L++  L++  
Sbjct  484   QLMKKGIDDKAAFNSLIRGHAKEGVPEAAQEILAIMTRRGVGTDPESHALLVDSFLKKNG  543

Query  1752  PRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTD  1931
             P  A   L+ M++  H+P T +F S++  L         + ++  M+ K + +N++++  
Sbjct  544   PADAKTALDGMMEQGHVPSTALFMSVMVALFNDGRIQTASRVMKSMIEKGVTENMDMAHK  603

Query  1932  TVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSV  2111
              ++ LF  G  E A   +  + +NG   ++ +L+V L +  K+ EA  L  F+L     +
Sbjct  604   ILQALFMRGHVEEAIGRVNLMVENGCFPDLDKLLVALCENDKVMEAHKLADFALDRDFDI  663

Query  2112  CIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVA  2291
                    VL AL    +   A+ +  ++  +   +     + L   L+  G SK+A+ + 
Sbjct  664   SFSTYDRVLEALYTEEKTLPAYSMLCKIKNKGGVVDQKGCDALMESLKAGGYSKQADILT  723

Query  2292  K  2294
             +
Sbjct  724   R  724



>gb|EMT27270.1| hypothetical protein F775_52113 [Aegilops tauschii]
Length=718

 Score =   288 bits (736),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 189/614 (31%), Positives = 308/614 (50%), Gaps = 14/614 (2%)
 Frame = +3

Query  471   FFVWAEQK-GFALTSQCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFFNSL  644
             FF +A ++ GF      +  ++ +L ++  LN AR  L  ++P  S   +P E     +L
Sbjct  93    FFRFAYRRAGFRPEPATFALLVPILASKSMLNHARCILLETMPSFS---IPPEEATVAAL  149

Query  645   IKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFG  824
             +  Y  AG+ QE++KLF  M  +GI+ + +++N +   ++ RGR  M   +++ M+   G
Sbjct  150   VAAYGKAGIPQEAVKLFRLMPELGIARTALSYNAVLKAILCRGREAMARRIYNAMIAD-G  208

Query  825   VKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAH  1004
             V PDL T+N LI G  +   ++   R F++M+ H   PDV TYNT+++   R G +E   
Sbjct  209   VVPDLSTYNTLIWGFGLCKKMESAVRVFEDMKDHGVTPDVTTYNTLLNAWVRTGDMESVR  268

Query  1005  NVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQ  1184
              V   M   G     N ++Y  +++GY E  KVEEA+ +FKEM ++G   +  T+  L+ 
Sbjct  269   KVFDEMPVAG--FERNSISYNVMIKGYVEANKVEEAVGLFKEMGEKGLRLSEKTFAALMP  326

Query  1185  GLLEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSIL  1355
             GL +     K  E  K   +  + R  P D   F  L+ T C  G+L  ALE  +K    
Sbjct  327   GLCDDE--GKAAEARKAVEDMAERRLTPKDKSVFLRLVSTLCKAGDLDGALEVHKKSGQF  384

Query  1356  -NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLC  1532
              +   D   Y +L+  LC  G  + A +  DEL + GTLLS         AYNP+ +YLC
Sbjct  385   KHVLVDPRQYGVLMESLCAGGKCDRAVEVLDELLEKGTLLSPKSPVLEAPAYNPVIEYLC  444

Query  1533  ENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFET  1712
              NG T KAE  FRQLM+ GV D   F +LI G+  EG  E   E+L  M RR    D  +
Sbjct  445   NNGNTNKAETFFRQLMKKGVDDKSAFNSLIRGHAKEGALEAAKEILSIMTRRGVPTDPHS  504

Query  1713  YESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLML  1892
             +  L++  L++ +P  A   L+ M+   HLPR  +F S++  L         + ++  M+
Sbjct  505   HALLIDSFLKKNEPADAKTALDSMMVHGHLPRPALFQSVMVSLFNDGRVQTASRVMKSMI  564

Query  1893  VKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEAR  2072
              K + +N++++   +  LF  G  E A   +  + +NG++ ++ +L+V L Q  K+ EA 
Sbjct  565   EKGVTENMDMAHMILEALFMRGHVEEAIGRVNLMVENGFVPDLDKLLVSLCQKDKVMEAH  624

Query  2073  DLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRL  2252
              L  F+L     V       VL AL    +   A+ +  ++  +   +     + L   L
Sbjct  625   KLADFALDRDFEVSFSTYDKVLEALYTEEKTLPAYSMLCKIKHKGGVVDQKGCDALMDSL  684

Query  2253  EVEGRSKEAEFVAK  2294
             +  G SK+A+ +++
Sbjct  685   KAGGYSKQADILSR  698



>ref|NP_001045649.1| Os02g0110400 [Oryza sativa Japonica Group]
 dbj|BAD07836.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
 dbj|BAF07563.1| Os02g0110400 [Oryza sativa Japonica Group]
 dbj|BAG93340.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56160.1| hypothetical protein OsJ_05062 [Oryza sativa Japonica Group]
Length=747

 Score =   288 bits (737),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 205/667 (31%), Positives = 335/667 (50%), Gaps = 32/667 (5%)
 Frame = +3

Query  342   LIKFQPWSPQTEsslsalagpslsETT--VIHSIRLLKTPRKALKFFVWAEQK-GFALTS  512
             +I+ +PW+ + E+S+  L+    +     VI           AL+FF +A ++ GF+   
Sbjct  77    MIRRRPWTTRLENSIRLLSPTLAAPLVHGVISGAAAAGRADLALQFFRFAYRRAGFSPEP  136

Query  513   QCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLK  689
               +  ++ +L + R LN AR  L  ++P  S    P EA    +LI  Y  A + QES+K
Sbjct  137   ATFSLLIPILASHRMLNHARCILLDTMPSFS--IAPEEATV-AALIAAYGKANIPQESVK  193

Query  690   LFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGC  869
             LF  M  +GI+ + +++N +   ++ RGR  M   +++ M+    V PDL T+N LI G 
Sbjct  194   LFRLMPDLGIARTALSYNAVLKAILCRGREAMARRIYNAMIAD-AVTPDLSTYNTLIWGF  252

Query  870   CMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSP  1049
              +   ++   R F +M+ H   PDV TYNT+++   RAG +E A  V   M   G+  + 
Sbjct  253   GLCKKMEAALRVFGDMKDHGVTPDVTTYNTLLNAWVRAGDLESARKVFDEM--PGAGFAQ  310

Query  1050  NVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGL-------LEARK-  1205
             N V+Y  +++GY E  KVEEA+ +F EM ++G   +  T+  L+ GL       +EARK 
Sbjct  311   NSVSYNVMIKGYVEAGKVEEAVGLFSEMGEKGLRLSEKTFAALMPGLCDDEGRVVEARKA  370

Query  1206  FDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSIL-NAAPDSAT  1379
              D + E         R  P D   F  L+ T C  G+L  AL+  +K     +   D   
Sbjct  371   MDDMAER--------RLTPKDKSVFLRLVTTLCRAGDLDGALDVHQKSGQFKHVLVDPRQ  422

Query  1380  YSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV--AAYNPMFKYLCENGKTKK  1553
             Y +L+  LC  G  + A +  DEL + GTLLS     PV+   AYNP+ +YLC NG T K
Sbjct  423   YGVLMESLCAGGKCDGAVEVMDELLEKGTLLSPKS--PVLEGPAYNPVIEYLCSNGNTSK  480

Query  1554  AEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEG  1733
             AE  FRQLM+ GV D   F +LI G+  EG+ E   E+L  M RR    D E++  L++ 
Sbjct  481   AETFFRQLMKKGVDDKAAFNSLIRGHAKEGVPEAAQEILAIMTRRGVRTDPESHALLVDS  540

Query  1734  LLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQN  1913
              L++ +P  A   L+ M++  H+P   +F S++  L         + ++  M+ K + +N
Sbjct  541   FLKKNEPADAKTALDSMMEQGHVPSPSLFMSVMVALFNSGRVQTASRVMKSMIEKGVTEN  600

Query  1914  INLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSL  2093
             ++++   +  LF  G  E A   +  + +NG L ++ +L++ L +  K+ EA  L  F+L
Sbjct  601   MDMAHKILEALFMRGHVEEAIGRVNLMVENGCLPDLDKLLIALCENDKVMEAHKLADFAL  660

Query  2094  KNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSK  2273
                  V       VL AL    +   A+ +  ++  +   +     + L   L+  G SK
Sbjct  661   DRDFDVSFSTYDRVLEALYTEEKTLPAYSMLCKIKNKGGVVDQKGCDALMDSLKAGGYSK  720

Query  2274  EAEFVAK  2294
             +A+ +++
Sbjct  721   QADILSR  727



>ref|XP_008777075.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Phoenix dactylifera]
Length=459

 Score =   209 bits (532),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N G  +L  E + ++D+P+S+AWS D K L  G ASS+I+LWD   S+ VR L+G
Sbjct  168   LWNAEN-GEVKLLLEANEEEDHPTSVAWSGDGKILAAGFASSRIELWDVAASRQVRILEG  226

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS+AWN ++LTSGS D SII+HDVR      +  + HT EVCGL+WSG G+ L S
Sbjct  227   HTSRVGSLAWNRNILTSGSLDASIINHDVRSIGRSATHFQGHTDEVCGLRWSGAGDLLAS  286

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNLV++WD+  M S  YL +F DH AAV+ALAWCP+  ++LASGGGT D CIK+W+ 
Sbjct  287   GGNDNLVHVWDSSSMGSSKYLRKFTDHCAAVRALAWCPFQSNILASGGGTADRCIKIWNA  346

Query  2735  RKGACISS  2712
             R G C  S
Sbjct  347   RTGKCTKS  354


 Score =   117 bits (292),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 7/107 (7%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L+WN+HHKE+LS HG+ +      +L LW YPSMSKI D   H +R LHL+QSP
Sbjct  358   GAQVCALEWNRHHKEILSAHGYSQ-----FQLSLWSYPSMSKIVDLRGHEARVLHLTQSP  412

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDNL--LSLKTSPIR  2375
             DG TVVSA ADE++ FW++FGPP +  SR  D D    LSLK   IR
Sbjct  413   DGSTVVSAAADESICFWKVFGPPPSASSRMCDEDYTGHLSLKRFDIR  459



>ref|XP_002453150.1| hypothetical protein SORBIDRAFT_04g000850 [Sorghum bicolor]
 gb|EES06126.1| hypothetical protein SORBIDRAFT_04g000850 [Sorghum bicolor]
Length=757

 Score =   287 bits (735),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 188/617 (30%), Positives = 311/617 (50%), Gaps = 14/617 (2%)
 Frame = +3

Query  462   ALKFFVWAEQKG-FALTSQCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFF  635
             AL+FF +A ++G F      +  ++  L + R LN AR  +  ++P  S   V  +    
Sbjct  128   ALQFFRFAYRRGGFRPDGDTFALLVPALASRRMLNHARCLVLDTMPSFS---VAPDEPTL  184

Query  636   NSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLK  815
              +LI  Y  A + QE++KLF  M  +G+  + +++N +   ++ RGR  M   +++ M+ 
Sbjct  185   AALISAYGRAAIPQEAVKLFRMMPDLGVPRTALSYNAVLKAILCRGREAMARRIYNAMIA  244

Query  816   TFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVE  995
               GV PD+ T+N LI G  +   ++   R F EM+ H   PDV TYN +++   R G +E
Sbjct  245   D-GVAPDVSTYNTLIWGFGLCKKMETAVRVFGEMKGHGVTPDVTTYNALLNAWVRTGDLE  303

Query  996   IAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNT  1175
              A  V   M  KG  +  N V+Y  +++GY E  +VEEA+ +F EM ++G   +  T+  
Sbjct  304   SARKVFDEMTGKG--IERNSVSYNVMIKGYVEGNRVEEAVALFAEMGEKGLRLSEKTFAA  361

Query  1176  LIQGLLEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             L+ GL + +   +  E  K   +  + R  P D   F  L+ T C  G+L  ALE   K 
Sbjct  362   LMPGLCDDQ--GRAAEARKAVDDMAERRLTPKDKSVFLRLVTTLCKAGDLDGALEVHRKS  419

Query  1347  SIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFK  1523
                 +   D   Y +L+  LC  G  EMA +  DEL + GTLLS        +AYNP+ +
Sbjct  420   GQFKHVLVDPRQYGVLMEGLCAGGKSEMAIEVLDELMEKGTLLSPKSPVLEASAYNPVIE  479

Query  1524  YLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPD  1703
             +LC NG T KAE  FRQLM+ GV D   F +LI G+  EG+ E   E+L  M RR    D
Sbjct  480   HLCSNGSTTKAETFFRQLMKKGVDDKAAFNSLIRGHAKEGVPEAAQEILAIMTRREVPTD  539

Query  1704  FETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVV  1883
              E++  L++  L++ +P  A   L+ M++  HLP   +F S++  L         + ++ 
Sbjct  540   PESHVLLVDSFLKKNEPADAKTALDSMMQHGHLPSPALFKSVMEALFNDGRIQTASRVMK  599

Query  1884  LMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLS  2063
              M+ K + +N++++   +  LF  G  E A   +  + +NG + ++ +L+V L    ++ 
Sbjct  600   SMIEKGVTENMDMAHKILEALFTRGHVEEAIGRVNLMVENGCMPDLDKLLVGLCDNDRVM  659

Query  2064  EARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLR  2243
             EA+ L  F+L     V       VL AL    +   A+ +  ++  +   +     + L 
Sbjct  660   EAQKLADFALDRDFDVSFSTYDRVLEALYAEEKTLPAYSMLCKIKNKGGVVDQKGCDALM  719

Query  2244  LRLEVEGRSKEAEFVAK  2294
               L+ EG SK+A+ +++
Sbjct  720   ESLKSEGYSKQADILSR  736



>gb|EPS65130.1| hypothetical protein M569_09650, partial [Genlisea aurea]
Length=354

 Score =   197 bits (500),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 138/199 (69%), Gaps = 9/199 (5%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK-  3099
             LWNA  H        E+  ++YP S+AWS D K++ VG + SKIQL+D ET + VR  K 
Sbjct  32    LWNADTH--LTELLSEERGNEYPCSVAWSQDGKSIAVGYSCSKIQLFDCETLRPVRKFKI  89

Query  3098  ----GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTG  2931
                 GH  RV S+AWNGH LTSGS DR II+ DVR  NS+   +K H  EVCGLKWS TG
Sbjct  90    CFTDGHHKRVASVAWNGHNLTSGSRDR-IINQDVRARNSIGCNIKPHRGEVCGLKWSTTG  148

Query  2930  NFLVSGGNDNLVYIWDTFKMSSR-DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGC  2754
              +L +G ND+ VYIWD  KM S+ DY   F++H AAVKALAWCP++++V+ASGGGT DGC
Sbjct  149   RYLATGANDHRVYIWDASKMRSKQDYTLCFDEHCAAVKALAWCPFDHNVIASGGGTEDGC  208

Query  2753  IKMWSIRKGACISSTFSKN  2697
             +K+W+++ G CIS+  S++
Sbjct  209   VKVWNLKNGRCISNFDSRS  227


 Score =   126 bits (317),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             QICGLQWN+HHKE++S HG+G   D   +LCL +YPSMS I +S    +R LHLSQSPDG
Sbjct  252   QICGLQWNRHHKEIVSAHGYGHE-DYRNRLCLLKYPSMSCIWESPQQRARVLHLSQSPDG  310

Query  2503  LTVVSAGADETLRFWEIFGPPQAD-KSRTSDFDNLLSLKTSPIR  2375
             L+ VSA  D T+RFWE+FGPP  D +S  S F++LLSL  +P+R
Sbjct  311   LSAVSAVEDATIRFWEVFGPPATDCRSSNSSFESLLSLTATPLR  354



>ref|XP_010934406.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Elaeis guineensis]
Length=442

 Score =   212 bits (539),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N  ++ L    + +D +P+S+AWS D KTL VG ASS+I+LWD  +S+ VR L+G
Sbjct  151   LWNAENSEVKLLRRVNEEED-HPTSVAWSGDGKTLAVGFASSRIELWDVASSRQVRILEG  209

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS++WN + LTSGS D SII+HDVR        ++ HT EVCGL+WSG G+ L S
Sbjct  210   HTSRVGSLSWNRNTLTSGSRDASIINHDVRSIGRSTPHIRGHTEEVCGLRWSGDGDLLAS  269

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNLV++W+   M S  YLH+F DH AAV+ALAWCP+  ++LASGGGT D CIK+W+ 
Sbjct  270   GGNDNLVHVWEPSNMGSSKYLHKFTDHCAAVRALAWCPFQSNILASGGGTADRCIKIWNA  329

Query  2735  RKGACISS  2712
             R G C  S
Sbjct  330   RTGKCTKS  337


 Score =   111 bits (277),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 70/105 (67%), Gaps = 7/105 (7%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C L+WN+H KE+LS HG+        +L LW YPSMSKI D   HA+R LHL+QS DG
Sbjct  343   QVCALEWNRHQKEILSAHGYS-----WNQLSLWAYPSMSKIVDLSGHAARVLHLTQSLDG  397

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDN--LLSLKTSPIR  2375
              TVVSA ADET+RFW++F PP    SR  D +N   LSLK   IR
Sbjct  398   STVVSAAADETIRFWKVFEPPPLAFSRMRDEENTSFLSLKRLHIR  442



>gb|EEC72333.1| hypothetical protein OsI_05540 [Oryza sativa Indica Group]
Length=747

 Score =   285 bits (728),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 204/667 (31%), Positives = 334/667 (50%), Gaps = 32/667 (5%)
 Frame = +3

Query  342   LIKFQPWSPQTEsslsalagpslsETT--VIHSIRLLKTPRKALKFFVWAEQK-GFALTS  512
             +I+ +PW+ + E+S+  L+    +     VI           AL+FF +A ++ GF+   
Sbjct  77    MIRRRPWTTRLENSIRLLSPTLAAPLVHGVISGAAAAGRADLALQFFRFAYRRAGFSPEP  136

Query  513   QCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLK  689
               +  ++ +L +   LN AR  L  ++P  S    P EA    +LI  Y  A + QES+K
Sbjct  137   ATFSLLIPILASHSMLNHARCILLDTMPSFS--IAPEEATV-AALIAAYGKANIPQESVK  193

Query  690   LFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGC  869
             LF  M  +GI+ + +++N +   ++ RGR  M   +++ M+    V PDL T+N LI G 
Sbjct  194   LFRLMPDLGIARTALSYNAVLKAILCRGREAMARRIYNAMIAD-AVTPDLSTYNTLIWGF  252

Query  870   CMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSP  1049
              +   ++   R F +M+ H   PDV TYNT+++   RAG +E A  V   M   G+  + 
Sbjct  253   GLCKKMEAALRVFGDMKDHGVTPDVTTYNTLLNAWVRAGDLESARKVFDEM--PGAGFAQ  310

Query  1050  NVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGL-------LEARK-  1205
             N V+Y  +++GY E  KVEEA+ +F EM ++G   +  T+  L+ GL       +EARK 
Sbjct  311   NSVSYNVMIKGYVEAGKVEEAVGLFSEMGEKGLRLSEKTFAALMPGLCDDEGRVVEARKA  370

Query  1206  FDKVKELFKGAGEDGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSIL-NAAPDSAT  1379
              D + E         R  P D   F  L+ T C  G+L  AL+  +K     +   D   
Sbjct  371   MDDMAER--------RLTPKDKSVFLRLVTTLCRAGDLDGALDVHQKSGQFKHVLVDPRQ  422

Query  1380  YSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVV--AAYNPMFKYLCENGKTKK  1553
             Y +L+  LC  G  + A +  DEL + GTLLS     PV+   AYNP+ +YLC NG T K
Sbjct  423   YGVLMESLCAGGKCDGAVEVMDELLEKGTLLSPKS--PVLEGPAYNPVIEYLCSNGNTSK  480

Query  1554  AEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEG  1733
             AE  FRQLM+ GV D   F +LI G+  EG+ E   E+L  M RR    D E++  L++ 
Sbjct  481   AETFFRQLMKKGVDDKAAFNSLIRGHAKEGVPEAAQEILAIMTRRGVRTDPESHALLVDS  540

Query  1734  LLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQN  1913
              L++ +P  A   L+ M++  H+P   +F S++  L         + ++  M+ K + +N
Sbjct  541   FLKKNEPADAKTALDSMMEQGHVPSPSLFMSVMVALFNGGRVQTASRVMKSMIEKGVTEN  600

Query  1914  INLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSL  2093
             ++++   +  LF  G  E A   +  + +NG L ++ +L++ L +  K+ EA  L  F+L
Sbjct  601   MDMAHKILEALFMRGHVEEAIGRVNLMVENGCLPDLDKLLIALCENDKVMEAHKLADFAL  660

Query  2094  KNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSK  2273
                  V       VL AL    +   A+ +  ++  +   +     + L   L+  G SK
Sbjct  661   DRDFDVSFSTYDRVLEALYTEEKTLPAYSMLCKIKNKGGVVDQKGCDALMDSLKAGGYSK  720

Query  2274  EAEFVAK  2294
             +A+ +++
Sbjct  721   QADILSR  727



>ref|XP_010907481.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Elaeis guineensis]
Length=459

 Score =   208 bits (529),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA    ++ L    D +D +P+S+AWS D KTL VG AS++I+LWD   S+ VR L+G
Sbjct  168   LWNAEKREVKLLRRVNDEED-HPTSVAWSGDGKTLAVGFASARIELWDVACSRQVRILEG  226

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS++WN + LTSGS D SII+HDVR        ++ H +EVCGL+WSG G+ L S
Sbjct  227   HTSRVGSLSWNRNTLTSGSRDASIINHDVRSIGGSAPCIRGHIKEVCGLRWSGAGDLLAS  286

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNLVYIW+   M S  YLH+F DH A V+ALAWCP+  ++LASGGGT D CIK+W+ 
Sbjct  287   GGNDNLVYIWEPSNMGSSKYLHKFTDHCAPVRALAWCPFQSNILASGGGTADRCIKIWNA  346

Query  2735  RKGACISS  2712
             R G C  S
Sbjct  347   RTGKCTKS  354


 Score =   113 bits (282),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 70/107 (65%), Gaps = 7/107 (7%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L+WN+H KE+LS HG     D   +L LW YPSMSK+ D   HA R LHL+QSP
Sbjct  358   GAQVCALEWNRHQKEILSAHG-----DNQNQLSLWAYPSMSKLVDLSGHAGRVLHLTQSP  412

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKSRTSDFDN--LLSLKTSPIR  2375
             DG TVVSA ADE LRFW++F PP    SR  D ++   LSLK   IR
Sbjct  413   DGSTVVSAAADEKLRFWKVFEPPPLAFSRMRDEEDTSFLSLKRLHIR  459



>gb|KHN12442.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=556

 Score =   278 bits (712),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 168/547 (31%), Positives = 293/547 (54%), Gaps = 13/547 (2%)
 Frame = +3

Query  702   MKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNS  881
             MK +G+  +V +++ LF ++++RGR  M    ++ ML    V+P  +T+NIL+ G  ++ 
Sbjct  1     MKELGVDRTVKSYDALFKVILRRGRYMMAKRYYNAMLNE-SVEPTRHTYNILLWGMFLSL  59

Query  882   MVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVT  1061
              +D   RF+++M+     PDV+TYNT+++G  R  KVE A  +   M  KG D+ PNV++
Sbjct  60    RLDTAVRFYEDMKSRGILPDVVTYNTLINGYFRFKKVEEAEKLFVEM--KGRDIVPNVIS  117

Query  1062  YTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAG  1241
             +TT+++GY    ++++AL VF+EM   G +PN+VT++TL+ GL +A K  + +++     
Sbjct  118   FTTMLKGYVAAGQIDDALKVFEEMKGCGVKPNAVTFSTLLPGLCDAEKMAEARDVLGEMV  177

Query  1242  EDGRFVP--DTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKG  1415
             E  R++   D   F  L+   C  G+L AA +  + M  L+   ++  Y +LI   C+  
Sbjct  178   E--RYIAPKDNAVFMKLMSYQCKAGDLDAAGDVLKAMIRLSIPTEAGHYGVLIENFCKAN  235

Query  1416  DFEMAEKFFDELFKTGTLLSDAGCRPVV------AAYNPMFKYLCENGKTKKAEKVFRQL  1577
              ++ AEK  D++ +   +L               +AYN M  YLCE+G+T KAE  FRQL
Sbjct  236   LYDKAEKLLDKMIEKEIVLRQKNAYETELFEMEPSAYNLMIGYLCEHGRTGKAETFFRQL  295

Query  1578  MRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGKPR  1757
             M+ GVQD ++F  LI G+  EG  +   E++  M RR    D ++Y  L+E  L++G+P 
Sbjct  296   MKKGVQDSVSFNNLICGHSKEGNPDSAIEIIKIMGRRGVARDADSYRLLIESYLRKGEPA  355

Query  1758  LAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTV  1937
              A   L+ ML+S HLP + ++ S++  L         + ++  M+ K +++N +L +  +
Sbjct  356   DAKTALDGMLESGHLPESSLYRSVMESLFDDGRVQTASRVMKSMVEKGVKENTDLVSKVL  415

Query  1938  RILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCI  2117
               L   G  E A   +  L  NG   +   L+  L + +K   A  LL F L+    +  
Sbjct  416   EALLMRGHVEEALGRIHLLMLNGCEPDFDHLLSVLCEKEKTIAALKLLDFVLERDCIIDF  475

Query  2118  EICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVAKR  2297
              I   VL AL  A +   A+ +  +++E+      +  ++L   L  EG +K+A+ +++ 
Sbjct  476   SIYDKVLDALLAAGKTLNAYSILCKILEKGGSTDWSSRDELIKSLNQEGNTKQADVLSRM  535

Query  2298  MPRLEGA  2318
             +   +G 
Sbjct  536   IKGTDGG  542


 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 114/460 (25%), Positives = 210/460 (46%), Gaps = 66/460 (14%)
 Frame = +3

Query  558   LNTARNFLFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVT  737
             L+TA  F   +  +S G +P +   +N+LI  Y      +E+ KLF  MK   I P+V++
Sbjct  61    LDTAVRFYEDM--KSRGILP-DVVTYNTLINGYFRFKKVEEAEKLFVEMKGRDIVPNVIS  117

Query  738   FNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEM  917
             F T+    +  G+     ++F+EM K  GVKP+  TF+ L+ G C    + +      EM
Sbjct  118   FTTMLKGYVAAGQIDDALKVFEEM-KGCGVKPNAVTFSTLLPGLCDAEKMAEARDVLGEM  176

Query  918   -EKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEK  1094
              E++    D   +  ++   C+AG ++ A +V+K M++    +      Y  L+  +C+ 
Sbjct  177   VERYIAPKDNAVFMKLMSYQCKAGDLDAAGDVLKAMIR--LSIPTEAGHYGVLIENFCKA  234

Query  1095  QKVEEALNVFKEMVDRGP---------------EPNSVTYNTLIQGLLEARKFDKVKELF  1229
                ++A  +  +M+++                 EP++  YN +I  L E  +  K +  F
Sbjct  235   NLYDKAEKLLDKMIEKEIVLRQKNAYETELFEMEPSA--YNLMIGYLCEHGRTGKAETFF  292

Query  1230  KGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQ  1409
             +   + G  V D+ +FN LI  H  +GN  +A+E  + M     A D+ +Y +LI    +
Sbjct  293   RQLMKKG--VQDSVSFNNLICGHSKEGNPDSAIEIIKIMGRRGVARDADSYRLLIESYLR  350

Query  1410  KGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMG  1589
             KG+   A+   D + ++G L       P  + Y  + + L ++G+ + A +V + ++  G
Sbjct  351   KGEPADAKTALDGMLESGHL-------PESSLYRSVMESLFDDGRVQTASRVMKSMVEKG  403

Query  1590  VQDPLTFKT------LIMGNRNEGMSE------DGHE---------------------LL  1670
             V++     +      L+ G+  E +        +G E                     LL
Sbjct  404   VKENTDLVSKVLEALLMRGHVEEALGRIHLLMLNGCEPDFDHLLSVLCEKEKTIAALKLL  463

Query  1671  VWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLK  1790
              ++L R+ + DF  Y+ +L+ LL  GK   AY  L ++L+
Sbjct  464   DFVLERDCIIDFSIYDKVLDALLAAGKTLNAYSILCKILE  503



>dbj|BAJ87147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   283 bits (723),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 189/617 (31%), Positives = 309/617 (50%), Gaps = 14/617 (2%)
 Frame = +3

Query  462   ALKFFVWAEQK-GFALTSQCYFRMLELLGTERNLNTARNFLF-SIPKRSNGAVPLEARFF  635
             +L+FF +A ++ GF      +  ++ +L ++  LN AR  L  ++P  S    P EA   
Sbjct  129   SLQFFRFAYRRAGFRPEPATFALLVPILASKGMLNHARCILLDTMP--SFSVCPDEATV-  185

Query  636   NSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLK  815
              +L+  Y  AG+ QE++KLF  M  +GI+ + +++N +   ++ RGR  M   +++ M+ 
Sbjct  186   AALVAAYGRAGIPQEAVKLFRLMPELGITRTALSYNAVLKAILCRGREAMARRVYNAMIA  245

Query  816   TFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVE  995
               GV P L T+N LI G  +   ++   R F +M+ H   PDV TYNT+++   R G +E
Sbjct  246   D-GVAPTLSTYNTLIWGFGLCKKMESAVRVFGDMKGHGVAPDVTTYNTLLNAWVRKGDLE  304

Query  996   IAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNT  1175
              A  V   M + G  L  N ++Y  +++GY +  KVEEAL +F EM ++G      T+  
Sbjct  305   SARKVFDEMPEAG--LERNSISYNVMIKGYVDANKVEEALGLFTEMGEKGLRLTEKTFAV  362

Query  1176  LIQGLLEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKM  1346
             L+ GL +     K  E  K   +  + R  P D   F  L+ T C  G+   ALE  +K 
Sbjct  363   LMPGLCDDE--GKAAEARKAVADMAERRLTPKDKSVFLRLVSTLCKAGDFDGALEVHKKS  420

Query  1347  SIL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFK  1523
                 +   D   Y +L+  LC  G  + A +  DEL + GTLLS         AYNP+ +
Sbjct  421   GQFKHVLVDPRQYGVLMESLCAGGKCDGAVQVLDELLEKGTLLSPKSPVLEAPAYNPVIE  480

Query  1524  YLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPD  1703
             YLC NG T KAE  FRQLM+ GV D   F +LI G+  EG  +   E+L  M RR    D
Sbjct  481   YLCNNGNTDKAETFFRQLMKKGVDDKSAFNSLIRGHAKEGALDAAKEILAIMTRRGVPTD  540

Query  1704  FETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVV  1883
               ++  L++  L++ +P  A   L+ M++  HLPR  +F S++  L         + ++ 
Sbjct  541   PHSHALLIDSFLKKNEPADAKTALDSMMEHGHLPRPALFQSVMAALFNDGRVQTASRVMK  600

Query  1884  LMLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLS  2063
              M+ K I +N++++   V  LF  G  E A   +  + +NG + ++ +L+  L +  K+ 
Sbjct  601   SMIEKGITENMDMANKIVEALFMRGHVEEAIGRVNLMVENGCMPDLDKLLAALCEKDKVM  660

Query  2064  EARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLR  2243
             EA+ L  F+L     V       VL AL    +   A+ +  ++  +   +     + L 
Sbjct  661   EAQKLADFALDRDFEVSFSTYDRVLEALYTEEKTLPAYSMLCKIKHKGGIVDQKGCDALM  720

Query  2244  LRLEVEGRSKEAEFVAK  2294
               L+  G SK+A+ +++
Sbjct  721   DSLKAGGYSKQADILSR  737



>gb|EMT33853.1| hypothetical protein F775_26591 [Aegilops tauschii]
Length=585

 Score =   275 bits (703),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 173/556 (31%), Positives = 280/556 (50%), Gaps = 9/556 (2%)
 Frame = +3

Query  639   SLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKT  818
             +L+  Y  AG+ QE++KLF  M  +GI+ + +++N +  +++ RGR  M   +++ M+  
Sbjct  15    ALVAAYGRAGIPQEAVKLFRLMPDLGITRTALSYNAVLKVILCRGREAMARRIYNAMIAD  74

Query  819   FGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEI  998
              GV P L T+N LI G  +   ++   R F +M+ H   PDV TYNT+++   R G +E 
Sbjct  75    -GVAPTLSTYNTLIWGFGLCKKMESAVRVFGDMKGHGVTPDVTTYNTLLNAWVRKGDLES  133

Query  999   AHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTL  1178
             A  V   M   G+    N ++Y  +++GY E  KVEEA+ +F EM ++G   +  T+  L
Sbjct  134   ARKVFDEM--PGAGFERNSISYNVMIKGYVEANKVEEAVGLFTEMGEKGLRLSEKTFAAL  191

Query  1179  IQGLLEARKFDKVKELFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMS  1349
             + GL +     K  E  K   E  + R  P D   F  L+ T C  G+L  ALE  +K  
Sbjct  192   MPGLCDDE--GKAAEARKAVAEMAERRLTPKDKSVFLRLVSTLCKAGDLDGALEVHKKSG  249

Query  1350  IL-NAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKY  1526
                +   D   Y +L+  LC  G  + A +  DEL + GTLLS         AYNP+ +Y
Sbjct  250   QFKHVLVDPRQYGVLMESLCAGGKCDGAVQVLDELLEKGTLLSPKSPVLEAPAYNPVIEY  309

Query  1527  LCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDF  1706
             LC NG T KAE  FRQLM+ GV D   F +LI G+  EG  E   E+L  M RR    D 
Sbjct  310   LCNNGNTNKAETFFRQLMKKGVDDKSAFNSLIRGHAKEGALEAAKEILAIMTRRGVPTDP  369

Query  1707  ETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVL  1886
              ++  L++  L++ +   A   L+ M++  HLPR  +F S++  L         + ++  
Sbjct  370   HSHALLIDSFLKKNESADAKTALDSMMEHGHLPRPALFQSVMVALFNDGRVQTASRVMKS  429

Query  1887  MLVKKIRQNINLSTDTVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSE  2066
             M+ K I +N++++   V  LF  G  E A   +  + +NG + ++ +L+  L +  K+ E
Sbjct  430   MIEKGITENMDMANKIVEALFMRGHVEEAIGRVNLIVENGCMPDLDKLLAALCEKDKVME  489

Query  2067  ARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRL  2246
             A+ L  F+L     V       VL AL    +   A+ +  ++  +   +     + L  
Sbjct  490   AQKLADFALDRDFEVSFSTYDRVLEALYTEEKTLPAYSMLCKIKHKGGVVDQKGCDALMD  549

Query  2247  RLEVEGRSKEAEFVAK  2294
              L+  G SK+A+ +++
Sbjct  550   SLKAGGYSKQADILSR  565



>ref|XP_009383114.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
[Musa acuminata subsp. malaccensis]
Length=446

 Score =   201 bits (511),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA N  +Q L   + +   +P+S+AWS D K + VG ASSK+++WDA   + VR L+G
Sbjct  158   LWNAANSMVQLLLTTDVDD--HPTSVAWSVDGKMVAVGFASSKVEIWDAIALQQVRILEG  215

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS++W  ++L+SGS D SI +HDVR    + S LKAHT +VCGLKWS  G+ L S
Sbjct  216   HLARVGSLSWTWNMLSSGSRDASISNHDVRSFRHVSSKLKAHTGDVCGLKWSCGGDLLAS  275

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNLV++W++ KM S  YLHRF DH AAV+ALAWCP+    LASGGGT D C+K+W++
Sbjct  276   GGNDNLVHVWESSKMGSSRYLHRFTDHRAAVRALAWCPFQPKTLASGGGTADQCVKIWNV  335

Query  2735  RKGACISS  2712
             + G C +S
Sbjct  336   QTGKCTNS  343


 Score =   108 bits (269),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C L+WN++ KE+LS HG+ +      +L LW YPS++KI D   H  R L LSQSPDG
Sbjct  349   QVCALEWNRYQKEILSAHGYNQ-----NRLSLWAYPSLAKITDFTGHTDRILQLSQSPDG  403

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSA ADET+RFW++F P         D D L SL+ + IR
Sbjct  404   STVVSAAADETIRFWKVFEPTPCSSPSMDDEDRLFSLRRTHIR  446


 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 25/114 (22%)
 Frame = -2

Query  3723  KGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGNWELWV  3544
             +GDRFIP RSLM+LD A + L    +  G +     +                      +
Sbjct  19    QGDRFIPTRSLMNLDFARSSLMRHPRRDGATVDRPDI----------------------L  56

Query  3543  SPFCMKGEYRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDEE  3382
             +P   K EYRRR+E +  LD +G+P +MLVFRGSP+ S  S+  +DE+ +   E
Sbjct  57    TP---KEEYRRRVEESWTLDSQGKPLKMLVFRGSPRKSHPSVLMVDEILKEQRE  107



>ref|XP_004952178.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g37230-like [Setaria italica]
Length=742

 Score =   273 bits (697),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 194/661 (29%), Positives = 332/661 (50%), Gaps = 20/661 (3%)
 Frame = +3

Query  342   LIKFQPWSPQTEsslsalagpslsETTVIHSI----RLLKTPRKALKFFVWAEQK-GFAL  506
             +I+ +PW+ + E+S+  L+     +  ++H +            AL+FF +A ++ G   
Sbjct  72    MIRRRPWTTRLENSIRLLSPTL--DAPIVHGVISGAAAAGRANLALQFFRFAYRRAGLRP  129

Query  507   TSQCYFRMLELLGTERNLNTARNF-LFSIPKRSNGAVPLEARFFNSLIKNYAVAGLFQES  683
                 +  ++  L + R LN  R   L ++P  ++   P E     SLI     A + QE+
Sbjct  130   GRDTFPLIVPALASRRMLNXTRCLVLHTMPSFND--TPDEDSL-ASLIIGIQKAAIPQEA  186

Query  684   LKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKPDLYTFNILIR  863
             +K F  +  +GI+ + +++N +   ++ RGR  M   +++ M+   GV PDL T+N LI 
Sbjct  187   VKRFRIIPDLGITRTTLSYNAVLKAIICRGREAMARRIYNAMIAE-GVAPDLSTYNTLIW  245

Query  864   GCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVVKGMLKKGSDL  1043
             G  +   ++   R F +M+ H   PD  T+NT+++   RAG +E A  V   M  +G  +
Sbjct  246   GFGLCKKMEAAVRVFGDMKAHGVTPDATTHNTLLNAWVRAGDLESARKVFDEMTAEG--I  303

Query  1044  SPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKE  1223
               N V+Y  +++GY E  KVEEA+ +F EM ++G   +  T+  L+ GL + +   +V E
Sbjct  304   ERNSVSYNVMIKGYVEATKVEEAVALFTEMGEKGLRLSEKTFAALMPGLCDDQ--GRVAE  361

Query  1224  LFKGAGE--DGRFVP-DTCTFNTLIHTHCSDGNLKAALEAFEKMSIL-NAAPDSATYSIL  1391
               K   +  + R  P D   F  L+ T C+ G+L  ALE   K     +   D   Y +L
Sbjct  362   ARKAVDDMAERRLTPKDKSVFLRLVRTLCTAGDLDGALEVHRKSGQFKHVLVDPRQYGVL  421

Query  1392  IRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVAAYNPMFKYLCENGKTKKAEKVFR  1571
             +  LC  G  + A +  DEL + GTLLS        +AYNP+ +YLC NG T KAE  FR
Sbjct  422   MEGLCAGGKCDSAVEVLDELMEKGTLLSPKSPVLEASAYNPVIEYLCNNGSTTKAETFFR  481

Query  1572  QLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVPDFETYESLLEGLLQEGK  1751
             QLM+ GV D + F +LI G+  EG+ E   E+L  M RR    D E++  L++  L++ +
Sbjct  482   QLMKKGVDDKVAFNSLIRGHAKEGVPEAAQEILAIMTRREVPTDPESHALLVDSFLKKNE  541

Query  1752  PRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTD  1931
                A   L+ M++  HLP   +F S++  L         + ++  M+ K + +N++L+  
Sbjct  542   AADAKTALDSMMQQGHLPSPALFKSVMEALFNGGRVQTASRVMKSMIEKGVTENMDLAHK  601

Query  1932  TVRILFKAGLKERAFEILGCLYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSV  2111
              +  LF  G  E A   +  + +NG + ++ +L+V L +  ++ EA+ L  F+L    +V
Sbjct  602   ILEALFMRGHVEEAIGRVNLMVENGCMPDLDKLLVGLCENDRVMEAQKLADFALDRDFNV  661

Query  2112  CIEICSTVLSALCKACRAQEAFELYYELVERQIELPLNCLEDLRLRLEVEGRSKEAEFVA  2291
                    VL AL    +   A+ +  ++  +   +     + L   L+ EG SK+A+ ++
Sbjct  662   SFSTYDRVLEALYTEEKTLPAYSMLCKIKNKGGVVNQKGCDALMESLKSEGYSKQADILS  721

Query  2292  K  2294
             K
Sbjct  722   K  722



>ref|XP_001757257.1| predicted protein [Physcomitrella patens]
 gb|EDQ77742.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   197 bits (501),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDRS  3027
             +S+ W+ D + L VG  ++ +QLWD++  + +R LKGH  RVGS+AWNG VL+SGS D S
Sbjct  161   TSVHWAPDGRYLAVGLNNADVQLWDSQELRQLRSLKGHSARVGSLAWNGPVLSSGSRDSS  220

Query  3026  IIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR---DY  2856
             II+HDVR+ + +I  ++AH +EVCGLKWS +G+ L SGGNDNL+YIWD    S++    Y
Sbjct  221   IINHDVRIRDHVIGRMEAHEQEVCGLKWSPSGHQLASGGNDNLLYIWDASAASNQGPSPY  280

Query  2855  LHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSKNLV  2691
             L R +DH AAVKALAWCP+  ++LASGGGT D CIK W+   G C++S  +++ V
Sbjct  281   LLRLDDHRAAVKALAWCPFQSNLLASGGGTADRCIKFWNTHTGVCLNSIDTQSQV  335


 Score =   111 bits (278),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 65/88 (74%), Gaps = 5/88 (6%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQW+KH +E+LS HGF +      +LCLW+YPSM K+ +   H SR LHL+QSPDG
Sbjct  334   QVCALQWSKHEREILSSHGFSQ-----NQLCLWKYPSMVKLAELTGHTSRVLHLAQSPDG  388

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRT  2420
              T+ SA  DETLRFW++FG P+A K+++
Sbjct  389   YTIASAAGDETLRFWKVFGDPEALKAKS  416



>gb|EPS72095.1| hypothetical protein M569_02663, partial [Genlisea aurea]
Length=712

 Score =   271 bits (693),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 183/625 (29%), Positives = 304/625 (49%), Gaps = 17/625 (3%)
 Frame = +3

Query  447   KTPRKALKFFVWAEQKGFALTS-QCYFRMLELLGTERNLNTARNFLFSIPKRSNGAVPLE  623
             + P+ AL+FF W E+        + Y +++E LG    LN AR  L  +PK+    V  +
Sbjct  78    RKPQHALQFFRWVERSHLIQPDREAYLKIIETLGHASMLNHARCILLDMPKK---GVEWD  134

Query  624   ARFFNSLIKNYAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFD  803
                + S+I +Y  AG+ QE +KLF  M   G+  +  +++T    ++ RGR  M    F+
Sbjct  135   EDLWISMIASYGRAGIVQECVKLFQKMPEFGVKRTSKSYDTFLRAILLRGRYMMAKRYFN  194

Query  804   EMLKTFGVKPDLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRA  983
             +ML   G++P  +TFNILI G  ++  +    RFF++M+     PDVITY+T++ G  R 
Sbjct  195   KMLNE-GIEPTSHTFNILIWGFFLSRKLCVVKRFFQDMKARGITPDVITYSTMISGYFRV  253

Query  984   GKVEIAHNVVKGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSV  1163
              ++E A      M  K   + P V+TYT L++GY +  ++++A+ + +EM   G +PN+V
Sbjct  254   KRIEDAEKYFAEM--KEMQIKPTVITYTALIKGYVDNDRIDDAMRMVEEMKGVGIKPNAV  311

Query  1164  TYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCSDGNLKAALEAFEK  1343
             TY+TL+ GL  A        + K        + D   F  LI + C   NL AA    + 
Sbjct  312   TYSTLLPGLCNADHISSAAAMLKEVVGKRITLKDHSIFMRLISSLCETSNLDAAANVLDS  371

Query  1344  MSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAGCRPVVA-AYNPMF  1520
             M  L    +   Y +LI+   + G ++   K  D L +   ++       +   +YNPM 
Sbjct  372   MVRLGVPAEPGHYGVLIKSFFEAGRYDEGVKLLDSLIEKDIVMRPENTHHLEPDSYNPMI  431

Query  1521  KYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSEDGHELLVWMLRRNFVP  1700
             +YLC NG+T KAE +FRQLM++GV D   F  L++G+  EG      E+L    RR+   
Sbjct  432   EYLCSNGQTAKAEALFRQLMKLGVLDAAAFNALVVGHSREGAPASASEILRITARRSIPI  491

Query  1701  DFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRTFVFHSILTELVKQNCALECADLV  1880
             +  +YES++   L +  P  A   L+ M++S HLP + ++ S++  L         + ++
Sbjct  492   ERASYESVIRSYLDKNDPSEAKLALDGMIESGHLPDSSLYGSVMESLFDDGRVQTASRVM  551

Query  1881  VLMLVKK--IRQNINLSTDTVRILFKAGLKERAF---EILGCLYDNGYLVNMQELIVFLS  2045
               ML K      +  L       LF  G  E A    E+L  +  +G   +   L+  L 
Sbjct  552   KTMLEKNAATADHAGLFGKITESLFVRGHVEEALGRVEML--MRSSGMGPDFDGLLSSLC  609

Query  2046  QGKKLSEARDLLLFSL-KNSQSVCIEICSTVLSALCKACRAQEAFELYYELVER-QIELP  2219
             +  K S A  LL F + ++  +  +     VL AL    +   A+ +  +++ +      
Sbjct  610   EKGKTSAATKLLDFCVERDCTAAAVSSTERVLDALLAEGKTLNAYGVLCKVLGKGSGGCD  669

Query  2220  LNCLEDLRLRLEVEGRSKEAEFVAK  2294
                 +DL   L  EG +K+AE +++
Sbjct  670   WEGCKDLIRSLNEEGNTKQAEILSR  694



>ref|XP_010274572.1| PREDICTED: cell division cycle 20.2, cofactor of APC complex-like 
isoform X2 [Nelumbo nucifera]
Length=430

 Score =   224 bits (572),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = -3

Query  3212  YPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYD  3033
             YP+S+AWS +AK L VG + S++QLWDAETS++VR L+GHE RVG +AWNGH+LTSGS D
Sbjct  184   YPTSVAWSQNAKMLAVGLSCSELQLWDAETSQLVRRLEGHENRVGILAWNGHLLTSGSRD  243

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRDYL  2853
             R II+HDVR   +L S ++AH  EVCGLKWS  GN L SGGNDN+++IW+   M S  +L
Sbjct  244   RYIINHDVRSRRNLTSCIRAHNEEVCGLKWSSRGNLLASGGNDNIIHIWEASNMRSSSFL  303

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISSTFSKNLV  2691
             HRF +H +AVKA AW PY +++LASGGGT D CIK+W+ + G C++S  +K  V
Sbjct  304   HRFTEHHSAVKAFAWSPYEFNILASGGGTNDRCIKIWNSQTGKCLNSIDTKAQV  357


 Score = 77.8 bits (190),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQ  2516
             Q+CGLQWN+HH E+LSGHGF        KLCLW+YPS+SKI  S  H SR LHL+Q
Sbjct  356   QVCGLQWNRHHNEILSGHGFSLHQHDQTKLCLWKYPSLSKIGASPRHESRVLHLAQ  411


 Score = 25.0 bits (53),  Expect(3) = 4e-73, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -2

Query  2481  QMKLFASGRFLARLKLTSQ  2425
             QMKLFASGR L  L  T Q
Sbjct  411   QMKLFASGRPLDHLGPTIQ  429


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 83/197 (42%), Gaps = 75/197 (38%)
 Frame = -2

Query  3918  RLQSHWYYPTRLLSTPTEYDFPVLNTLFLHFLTQFVCLTSKfllf**fFWGHELPSANGF  3739
             RL+  WY P RLLS+P +YDFP                                      
Sbjct  3     RLELDWYSPRRLLSSPMKYDFP--------------------------------------  24

Query  3738  *FSLMKGDRFIPNRSLMDLDRAHTLLTNPSKELGKSKYNVSMSFLISLNECFWFLPISGN  3559
                   GDRFIPNRSLMDLD   +LLT+ +KE   S  +                     
Sbjct  25    ------GDRFIPNRSLMDLDHVRSLLTSTTKESSGSMLD---------------------  57

Query  3558  WELWVSPFCMKGE--YRRRLEAALKLDEEGRPFRMLVFRGSPKGSRKSIREIDEMRRSDE  3385
                  SP   K    YR+R+E  L LD EG+PFRMLVFRGSPK  R+S+   D  ++   
Sbjct  58    -----SPANSKFNDLYRKRVEENLTLDSEGKPFRMLVFRGSPKTCRRSLCTTDSTQQEKL  112

Query  3384  ESFSCTDVNKQSRAFPK  3334
             ES       KQ R FPK
Sbjct  113   ESLENA---KQFRQFPK  126



>ref|XP_002970067.1| hypothetical protein SELMODRAFT_92939 [Selaginella moellendorffii]
 ref|XP_002985258.1| hypothetical protein SELMODRAFT_121776 [Selaginella moellendorffii]
 gb|EFJ13752.1| hypothetical protein SELMODRAFT_121776 [Selaginella moellendorffii]
 gb|EFJ29191.1| hypothetical protein SELMODRAFT_92939 [Selaginella moellendorffii]
Length=419

 Score =   197 bits (500),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNAT  GI++L +  ++     +S++W+ D K + VG  ++ +QLWDA + + VR LK 
Sbjct  126   LWNATTGGIEELMQVSEDDGPV-TSVSWAPDGKHISVGLNNADVQLWDAFSLRQVRSLKA  184

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS+AWNG +L++G  D  I +HDVR+   +   + AH +EVCGLKWS +G  L S
Sbjct  185   HTARVGSLAWNGPILSTGGRDNVIFNHDVRIREHVTGKMAAHQQEVCGLKWSPSGQQLAS  244

Query  2915  GGNDNLVYIWDTFKMSSR---DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKM  2745
             GGNDNL+Y+WD    +SR    YLHR ++H AAVKALAWCP+  ++LASGGGT D CIK 
Sbjct  245   GGNDNLLYVWDAAAAASRGNSTYLHRLDEHQAAVKALAWCPFQSNLLASGGGTADRCIKF  304

Query  2744  WSIRKGACISS  2712
             W+   GACI S
Sbjct  305   WNTHTGACIQS  315


 Score =   107 bits (266),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
               Q+C LQW+KH +ELLS HGF +      +L LW+YPSM K+ +   H SR LH++QSP
Sbjct  319   ASQVCALQWSKHERELLSSHGFSQ-----NQLILWKYPSMVKMAELTGHTSRVLHMAQSP  373

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS  2426
             DG TV SA  DETLRFW++FG P   K+
Sbjct  374   DGYTVASAAGDETLRFWQVFGTPDTTKA  401



>ref|XP_006828788.1| hypothetical protein AMTR_s00001p00114780 [Amborella trichopoda]
 gb|ERM96204.1| hypothetical protein AMTR_s00001p00114780 [Amborella trichopoda]
Length=456

 Score =   192 bits (488),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 1/188 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA+N  I +L +  ++     +S+AW+ D   + VG  +S++Q+WD  T K VR ++G
Sbjct  171   LWNASNSAINELTQVHEDDGPI-TSVAWAQDGNHIAVGLNNSEVQIWDHSTMKKVRSMRG  229

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS+AW+G  L +G  D  I++HDVR  N + S L AH +EVCGLKWS  G  L S
Sbjct  230   HSARVGSLAWHGSTLCTGGRDSKILYHDVRNRNHITSQLSAHEQEVCGLKWSLCGKQLAS  289

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNL+YIWD+  ++S  +L RF+ H AAVKALAWCPY  ++LASGGGT D CIK W+ 
Sbjct  290   GGNDNLLYIWDSRSITSSRHLFRFDQHKAAVKALAWCPYQTNLLASGGGTTDRCIKFWNT  349

Query  2735  RKGACISS  2712
             ++G  ++S
Sbjct  350   QRGMLLNS  357


 Score =   110 bits (276),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C LQWN H +E+LS HGF E      +L LW+YPSM KI +   H SR LH++QSP
Sbjct  361   GSQVCSLQWNHHEQEILSSHGFSE-----NQLILWKYPSMRKITEIMGHTSRVLHMAQSP  415

Query  2509  DGLTVVSAGADETLRFWEIFGP  2444
             DG TV +A ADETLRFW++FGP
Sbjct  416   DGFTVATAAADETLRFWQVFGP  437



>ref|XP_001766400.1| predicted protein [Physcomitrella patens]
 gb|EDQ68728.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   190 bits (482),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 133/196 (68%), Gaps = 3/196 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+AT   I++L   ++      +S++W+ D + + VG  +S +QLWD+ + + +R L+G
Sbjct  135   LWDATTSSIEELMTVDEEGPI--TSVSWAPDGQYIAVGLNNSTVQLWDSTSLRQLRTLRG  192

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVG++AWNG  L +G  D +I++HDVR+ N +I  L  H +EVCGLKWS +G  L S
Sbjct  193   HSARVGALAWNGPTLATGGRDSTILNHDVRIRNHVIGKLTGHEQEVCGLKWSPSGQQLAS  252

Query  2915  GGNDNLVYIWD-TFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             GGNDNL++IWD     +S  YLHR +DH AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  253   GGNDNLLHIWDSAAASNSSSYLHRLDDHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  312

Query  2738  IRKGACISSTFSKNLV  2691
                G C++S  +++ V
Sbjct  313   THTGVCVNSIDTQSQV  328


 Score =   112 bits (280),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 8/99 (8%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQW+KH KE+LS HGF +      +LCLW+YPSM K+ +   H SR LHL+QSPDG
Sbjct  327   QVCALQWSKHEKEILSSHGFSQ-----NQLCLWKYPSMVKMAEFTGHTSRVLHLAQSPDG  381

Query  2503  LTVVSAGADETLRFWEIFGPP---QADKSRTSDFDNLLS  2396
              TV SA  DETLRFW++FG P   Q  + RT +  + L+
Sbjct  382   YTVASAAGDETLRFWQVFGTPETKQTSQKRTKEVGSALT  420



>ref|XP_002967241.1| hypothetical protein SELMODRAFT_86492 [Selaginella moellendorffii]
 gb|EFJ31840.1| hypothetical protein SELMODRAFT_86492 [Selaginella moellendorffii]
Length=475

 Score =   188 bits (477),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 127/191 (66%), Gaps = 4/191 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA+   I++L +  +      +S+AW+ D K + VG +++ +QLWD+ + + VR LK 
Sbjct  181   LWNASTGNIEELMQANEEDGPV-TSVAWAPDGKHISVGLSNADVQLWDSLSLRQVRSLKA  239

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS+AWNG +L++G  D  I +HDVR+   +   + AH +EVCGLKWS +G  L S
Sbjct  240   HSARVGSLAWNGPILSTGGRDNVIFNHDVRIREHVTGKMVAHQQEVCGLKWSPSGQQLAS  299

Query  2915  GGNDNLVYIWDTFKMSS---RDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKM  2745
             GGNDNL+++WD     S     YLHR ++H AAVKALAWCP+  ++LASGGGT D CIK 
Sbjct  300   GGNDNLLHVWDAAAAVSGGTSSYLHRLDEHQAAVKALAWCPFQSNLLASGGGTADRCIKF  359

Query  2744  WSIRKGACISS  2712
             W+   GACI S
Sbjct  360   WNTHTGACIQS  370


 Score =   110 bits (275),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 7/107 (7%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C LQW+KH +ELLS HGF +      +L LW+YPSM K+ +   H SR LHL+QSP
Sbjct  374   GSQVCALQWSKHERELLSSHGFSQ-----NQLILWKYPSMVKMAELTGHTSRVLHLAQSP  428

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS--RTSDFDNLLSLKTSPIR  2375
             DG TV SA  DETLRFW++FG P   K+  RT   +   +L +  IR
Sbjct  429   DGYTVASAAGDETLRFWQVFGNPDTAKAAVRTKARETYSALNSRCIR  475



>ref|XP_002960485.1| hypothetical protein SELMODRAFT_229944 [Selaginella moellendorffii]
 gb|EFJ38024.1| hypothetical protein SELMODRAFT_229944 [Selaginella moellendorffii]
Length=432

 Score =   188 bits (477),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 127/191 (66%), Gaps = 4/191 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA+   I++L +  +      +S+AW+ D K + VG +++ +QLWD+ + + VR LK 
Sbjct  138   LWNASTGNIEELMQANEEDGPV-TSVAWAPDGKHISVGLSNADVQLWDSLSLRQVRSLKA  196

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVGS+AWNG +L++G  D  I +HDVR+   +   + AH +EVCGLKWS +G  L S
Sbjct  197   HSARVGSLAWNGPILSTGGRDNVIFNHDVRIREHVTGKMVAHQQEVCGLKWSPSGQQLAS  256

Query  2915  GGNDNLVYIWDTFKMSS---RDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKM  2745
             GGNDNL++IWD     S     YLHR ++H AAVKALAWCP+  ++LASGGGT D CIK 
Sbjct  257   GGNDNLLHIWDAAAAVSGGTSSYLHRLDEHQAAVKALAWCPFQSNLLASGGGTADRCIKF  316

Query  2744  WSIRKGACISS  2712
             W+   GACI S
Sbjct  317   WNTHTGACIQS  327


 Score =   110 bits (275),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 7/107 (7%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C LQW+KH +ELLS HGF +      +L LW+YPSM K+ +   H SR LHL+QSP
Sbjct  331   GSQVCALQWSKHERELLSSHGFSQ-----NQLILWKYPSMVKMAELTGHTSRVLHLAQSP  385

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS--RTSDFDNLLSLKTSPIR  2375
             DG TV SA  DETLRFW++FG P   K+  RT   +   +L +  IR
Sbjct  386   DGYTVASAAGDETLRFWQVFGNPDTAKAAVRTKARETYSALNSRCIR  432



>ref|XP_009794506.1| PREDICTED: cell division cycle 20.1, cofactor of APC complex-like 
isoform X1 [Nicotiana sylvestris]
Length=447

 Score =   185 bits (469),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  3200  IAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDRSII  3021
             ++W+ D + L +G  +S +QLWD+ +S+++R L+GH  RVGS+ WNGH+LT+GS D  II
Sbjct  180   VSWAPDGRHLALGLNNSHVQLWDSRSSRLLRTLQGHSLRVGSLDWNGHILTTGSMDTMII  239

Query  3020  HHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDT---FKMSSRDYLH  2850
             ++DVR+ + ++   + H +E+CGLKWS +G  L SGGNDNLV+IW        S+R ++H
Sbjct  240   NNDVRIRSHVVGTYRGHNQEICGLKWSASGQQLASGGNDNLVHIWSVSMGSPNSTRQWIH  299

Query  2849  RFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             R  DH+AAVKAL+WCP+  +++ASGGG  D CIK W+   GAC++S
Sbjct  300   RMTDHTAAVKALSWCPFQSNMVASGGGVGDECIKFWNTNTGACLNS  345


 Score =   110 bits (276),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WN+H +ELLS HGF +      +L +W+YPSM+K+ + + H SR LH++QSP
Sbjct  349   GSQVCSLLWNRHERELLSSHGFTD-----NQLTVWKYPSMTKVAEFFGHTSRVLHMAQSP  403

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS  2426
             DG TV +A ADETLRFW IFG P+  KS
Sbjct  404   DGYTVATAAADETLRFWNIFGNPEETKS  431



>ref|XP_009794507.1| PREDICTED: cell division cycle 20.1, cofactor of APC complex-like 
isoform X2 [Nicotiana sylvestris]
Length=409

 Score =   184 bits (468),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -3

Query  3200  IAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDRSII  3021
             ++W+ D + L +G  +S +QLWD+ +S+++R L+GH  RVGS+ WNGH+LT+GS D  II
Sbjct  142   VSWAPDGRHLALGLNNSHVQLWDSRSSRLLRTLQGHSLRVGSLDWNGHILTTGSMDTMII  201

Query  3020  HHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDT---FKMSSRDYLH  2850
             ++DVR+ + ++   + H +E+CGLKWS +G  L SGGNDNLV+IW        S+R ++H
Sbjct  202   NNDVRIRSHVVGTYRGHNQEICGLKWSASGQQLASGGNDNLVHIWSVSMGSPNSTRQWIH  261

Query  2849  RFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             R  DH+AAVKAL+WCP+  +++ASGGG  D CIK W+   GAC++S
Sbjct  262   RMTDHTAAVKALSWCPFQSNMVASGGGVGDECIKFWNTNTGACLNS  307


 Score =   110 bits (275),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WN+H +ELLS HGF +      +L +W+YPSM+K+ + + H SR LH++QSP
Sbjct  311   GSQVCSLLWNRHERELLSSHGFTD-----NQLTVWKYPSMTKVAEFFGHTSRVLHMAQSP  365

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS  2426
             DG TV +A ADETLRFW IFG P+  KS
Sbjct  366   DGYTVATAAADETLRFWNIFGNPEETKS  393



>ref|XP_009606788.1| PREDICTED: cell division cycle 20.1, cofactor of APC complex-like 
isoform X1 [Nicotiana tomentosiformis]
Length=447

 Score =   182 bits (462),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = -3

Query  3200  IAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDRSII  3021
             ++W+ D + L +G  +S +QLWD+ +S+++R L GH  RVGS+ WNGH+LT+GS D  II
Sbjct  180   VSWAPDGRHLALGLNNSHVQLWDSRSSRLLRTLTGHNLRVGSLDWNGHILTTGSMDTMII  239

Query  3020  HHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKM----SSRDYL  2853
             ++DVR+ + ++   + H +E+CGLKWS +G  L SGGNDNLV++W +  M    S+R ++
Sbjct  240   NNDVRIRSHVVGTYRGHNQEICGLKWSASGQQLASGGNDNLVHVW-SLSMGSPNSTRQWI  298

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             HR  DH+AAVKA++WCP+  +++ASGGG  D CIK W+   GAC++S
Sbjct  299   HRMTDHTAAVKAISWCPFQSNMVASGGGVGDECIKFWNTNTGACLNS  345


 Score =   110 bits (275),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 5/87 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNKH +ELLS HGF +      +L +W+YPSM+K+ + + H SR LH++QSP
Sbjct  349   GSQVCSLLWNKHERELLSSHGFTD-----NQLTVWKYPSMTKVAELFGHTSRVLHMAQSP  403

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADK  2429
             DG TV +A ADETLRFW IFG P+  K
Sbjct  404   DGYTVATAAADETLRFWNIFGNPEESK  430



>ref|XP_001765142.1| predicted protein [Physcomitrella patens]
 gb|EDQ70137.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   182 bits (463),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 130/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+AT   I++L   ++      +S++W+ D + L VG  +S +QLWD+ + + +R L+G
Sbjct  135   LWDATTSSIEELVTVDEEGPI--TSVSWAPDGQYLAVGLNNSTVQLWDSTSLRQLRTLRG  192

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVG++AWNG  L +G  D +I++HDVR+ + +I  ++AH +EVCGLKWS +G  L S
Sbjct  193   HSARVGALAWNGPTLATGGRDNAILNHDVRIRDHVIGSMEAHEQEVCGLKWSPSGQQLAS  252

Query  2915  GGNDNLVYIWDTFKMSSRDY--LHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMW  2742
             GGNDN+++IWD    SS     LH  ++H AAVKALAWCP+  ++LASGGGT D CIK W
Sbjct  253   GGNDNILHIWDASAASSASASPLHSLDEHQAAVKALAWCPFQSNLLASGGGTADRCIKFW  312

Query  2741  SIRKGACISS  2712
             +   GAC++S
Sbjct  313   NTHTGACVNS  322


 Score =   110 bits (274),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQW+KH KE+LS HGF +      +LCLW+YPSM K+ +   H SR LHL+QSPDG
Sbjct  328   QVCALQWSKHEKEILSSHGFSQ-----NQLCLWKYPSMVKMTELSGHTSRVLHLAQSPDG  382

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTS  2417
              TV SA  DETLRFW +FG P+  +   S
Sbjct  383   YTVASAAGDETLRFWNVFGTPETKEVNIS  411



>ref|XP_003059233.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56365.1| predicted protein [Micromonas pusilla CCMP1545]
Length=358

 Score =   186 bits (472),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 133/189 (70%), Gaps = 1/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqql-eeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK  3099
             LWNA    IQQL +  +DN+DDY +S++W  D K + VG   +++Q+WDA   K VR L+
Sbjct  66    LWNAETGDIQQLCQTNQDNEDDYVTSVSWGGDGKHVAVGTNGAEVQIWDASRLKQVRTLR  125

Query  3098  GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             GH  RVG++AWNG  L +GS D +I+ HDVRV     + L +HT+EVCGLKW+ +GN L 
Sbjct  126   GHSARVGALAWNGTQLATGSRDNNIMMHDVRVREHCTATLTSHTQEVCGLKWAPSGNQLA  185

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGNDNL++I+D   +S+  +LHR + H AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  186   SGGNDNLLHIYDANSISNSTHLHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  245

Query  2738  IRKGACISS  2712
                GA ++S
Sbjct  246   TNTGAMLNS  254


 Score =   106 bits (264),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 5/87 (6%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWNKH +ELLS HG+ +      +LCLW+YP+M+K+ +   H +R LH++QSPDG
Sbjct  260   QVCALQWNKHERELLSSHGYSQ-----NQLCLWKYPTMTKMAELTGHTARVLHMAQSPDG  314

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSR  2423
              +VVSA ADETLRFW+ F    + K++
Sbjct  315   TSVVSAAADETLRFWKCFSESDSGKAK  341



>ref|XP_009606789.1| PREDICTED: cell division cycle 20.1, cofactor of APC complex-like 
isoform X2 [Nicotiana tomentosiformis]
Length=409

 Score =   182 bits (462),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = -3

Query  3200  IAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKGHEGRVGSIAWNGHVLTSGSYDRSII  3021
             ++W+ D + L +G  +S +QLWD+ +S+++R L GH  RVGS+ WNGH+LT+GS D  II
Sbjct  142   VSWAPDGRHLALGLNNSHVQLWDSRSSRLLRTLTGHNLRVGSLDWNGHILTTGSMDTMII  201

Query  3020  HHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKM----SSRDYL  2853
             ++DVR+ + ++   + H +E+CGLKWS +G  L SGGNDNLV++W +  M    S+R ++
Sbjct  202   NNDVRIRSHVVGTYRGHNQEICGLKWSASGQQLASGGNDNLVHVW-SLSMGSPNSTRQWI  260

Query  2852  HRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             HR  DH+AAVKA++WCP+  +++ASGGG  D CIK W+   GAC++S
Sbjct  261   HRMTDHTAAVKAISWCPFQSNMVASGGGVGDECIKFWNTNTGACLNS  307


 Score =   110 bits (274),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 5/87 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNKH +ELLS HGF +      +L +W+YPSM+K+ + + H SR LH++QSP
Sbjct  311   GSQVCSLLWNKHERELLSSHGFTD-----NQLTVWKYPSMTKVAELFGHTSRVLHMAQSP  365

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADK  2429
             DG TV +A ADETLRFW IFG P+  K
Sbjct  366   DGYTVATAAADETLRFWNIFGNPEESK  392



>ref|XP_002502587.1| anaphase promoting complex protein [Micromonas sp. RCC299]
 gb|ACO63845.1| anaphase promoting complex protein [Micromonas sp. RCC299]
Length=454

 Score =   183 bits (464),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 130/189 (69%), Gaps = 1/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqql-eeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK  3099
             LWNA +  IQQL + + +N DDY +S+ W  D K + VG   +++Q+WD    K VR L+
Sbjct  161   LWNADSGDIQQLCQTDPNNGDDYVTSVQWGGDGKHIAVGTNDAEVQIWDVSRLKQVRTLR  220

Query  3098  GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             GH  RVG++AWNG  L +GS D +++ HDVR+     + L +H++EVCGLKW+ +GN L 
Sbjct  221   GHNARVGALAWNGTQLATGSRDNTVMMHDVRIREHRTATLTSHSQEVCGLKWAPSGNQLA  280

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGNDNL++IWD   + +  +LHR + H AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  281   SGGNDNLLHIWDQNSIGNGTHLHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  340

Query  2738  IRKGACISS  2712
                GA ++S
Sbjct  341   TNTGALLNS  349


 Score =   108 bits (269),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 5/87 (6%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWNKH +ELLS HG+ +      +LCLW+YP+M+K+ +   H++R LH++QSPDG
Sbjct  355   QVCSLQWNKHERELLSSHGYSQ-----NQLCLWKYPTMTKMAELTGHSARVLHMAQSPDG  409

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSR  2423
              TVVSA ADETLRFW+ F    A K++
Sbjct  410   TTVVSAAADETLRFWKCFSDSDAGKAK  436



>emb|CEF97720.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=457

 Score =   187 bits (475),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 1/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqql-eeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK  3099
             +WNA    I QL +    +++DY +S+ W  D K + VG  S+++Q+WDA   K VR L+
Sbjct  166   MWNADTGAINQLCQTNPADEEDYITSVNWGADGKHIAVGTNSAEVQIWDASQCKKVRTLR  225

Query  3098  GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             GH  RVG+I+WNG  L +G  D +I+ HDVR+     S L+ H +EVCGLKWS +GN L 
Sbjct  226   GHAARVGAISWNGSQLATGGRDNTIMIHDVRIREHCTSTLRVHQQEVCGLKWSPSGNQLA  285

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGNDNL++I+D   + +R  LHR + H AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  286   SGGNDNLLHIFDATSIGNRQALHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  345

Query  2738  IRKGACISS  2712
                GA ++S
Sbjct  346   TNTGAMLNS  354


 Score =   103 bits (257),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWN H +ELLS HG+ +      +LCLW+YP+M+K+ +   H +R LH++QSPDG
Sbjct  360   QVCSLQWNTHERELLSSHGYSQ-----NQLCLWKYPTMTKMAELTGHQARVLHMAQSPDG  414

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSA ADETLRFW+ F        +  D ++   L+    R
Sbjct  415   TTVVSAAADETLRFWKCFDNSVEKTKKVRDANDSSVLRRFNFR  457



>gb|AAV68609.1| CDC20 protein [Ostreococcus tauri]
Length=395

 Score =   187 bits (474),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 1/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqql-eeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK  3099
             +WNA    I QL +    +++DY +S+ W  D K + VG  S+++Q+WDA   K VR L+
Sbjct  104   MWNADTGAINQLCQTNPADEEDYITSVNWGADGKHIAVGTNSAEVQIWDASQCKKVRTLR  163

Query  3098  GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             GH  RVG+I+WNG  L +G  D +I+ HDVR+     S L+ H +EVCGLKWS +GN L 
Sbjct  164   GHAARVGAISWNGSQLATGGRDNTIMIHDVRIREHCTSTLRVHQQEVCGLKWSPSGNQLA  223

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGNDNL++I+D   + +R  LHR + H AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  224   SGGNDNLLHIFDATSIGNRQALHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  283

Query  2738  IRKGACISS  2712
                GA ++S
Sbjct  284   TNTGAMLNS  292


 Score =   103 bits (257),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWN H +ELLS HG+ +      +LCLW+YP+M+K+ +   H +R LH++QSPDG
Sbjct  298   QVCSLQWNTHERELLSSHGYSQ-----NQLCLWKYPTMTKMAELTGHQARVLHMAQSPDG  352

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSA ADETLRFW+ F        +  D ++   L+    R
Sbjct  353   TTVVSAAADETLRFWKCFDNSVEKTKKVRDANDSSVLRRFNFR  395



>ref|XP_001753296.1| predicted protein [Physcomitrella patens]
 gb|EDQ81925.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   184 bits (466),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 131/197 (66%), Gaps = 4/197 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+AT   I++L   ++      +S++W+ D + L VG  +S +QLWD+ T + +R L+G
Sbjct  147   LWDATTSSIEELMTVDEEGPI--TSVSWAPDGQYLAVGLNNSSVQLWDSTTLRQLRTLRG  204

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RV ++AWNG  L +G  D  I++HDVR+  ++I  + AH +EVCGLKWS +G  L S
Sbjct  205   HSARVSALAWNGPTLATGGRDNMILNHDVRIRENVIGCMAAHEQEVCGLKWSPSGQQLAS  264

Query  2915  GGNDNLVYIWDTFKMSSRDY--LHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMW  2742
             GGNDNL++IWD    SS     LH  ++H AAVKALAWCP+  ++LASGGGT D CIK W
Sbjct  265   GGNDNLLHIWDASAASSLSASPLHSLDEHQAAVKALAWCPFQSNLLASGGGTADRCIKFW  324

Query  2741  SIRKGACISSTFSKNLV  2691
             +   GAC++S  +++ V
Sbjct  325   NTHTGACVNSIDTQSQV  341


 Score =   106 bits (265),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQ-SPD  2507
             Q+C LQW+KH KE+LS HGF +      +LCLW+YPSM K+ +   H SR LHL+Q SPD
Sbjct  340   QVCALQWSKHEKEILSSHGFSQ-----NQLCLWKYPSMVKMAEFTGHTSRVLHLAQQSPD  394

Query  2506  GLTVVSAGADETLRFWEIFGPPQA  2435
             G TV SA  DETLRFW +FG P+A
Sbjct  395   GYTVASAAGDETLRFWNVFGTPEA  418



>gb|KDP21935.1| hypothetical protein JCGZ_03073 [Jatropha curcas]
Length=419

 Score =   181 bits (460),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 119/170 (70%), Gaps = 5/170 (3%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             SSI+W+ D + + VG  +S +Q+WD  T++ +R LKG H  RV S+AWN H+LT+G  D 
Sbjct  148   SSISWAPDGQHIAVGLNNSDVQIWDCSTNRRLRTLKGGHRLRVNSLAWNNHILTTGGMDA  207

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMS----SR  2862
              II++DVRV   ++   + H +EVCGLKWSG+G  L SGGNDNL++IWD    S    S+
Sbjct  208   RIINNDVRVREHVVETYRGHQQEVCGLKWSGSGQQLASGGNDNLLFIWDRSMASSNSPSQ  267

Query  2861  DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
              +LHR  +H+AAVKALAWCP+  ++LASGGG  D CIK W+   G+C++S
Sbjct  268   QWLHRLEEHTAAVKALAWCPFQSNLLASGGGGDDRCIKFWNAHTGSCLNS  317


 Score =   108 bits (270),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNKH +ELLS HGF E      +L LW+YPSM K+ +   H SR L L+QSP
Sbjct  321   GSQVCALLWNKHERELLSSHGFTE-----NQLTLWKYPSMVKMAELTGHTSRVLFLAQSP  375

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS  2426
             DG TV SA  DETLRFW IFG PQ  KS
Sbjct  376   DGCTVASAAGDETLRFWNIFGTPQVTKS  403



>ref|XP_003078994.1| cell division cycle protein 20 homolog (p55cdc) (IC), partial 
[Ostreococcus tauri]
Length=394

 Score =   186 bits (473),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 1/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqql-eeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK  3099
             +WNA    I QL +    +++DY +S+ W  D K + VG  S+++Q+WDA   K VR L+
Sbjct  104   MWNADTGAINQLCQTNPADEEDYITSVNWGADGKHIAVGTNSAEVQIWDASQCKKVRTLR  163

Query  3098  GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             GH  RVG+I+WNG  L +G  D +I+ HDVR+     S L+ H +EVCGLKWS +GN L 
Sbjct  164   GHAARVGAISWNGSQLATGGRDNTIMIHDVRIREHCTSTLRVHQQEVCGLKWSPSGNQLA  223

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGNDNL++I+D   + +R  LHR + H AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  224   SGGNDNLLHIFDATSIGNRQALHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  283

Query  2738  IRKGACISS  2712
                GA ++S
Sbjct  284   TNTGAMLNS  292


 Score =   103 bits (257),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWN H +ELLS HG+ +      +LCLW+YP+M+K+ +   H +R LH++QSPDG
Sbjct  298   QVCSLQWNTHERELLSSHGYSQ-----NQLCLWKYPTMTKMAELTGHQARVLHMAQSPDG  352

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLK  2390
              TVVSA ADETLRFW+ F        +  D ++   L+
Sbjct  353   TTVVSAAADETLRFWKCFDNSVEKTKKVRDANDSSVLR  390



>ref|XP_001417356.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95649.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=462

 Score =   186 bits (471),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 129/189 (68%), Gaps = 1/189 (1%)
 Frame = -3

Query  3275  LWNATNHGIqql-eeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLK  3099
             +WNA    I QL +   D++DDY +S+ W  D K + VG  S+++Q+WDA   K VR L+
Sbjct  171   MWNADTGAINQLCQTNPDDEDDYITSVNWGADGKHIAVGTNSAEVQIWDAAQCKKVRTLR  230

Query  3098  GHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
             GH  RVG+++WNG  L +GS D +I+ HDVR+     S L+ H +EVCGLKWS +GN L 
Sbjct  231   GHAARVGAVSWNGSQLATGSRDNNIMIHDVRIREHCTSTLQVHQQEVCGLKWSPSGNQLA  290

Query  2918  SGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWS  2739
             SGGNDNL++I+D   + ++  LHR + H AAVKALAWCP+  ++LASGGGT D CIK W+
Sbjct  291   SGGNDNLLHIFDASSIGNQQALHRLDAHQAAVKALAWCPFQSNLLASGGGTADRCIKFWN  350

Query  2738  IRKGACISS  2712
                GA ++S
Sbjct  351   TNTGAMLNS  359


 Score =   104 bits (259),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 65/103 (63%), Gaps = 5/103 (5%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWN H +ELLS HG+ +      +LCLW+YP+M+K+ +   H +R LH++QSPDG
Sbjct  365   QVCSLQWNTHERELLSSHGYSQ-----NQLCLWKYPTMTKMAELTGHQARVLHMAQSPDG  419

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTSDFDNLLSLKTSPIR  2375
              TVVSA ADETLRFW+ F        +  D ++   L+    R
Sbjct  420   TTVVSAAADETLRFWKCFDNASEKTKKVRDSNDSSVLRRFNFR  462



>dbj|BAJ85982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   183 bits (465),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 121/172 (70%), Gaps = 7/172 (4%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             +S++W+ D   + +G  SS +Q+WD+ +S+++R L+G HE RVGS+AWN ++LT+G  D 
Sbjct  218   TSVSWAPDGNHIAIGLNSSAVQIWDSSSSQLLRTLQGVHELRVGSLAWNKNILTAGGMDG  277

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSS-----  2865
              I+++D+R+ N  +   + H +EVCGLKWSG+G  L SGGNDNL++IWD    S+     
Sbjct  278   KIVNNDLRIRNHAVQTYRGHEQEVCGLKWSGSGQQLASGGNDNLLHIWDVSMASTAQSAG  337

Query  2864  -RDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
                +LHR  DHSAAVKALAWCP+  ++LASGGG  D CIK W+   GAC++S
Sbjct  338   RTQWLHRMEDHSAAVKALAWCPFQSNLLASGGGANDRCIKFWNTHTGACLNS  389


 Score =   105 bits (263),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM+K+ +   H SR L ++QSP
Sbjct  393   GSQVCALLWNKNDRELLSSHGFTQ-----NQLTLWKYPSMTKMAELNGHTSRVLFMAQSP  447

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKS  2426
             DG TV SA ADETLRFW +FG P A KS
Sbjct  448   DGCTVASAAADETLRFWNVFGTPDAPKS  475



>ref|XP_007511434.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17555.1| predicted protein [Bathycoccus prasinos]
Length=472

 Score =   178 bits (452),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 132/197 (67%), Gaps = 2/197 (1%)
 Frame = -3

Query  3275  LWNATNHGIqqleee--ednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCL  3102
             LWNA    I QL +   E++++DY +S+ W+ D K + VG  ++++Q+WDA  ++ VR L
Sbjct  177   LWNAGTGAIDQLMQTDVENDEEDYVTSVNWAPDGKHIAVGTNNAEVQIWDASRARKVRTL  236

Query  3101  KGHEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFL  2922
             KGHE RVG++AWNG  L +GS D +++ HDVR+     +    H++EVCGLKWS +G  L
Sbjct  237   KGHEARVGALAWNGTQLATGSRDTTVMTHDVRIREHCTNTFTCHSQEVCGLKWSPSGTQL  296

Query  2921  VSGGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMW  2742
              SGGNDN ++I+D+  +S+  Y H+   H AAVKALAWCP+  +VLASGGGT D CIK W
Sbjct  297   ASGGNDNSLHIYDSQSLSNGTYRHKLVAHQAAVKALAWCPWQANVLASGGGTADRCIKFW  356

Query  2741  SIRKGACISSTFSKNLV  2691
             +   GA  +S  + + V
Sbjct  357   NANTGAMTNSVDTHSQV  373


 Score =   110 bits (275),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQWN H +ELLS HG+ +      +LCLW+YP+M+KI +   H +R LH++QSPDG
Sbjct  372   QVCALQWNTHERELLSSHGYSQ-----NQLCLWKYPTMTKIAEFTGHTARVLHMAQSPDG  426

Query  2503  LTVVSAGADETLRFWEIFGPPQADKSRTS  2417
              TVVSA ADETLRFW+ F    AD  R +
Sbjct  427   TTVVSAAADETLRFWKCFAENSADSKRVA  455



>gb|AFW69887.1| hypothetical protein ZEAMMB73_120375 [Zea mays]
Length=453

 Score =   246 bits (628),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/322 (42%), Positives = 196/322 (61%), Gaps = 17/322 (5%)
 Frame = +3

Query  795   LFDEMLKTFGVKPDLYTFNILIRG------CCMNSMVDQGFRFFKEMEKHECEPDVITYN  956
             L   +L+  G  PD+ T N LI G      C     + + FRF  E   +   PD ITYN
Sbjct  36    LLAALLRCPGASPDVATLNTLIHGLSTASPCPSAPALLRLFRFLPE--AYAFAPDAITYN  93

Query  957   TIVDGLCRAGKVEIAHNVVKGML--KKGSDLS--PNVVTYTTLVRGYCEKQKVEEALNVF  1124
             +++  LCRAG +  A  +  GM   ++G +    PNVVTYTT++R  C ++  +EAL++F
Sbjct  94    SMLAALCRAGDLATARRLFDGMRVGEQGGEAGAFPNVVTYTTMIRACCARRLADEALSLF  153

Query  1125  KEMVDRGPEPNSVTYNTLIQGLLEARKFDKVKELFKGAGEDGRFVPDTCTFNTLIHTHCS  1304
             K M+  G  PN +TYNT++QG  +A + + VKE+F   G D  F PDTCTFNTL+  HC 
Sbjct  154   KMMLVEGVRPNRITYNTMMQGFCQAGRMELVKEVF---GMDS-FKPDTCTFNTLMAAHCR  209

Query  1305  DGNLKAALEAFEKMSILNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLSDAG  1484
             +G ++ A + F++   L    DSA+YSI+ R LC+ G+F  AE+  D L +   L    G
Sbjct  210   EGRIQDAKKVFDQTMELRVRRDSASYSIVTRALCENGEFGRAEELVDSLLEKEVLKKRGG  269

Query  1485  CRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQ-DPLTFKTLIMGNRNEGMSEDGH  1661
             C P++A YNP+FKYLCENGK KKA  +F QL+ +  + D L FKTLI+G+  E   E G+
Sbjct  270   CVPLIAYYNPVFKYLCENGKAKKARLLFGQLLDIRSKVDFLAFKTLILGHCKEEDFEQGY  329

Query  1662  ELLVWMLRRNFVPDFETYESLL  1727
             EL++ ML+R+ +PD E Y +++
Sbjct  330   ELVLSMLKRDLMPDSECYIAVI  351


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 87/372 (23%), Positives = 156/372 (42%), Gaps = 40/372 (11%)
 Frame = +3

Query  1143  GPEPNSVTYNTLIQGLLEARKFDKVK---ELFKGAGEDGRFVPDTCTFNTLIHTHCSDGN  1313
             G  P+  T NTLI GL  A           LF+   E   F PD  T+N+++   C  G+
Sbjct  45    GASPDVATLNTLIHGLSTASPCPSAPALLRLFRFLPEAYAFAPDAITYNSMLAALCRAGD  104

Query  1314  LKAALEAFEKMSI------LNAAPDSATYSILIRCLCQKGDFEMAEKFFDELFKTGTLLS  1475
             L  A   F+ M +        A P+  TY+ +IR  C       A +  DE      ++ 
Sbjct  105   LATARRLFDGMRVGEQGGEAGAFPNVVTYTTMIRACC-------ARRLADEALSLFKMML  157

Query  1476  DAGCRPVVAAYNPMFKYLCENGKTKKAEKVFRQLMRMGVQDPLTFKTLIMGNRNEGMSED  1655
               G RP    YN M +  C+ G+ +  ++VF   M     D  TF TL+  +  EG  +D
Sbjct  158   VEGVRPNRITYNTMMQGFCQAGRMELVKEVFG--MDSFKPDTCTFNTLMAAHCREGRIQD  215

Query  1656  GHELLVWMLRRNFVPDFETYESLLEGLLQEGKPRLAYDTLERMLKSSHLPRT------FV  1817
               ++    +      D  +Y  +   L + G+   A + ++ +L+   L +         
Sbjct  216   AKKVFDQTMELRVRRDSASYSIVTRALCENGEFGRAEELVDSLLEKEVLKKRGGCVPLIA  275

Query  1818  FHSILTELVKQNCALECADLVVLMLVKKIRQNINLSTDTVRILFKAGLK--ERAFEILGC  1991
             +++ + + + +N   + A L+   L+  IR  ++       IL     +  E+ +E++  
Sbjct  276   YYNPVFKYLCENGKAKKARLLFGQLLD-IRSKVDFLAFKTLILGHCKEEDFEQGYELVLS  334

Query  1992  LYDNGYLVNMQELIVFLSQGKKLSEARDLLLFSLKNSQSVCIEICSTVLSALCKACRAQE  2171
             +     + + +  I  ++       A +  LFSL+    + + + S VL          E
Sbjct  335   MLKRDLMPDSECYIAVIN-------AAEFSLFSLRKRHELGVAVHSQVLDG------TSE  381

Query  2172  AFELYYELVERQ  2207
             AF+L+YEL+E +
Sbjct  382   AFQLFYELIENK  393


 Score = 84.0 bits (206),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/256 (27%), Positives = 113/256 (44%), Gaps = 14/256 (5%)
 Frame = +3

Query  486   EQKGFALTSQCYFRMLELLGTERNLNTARNFLFSI----PKRSNGAVPLEARFFNSLIKN  653
             E   FA  +  Y  ML  L    +L TAR     +         GA P     + ++I+ 
Sbjct  81    EAYAFAPDAITYNSMLAALCRAGDLATARRLFDGMRVGEQGGEAGAFP-NVVTYTTMIRA  139

Query  654   YAVAGLFQESLKLFTSMKVIGISPSVVTFNTLFSILMKRGRTGMVYELFDEMLKTFGVKP  833
                  L  E+L LF  M V G+ P+ +T+NT+     + GR  +V E+F   + +F  KP
Sbjct  140   CCARRLADEALSLFKMMLVEGVRPNRITYNTMMQGFCQAGRMELVKEVFG--MDSF--KP  195

Query  834   DLYTFNILIRGCCMNSMVDQGFRFFKEMEKHECEPDVITYNTIVDGLCRAGKVEIAHNVV  1013
             D  TFN L+   C    +    + F +  +     D  +Y+ +   LC  G+   A  +V
Sbjct  196   DTCTFNTLMAAHCREGRIQDAKKVFDQTMELRVRRDSASYSIVTRALCENGEFGRAEELV  255

Query  1014  -----KGMLKKGSDLSPNVVTYTTLVRGYCEKQKVEEALNVFKEMVDRGPEPNSVTYNTL  1178
                  K +LKK     P +  Y  + +  CE  K ++A  +F +++D   + + + + TL
Sbjct  256   DSLLEKEVLKKRGGCVPLIAYYNPVFKYLCENGKAKKARLLFGQLLDIRSKVDFLAFKTL  315

Query  1179  IQGLLEARKFDKVKEL  1226
             I G  +   F++  EL
Sbjct  316   ILGHCKEEDFEQGYEL  331



>ref|XP_008873033.1| hypothetical protein H310_08893 [Aphanomyces invadans]
 gb|ETV98158.1| hypothetical protein H310_08893 [Aphanomyces invadans]
Length=565

 Score =   185 bits (469),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNAT   I +L   + ++  Y SS++W  D  TL +G +++ IQLWDA T++++R L+G
Sbjct  264   LWNATTGEIDELMSLDGDE--YISSVSWIQDGNTLAIGTSNATIQLWDAHTARLLRTLRG  321

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVG+++WN HVL+SGS D +I HHDVR+   LI+ L  H +EVCGL WS  G  L S
Sbjct  322   HSMRVGALSWNQHVLSSGSRDTTIKHHDVRIQQPLIATLSGHDQEVCGLAWSPDGTKLAS  381

Query  2915  GGNDNLVYIWDTFKMSSRDY--LHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMW  2742
             GGNDN++ IW+    SS +   +H+   H AAVKALAWCP+   VLASGGGT D  IK+W
Sbjct  382   GGNDNILCIWNHPSSSSSNIRPVHKLQHHVAAVKALAWCPWERHVLASGGGTADRTIKLW  441

Query  2741  SIRKGACISS  2712
             +++ G+ + S
Sbjct  442   NVQTGSLLQS  451


 Score =   101 bits (251),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 57/91 (63%), Gaps = 5/91 (5%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L W    KELLS HG+ +      +LCLW YPSM KI +   H +R LH++ +P
Sbjct  455   GSQVCALLWATSDKELLSSHGYAQ-----NELCLWEYPSMVKIKELTGHTARVLHMAAAP  509

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADKSRTS  2417
             D +TVVS  ADETLRFW IF PP+  K   S
Sbjct  510   DKMTVVSGAADETLRFWNIFAPPKPTKKTKS  540



>ref|XP_005651189.1| cell division cycle 20 [Coccomyxa subellipsoidea C-169]
 gb|EIE26645.1| cell division cycle 20 [Coccomyxa subellipsoidea C-169]
Length=429

 Score =   178 bits (452),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA   G  +   E   +DDY +S+AW+ D K + VG AS+++Q+WDA   K +R LKG
Sbjct  141   LWNAAT-GSIEQLMECAEEDDYVTSVAWAADGKHVAVGTASAQVQIWDAARVKQIRALKG  199

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RV ++AW+G  L++G  D  II+HDVRV   + + ++ H +EVCGLKWS +G  L S
Sbjct  200   HSARVSAMAWSGTTLSTGGRDSLIINHDVRVREHITATMRGHEQEVCGLKWSPSGAQLAS  259

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDNL+++W     +    LHR   H+AAVKALAWCP+  ++LASGGGT D CIK W+ 
Sbjct  260   GGNDNLLHVWGAGGGAP---LHRLTAHTAAVKALAWCPFQSNLLASGGGTADRCIKFWNT  316

Query  2735  RKGACISS  2712
               GA ++S
Sbjct  317   HTGALLNS  324


 Score =   107 bits (267),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = -1

Query  2683  QICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSPDG  2504
             Q+C LQW++H KE+LS HGF +      +LCLW+YPSM+K+ +   H SR LHL+QSPDG
Sbjct  330   QVCALQWSRHEKEILSSHGFSQ-----NQLCLWKYPSMAKVAEMSGHTSRVLHLAQSPDG  384

Query  2503  LTVVSAGADETLRFWEIFG-PPQADKSRTS  2417
              TV SA ADETLRFW+ F   P A K++++
Sbjct  385   TTVCSAAADETLRFWKCFAEAPPAPKAKSA  414



>ref|XP_004511460.1| PREDICTED: anaphase-promoting complex subunit cdc20-like [Cicer 
arietinum]
Length=454

 Score =   182 bits (461),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+A+N G        D++    +S++W+ D + + +G  SS++QLWD  + K +R L+G
Sbjct  161   LWDASN-GSTSELVTVDDESGPITSVSWAPDGRHIAIGLNSSEVQLWDTTSDKQLRTLRG  219

Query  3095  -HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
              H  RVGS+AWN H+LT+G  D  II++DVR+ + ++   + H  EVCGLKWS +G  L 
Sbjct  220   GHRQRVGSLAWNNHILTTGGMDGKIINNDVRIRSHIVETYRGHEHEVCGLKWSPSGQQLA  279

Query  2918  SGGNDNLVYIWD---TFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIK  2748
             SGGNDNL+YIWD   +   S   +LHR  DH++AVKALAWCP+  ++LASGGG+ D CIK
Sbjct  280   SGGNDNLLYIWDRSTSSSSSPTQWLHRLEDHTSAVKALAWCPFQGNLLASGGGSGDRCIK  339

Query  2747  MWSIRKGACISS  2712
              W+   GAC++S
Sbjct  340   FWNTHTGACLNS  351


 Score =   103 bits (257),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  355   GSQVCSLLWNKNERELLSSHGFSQ-----NQLTLWKYPSMVKMGELTGHTSRVLYMAQSP  409

Query  2509  DGLTVVSAGADETLRFWEIFGPPQ-----ADKSRTSDFDNLLSLK  2390
             DG TV SA ADETLRFW  FG P+     A K+R   F +L  ++
Sbjct  410   DGCTVASAAADETLRFWNAFGTPEVVTKAAPKARVEPFSHLSRIR  454



>ref|XP_006429995.1| hypothetical protein CICLE_v10011710mg [Citrus clementina]
 gb|ESR43235.1| hypothetical protein CICLE_v10011710mg [Citrus clementina]
Length=450

 Score =   182 bits (462),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 145/233 (62%), Gaps = 13/233 (6%)
 Frame = -3

Query  3374  HVPMS----INNPELSPR*TFLLFCYSESSE-ASEMSN---LWNATNHGIqqleeeednq  3219
             H+P S    ++ PEL       L  +  S+  A  +SN   LW+A+N G        D++
Sbjct  117   HIPQSSERTLDAPELVDDFYLNLLDWGSSNVLAIALSNTVYLWDASN-GSTSELVTIDDE  175

Query  3218  dDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSG  3042
             D   +S++W+ D + + +G  +S +Q+WD+  ++ +R L+G H  RV S+AWN H+LT+G
Sbjct  176   DGPVTSVSWAPDGRHMAIGLNNSHVQIWDSTANRQLRTLRGCHRSRVDSLAWNNHILTTG  235

Query  3041  SYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR  2862
               D  II++DVRV   ++   + H +EVCGLKWS +G  L SGGNDNL++IWD    SS 
Sbjct  236   GMDGKIINNDVRVREHIVETYRGHQQEVCGLKWSASGQQLASGGNDNLLFIWDRSMASSN  295

Query  2861  ---DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
                 +LHR  DH+AAVKALAWCP+  ++LASGGG  D CIK W+   GAC++S
Sbjct  296   SPTQWLHRLEDHTAAVKALAWCPFQGNLLASGGGGGDQCIKFWNTHTGACLNS  348


 Score =   103 bits (256),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C LQW+KH +ELLS HGF +      +L LW+YPSM K+ +   H SR L ++QSP
Sbjct  352   GSQVCSLQWSKHERELLSSHGFTQ-----NQLTLWKYPSMVKMAELTGHTSRVLFMAQSP  406

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADK  2429
             DG TV SA  DETLRFW +FG P+  K
Sbjct  407   DGNTVASAAGDETLRFWNVFGSPEVAK  433



>ref|XP_004511458.1| PREDICTED: anaphase-promoting complex subunit cdc20-like [Cicer 
arietinum]
Length=454

 Score =   182 bits (461),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+A+N G        D++    +S++W+ D + + +G  SS++QLWD  + K +R L+G
Sbjct  161   LWDASN-GSTSELVTVDDESGPITSVSWAPDGRHIAIGLNSSEVQLWDTTSDKQLRTLRG  219

Query  3095  -HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
              H  RVGS+AWN H+LT+G  D  II++DVR+ + ++   + H  EVCGLKWS +G  L 
Sbjct  220   GHRQRVGSLAWNNHILTTGGMDGKIINNDVRIRSHIVETYRGHEHEVCGLKWSPSGQQLA  279

Query  2918  SGGNDNLVYIWD---TFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIK  2748
             SGGNDNL+YIWD   +   S   +LHR  DH++AVKALAWCP+  ++LASGGG+ D CIK
Sbjct  280   SGGNDNLLYIWDRSTSSSSSPTQWLHRLEDHTSAVKALAWCPFQGNLLASGGGSGDRCIK  339

Query  2747  MWSIRKGACISS  2712
              W+   GAC++S
Sbjct  340   FWNTHTGACLNS  351


 Score =   103 bits (257),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  355   GSQVCSLLWNKNERELLSSHGFSQ-----NQLTLWKYPSMVKMGELTGHTSRVLYMAQSP  409

Query  2509  DGLTVVSAGADETLRFWEIFGPPQ-----ADKSRTSDFDNLLSLK  2390
             DG TV SA ADETLRFW  FG P+     A K+R   F +L  ++
Sbjct  410   DGCTVASAAADETLRFWNAFGTPEVVTKAAPKARAQPFSHLSRIR  454



>gb|EMS66828.1| Anaphase-promoting complex subunit cdc20 [Triticum urartu]
Length=457

 Score =   184 bits (468),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 122/172 (71%), Gaps = 7/172 (4%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             +S++W+ D + + +G  SS +Q+WD+ +++++R L+G HE RVGS+AWN  +LT+G  D 
Sbjct  183   TSVSWAPDGQNIAIGLNSSAVQIWDSSSNRLLRTLQGVHESRVGSLAWNKSILTAGGMDG  242

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSS-----  2865
              I+++DVR+ +  +   + H++EVCGLKWSG+G  L SGGNDNL++IWD    SS     
Sbjct  243   KIVNNDVRIRDHAVQTYRGHSQEVCGLKWSGSGRQLASGGNDNLLHIWDVSMASSAQSAG  302

Query  2864  -RDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
                +LHR  DHSAAVKALAWCP+  ++LASGGG  D CIK W+   GAC++S
Sbjct  303   RTQWLHRMEDHSAAVKALAWCPFQSNLLASGGGANDRCIKFWNTHTGACLNS  354


 Score =   100 bits (250),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 62/93 (67%), Gaps = 7/93 (8%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM+K+ +   H SR L ++QSP
Sbjct  358   GSQVCALLWNKNDRELLSSHGFTQ-----NQLTLWKYPSMAKMAELNGHTSRVLFMAQSP  412

Query  2509  DGLTVVSAGADETLRFWEIF--GPPQADKSRTS  2417
             DG TV SA ADETLRFW +F   P  A K +TS
Sbjct  413   DGCTVASAAADETLRFWNVFSEAPKSAVKEKTS  445



>ref|XP_004511461.1| PREDICTED: anaphase-promoting complex subunit cdc20-like [Cicer 
arietinum]
Length=454

 Score =   182 bits (461),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+A+N G        D++    +S++W+ D + + +G  SS++QLWD  + K +R L+G
Sbjct  161   LWDASN-GSTSELVTVDDESGPITSVSWAPDGRHIAIGLNSSEVQLWDTTSDKQLRTLRG  219

Query  3095  -HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
              H  RVGS+AWN H+LT+G  D  II++DVR+ + ++   + H  EVCGLKWS +G  L 
Sbjct  220   GHRQRVGSLAWNNHILTTGGMDGKIINNDVRIRSHIVETYRGHEHEVCGLKWSPSGQQLA  279

Query  2918  SGGNDNLVYIWD---TFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIK  2748
             SGGNDNL+YIWD   +   S   +LHR  DH++AVKALAWCP+  ++LASGGG+ D CIK
Sbjct  280   SGGNDNLLYIWDRSTSSSSSPTQWLHRLEDHTSAVKALAWCPFQGNLLASGGGSGDRCIK  339

Query  2747  MWSIRKGACISS  2712
              W+   GAC++S
Sbjct  340   FWNTHTGACLNS  351


 Score =   103 bits (257),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  355   GSQVCSLLWNKNERELLSSHGFSQ-----NQLTLWKYPSMVKMGELTGHTSRVLYMAQSP  409

Query  2509  DGLTVVSAGADETLRFWEIFGPPQ-----ADKSRTSDFDNLLSLK  2390
             DG TV SA ADETLRFW  FG P+     A K+R   F +L  ++
Sbjct  410   DGCTVASAAADETLRFWNAFGTPEVVTKAAPKARAEPFSHLSRIR  454



>ref|XP_008621004.1| cell division cycle 20, cofactor-APC complex [Saprolegnia diclina 
VS20]
 gb|EQC25548.1| cell division cycle 20, cofactor-APC complex [Saprolegnia diclina 
VS20]
Length=518

 Score =   187 bits (474),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 130/189 (69%), Gaps = 5/189 (3%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA    I +L   + ++  Y SS++W  +  TL VG + + +QLWD   +K++R L G
Sbjct  235   LWNAATGAIDELMALDGDE--YISSVSWIQEGSTLAVGSSDATVQLWDTTNAKLLRTLNG  292

Query  3095  HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVS  2916
             H  RVG+++WN HVL+SGS D SIIHHDVRV++ +++ L +H +EVCGL+WS  G+ L S
Sbjct  293   HSARVGALSWNRHVLSSGSRDTSIIHHDVRVASHIVATLNSHEQEVCGLRWSPDGSKLAS  352

Query  2915  GGNDNLVYIWDTFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSI  2736
             GGNDN + IW+  + +    +H+  DH AAVKALAWCP++  VLASGGGT D  IK+W+ 
Sbjct  353   GGNDNALCIWNQMQTTP---MHKLTDHCAAVKALAWCPWDRHVLASGGGTADRTIKLWNA  409

Query  2735  RKGACISST  2709
             + G+ + ST
Sbjct  410   QTGSLLQST  418


 Score = 98.2 bits (243),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L W+   KELLS HG+ +      +LCLW YP+M K+ +   H++R LHL+  P
Sbjct  421   GSQVCALLWSTSEKELLSSHGYAQ-----NELCLWSYPAMRKVKELTGHSARVLHLAAGP  475

Query  2509  DGLTVVSAGADETLRFWEIFGPP  2441
             D  TVVS  ADETLRFW IF PP
Sbjct  476   DATTVVSGAADETLRFWNIFSPP  498



>ref|XP_003600092.1| Fizzy-related protein-like protein [Medicago truncatula]
 gb|AES70343.1| transducin family protein/WD-40 repeat protein [Medicago truncatula]
Length=459

 Score =   181 bits (458),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 119/170 (70%), Gaps = 5/170 (3%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG--HEGRVGSIAWNGHVLTSGSYD  3033
             +S++W+ D + +G+G  +S++QLWD  + + +R LKG   + RVGS+AWN H+LT+G  D
Sbjct  187   TSVSWAPDGRHIGIGLNNSEVQLWDTASDRQLRTLKGGHRQQRVGSLAWNNHILTTGGMD  246

Query  3032  RSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR---  2862
               II++DVR+   ++   + H REVCGLKWS +G  L SGGNDN +YIWD    +SR   
Sbjct  247   GRIINNDVRIRAHIVETYRGHEREVCGLKWSASGQQLASGGNDNQLYIWDRSTSTSRSPT  306

Query  2861  DYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
              +LHR  DH++AVKALAWCP+  ++LA+GGG+ D  IK W+   GAC++S
Sbjct  307   QWLHRLEDHTSAVKALAWCPFQANLLATGGGSGDETIKFWNTHTGACLNS  356


 Score =   104 bits (259),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM KI +   H SR LH++Q+P
Sbjct  360   GSQVCSLLWNKNERELLSSHGFTQ-----NQLTLWKYPSMVKIAELNGHTSRVLHMAQNP  414

Query  2509  DGLTVVSAGADETLRFWEIFGPPQ-----ADKSRTSDFDNLLSLK  2390
             DG TV +A ADETLRFW  FG P+     A K+R   F ++  ++
Sbjct  415   DGCTVATAAADETLRFWNAFGTPEVATKAAPKARAEPFSHVSRIR  459



>ref|XP_003610876.1| Cell division cycle protein-like protein [Medicago truncatula]
 gb|AES93834.1| anaphase-promoting complex subunit cdc20-like protein [Medicago 
truncatula]
Length=454

 Score =   182 bits (462),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LW+A+N G        + +D   +S++W+ D + +G+G  +S++QLWD  + K +R LKG
Sbjct  161   LWDASN-GSTSELVTVEEEDGPITSVSWAPDGRHIGIGLNNSEVQLWDTASDKQLRTLKG  219

Query  3095  -HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
              H  RVGS+AWN H+LT+G  D  II++DVR+   ++   + H +EVCGLKWS +G  L 
Sbjct  220   GHRQRVGSLAWNNHILTTGGMDGKIINNDVRIRAHIVETYRGHEQEVCGLKWSASGQQLA  279

Query  2918  SGGNDNLVYIWD---TFKMSSRDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIK  2748
             SGGNDNL+YIWD   +   S   +LHR  DH++AVKALAWCP+  ++LA+GGG+ D  IK
Sbjct  280   SGGNDNLLYIWDRGTSTSSSPTQWLHRLEDHTSAVKALAWCPFQGNLLATGGGSGDRTIK  339

Query  2747  MWSIRKGACISS  2712
              W+   GAC++S
Sbjct  340   FWNTHTGACLNS  351


 Score =   102 bits (255),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  355   GSQVCSLLWNKNERELLSSHGFAQ-----NQLTLWKYPSMVKMAELNGHTSRVLYMAQSP  409

Query  2509  DGLTVVSAGADETLRFWEIFGPPQ-----ADKSRTSDFDNLLSLK  2390
             DG TV +A ADETLRFW  FG P+     A K+R   F ++  ++
Sbjct  410   DGCTVATAAADETLRFWNAFGTPEVVAKAAPKARAEPFSHVSRIR  454



>ref|XP_004494277.1| PREDICTED: anaphase-promoting complex subunit cdc20-like [Cicer 
arietinum]
Length=455

 Score =   183 bits (465),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             +S++W+ D + L VG  +S +QLWD  ++K++R LKG H  RVG++AWN H+LT+G+ D 
Sbjct  184   TSVSWAPDGRHLAVGLNNSHVQLWDTTSNKLLRTLKGGHRARVGTLAWNSHILTTGAMDS  243

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRD---  2859
              I+++DVRV + ++   + H++EVCGLKWS +G  L SGGNDN+V+IWD   +SS     
Sbjct  244   KIVNNDVRVRSHIVETYRGHSQEVCGLKWSPSGTQLASGGNDNVVHIWDRSVVSSNSPTR  303

Query  2858  YLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             +LHRF +H+AAVKALAWCP+  ++LASGGG  D CIK+W+   GA ++S
Sbjct  304   WLHRFEEHNAAVKALAWCPFQGNLLASGGGGGDHCIKLWNTHTGARLNS  352


 Score =   101 bits (252),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HG+ +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  356   GSQVCSLLWNKNERELLSAHGYTQ-----NQLTLWKYPSMVKMAELNGHTSRVLYMAQSP  410

Query  2509  DGLTVVSAGADETLRFWEIFGPPQA  2435
             DG TV SA ADETLRFW +FG P A
Sbjct  411   DGCTVASAAADETLRFWNVFGTPAA  435



>gb|KHN22585.1| Anaphase-promoting complex subunit cdc20 [Glycine soja]
Length=457

 Score =   183 bits (465),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 122/169 (72%), Gaps = 4/169 (2%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             +S+AW+ D + + +G  +S +QLWD+  S+++R LKG H+ RVGS++WN H+LT+G  D 
Sbjct  187   TSVAWAPDGRHVAIGLNNSHVQLWDSHASRLLRTLKGGHQARVGSLSWNNHILTTGGMDG  246

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRD---  2859
              I+++DVRV + ++   + H +E+CGL+WS +G  L SGGNDN+++IWD   +SS     
Sbjct  247   RIVNNDVRVRHHIVESYRGHQQEICGLRWSPSGQQLASGGNDNVIHIWDRTMVSSNSPTH  306

Query  2858  YLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             +LHRF +H AAVKALAWCP+  ++LASGGG  D CIK W+   GAC++S
Sbjct  307   WLHRFEEHRAAVKALAWCPFQANLLASGGGGGDHCIKFWNTHTGACLNS  355


 Score =   100 bits (250),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L W+K+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  359   GSQVCALLWSKNERELLSSHGFTQ-----NQLALWKYPSMLKMAELKGHTSRVLYMAQSP  413

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADK  2429
             +G TV SA  DETLRFW +FG PQA K
Sbjct  414   NGCTVASAAGDETLRFWNVFGTPQASK  440



>ref|XP_002323378.2| hypothetical protein POPTR_0016s06920g [Populus trichocarpa]
 gb|EEF05139.2| hypothetical protein POPTR_0016s06920g [Populus trichocarpa]
Length=448

 Score =   183 bits (465),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 131/192 (68%), Gaps = 5/192 (3%)
 Frame = -3

Query  3275  LWNATNHGIqqleeeednqdDYPSSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG  3096
             LWNA+N  I ++   ++      +SI+W+ D + L VG  +S +QLWD+ T++++R L+G
Sbjct  156   LWNASNSSISEVVTVDEEDGPV-TSISWAPDGRHLAVGLDNSNVQLWDSATNQMLRTLRG  214

Query  3095  -HEGRVGSIAWNGHVLTSGSYDRSIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLV  2919
              H  RV S+AWN H+LT+G  D  +I++DVR+   ++   + H +EVCGLKWS +G  L 
Sbjct  215   GHRLRVTSLAWNHHLLTTGGKDAKVINNDVRIREHIVESYEGHRQEVCGLKWSASGQQLA  274

Query  2918  SGGNDNLVYIWDTFKMSS---RDYLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIK  2748
             SGGNDNL++IWD F  SS   R +LH+  DH+AAVKALAWCP+  ++LASGGG  D  IK
Sbjct  275   SGGNDNLLFIWDRFMASSNSPRHWLHKLEDHTAAVKALAWCPFQSNLLASGGGGNDRHIK  334

Query  2747  MWSIRKGACISS  2712
              W+ + G C++S
Sbjct  335   FWNTQTGTCLNS  346


 Score =   100 bits (249),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C LQWNKH +ELLS HGF E      +L LW+YPSM K+ +   H S  L ++QSP
Sbjct  350   GSQVCALQWNKHERELLSSHGFTE-----NQLILWKYPSMVKMAELSGHTSPVLFMTQSP  404

Query  2509  DGLTVVSAGADETLRFWEIFG  2447
             DG TV SA  DETLRFW +FG
Sbjct  405   DGYTVASAAGDETLRFWNVFG  425



>ref|XP_007163007.1| hypothetical protein PHAVU_001G198300g [Phaseolus vulgaris]
 gb|ESW35001.1| hypothetical protein PHAVU_001G198300g [Phaseolus vulgaris]
Length=458

 Score =   181 bits (459),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 119/169 (70%), Gaps = 4/169 (2%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             +S+AW+ D + L +G  +  +QLWD+ +S++VR L+G H+ RVGS+ WN H+LT+G  D 
Sbjct  186   TSVAWAPDGRHLAIGLNNFHVQLWDSHSSRMVRTLRGGHQARVGSLCWNNHILTTGGMDG  245

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSRD---  2859
              I+++DVRV + ++   + H +EVCGLKWS +G  L SGGNDN+++IWD    SS     
Sbjct  246   RIVNNDVRVRSHIVESYRGHQQEVCGLKWSPSGQQLASGGNDNVIHIWDRASASSNSATR  305

Query  2858  YLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             +LHRF +H AAVKALAWCP+  ++LASGGG  D CIK W+   G C++S
Sbjct  306   WLHRFEEHRAAVKALAWCPFQANLLASGGGGGDHCIKFWNAHTGVCLNS  354


 Score =   102 bits (255),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L WNK+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  358   GSQVCSLLWNKNERELLSSHGFTQ-----NQLTLWKYPSMLKMGELKGHTSRVLYMTQSP  412

Query  2509  DGLTVVSAGADETLRFWEIFGPPQADK  2429
             DG TV SA  DETLRFW +FG PQA K
Sbjct  413   DGCTVASAAGDETLRFWNVFGTPQASK  439



>gb|KFK29939.1| hypothetical protein AALP_AA7G197900 [Arabis alpina]
Length=456

 Score =   182 bits (463),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 122/169 (72%), Gaps = 4/169 (2%)
 Frame = -3

Query  3206  SSIAWSTDAKTLGVGCASSKIQLWDAETSKIVRCLKG-HEGRVGSIAWNGHVLTSGSYDR  3030
             +SI W+ D + + VG  +S++QLWD+ +++ +R LKG H+ RVGS+AWN H+LT+G  D 
Sbjct  185   TSINWAPDGRHVAVGLNNSEVQLWDSASNRQLRTLKGGHQSRVGSLAWNNHILTTGGMDG  244

Query  3029  SIIHHDVRVSNSLISLLKAHTREVCGLKWSGTGNFLVSGGNDNLVYIWDTFKMSSR---D  2859
              II++DVR+ + ++   + HT+EVCGLKWSG+G  L SGGNDN+V+IWD    SS     
Sbjct  245   QIINNDVRIRSPIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQ  304

Query  2858  YLHRFNDHSAAVKALAWCPYNYDVLASGGGTFDGCIKMWSIRKGACISS  2712
             +LHR  +H++AVKALAWCP+  ++LA+GGG  D  IK W+   GAC++S
Sbjct  305   WLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNS  353


 Score =   100 bits (250),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 10/105 (10%)
 Frame = -1

Query  2689  GDQICGLQWNKHHKELLSGHGFGERGDGTGKLCLWRYPSMSKICDSWNHASRALHLSQSP  2510
             G Q+C L W+K+ +ELLS HGF +      +L LW+YPSM K+ +   H SR L+++QSP
Sbjct  357   GSQVCSLLWSKNERELLSSHGFTQ-----NQLTLWKYPSMVKMAELTGHTSRVLYMAQSP  411

Query  2509  DGLTVVSAGADETLRFWEIFGPPQ-----ADKSRTSDFDNLLSLK  2390
             DG TV SA  DETLRFW +FG P+     A K+ +  F N+  ++
Sbjct  412   DGCTVASAAGDETLRFWNVFGVPETAKKPAPKAASEPFSNVNRIR  456



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13744078097256