BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22995_g1_i1 len=2013 path=[1:0-123 6652:124-187 7880:188-195
7888:196-213 6786:214-458 2888:459-513 2888:514-568 2888:569-623
2942:624-2012]

Length=2013
                                                                      Score     E

ref|XP_011089572.1|  PREDICTED: peroxisomal membrane protein 13         202   8e-56   
gb|KDP45181.1|  hypothetical protein JCGZ_15046                         195   4e-53   
ref|XP_002524578.1|  nucleic acid binding protein, putative             196   5e-53   Ricinus communis
ref|XP_007049511.1|  Peroxin 13                                         194   8e-53   
ref|XP_010258482.1|  PREDICTED: peroxisomal membrane protein 13-like    193   2e-52   
ref|XP_006447908.1|  hypothetical protein CICLE_v10016105mg             191   1e-51   
emb|CDP06814.1|  unnamed protein product                                191   1e-51   
ref|XP_006469374.1|  PREDICTED: peroxisomal membrane protein 13-like    191   1e-51   
gb|KDO51029.1|  hypothetical protein CISIN_1g022421mg                   191   1e-51   
gb|KDO51030.1|  hypothetical protein CISIN_1g022421mg                   185   2e-49   
ref|XP_004240448.1|  PREDICTED: peroxisomal membrane protein 13         184   5e-49   
ref|XP_002320551.2|  hypothetical protein POPTR_0014s17220g             184   6e-49   Populus trichocarpa [western balsam poplar]
ref|XP_004486871.1|  PREDICTED: peroxisomal membrane protein 13-like    183   8e-49   
ref|XP_011006736.1|  PREDICTED: peroxisomal membrane protein 13-like    183   9e-49   
ref|XP_003546796.1|  PREDICTED: peroxisomal membrane protein 13         183   1e-48   
ref|XP_010025045.1|  PREDICTED: peroxisomal membrane protein 13-like    182   3e-48   
ref|XP_006344086.1|  PREDICTED: peroxisomal membrane protein 13-l...    181   7e-48   
ref|XP_006344085.1|  PREDICTED: peroxisomal membrane protein 13-l...    181   8e-48   
ref|XP_003597539.1|  Peroxisome biogenesis factor                       180   2e-47   
gb|KEH39502.1|  hypothetical protein MTR_2g099360                       180   2e-47   
gb|ACB59355.1|  peroxisome biogenesis factor 13                         179   3e-47   Nicotiana tabacum [American tobacco]
gb|KHG04730.1|  Peroxisomal membrane 13 -like protein                   179   4e-47   
ref|XP_009615747.1|  PREDICTED: peroxisomal membrane protein 13 i...    179   4e-47   
ref|XP_006372778.1|  glycine-rich family protein                        178   5e-47   
gb|ABK93770.1|  unknown                                                 178   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011043592.1|  PREDICTED: peroxisomal membrane protein 13-like    178   6e-47   
ref|XP_011047730.1|  PREDICTED: peroxisomal membrane protein 13-l...    177   7e-47   
ref|XP_011011867.1|  PREDICTED: peroxisomal membrane protein 13-like    177   7e-47   
ref|XP_010242714.1|  PREDICTED: peroxisomal membrane protein 13-like    177   7e-47   
ref|XP_009615746.1|  PREDICTED: peroxisomal membrane protein 13 i...    178   8e-47   
ref|XP_009764929.1|  PREDICTED: peroxisomal membrane protein 13 i...    177   9e-47   
ref|XP_006442935.1|  hypothetical protein CICLE_v10021425mg             177   1e-46   
gb|KDO50762.1|  hypothetical protein CISIN_1g022548mg                   177   2e-46   
ref|XP_009764922.1|  PREDICTED: peroxisomal membrane protein 13 i...    177   2e-46   
ref|XP_007131922.1|  hypothetical protein PHAVU_011G052000g             176   4e-46   
gb|AGV54834.1|  hypothetical protein                                    173   3e-45   
ref|XP_010551992.1|  PREDICTED: peroxisomal membrane protein 13-like    171   9e-45   
ref|XP_010547185.1|  PREDICTED: peroxisomal membrane protein 13 i...    172   1e-44   
ref|XP_010547186.1|  PREDICTED: peroxisomal membrane protein 13 i...    171   1e-44   
ref|XP_004299871.1|  PREDICTED: uncharacterized protein LOC101314...    170   6e-44   
ref|XP_004299872.1|  PREDICTED: uncharacterized protein LOC101314...    170   7e-44   
ref|XP_006344102.1|  PREDICTED: peroxisomal membrane protein 13-like    169   1e-43   
gb|ACU19041.1|  unknown                                                 168   2e-43   Glycine max [soybeans]
ref|XP_003543576.1|  PREDICTED: peroxisomal membrane protein 13 i...    168   3e-43   
ref|XP_010094089.1|  hypothetical protein L484_018106                   168   5e-43   
ref|XP_008369189.1|  PREDICTED: peroxisomal membrane protein 13         165   2e-42   
ref|XP_003537925.1|  PREDICTED: peroxisomal membrane protein 13-like    164   3e-42   
ref|XP_006298214.1|  hypothetical protein CARUB_v10014265mg             164   6e-42   
ref|XP_002884657.1|  hypothetical protein ARALYDRAFT_478079             163   1e-41   
ref|NP_187412.1|  peroxin 13                                            162   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009341150.1|  PREDICTED: peroxisomal membrane protein 13         162   2e-41   
ref|XP_007150473.1|  hypothetical protein PHAVU_005G155400g             160   2e-40   
ref|XP_010069556.1|  PREDICTED: peroxisomal membrane protein 13         157   1e-39   
ref|XP_007223181.1|  hypothetical protein PRUPE_ppa009172mg             155   9e-39   
ref|XP_010929991.1|  PREDICTED: peroxisomal membrane protein 13-like    153   2e-38   
emb|CDY28038.1|  BnaC05g44400D                                          153   2e-38   
ref|XP_006407824.1|  hypothetical protein EUTSA_v10021215mg             153   5e-38   
ref|XP_008796037.1|  PREDICTED: peroxisomal membrane protein 13-like    151   1e-37   
ref|XP_008237186.1|  PREDICTED: peroxisomal membrane protein 13         150   3e-37   
ref|XP_008347893.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    154   3e-37   
ref|XP_009147062.1|  PREDICTED: peroxisomal membrane protein 13         150   4e-37   
ref|XP_009134980.1|  PREDICTED: peroxisomal membrane protein 13-like    150   5e-37   
emb|CDY35943.1|  BnaA05g30070D                                          150   8e-37   
ref|XP_010486321.1|  PREDICTED: peroxisomal membrane protein 13         149   2e-36   
ref|XP_010464388.1|  PREDICTED: peroxisomal membrane protein 13-like    148   2e-36   
ref|XP_010454009.1|  PREDICTED: peroxisomal membrane protein 13-like    147   4e-36   
ref|XP_004152142.1|  PREDICTED: uncharacterized protein LOC101221260    145   2e-35   
ref|XP_010941061.1|  PREDICTED: peroxisomal membrane protein 13-like    144   6e-35   
ref|XP_008454097.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    144   6e-35   
ref|XP_009399015.1|  PREDICTED: peroxisomal membrane protein 13         143   1e-34   
ref|XP_008775485.1|  PREDICTED: peroxisomal membrane protein 13-like    142   2e-34   
ref|XP_009388497.1|  PREDICTED: peroxisomal membrane protein 13-like    142   2e-34   
ref|XP_010672281.1|  PREDICTED: peroxisomal membrane protein 13         142   4e-34   
ref|XP_010910086.1|  PREDICTED: peroxisomal membrane protein 13-l...    139   3e-33   
ref|XP_010910084.1|  PREDICTED: peroxisomal membrane protein 13-l...    139   7e-33   
gb|EYU36869.1|  hypothetical protein MIMGU_mgv1a010448mg                139   7e-33   
ref|XP_009124313.1|  PREDICTED: peroxisomal membrane protein 13-like    137   8e-33   
ref|XP_010910085.1|  PREDICTED: peroxisomal membrane protein 13-l...    138   9e-33   
gb|KDP43909.1|  hypothetical protein JCGZ_20919                         137   1e-32   
ref|XP_006657452.1|  PREDICTED: peroxisomal membrane protein 13-l...    135   4e-32   
ref|XP_006657451.1|  PREDICTED: peroxisomal membrane protein 13-l...    135   5e-32   
gb|ABK26417.1|  unknown                                                 135   7e-32   Picea sitchensis
ref|NP_001058908.1|  Os07g0152800                                       131   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EMT28271.1|  hypothetical protein F775_30696                         130   4e-30   
ref|XP_006858184.1|  hypothetical protein AMTR_s00062p00160630          130   8e-30   
gb|EMS58205.1|  hypothetical protein TRIUR3_02268                       130   9e-30   
ref|XP_004955471.1|  PREDICTED: peroxisomal membrane protein 13-l...    129   1e-29   
dbj|BAJ86828.1|  predicted protein                                      129   1e-29   
ref|XP_004955473.1|  PREDICTED: peroxisomal membrane protein 13-l...    129   1e-29   
ref|XP_003557652.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    134   2e-29   
ref|XP_004955472.1|  PREDICTED: peroxisomal membrane protein 13-l...    128   2e-29   
gb|ACG37046.1|  glycine-rich protein                                    127   3e-29   Zea mays [maize]
emb|CDX74040.1|  BnaA03g30070D                                          127   1e-28   
ref|XP_008667295.1|  PREDICTED: uncharacterized protein LOC100194...    126   1e-28   
ref|XP_008667294.1|  PREDICTED: uncharacterized protein LOC100194...    126   1e-28   
emb|CDY07989.1|  BnaC03g35340D                                          127   2e-28   
ref|XP_004981532.1|  PREDICTED: peroxisomal membrane protein 13-l...    122   2e-27   
ref|XP_004981531.1|  PREDICTED: peroxisomal membrane protein 13-l...    122   2e-27   
ref|XP_002466342.1|  hypothetical protein SORBIDRAFT_01g005970          124   5e-27   Sorghum bicolor [broomcorn]
ref|NP_001051486.1|  Os03g0786000                                       120   1e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABC60343.1|  putative glycine-rich protein                           116   2e-26   Musa acuminata [banana]
ref|XP_006650694.1|  PREDICTED: peroxisomal membrane protein 13-like    118   8e-26   
gb|ACL54731.1|  unknown                                                 117   1e-25   Zea mays [maize]
tpg|DAA51783.1|  TPA: glycine-rich protein                              116   3e-25   
ref|XP_008812815.1|  PREDICTED: peroxisomal membrane protein 13-like    114   3e-25   
ref|NP_001132789.1|  uncharacterized protein LOC100194278               112   9e-24   Zea mays [maize]
ref|XP_008667293.1|  PREDICTED: uncharacterized protein LOC100194...    112   1e-23   
ref|XP_008667292.1|  PREDICTED: uncharacterized protein LOC100194...    112   1e-23   
dbj|BAK08359.1|  predicted protein                                      111   1e-23   
ref|XP_002973297.1|  hypothetical protein SELMODRAFT_173180             110   3e-23   
ref|XP_002976607.1|  hypothetical protein SELMODRAFT_443291             110   3e-23   
ref|XP_003558107.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...    114   4e-23   
gb|EMT00619.1|  Putative peroxisomal (S)-2-hydroxy-acid oxidase 1       114   4e-23   
gb|ABK22418.1|  unknown                                                 107   4e-22   Picea sitchensis
ref|NP_001149646.1|  LOC100283272                                       107   5e-22   Zea mays [maize]
gb|KCW87649.1|  hypothetical protein EUGRSUZ_A00039                   97.8    4e-19   
gb|KCW87650.1|  hypothetical protein EUGRSUZ_A00039                   97.4    4e-19   
gb|AFK39269.1|  unknown                                               94.7    8e-19   
ref|XP_006442934.1|  hypothetical protein CICLE_v10021425mg           96.7    1e-18   
gb|KDO50763.1|  hypothetical protein CISIN_1g022548mg                 96.3    1e-18   
ref|XP_001770268.1|  predicted protein                                97.4    3e-18   
ref|XP_011047732.1|  PREDICTED: peroxisomal membrane protein 13-l...  94.4    5e-18   
gb|ACU21190.1|  unknown                                               90.9    6e-17   Glycine max [soybeans]
gb|EPS63109.1|  hypothetical protein M569_11678                       89.7    1e-16   
gb|ACU23798.1|  unknown                                               86.3    2e-16   Glycine max [soybeans]
ref|XP_009397409.1|  PREDICTED: peroxisomal membrane protein 13-like  83.2    1e-15   
ref|XP_005849539.1|  hypothetical protein CHLNCDRAFT_142910           87.4    1e-15   
gb|ABF99230.1|  expressed protein                                     85.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809368.1|  PREDICTED: peroxisomal membrane protein 13-l...  85.9    3e-15   
ref|XP_010910087.1|  PREDICTED: peroxisomal membrane protein 13-l...  83.6    3e-14   
ref|XP_002503524.1|  predicted protein                                83.6    4e-14   Micromonas commoda
gb|KCW87079.1|  hypothetical protein EUGRSUZ_B03613                   79.3    5e-14   
gb|EPS69103.1|  hypothetical protein M569_05665                       78.2    8e-14   
ref|XP_008809369.1|  PREDICTED: peroxisomal membrane protein 13-l...  80.9    1e-13   
ref|XP_005645103.1|  hypothetical protein COCSUDRAFT_43976            80.5    2e-13   
gb|KCW81100.1|  hypothetical protein EUGRSUZ_C02476                   76.3    5e-13   
ref|XP_007033847.1|  Uncharacterized protein TCM_019948               75.1    1e-12   
dbj|BAH56952.1|  AT3G07560                                            75.1    4e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85612.1|  predicted protein                                    75.9    7e-12   
ref|XP_003055612.1|  predicted protein                                76.3    3e-11   
gb|KDD75299.1|  hypothetical protein H632_c758p1                      69.3    2e-09   
gb|KFM22936.1|  Peroxisomal membrane protein 13                       66.2    5e-09   
ref|XP_002949297.1|  hypothetical protein VOLCADRAFT_104235           61.2    2e-07   
ref|XP_001420118.1|  predicted protein                                61.2    8e-07   Ostreococcus lucimarinus CCE9901
ref|XP_001693517.1|  predicted protein                                60.1    9e-07   Chlamydomonas reinhardtii
emb|CEF99344.1|  unnamed product                                      59.7    2e-06   
tpg|DAA39779.1|  TPA: hypothetical protein ZEAMMB73_031103            59.7    4e-06   
ref|XP_007510404.1|  predicted protein                                57.4    9e-06   
gb|AFW87992.1|  hypothetical protein ZEAMMB73_343017                  56.2    7e-05   
ref|XP_006859049.1|  hypothetical protein AMTR_s00068p00188230        52.4    1e-04   



>ref|XP_011089572.1| PREDICTED: peroxisomal membrane protein 13 [Sesamum indicum]
Length=285

 Score =   202 bits (515),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAP SPPGFWISL+RVMQGVV FF R+AML DQ+ QAFH+ +TALLQLFDRS
Sbjct  162   DQDPNNPFGAPPSPPGFWISLMRVMQGVVTFFGRVAMLIDQNTQAFHMFMTALLQLFDRS  221

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLRILG+KTKP+KVHPP  EGLPGP +  G Q YIEGPK APSGAWD
Sbjct  222   GMLY---GELARFVLRILGVKTKPQKVHPPGVEGLPGPHNAPGRQSYIEGPKPAPSGAWD  278

Query  1096  SVWGD  1082
              VWGD
Sbjct  279   GVWGD  283


 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME N++  G  PPPKPWER GSSSGP PFKP S G TSDVVEASGT++PGE+V   +R+ 
Sbjct  1     MENNAQSSGGGPPPKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTAQPGEVVSTTDRSA  60

Query  1756  atnintvARPVPTRPWEQR  1700
             A N NT+ RPVPTRPWEQ+
Sbjct  61    AVNRNTLGRPVPTRPWEQQ  79



>gb|KDP45181.1| hypothetical protein JCGZ_15046 [Jatropha curcas]
Length=290

 Score =   195 bits (496),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TA+LQLFDR+
Sbjct  165   DQDPNNPYGAPSSPPGFWISFLRVMQGVVNFFGRISILIDQNTQAFHMFMTAMLQLFDRT  224

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLR+LGIKTKP+KV  P  +GLP P +  GNQ+Y+EGPK APSGAWD
Sbjct  225   GLLY---GELARFVLRLLGIKTKPRKVQGPGPDGLPAPHNPHGNQNYLEGPKGAPSGAWD  281

Query  1096  SVWGD  1082
             +VWGD
Sbjct  282   NVWGD  286


 Score = 95.1 bits (235),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVG-SSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++NS+Q GS PP KPWE+ G SSSGPTPFKPPS G TSDVVEASGT++PGE+V AA+RN
Sbjct  1     MDSNSQQTGSGPPAKPWEQAGTSSSGPTPFKPPSPGSTSDVVEASGTARPGEIVSAADRN  60

Query  1759  tatnintvARPVPTRPWEQR  1700
             T  N NT+ RPVPTRPWEQ+
Sbjct  61    TTVNRNTLGRPVPTRPWEQQ  80



>ref|XP_002524578.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF37786.1| nucleic acid binding protein, putative [Ricinus communis]
Length=313

 Score =   196 bits (497),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TA+LQLFDR+
Sbjct  188   DQDPNNPYGAPSSPPGFWISFLRVMQGVVNFFGRISILIDQNTQAFHMFMTAMLQLFDRT  247

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLR+LGIKTKP+KV  P  +GLP P +  GNQ+YIEGPK APSG WD
Sbjct  248   GLLY---GELARFVLRLLGIKTKPRKVQGPGPDGLPAPHNPHGNQNYIEGPKGAPSGGWD  304

Query  1096  SVWGDK  1079
             +VWGD 
Sbjct  305   NVWGDN  310


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 3/80 (4%)
 Frame = -3

Query  1912  GSSPPPKPWERVG-SSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv  1736
             G SPP KPWER G SSSGPTPFKPP+ G TSDVVEASGT++PGE+VPAANR TA N    
Sbjct  23    GGSPPAKPWERSGTSSSGPTPFKPPTPGSTSDVVEASGTARPGEIVPAANRTTAVNNTNT  82

Query  1735  A-RPVPTRPWEQRQTYGNTF  1679
               RPVPTRPWEQ QTYG+++
Sbjct  83    LGRPVPTRPWEQ-QTYGSSY  101



>ref|XP_007049511.1| Peroxin 13 [Theobroma cacao]
 gb|EOX93668.1| Peroxin 13 [Theobroma cacao]
Length=290

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNP+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ ++ALLQLFDR+
Sbjct  165   EQDPNNPYGAPSSPPGFWISFLRVMQGVVNFFGRISILIDQNTQAFHMFMSALLQLFDRT  224

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLR+LGIKTKP+K++    +GLP P +  GNQ+YIEGPKAAPSGAWD
Sbjct  225   GLLY---GELARFVLRLLGIKTKPRKINQAGPDGLPAPHNPHGNQNYIEGPKAAPSGAWD  281

Query  1096  SVWGDK  1079
             +VWG+ 
Sbjct  282   NVWGEN  287


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = -3

Query  1936  METNSRQPGSS-PPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++N +QP +   PPKPWE+  SSSG  PFKPPS G TSDVVEASGT++PGE+V   +R 
Sbjct  1     MDSNPQQPAAGGSPPKPWEQARSSSGSGPFKPPSPGSTSDVVEASGTARPGEIVSTTDRT  60

Query  1759  tatnintvARPVPTRPWEQRQ  1697
             TA N N V RP+P+RPWEQ+ 
Sbjct  61    TAVNRNAVGRPLPSRPWEQQN  81



>ref|XP_010258482.1| PREDICTED: peroxisomal membrane protein 13-like [Nelumbo nucifera]
 ref|XP_010258483.1| PREDICTED: peroxisomal membrane protein 13-like [Nelumbo nucifera]
Length=283

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNPFGAP SPPGFWIS +RVMQGVV FF RI++L DQ+ QAFH+ ++ALLQLFDRS
Sbjct  158   EQDPNNPFGAPPSPPGFWISFLRVMQGVVTFFGRISILVDQNTQAFHMFISALLQLFDRS  217

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LGI+ KP+K H P  +GLPGP + QG Q+YIEGPKAAPSG+WD
Sbjct  218   GVLY---GELARFVLRLLGIRRKPRKGHIPGPDGLPGPHNPQGGQNYIEGPKAAPSGSWD  274

Query  1096  SVWGD  1082
             SVWGD
Sbjct  275   SVWGD  279


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME+  +Q  +SPPPKPWER G+SSGP PFKPPS G TS+VVE +GTSKPGE+V  A+RNT
Sbjct  1     MESKPQQGANSPPPKPWERAGTSSGPAPFKPPSPGSTSEVVEGAGTSKPGEIVSTADRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
               N NT+ RPVPTRPWE  Q YG+ +
Sbjct  61    TVNRNTLGRPVPTRPWE--QNYGSNY  84



>ref|XP_006447908.1| hypothetical protein CICLE_v10016105mg [Citrus clementina]
 gb|ESR61148.1| hypothetical protein CICLE_v10016105mg [Citrus clementina]
Length=297

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 6/128 (5%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNP+G P SPPGFWIS +RVMQGVVNFF R+++L DQ+ QA H+ ++ALLQLFDRSG
Sbjct  170   QDPNNPYGDPPSPPGFWISFLRVMQGVVNFFGRVSILIDQNTQAVHMFMSALLQLFDRSG  229

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQS---LQGNQHYIEGPKAAPSGA  1103
             LLYGE   LARFVLRILGIKTKPK+V+ P   GLPGP +   LQGNQ+YIEGPKAAPSG 
Sbjct  230   LLYGE---LARFVLRILGIKTKPKQVNQPGPNGLPGPHNPHNLQGNQNYIEGPKAAPSGG  286

Query  1102  WDSVWGDK  1079
             WD+VWGD 
Sbjct  287   WDNVWGDN  294


 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++NS+Q    PP KPWER G+SSGPTPFKPPS G TSDVVEASGT++PG++V  A+RNT
Sbjct  1     MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTADRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
             A N N + RPVPTRPWEQ+Q YG+T+
Sbjct  61    AVNRNNLTRPVPTRPWEQQQNYGSTY  86



>emb|CDP06814.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAP SPP FW+SL+RVMQGVV FF R+A+L DQ+ QAFH+ VTALLQLFDRS
Sbjct  177   DQDPNNPFGAPPSPPSFWVSLMRVMQGVVTFFGRVAILIDQNTQAFHMFVTALLQLFDRS  236

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLRILGI+TKPKK  PP   GL GP +  GNQ+YIEGPKA PSG WD
Sbjct  237   GLLY---GELARFVLRILGIRTKPKKGQPPGPRGLQGPHNPHGNQNYIEGPKAPPSGGWD  293

Query  1096  SVWGDK  1079
             ++WGD 
Sbjct  294   NLWGDN  299


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvA  1733
             GS+PP KPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V  A+R+ +T      
Sbjct  16    GSNPPAKPWERAGSSSGPAPFKPPSPGSTSDVVEASGTARPGEIVSTADRSASTVNANAV  75

Query  1732  -RPVPTRPWE-QRQTYG  1688
              RP+P+RPWE Q+Q+YG
Sbjct  76    GRPMPSRPWEQQQQSYG  92



>ref|XP_006469374.1| PREDICTED: peroxisomal membrane protein 13-like [Citrus sinensis]
Length=297

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 6/128 (5%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNP+G P SPPGFWIS +RVMQGVVNFF R+++L DQ+ QA H+ ++ALLQLFDRSG
Sbjct  170   QDPNNPYGDPPSPPGFWISFLRVMQGVVNFFGRVSILIDQNTQAVHMFMSALLQLFDRSG  229

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQS---LQGNQHYIEGPKAAPSGA  1103
             LLYGE   LARFVLRILGIKTKPK+V+ P   GLPGP +   LQGNQ+YIEGPKAAPSG 
Sbjct  230   LLYGE---LARFVLRILGIKTKPKQVNQPGPNGLPGPHNPHNLQGNQNYIEGPKAAPSGG  286

Query  1102  WDSVWGDK  1079
             WD+VWGD 
Sbjct  287   WDNVWGDN  294


 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++NS+Q    PP KPWER G+SSGPTPFKPPS G TSDVVEASGT++PG++V   +RNT
Sbjct  1     MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTVDRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
             A N N + RPVPTRPWEQ+Q YG+T+
Sbjct  61    AVNRNNLTRPVPTRPWEQQQNYGSTY  86



>gb|KDO51029.1| hypothetical protein CISIN_1g022421mg [Citrus sinensis]
Length=297

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 6/128 (5%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNP+G P SPPGFWIS +RVMQGVVNFF R+++L DQ+ QA H+ ++ALLQLFDRSG
Sbjct  170   QDPNNPYGDPPSPPGFWISFLRVMQGVVNFFGRVSILIDQNTQAVHMFMSALLQLFDRSG  229

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPG---PQSLQGNQHYIEGPKAAPSGA  1103
             LLYGE   LARFVLRILGIKTKPK+V+ P   GLPG   P +LQGNQ+YIEGPKAAPSG 
Sbjct  230   LLYGE---LARFVLRILGIKTKPKQVNQPGPNGLPGLHNPHNLQGNQNYIEGPKAAPSGG  286

Query  1102  WDSVWGDK  1079
             WD+VWGD 
Sbjct  287   WDNVWGDN  294


 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++NS+Q    PP KPWER G+SSGPTPFKPPS G TSDVVEASGT++PG++V   +RNT
Sbjct  1     MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTVDRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
             A N N + RPVPTRPWEQ+Q YG+T+
Sbjct  61    AVNRNNLTRPVPTRPWEQQQNYGSTY  86



>gb|KDO51030.1| hypothetical protein CISIN_1g022421mg [Citrus sinensis]
Length=296

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 106/128 (83%), Gaps = 7/128 (5%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNP+G P SPPGFWIS +R MQGVVNFF R+++L DQ+ QA H+ ++ALLQLFDRSG
Sbjct  170   QDPNNPYGDPPSPPGFWISFLR-MQGVVNFFGRVSILIDQNTQAVHMFMSALLQLFDRSG  228

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPG---PQSLQGNQHYIEGPKAAPSGA  1103
             LLYGE   LARFVLRILGIKTKPK+V+ P   GLPG   P +LQGNQ+YIEGPKAAPSG 
Sbjct  229   LLYGE---LARFVLRILGIKTKPKQVNQPGPNGLPGLHNPHNLQGNQNYIEGPKAAPSGG  285

Query  1102  WDSVWGDK  1079
             WD+VWGD 
Sbjct  286   WDNVWGDN  293


 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++NS+Q    PP KPWER G+SSGPTPFKPPS G TSDVVEASGT++PG++V   +RNT
Sbjct  1     MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTVDRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
             A N N + RPVPTRPWEQ+Q YG+T+
Sbjct  61    AVNRNNLTRPVPTRPWEQQQNYGSTY  86



>ref|XP_004240448.1| PREDICTED: peroxisomal membrane protein 13 [Solanum lycopersicum]
Length=296

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP SPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++ALLQLFDRS
Sbjct  173   DQDPNNPYGAPPSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSALLQLFDRS  232

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLR+LG+KTKP K+ PP A  LPGP    GNQ++IEGPKAAP  AW+
Sbjct  233   GLLY---GELARFVLRLLGVKTKP-KIQPPGANALPGPHQPHGNQNFIEGPKAAPGAAWN  288

Query  1096  SVWGDK  1079
              VWGD 
Sbjct  289   DVWGDN  294


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  1894  KPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTR  1715
             KPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V  ANRNTA N NT+ARPVPTR
Sbjct  16    KPWERAGSSSGPAPFKPPSAGNTSDVVEASGTARPGEIVSTANRNTAVNNNTLARPVPTR  75

Query  1714  PWEQRQTYGNTF  1679
             PWEQ+QTYG+++
Sbjct  76    PWEQQQTYGSSY  87



>ref|XP_002320551.2| hypothetical protein POPTR_0014s17220g [Populus trichocarpa]
 gb|EEE98866.2| hypothetical protein POPTR_0014s17220g [Populus trichocarpa]
Length=308

 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAP SPP FW+S ++VMQGVVN F RI+ L DQ+ QAFH+ ++ALLQLFDRS
Sbjct  183   DQDPNNPFGAPPSPPSFWVSFLQVMQGVVNVFGRISFLIDQNTQAFHMFMSALLQLFDRS  242

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARF LR+LGIK+KP+KV  P  +G P P + +GNQ+YIEGPKAAPSGAWD
Sbjct  243   GLLY---GELARFALRLLGIKSKPRKVQGPGPDGFPVPHNPRGNQNYIEGPKAAPSGAWD  299

Query  1096  SVWGD  1082
             +VWGD
Sbjct  300   NVWGD  304


 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVG-SSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++NS+QPGSSPPPKPWER G SSSGPTPFKPPS G TSDVVEASGT+KPGE+VPA   N
Sbjct  1     MDSNSQQPGSSPPPKPWERAGTSSSGPTPFKPPSPGSTSDVVEASGTTKPGEIVPATGGN  60

Query  1759  tatnintvARPVPTRPWEQRQ  1697
             T    N+  RPVPTRPWEQ+ 
Sbjct  61    TVATANSFGRPVPTRPWEQQN  81



>ref|XP_004486871.1| PREDICTED: peroxisomal membrane protein 13-like [Cicer arietinum]
Length=298

 Score =   183 bits (465),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 5/127 (4%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP SPPGFWIS++RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  171   DQDPNNPYGAPPSPPGFWISVMRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRS  230

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP--GPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LG++TK KKV+PP   G P  GP +  GN +YIEG KAAPSG+
Sbjct  231   GVLY---GELARFVLRLLGVRTKSKKVNPPGPNGHPLHGPHNSSGNMNYIEGAKAAPSGS  287

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  288   WDNVWGN  294


 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = -3

Query  1909  SSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvAR  1730
             SSPPPKPWER GSSSGPTPF+PPS G TSDVVEASGT+KPGE+V  A+RN A N NT+ R
Sbjct  8     SSPPPKPWERAGSSSGPTPFRPPSGGNTSDVVEASGTAKPGEIVTTADRNAAVNGNTLTR  67

Query  1729  PVPTRPWEQRQTYGNT  1682
             PVPTRPWE  Q YGN 
Sbjct  68    PVPTRPWE--QNYGNN  81



>ref|XP_011006736.1| PREDICTED: peroxisomal membrane protein 13-like [Populus euphratica]
Length=288

 Score =   183 bits (464),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAP SPP FW+S +RVMQ VVN F RI+ L DQ+ QAFH+ ++ALLQLFDR+
Sbjct  163   DQDPNNPFGAPPSPPSFWVSFLRVMQSVVNVFGRISFLIDQNTQAFHMFMSALLQLFDRT  222

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARF LR+LGIK+KP+KV  P  +G P P + +GNQ+YIEGPKAAPSGAWD
Sbjct  223   GLLY---GELARFALRLLGIKSKPRKVQGPGPDGFPVPHNPRGNQNYIEGPKAAPSGAWD  279

Query  1096  SVWGD  1082
             +VWGD
Sbjct  280   NVWGD  284


 Score =   107 bits (266),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVG-SSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++NS+QPG SPPPKPWER G SSSGPTPFKPPS G TSDVVEASGT+KPGE+VPA   N
Sbjct  1     MDSNSQQPGGSPPPKPWERAGTSSSGPTPFKPPSPGSTSDVVEASGTTKPGEIVPATGGN  60

Query  1759  tatnintvARPVPTRPWEQRQ  1697
             T    N++ RPVPTRPWEQ+ 
Sbjct  61    TVATANSLGRPVPTRPWEQQN  81



>ref|XP_003546796.1| PREDICTED: peroxisomal membrane protein 13 [Glycine max]
 gb|KHN33283.1| Peroxisomal membrane protein 13 [Glycine soja]
Length=297

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 7/129 (5%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPN+PFGAP SPPGFWIS++RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  168   DQDPNDPFGAPPSPPGFWISVLRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRS  227

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGL----PGPQSLQGNQHYIEGPKAAPS  1109
             G+LY   GELARFVLR+LGI+TK KKV+PP   G     PGP +  GN +YIE PKAAPS
Sbjct  228   GMLY---GELARFVLRLLGIRTKSKKVYPPGPNGQPLLGPGPHNPSGNVNYIEAPKAAPS  284

Query  1108  GAWDSVWGD  1082
             G+WD+VWG+
Sbjct  285   GSWDNVWGN  293


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME  ++   +SPPPKPWE+ GSSSGP PFKPPS G TSDVVEASGT+KPGE+V +++R+ 
Sbjct  1     MEPKTQPQANSPPPKPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
             A N NT+ RPVP+RPWE  Q YGN+
Sbjct  61    AVNRNTLGRPVPSRPWE--QNYGNS  83



>ref|XP_010025045.1| PREDICTED: peroxisomal membrane protein 13-like [Eucalyptus grandis]
 gb|KCW87648.1| hypothetical protein EUGRSUZ_A00039 [Eucalyptus grandis]
Length=293

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNP+G PSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  167   QDPNNPYGEPSSPPGFWISFLRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRSG  226

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFV R+LGI+TKP+KVHPP  +G  LPGP +    Q Y EGPKAAP+G+W
Sbjct  227   MLY---GELARFVFRLLGIRTKPRKVHPPGPDGRPLPGPGNPHAIQGYTEGPKAAPTGSW  283

Query  1099  DSVW  1088
             D+VW
Sbjct  284   DNVW  287


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -3

Query  1936  METNSRQPGS-SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M +N + P S +PPPKPWER G+SSGP PFKPPS G TSDVVEASGT++PGE+V + +R 
Sbjct  1     MASNPQPPSSATPPPKPWERSGASSGPAPFKPPSAGSTSDVVEASGTARPGEIVASTDRT  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNT  1682
             T  N N + RPVPTRPWEQ Q+YGN 
Sbjct  61    TTPNTNALGRPVPTRPWEQ-QSYGNN  85



>ref|XP_006344086.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Solanum 
tuberosum]
Length=299

 Score =   181 bits (459),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 102/132 (77%), Gaps = 9/132 (7%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP SPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++ALLQLFDRS
Sbjct  169   DQDPNNPYGAPPSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSALLQLFDRS  228

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSA------EGLPGPQSLQGNQHYIEGPKAA  1115
             GLLY   GELARFVLR+LG+K K  K+HPP A        LPGP   +GNQ++IEGPKAA
Sbjct  229   GLLY---GELARFVLRLLGVKIKANKIHPPGANAPHGPNALPGPHQPRGNQNFIEGPKAA  285

Query  1114  PSGAWDSVWGDK  1079
             P  AW+ VWGD 
Sbjct  286   PGAAWNDVWGDN  297


 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  1909  SSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvAR  1730
             SSPPPKPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V  ANRNTA N +T+AR
Sbjct  5     SSPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSTANRNTAVNNSTLAR  64

Query  1729  PVPTRPWEQRQTYGNTF  1679
             PVPTRPWEQ+QTYG+++
Sbjct  65    PVPTRPWEQQQTYGSSY  81



>ref|XP_006344085.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Solanum 
tuberosum]
Length=305

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 102/132 (77%), Gaps = 9/132 (7%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP SPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++ALLQLFDRS
Sbjct  175   DQDPNNPYGAPPSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSALLQLFDRS  234

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSA------EGLPGPQSLQGNQHYIEGPKAA  1115
             GLLY   GELARFVLR+LG+K K  K+HPP A        LPGP   +GNQ++IEGPKAA
Sbjct  235   GLLY---GELARFVLRLLGVKIKANKIHPPGANAPHGPNALPGPHQPRGNQNFIEGPKAA  291

Query  1114  PSGAWDSVWGDK  1079
             P  AW+ VWGD 
Sbjct  292   PGAAWNDVWGDN  303


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  1894  KPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTR  1715
             KPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V  ANRNTA N +T+ARPVPTR
Sbjct  16    KPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPTR  75

Query  1714  PWEQRQTYGNTF  1679
             PWEQ+QTYG+++
Sbjct  76    PWEQQQTYGSSY  87



>ref|XP_003597539.1| Peroxisome biogenesis factor [Medicago truncatula]
 gb|AES67790.1| hypothetical protein MTR_2g099360 [Medicago truncatula]
Length=316

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 105/135 (78%), Gaps = 13/135 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNP+GAP SPPGFWIS++RVMQGVVNFF RI++L DQ+ QAFH+ +TA+LQLFDRS
Sbjct  181   EQDPNNPYGAPPSPPGFWISVMRVMQGVVNFFGRISILIDQNTQAFHLFMTAMLQLFDRS  240

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP----------GPQSLQGNQHYIEG  1127
             G+LY   GELARFVLR+LGIKTK  KV+PP   G P          G  +  GN +YIE 
Sbjct  241   GMLY---GELARFVLRLLGIKTKANKVNPPGPNGYPHQGPNGYPHQGQHNSSGNMNYIEA  297

Query  1126  PKAAPSGAWDSVWGD  1082
             PKAAPSG+WD+VWG+
Sbjct  298   PKAAPSGSWDNVWGN  312


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   S+PPPKPWER GSSSGP PF+PPS G TSDVVEASGT+KPGE+V AA+R+ 
Sbjct  1     MASNPQPSASNPPPKPWERAGSSSGPAPFRPPSGGSTSDVVEASGTAKPGEIVTAADRSA  60

Query  1756  atnintvARPVPTRPWEQR  1700
             A N NT+ARPVPTRPWEQ 
Sbjct  61    AVNRNTLARPVPTRPWEQN  79



>gb|KEH39502.1| hypothetical protein MTR_2g099360 [Medicago truncatula]
Length=315

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 105/135 (78%), Gaps = 13/135 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNP+GAP SPPGFWIS++RVMQGVVNFF RI++L DQ+ QAFH+ +TA+LQLFDRS
Sbjct  180   EQDPNNPYGAPPSPPGFWISVMRVMQGVVNFFGRISILIDQNTQAFHLFMTAMLQLFDRS  239

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP----------GPQSLQGNQHYIEG  1127
             G+LY   GELARFVLR+LGIKTK  KV+PP   G P          G  +  GN +YIE 
Sbjct  240   GMLY---GELARFVLRLLGIKTKANKVNPPGPNGYPHQGPNGYPHQGQHNSSGNMNYIEA  296

Query  1126  PKAAPSGAWDSVWGD  1082
             PKAAPSG+WD+VWG+
Sbjct  297   PKAAPSGSWDNVWGN  311


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   S+PPPKPWER GSSSGP PF+PPS G TSDVVEASGT+KPGE+V AA+R+ 
Sbjct  1     MASNPQPSASNPPPKPWERAGSSSGPAPFRPPSGGSTSDVVEASGTAKPGEIVTAADRSA  60

Query  1756  atnintvARPVPTRPWEQR  1700
             A N NT+ARPVPTRPWEQ 
Sbjct  61    AVNRNTLARPVPTRPWEQN  79



>gb|ACB59355.1| peroxisome biogenesis factor 13 [Nicotiana tabacum]
Length=299

 Score =   179 bits (454),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAPSSPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++A+LQLFDRS
Sbjct  175   DQDPNNPFGAPSSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMSMSAMLQLFDRS  234

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LG+KTKP KVHPP    LPGP    GNQ++IEGPKAAPS  WD
Sbjct  235   GMLY---GELARFVLRLLGVKTKPNKVHPPGPGALPGPHHPHGNQNFIEGPKAAPSAGWD  291

Query  1096  SVWGDK  1079
             +VWGD 
Sbjct  292   NVWGDN  297


 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -3

Query  1936  METNSRQP-GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M+    QP G+SPPPKPWER GSSSGPTPFKPPS G TSDVVEASGT++PGE+V  ANRN
Sbjct  1     MDNGPPQPSGNSPPPKPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRN  60

Query  1759  tatnintvARPVPTRPWEQRQTYG  1688
             T  N +T+ARPVP RPWEQ+QTYG
Sbjct  61    TTVNNSTLARPVPPRPWEQQQTYG  84



>gb|KHG04730.1| Peroxisomal membrane 13 -like protein [Gossypium arboreum]
Length=293

 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNPFGAP SPPGFW+S +RVMQGVVN F RI++L DQ+ QAFH+ +TALLQLFDR+
Sbjct  168   EQDPNNPFGAPPSPPGFWMSFLRVMQGVVNCFGRISILIDQNTQAFHMFMTALLQLFDRT  227

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLR+LGIK+KP+K++ P   GLPGP +  GNQ+YIEGPKAAPSGAWD
Sbjct  228   GLLY---GELARFVLRLLGIKSKPRKINQPGPGGLPGPHNPHGNQNYIEGPKAAPSGAWD  284

Query  1096  SVWGDK  1079
             +VWG+ 
Sbjct  285   NVWGEN  290


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = -3

Query  1936  METNSRQPGSS-PPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++NS+QP +   PPKPWE+ G S+G  PFKPPS G TSDVVEASGT++PGELV  A+R 
Sbjct  1     MDSNSQQPATGVSPPKPWEQAGGSTGAGPFKPPSPGSTSDVVEASGTARPGELVSTADRT  60

Query  1759  tatnintvARPVPTRPWEQRQ  1697
              A N N V RP+P+RPWEQ+ 
Sbjct  61    AAVNRNAVGRPLPSRPWEQQN  81



>ref|XP_009615747.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Nicotiana 
tomentosiformis]
Length=299

 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAPSSPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++ALLQLFDRS
Sbjct  175   DQDPNNPFGAPSSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSALLQLFDRS  234

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LG+KTKP KVHPP    LPGP    GNQ++IEGPKAAPS  WD
Sbjct  235   GMLY---GELARFVLRLLGVKTKPNKVHPPGPGALPGPHHPHGNQNFIEGPKAAPSTGWD  291

Query  1096  SVWGDK  1079
             +VWGD 
Sbjct  292   NVWGDN  297


 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvA  1733
             G+SPPPKPWER GSSSGPTPFKPPS G TSDVVEASGT++PGE+V  ANRNT  N +T+A
Sbjct  10    GNSPPPKPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTTVNNSTLA  69

Query  1732  RPVPTRPWEQRQTYG  1688
             RPVP RPWEQ+QTYG
Sbjct  70    RPVPPRPWEQQQTYG  84



>ref|XP_006372778.1| glycine-rich family protein [Populus trichocarpa]
 gb|ERP50575.1| glycine-rich family protein [Populus trichocarpa]
Length=297

 Score =   178 bits (452),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFG P SPPGFWIS +RV+QGVVNFF R+++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  171   QDPNNPFGEPPSPPGFWISFLRVLQGVVNFFGRLSILIDQNTQAFHMFMTALLQLFDRSG  230

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFVLR+LGI+TKP+ V+P    G  LPGP+    N  YIEGPKAAPSG+W
Sbjct  231   MLY---GELARFVLRLLGIRTKPRMVNPQGPNGLPLPGPEGTNANSRYIEGPKAAPSGSW  287

Query  1099  DSVW  1088
             D+VW
Sbjct  288   DNVW  291


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   ++PPPKPWE+ G SSG TPFKPPS G TSDVVEASGT++PGE+V  ++ NT
Sbjct  1     MASNPQPSANNPPPKPWEQSGGSSGATPFKPPSAGSTSDVVEASGTARPGEIV-QSSGNT  59

Query  1756  atnintvARPVPTRPWEQRQTYGN  1685
               N N V RP+P RPWEQ  +  N
Sbjct  60    TNNTNAVGRPLPARPWEQSYSTSN  83



>gb|ABK93770.1| unknown [Populus trichocarpa]
Length=304

 Score =   178 bits (452),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFG P SPPGFWIS +RV+QGVVNFF R+++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  178   QDPNNPFGEPPSPPGFWISFLRVLQGVVNFFGRLSILIDQNTQAFHMFMTALLQLFDRSG  237

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFVLR+LGI+TKP+ V+P    G  LPGP+    N  YIEGPKAAPSG+W
Sbjct  238   MLY---GELARFVLRLLGIRTKPRMVNPQGPNGLPLPGPEGTNANSRYIEGPKAAPSGSW  294

Query  1099  DSVW  1088
             D+VW
Sbjct  295   DNVW  298


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   ++PPPKPWE+ G SSG TPFKPPS G TSDVVEASGT++PGE+V  ++ NT
Sbjct  1     MASNPQPSANNPPPKPWEQSGGSSGATPFKPPSAGSTSDVVEASGTARPGEIV-QSSGNT  59

Query  1756  atnintvARPVPTRPWEQRQTYGN  1685
               N N V RP+P RPWEQ  +  N
Sbjct  60    TNNTNAVGRPLPARPWEQSYSTNN  83



>ref|XP_011043592.1| PREDICTED: peroxisomal membrane protein 13-like [Populus euphratica]
Length=303

 Score =   178 bits (452),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFG P SPPGFWIS +RV+QGVVNFF R+++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  177   QDPNNPFGEPPSPPGFWISFLRVLQGVVNFFGRLSILIDQNTQAFHMFMTALLQLFDRSG  236

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFVLR+LGI+TKP+ V+P    G  LPGP+    N  YIEGPKAAPSG+W
Sbjct  237   MLY---GELARFVLRLLGIRTKPRMVNPQGPNGLPLPGPEGTNANSRYIEGPKAAPSGSW  293

Query  1099  DSVW  1088
             D+VW
Sbjct  294   DNVW  297


 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   ++PPPKPWE+ G SSG TPFKPPS G TSDVVEASGT++PGE+V  ++ NT
Sbjct  1     MASNPQPSANNPPPKPWEQSGGSSGATPFKPPSPGSTSDVVEASGTARPGEIV-QSSGNT  59

Query  1756  atnintvARPVPTRPWEQRQTYGN  1685
               N N V RP+P RPWEQ  +  N
Sbjct  60    TNNANAVGRPLPARPWEQSYSTNN  83



>ref|XP_011047730.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Populus 
euphratica]
Length=281

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFGAP SPPGFWIS +RV+QGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  155   QDPNNPFGAPPSPPGFWISFLRVLQGVVNFFGRISILIDQNTQAFHMLMTALLQLFDRSG  214

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHP--PSAEGLPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GE+ARFVLR+LGIKTKP+  HP  P    LPGP+    N  YIEGPK APSG+W
Sbjct  215   MLY---GEVARFVLRLLGIKTKPRMAHPYGPHRLPLPGPEGTNANPLYIEGPKPAPSGSW  271

Query  1099  DSVW  1088
             DSVW
Sbjct  272   DSVW  275


 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   ++PPPKPWE+ G SSG TPFKPPS G TSDVVEASGT++PGE+V   +  +
Sbjct  1     MASNPQPSANNPPPKPWEQAGGSSGATPFKPPSAGSTSDVVEASGTARPGEIV--QSSGS  58

Query  1756  atnintvARPVPTRPWEQRQT  1694
             A N N V RP+P+RPWEQ  +
Sbjct  59    AANTNAVGRPLPSRPWEQNYS  79



>ref|XP_011011867.1| PREDICTED: peroxisomal membrane protein 13-like [Populus euphratica]
Length=281

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFGAP SPPGFWIS +RV+QGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  155   QDPNNPFGAPPSPPGFWISFLRVLQGVVNFFGRISILIDQNTQAFHMLMTALLQLFDRSG  214

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHP--PSAEGLPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GE+ARFVLR+LGIKTKP+  HP  P    LPGP+    N  YIEGPK APSG+W
Sbjct  215   MLY---GEVARFVLRLLGIKTKPRMAHPHGPHRLPLPGPEGTNANPLYIEGPKPAPSGSW  271

Query  1099  DSVW  1088
             DSVW
Sbjct  272   DSVW  275


 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   ++PPPKPWE+ G SSG TPFKPPS G TSDVVEASGT++PGE+V   +  +
Sbjct  1     MASNPQPSANNPPPKPWEQAGGSSGATPFKPPSAGSTSDVVEASGTARPGEIV--QSSGS  58

Query  1756  atnintvARPVPTRPWEQRQT  1694
             A N N V RP+P+RPWEQ  +
Sbjct  59    AANTNAVGRPLPSRPWEQNYS  79



>ref|XP_010242714.1| PREDICTED: peroxisomal membrane protein 13-like [Nelumbo nucifera]
Length=280

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 9/123 (7%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAPSSPPGFW+S +RVM GVV FF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  161   DQDPNNPFGAPSSPPGFWVSFLRVMHGVVTFFGRISILIDQNTQAFHMFMTALLQLFDRS  220

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LGI+TKP+KVHP      PGP + QG Q+ IEGPK APS +WD
Sbjct  221   GMLY---GELARFVLRLLGIRTKPRKVHP------PGPHNPQGGQNLIEGPKIAPSNSWD  271

Query  1096  SVW  1088
             +VW
Sbjct  272   TVW  274


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME+  +Q  S+PPPKPWER  +SSGP PF+P S G TSDVVEASGT+KPGE+V  A+RNT
Sbjct  1     MESRPQQGASNPPPKPWERAATSSGPAPFRPSSPGSTSDVVEASGTAKPGEIVSTADRNT  60

Query  1756  atnintvARPVPTRPWEQ  1703
               N NT+ RPVPTRPWEQ
Sbjct  61    TVNRNTLGRPVPTRPWEQ  78



>ref|XP_009615746.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   178 bits (451),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFGAPSSPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++ALLQLFDRS
Sbjct  175   DQDPNNPFGAPSSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSALLQLFDRS  234

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LG+KTKP KVHPP    LPGP    GNQ++IEGPKAAPS  WD
Sbjct  235   GMLY---GELARFVLRLLGVKTKPNKVHPPGPGALPGPHHPHGNQNFIEGPKAAPSTGWD  291

Query  1096  SVWGDK  1079
             +VWGD 
Sbjct  292   NVWGDN  297


 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -3

Query  1936  METNSRQP-GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M+    QP G+SPPPKPWER GSSSGPTPFKPPS G TSDVVEASGT++PGE+V  ANRN
Sbjct  1     MDNGPPQPSGNSPPPKPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRN  60

Query  1759  tatnintvARPVPTRPWEQRQTYG  1688
             T  N +T+ARPVP RPWEQ+QTYG
Sbjct  61    TTVNNSTLARPVPPRPWEQQQTYG  84



>ref|XP_009764929.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Nicotiana 
sylvestris]
Length=298

 Score =   177 bits (450),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAPSSPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++A+LQLFDRS
Sbjct  174   DQDPNNPYGAPSSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSAMLQLFDRS  233

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LG+KTKP KVHPP    LPGP    GNQ++IEGPKAAPS  WD
Sbjct  234   GMLY---GELARFVLRLLGVKTKPNKVHPPGPGALPGPHHPHGNQNFIEGPKAAPSAGWD  290

Query  1096  SVWGDK  1079
             +VWGD 
Sbjct  291   NVWGDN  296


 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvA  1733
             G+SPPPKPWER GSSSGPTPFKPPS G TSDVVEASGT++PGE+V  ANRNTA N +T+A
Sbjct  10    GNSPPPKPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTAVNNSTLA  69

Query  1732  RPVPTRPWEQRQTYG  1688
             RPVP RPWEQ+QTYG
Sbjct  70    RPVPPRPWEQQQTYG  84



>ref|XP_006442935.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
 ref|XP_006478829.1| PREDICTED: peroxisomal membrane protein 13-like [Citrus sinensis]
 gb|ESR56175.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
Length=295

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  175   QDPNDPYGAPSSPPGFWISALRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRSG  234

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             +LY   GELARFVLR+LGIKTKPKKV+ P+   LPGP ++ GNQ+++EGPKAAP  AWD+
Sbjct  235   MLY---GELARFVLRLLGIKTKPKKVNGPNGPPLPGPNNMHGNQNFLEGPKAAPGEAWDN  291

Query  1093  VWGD  1082
             VWG+
Sbjct  292   VWGN  295


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -3

Query  1897  PKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPT  1718
             PKPWE+ G++SGPTPFKPPS G TSDVVE+SGT+ PGE+V A++R    N N V RP+P+
Sbjct  15    PKPWEQAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPS  74

Query  1717  RPWEQRQTYGNT  1682
             RPWE  Q YG+T
Sbjct  75    RPWE--QNYGST  84



>gb|KDO50762.1| hypothetical protein CISIN_1g022548mg [Citrus sinensis]
Length=295

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  175   QDPNDPYGAPSSPPGFWISALRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRSG  234

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             +LY   GELARFVLR+LGIKTKPKKV+ P+   LPGP ++ GNQ+++EGPKAAP  AWD+
Sbjct  235   MLY---GELARFVLRLLGIKTKPKKVNGPNGPPLPGPNNMHGNQNFLEGPKAAPGEAWDN  291

Query  1093  VWGD  1082
             VWG+
Sbjct  292   VWGN  295


 Score = 79.7 bits (195),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -3

Query  1897  PKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPT  1718
             PKPWER G++SGPTPFKPPS G TSDVVE+SGT+ PGE+V A++R    N N V RP+P+
Sbjct  15    PKPWERAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPS  74

Query  1717  RPWEQRQTYGNT  1682
             RPWE  Q YG+T
Sbjct  75    RPWE--QNYGST  84



>ref|XP_009764922.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Nicotiana 
sylvestris]
Length=298

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAPSSPPGFW+S + VMQGVV FF R+AML DQ+ QAFH+ ++A+LQLFDRS
Sbjct  174   DQDPNNPYGAPSSPPGFWVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSAMLQLFDRS  233

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LG+KTKP KVHPP    LPGP    GNQ++IEGPKAAPS  WD
Sbjct  234   GMLY---GELARFVLRLLGVKTKPNKVHPPGPGALPGPHHPHGNQNFIEGPKAAPSAGWD  290

Query  1096  SVWGDK  1079
             +VWGD 
Sbjct  291   NVWGDN  296


 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -3

Query  1936  METNSRQP-GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M+    QP G+SPPPKPWER GSSSGPTPFKPPS G TSDVVEASGT++PGE+V  ANRN
Sbjct  1     MDNGPPQPSGNSPPPKPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRN  60

Query  1759  tatnintvARPVPTRPWEQRQTYG  1688
             TA N +T+ARPVP RPWEQ+QTYG
Sbjct  61    TAVNNSTLARPVPPRPWEQQQTYG  84



>ref|XP_007131922.1| hypothetical protein PHAVU_011G052000g [Phaseolus vulgaris]
 gb|ESW03916.1| hypothetical protein PHAVU_011G052000g [Phaseolus vulgaris]
Length=286

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 103/124 (83%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             +DPNNP+GAPS PPGFWIS IRVMQGVVNFF RI++L DQ+ QAFH+ +T+LLQLFDRSG
Sbjct  160   EDPNNPYGAPSPPPGFWISFIRVMQGVVNFFGRISILVDQNTQAFHMFMTSLLQLFDRSG  219

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFVLR+LG+K+KP+K++    +G  LPGP S   NQ+YIEG KAAPSG+W
Sbjct  220   VLY---GELARFVLRLLGVKSKPQKINHAGPDGLPLPGPHSSSVNQNYIEGTKAAPSGSW  276

Query  1099  DSVW  1088
             D+ W
Sbjct  277   DNAW  280


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -3

Query  1918  QPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint  1739
             +P +S PPKPWE+V +SSGP PFKPPS G TSDVVE+SGT+KPGE+V A+N     N N 
Sbjct  2     EPSASAPPKPWEKVAASSGPAPFKPPSAGTTSDVVESSGTAKPGEIVSASNNTATVNRNA  61

Query  1738  vARPVPTRPWEQRQTYGNT  1682
             + RP+PTRPWE  Q YG+T
Sbjct  62    LGRPLPTRPWE--QNYGST  78



>gb|AGV54834.1| hypothetical protein [Phaseolus vulgaris]
Length=291

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 102/124 (82%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             +DPNNP+GAPS PPGFWIS IRVMQGVVNFF RI++L DQ+ QAFH+ +T+LLQLFDRSG
Sbjct  165   EDPNNPYGAPSPPPGFWISFIRVMQGVVNFFGRISILVDQNTQAFHMFMTSLLQLFDRSG  224

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFVLR+LG+K+KP+K++    +G  LPGP S   N +YIEG KAAPSG+W
Sbjct  225   VLY---GELARFVLRLLGVKSKPQKINHAGPDGLPLPGPHSSSVNHNYIEGTKAAPSGSW  281

Query  1099  DSVW  1088
             D+ W
Sbjct  282   DNAW  285


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +    SPPPKPWE+V +SSGP PFKPPS G TSDVVE+SGT+KPGE+V A+N   
Sbjct  1     MASNPQPSAYSPPPKPWEKVAASSGPAPFKPPSAGTTSDVVESSGTAKPGEIVSASNNTA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
               N N + RP+PTRPWE  Q YG+T
Sbjct  61    TVNRNALGRPLPTRPWE--QNYGST  83



>ref|XP_010551992.1| PREDICTED: peroxisomal membrane protein 13-like [Tarenaya hassleriana]
Length=276

 Score =   171 bits (434),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 99/127 (78%), Gaps = 16/127 (13%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFG P SPPGFWIS +RVMQGVVNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  161   QDPNNPFGEPPSPPGFWISFLRVMQGVVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  220

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPK--AAPSGAW  1100
             LLY   GELARFVLRILG+KTKP+K+H P+           GNQ++ EGPK  AAPSG W
Sbjct  221   LLY---GELARFVLRILGVKTKPRKMHGPN-----------GNQNHPEGPKADAAPSGGW  266

Query  1099  DSVWGDK  1079
             D+VWGD 
Sbjct  267   DNVWGDN  273


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             S  P    PPKP ER GS+SGP+PFKPP+   T+D VE+SGT++PGE+V   NR      
Sbjct  3     SEPPAGGSPPKPGERAGSASGPSPFKPPTNSSTADAVESSGTARPGEIVTTTNRTATVAN  62

Query  1744  ntv-ARPVPTRPWEQRQTYGNTF  1679
                  RPVPTRPWEQ Q Y +T+
Sbjct  63    TNALGRPVPTRPWEQ-QNYASTY  84



>ref|XP_010547185.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Tarenaya 
hassleriana]
Length=296

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 103/133 (77%), Gaps = 11/133 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFG P SPPGFWIS +RVMQGVVNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  164   QDPNNPFGEPPSPPGFWISFLRVMQGVVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  223

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP---GPQSLQGNQHYIEGPK--AAPS  1109
             LLY   GELARFVLRILG+KTKP+K+HP   +GLP    P    GNQ+Y+EGPK  AAP+
Sbjct  224   LLY---GELARFVLRILGVKTKPRKMHPVGPDGLPLPHQPHDPHGNQNYLEGPKMAAAPN  280

Query  1108  ---GAWDSVWGDK  1079
                G WD+VWG  
Sbjct  281   GGGGGWDNVWGHN  293


 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -3

Query  1900  PPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-ARPV  1724
             PPKPWE+ G +SGP+PFKPP+ G T+D VE+SGT++PGE+V +ANR T        +RPV
Sbjct  11    PPKPWEQAGGTSGPSPFKPPTNGSTTDAVESSGTARPGEIVTSANRTTTAANTNALSRPV  70

Query  1723  PTRPWEQRQTYGNTF  1679
             PTRPWEQ Q YG+T+
Sbjct  71    PTRPWEQ-QNYGSTY  84



>ref|XP_010547186.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Tarenaya 
hassleriana]
Length=295

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 103/133 (77%), Gaps = 11/133 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPNNPFG P SPPGFWIS +RVMQGVVNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  163   QDPNNPFGEPPSPPGFWISFLRVMQGVVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  222

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP---GPQSLQGNQHYIEGPK--AAPS  1109
             LLY   GELARFVLRILG+KTKP+K+HP   +GLP    P    GNQ+Y+EGPK  AAP+
Sbjct  223   LLY---GELARFVLRILGVKTKPRKMHPVGPDGLPLPHQPHDPHGNQNYLEGPKMAAAPN  279

Query  1108  ---GAWDSVWGDK  1079
                G WD+VWG  
Sbjct  280   GGGGGWDNVWGHN  292


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             + QP    PPKPWE+ G +SGP+PFKPP+ G T+D VE+SGT++PGE+V +ANR T    
Sbjct  2     ASQPSGGSPPKPWEQAGGTSGPSPFKPPTNGSTTDAVESSGTARPGEIVTSANRTTTAAN  61

Query  1744  ntv-ARPVPTRPWEQRQTYGNTF  1679
                 +RPVPTRPWEQ Q YG+T+
Sbjct  62    TNALSRPVPTRPWEQ-QNYGSTY  83



>ref|XP_004299871.1| PREDICTED: uncharacterized protein LOC101314565 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   170 bits (431),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+GAP S PGFW+S + V+QGVV+FF RIA+L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  192   QDPNDPYGAPPSAPGFWVSALHVLQGVVSFFGRIAILIDQNTQAFHLFMTALLQLFDRSG  251

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP--GPQSLQGNQHYIEGPKAAPSGAW  1100
             LLY   GELARFVLRILG++TKPK   P    GLP  GP     N++YIEGPKAAPSG+W
Sbjct  252   LLY---GELARFVLRILGVRTKPKMGPPSGPNGLPFHGPNGAPENRNYIEGPKAAPSGSW  308

Query  1099  DSVWGDK  1079
             D+VWG+ 
Sbjct  309   DNVWGND  315


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -3

Query  1936  METNSRQPGSS-PPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++++  P ++ PPPKPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V +A+R+
Sbjct  1     MDSSNAPPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSSADRS  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNTF  1679
             T  N NT+ RPVP+RPWEQ     NT+
Sbjct  61    TPNNRNTLGRPVPSRPWEQNYGSSNTY  87



>ref|XP_004299872.1| PREDICTED: uncharacterized protein LOC101314565 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=308

 Score =   170 bits (430),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+GAP S PGFW+S + V+QGVV+FF RIA+L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  182   QDPNDPYGAPPSAPGFWVSALHVLQGVVSFFGRIAILIDQNTQAFHLFMTALLQLFDRSG  241

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP--GPQSLQGNQHYIEGPKAAPSGAW  1100
             LLY   GELARFVLRILG++TKPK   P    GLP  GP     N++YIEGPKAAPSG+W
Sbjct  242   LLY---GELARFVLRILGVRTKPKMGPPSGPNGLPFHGPNGAPENRNYIEGPKAAPSGSW  298

Query  1099  DSVWGDK  1079
             D+VWG+ 
Sbjct  299   DNVWGND  305


 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = -3

Query  1936  METNSRQPGSS-PPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++++  P ++ PPPKPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V +A+R+
Sbjct  1     MDSSNAPPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSSADRS  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNTF  1679
             T  N NT+ RPVP+RPWEQ     NT+
Sbjct  61    TPNNRNTLGRPVPSRPWEQNYGSSNTY  87



>ref|XP_006344102.1| PREDICTED: peroxisomal membrane protein 13-like [Solanum tuberosum]
Length=304

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP S     +S + VMQGVV FF R+AML DQ+ QAFH+ ++ALLQLFDRS
Sbjct  174   DQDPNNPYGAPPSSTRLLVSFMHVMQGVVTFFGRVAMLIDQNTQAFHMFMSALLQLFDRS  233

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSA------EGLPGPQSLQGNQHYIEGPKAA  1115
             GLLY   GELARFVLR+LG+KTK  K+HPP A        LPGP   +GNQ++IEGPKAA
Sbjct  234   GLLY---GELARFVLRLLGVKTKANKIHPPGANAPHGPNALPGPHQPRGNQNFIEGPKAA  290

Query  1114  PSGAWDSVWGDK  1079
             P  AW+ VWGD 
Sbjct  291   PGAAWNDVWGDN  302


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -3

Query  1894  KPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTR  1715
             KPWER GSSSGP PFKPPS G TSDVVEASGT++PGE+V  ANRNTA N +T+ARPVPTR
Sbjct  16    KPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPTR  75

Query  1714  PWEQRQTYGNTF  1679
             PWEQ+QTYG+++
Sbjct  76    PWEQQQTYGSSY  87



>gb|ACU19041.1| unknown [Glycine max]
Length=301

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 11/133 (8%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNP+GAP SPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  168   EQDPNNPYGAPPSPPGFWISALRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRS  227

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVH--------PPSAEGLPGPQSLQGNQHYIEGPK  1121
             G+LY   GELARFVLR+LGIKTK KKVH         P     PGP +  GN +YIE PK
Sbjct  228   GMLY---GELARFVLRLLGIKTKSKKVHPPGPNGQPLPGPGPGPGPHNPSGNVNYIEAPK  284

Query  1120  AAPSGAWDSVWGD  1082
             AAPSG+WD+VWG+
Sbjct  285   AAPSGSWDNVWGN  297


 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME  ++   +SPP KPWE+ GSSSGP PFKPPS G TSDVVEASGT+KPGE+V +++R+ 
Sbjct  1     MEPKTQPQANSPPLKPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
             A N NT+ RPVPTRPWE  Q YGN+
Sbjct  61    AVNRNTLGRPVPTRPWE--QNYGNS  83



>ref|XP_003543576.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Glycine 
max]
 gb|KHN30082.1| Peroxisomal membrane protein 13 [Glycine soja]
Length=301

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 11/133 (8%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             EQDPNNP+GAP SPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  168   EQDPNNPYGAPPSPPGFWISALRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRS  227

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVH--------PPSAEGLPGPQSLQGNQHYIEGPK  1121
             G+LY   GELARFVLR+LGIKTK KKVH         P     PGP +  GN +YIE PK
Sbjct  228   GMLY---GELARFVLRLLGIKTKSKKVHPPGPNGQPLPGPGPGPGPHNPSGNVNYIEAPK  284

Query  1120  AAPSGAWDSVWGD  1082
             AAPSG+WD+VWG+
Sbjct  285   AAPSGSWDNVWGN  297


 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME  ++   +SPPPKPWE+ GSSSGP PFKPPS G TSDVVEASGT+KPGE+V +++R+ 
Sbjct  1     MEPKTQPQANSPPPKPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
             A N NT+ RPVPTRPWE  Q YGN+
Sbjct  61    AVNRNTLGRPVPTRPWE--QNYGNS  83



>ref|XP_010094089.1| hypothetical protein L484_018106 [Morus notabilis]
 gb|EXB55179.1| hypothetical protein L484_018106 [Morus notabilis]
Length=350

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 107/126 (85%), Gaps = 6/126 (5%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP SPPGFWIS++RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLF+RS
Sbjct  226   DQDPNNPYGAPPSPPGFWISVLRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFERS  285

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPK-AAPSGAW  1100
             GLLY   GELARFVLRILG++TKPKKV PP  +GL  P     NQ+YIEGPK AAP+G+W
Sbjct  286   GLLY---GELARFVLRILGVRTKPKKVRPPGPDGL--PLPGPNNQNYIEGPKAAAPTGSW  340

Query  1099  DSVWGD  1082
             D+VWG+
Sbjct  341   DNVWGN  346


 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 7/101 (7%)
 Frame = -3

Query  1981  CRPAADPCVVSS*YDMETNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASG  1802
             CR A D         M++  +  G++PPPKPWER G S+GP PFKPPS G T+DVVEASG
Sbjct  44    CRFAEDS-------SMDSQPQPSGNTPPPKPWERAGGSTGPAPFKPPSGGSTTDVVEASG  96

Query  1801  TSKPGELVPaanrntatnintvARPVPTRPWEQRQTYGNTF  1679
             T+KPGE+V  ++RNTA N N ++RPVPTRPWEQ     N++
Sbjct  97    TAKPGEIVSTSDRNTAVNRNALSRPVPTRPWEQNYGTANSY  137



>ref|XP_008369189.1| PREDICTED: peroxisomal membrane protein 13 [Malus domestica]
Length=305

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 98/129 (76%), Gaps = 11/129 (9%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+G P S PGFWIS++RV QGVVNFF RIA+L DQ+ QAFH+ ++ALLQLFDRSG
Sbjct  175   QDPNDPYGPPPSHPGFWISVLRVTQGVVNFFGRIAILIDQNTQAFHLFMSALLQLFDRSG  234

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQS-------LQGNQHYIEGPKAA  1115
             LLY   GELARFVLRILG+KTK  KVHPP   G  GP           GNQ++IEGP+ A
Sbjct  235   LLY---GELARFVLRILGVKTK-SKVHPPGPNGFNGPHGPNGPHGPYGGNQNFIEGPRPA  290

Query  1114  PSGAWDSVW  1088
             PSG WD+VW
Sbjct  291   PSGGWDNVW  299


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++N +   + PPPKPWER GSSSGP PFKPPS G TSDVVEASGT+KPGE+VP+++RNT
Sbjct  1     MDSNPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
             A N N +ARPVP+RPWE  Q YG++
Sbjct  61    AANRNALARPVPSRPWE--QNYGSS  83



>ref|XP_003537925.1| PREDICTED: peroxisomal membrane protein 13-like [Glycine max]
 gb|KHN06187.1| Peroxisomal membrane protein 13 [Glycine soja]
Length=280

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             +DPNNP+G PSSPPGFWIS +RVMQGVVNFF RI+ML DQ+ QAFH+ +TALLQLFDRSG
Sbjct  154   EDPNNPYGVPSSPPGFWISFMRVMQGVVNFFGRISMLIDQNTQAFHMFMTALLQLFDRSG  213

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQG--NQHYIEGPKAAPSGAW  1100
             +LY   GELARFVLR+LGI+TKPKK++PP  +GLP P       NQ++IEG K APSG+W
Sbjct  214   VLY---GELARFVLRLLGIRTKPKKINPPGPDGLPLPGQHNSSVNQNFIEGTKPAPSGSW  270

Query  1099  DSVW  1088
             D+VW
Sbjct  271   DNVW  274


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -3

Query  1918  QPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint  1739
             +P  S PPKPWE+  SSSGP PFKPPS G TSDVVEASGT+KPGE+VPA+++    N N 
Sbjct  2     EPSVSAPPKPWEKAASSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPASDKTATVNRNA  61

Query  1738  vARPVPTRPWEQRQ  1697
             + RP+PTRPWEQ  
Sbjct  62    LGRPLPTRPWEQNN  75



>ref|XP_006298214.1| hypothetical protein CARUB_v10014265mg [Capsella rubella]
 gb|EOA31112.1| hypothetical protein CARUB_v10014265mg [Capsella rubella]
Length=302

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 97/129 (75%), Gaps = 8/129 (6%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  177   QDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  236

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIEGPKAA---PS  1109
             +LY   GELARFVLR+LG++TKP+K+   P    GLP P    GNQ+YIEGPK A     
Sbjct  237   MLY---GELARFVLRMLGVRTKPRKMQQPPQGPNGLPLPHQPHGNQNYIEGPKTAVPGGG  293

Query  1108  GAWDSVWGD  1082
             G WD+VWG+
Sbjct  294   GGWDNVWGN  302


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             + QP    PPKPWE+ G++SGP PF+PPS   T+  VEASGT+ PGE+V + NR      
Sbjct  2     ASQPAGGSPPKPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSVNRTNTAAN  61

Query  1744  ntv-ARPVPTRPWEQRQTYGNTF  1679
                 +RPVPTRPWEQ Q+YG T 
Sbjct  62    MNALSRPVPTRPWEQ-QSYGTTM  83



>ref|XP_002884657.1| hypothetical protein ARALYDRAFT_478079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60916.1| hypothetical protein ARALYDRAFT_478079 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 99/129 (77%), Gaps = 8/129 (6%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  179   QDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  238

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIEGPK-AAP--S  1109
             +LY   GELARFVLR+LG++T+P+K+   P    GLP P    GNQ+YIEGPK AAP   
Sbjct  239   MLY---GELARFVLRMLGVRTRPRKMQQPPQGPNGLPLPHQPHGNQNYIEGPKTAAPGGG  295

Query  1108  GAWDSVWGD  1082
             G WD+VWG+
Sbjct  296   GGWDNVWGN  304


 Score = 80.9 bits (198),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELV--Paanrntat  1751
             + QP    PPKPWE+ G++SGPTPF+PPS   T+  VEASGT+ PGE+V  P    NTA 
Sbjct  2     ASQPAGGCPPKPWEQEGNTSGPTPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRTNTAA  61

Query  1750  nintvARPVPTRPWEQRQTYGNTF  1679
             N+N ++RPVP RPWEQ Q YGNT 
Sbjct  62    NMNALSRPVPARPWEQ-QNYGNTM  84



>ref|NP_187412.1| peroxin 13 [Arabidopsis thaliana]
 sp|Q9SRR0.1|PEX13_ARATH RecName: Full=Peroxisomal membrane protein 13; AltName: Full=Peroxin-13; 
Short=AtPEX13; AltName: Full=Peroxisome biogenesis 
protein 13; AltName: Full=Pex13p; AltName: Full=Protein ABERRANT 
PEROXISOME MORPHOLOGY 2 [Arabidopsis thaliana]
 gb|AAF02160.1|AC009853_20 unknown protein [Arabidopsis thaliana]
 gb|AAL77696.1| AT3g07560/F21O3_27 [Arabidopsis thaliana]
 gb|AAM10369.1| AT3g07560/F21O3_27 [Arabidopsis thaliana]
 gb|AEE74561.1| peroxin 13 [Arabidopsis thaliana]
Length=304

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 8/130 (6%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+PF  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR 
Sbjct  178   SQDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRG  237

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIEGPK-AAP--  1112
             G+LY   GELARFVLR+LG++T+P+K+   P    GLP P    GNQ+Y+EGPK AAP  
Sbjct  238   GMLY---GELARFVLRMLGVRTRPRKMQQPPQGPNGLPLPHQPHGNQNYLEGPKTAAPGG  294

Query  1111  SGAWDSVWGD  1082
              G WD+VWG+
Sbjct  295   GGGWDNVWGN  304


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELV--Paanrntat  1751
             + QP    PPKPWE+ G++SGP PF+PPS   T+  VEASGT+ PGE+V  P    NTA 
Sbjct  2     ASQPAGGSPPKPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAA  61

Query  1750  nintvARPVPTRPWEQRQTYGNTF  1679
             N+N+++RPVP RPWEQ Q YG+T 
Sbjct  62    NMNSLSRPVPARPWEQ-QNYGSTM  84



>ref|XP_009341150.1| PREDICTED: peroxisomal membrane protein 13 [Pyrus x bretschneideri]
Length=304

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 97/129 (75%), Gaps = 11/129 (9%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+G P S PGFW+S++RV QGVVNFF RIA+L DQ+ QAFH+ ++ALLQLFDRSG
Sbjct  174   QDPNDPYGPPPSHPGFWVSVLRVTQGVVNFFGRIAILIDQNTQAFHLFMSALLQLFDRSG  233

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQS-------LQGNQHYIEGPKAA  1115
             LLY   GELARFV R+LG+KTK  KVHPP   G  GP           GNQ++IEGP+ A
Sbjct  234   LLY---GELARFVFRMLGVKTK-SKVHPPGPNGFNGPHGPNGPHGPYGGNQNFIEGPRPA  289

Query  1114  PSGAWDSVW  1088
             PSG WD+VW
Sbjct  290   PSGGWDNVW  298


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++NS+ P + PPPKPWER GSSSGP PFKPPS G TSDVVEASGT+KPGE+VP+++RNT
Sbjct  1     MDSNSQPPANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNT  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
             A N N +ARPVP+RPWE  Q YG++
Sbjct  61    AANRNALARPVPSRPWE--QNYGSS  83



>ref|XP_007150473.1| hypothetical protein PHAVU_005G155400g [Phaseolus vulgaris]
 gb|ESW22467.1| hypothetical protein PHAVU_005G155400g [Phaseolus vulgaris]
Length=298

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 5/127 (4%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNPFG P SPPGFWIS++RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  171   DQDPNNPFGGPPSPPGFWISVLRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQLFDRS  230

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEG--LPGPQSLQGNQHYIEGPKAAPSGA  1103
             GLLY   GELARFVLR+LGI++K KKV PP   G  LPGP +  G+ +YIE PKAAPSG+
Sbjct  231   GLLY---GELARFVLRLLGIRSKSKKVQPPGPNGQLLPGPYNSSGDVNYIEAPKAAPSGS  287

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  288   WDNVWGN  294


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 2/77 (3%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvA  1733
             G+SPPPKPWE+ GSSSGP PFKPPS G TS+VVEASGT+KPGE+V  ++R  A N N++ 
Sbjct  9     GNSPPPKPWEQAGSSSGPVPFKPPSAGNTSEVVEASGTAKPGEIVSGSDRTAAVNRNSLG  68

Query  1732  RPVPTRPWEQRQTYGNT  1682
             RPVPTRPWE  Q YGN 
Sbjct  69    RPVPTRPWE--QNYGNN  83



>ref|XP_010069556.1| PREDICTED: peroxisomal membrane protein 13 [Eucalyptus grandis]
 gb|KCW57942.1| hypothetical protein EUGRSUZ_H00681 [Eucalyptus grandis]
Length=305

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 105/128 (82%), Gaps = 8/128 (6%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
             +QDPNNP+GAP SPPGFWIS ++VMQGVV FF RI++L DQ+ QAFH+ ++ALLQLFDRS
Sbjct  181   DQDPNNPYGAPPSPPGFWISFLQVMQGVVTFFGRISILIDQNTQAFHMFMSALLQLFDRS  240

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGN--QHYIEGPKAAPSGA  1103
             GLLY   GELARFVLRILGIKTKPKKV PP   G+PG   L G   Q+ IEGPKAA SGA
Sbjct  241   GLLY---GELARFVLRILGIKTKPKKVPPPGHNGMPG---LPGAFPQNAIEGPKAAQSGA  294

Query  1102  WDSVWGDK  1079
             WD+VWGDK
Sbjct  295   WDNVWGDK  302


 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M++++  P + PPPKPWER G SSGP PFKPPS G TSD+VEASGT++PGE+V   +R  
Sbjct  1     MDSSNGAPANGPPPKPWERAGGSSGPAPFKPPSSGSTSDIVEASGTARPGEIVSTTDRTV  60

Query  1756  atnintvARPVPTRPWEQR  1700
               N N++ARPVPTRPWEQ+
Sbjct  61    PVNANSIARPVPTRPWEQQ  79



>ref|XP_007223181.1| hypothetical protein PRUPE_ppa009172mg [Prunus persica]
 gb|EMJ24380.1| hypothetical protein PRUPE_ppa009172mg [Prunus persica]
Length=303

 Score =   155 bits (392),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 5/124 (4%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+G P SPPGFWIS++RV QGVVNFF RIA+L DQ+ QAFH+ ++ALLQLFDRSG
Sbjct  177   QDPNDPYGGPPSPPGFWISVLRVTQGVVNFFGRIAILIDQNTQAFHMFMSALLQLFDRSG  236

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP--GPQSLQGNQHYIEGPKAAPSGAW  1100
             LLY   GELARFVLRILG+KTKP KVHP    G P  GP    G Q+YIEGP+ APSG W
Sbjct  237   LLY---GELARFVLRILGVKTKPNKVHPQGPNGGPLHGPHGPHGPQNYIEGPRPAPSGGW  293

Query  1099  DSVW  1088
             D+VW
Sbjct  294   DNVW  297


 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME+N +   + PPPKPWER GSSSGP PFKPPS G TSDVVEASGT+KPGE+V +++RN 
Sbjct  1     MESNPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVSSSDRNA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
               N N +ARPVP+RPWE  Q YG++
Sbjct  61    TVNRNALARPVPSRPWE--QNYGSS  83



>ref|XP_010929991.1| PREDICTED: peroxisomal membrane protein 13-like [Elaeis guineensis]
Length=267

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 6/125 (5%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              +DPNNP+G PSSPPGFWIS IRVM GVVNFF RI++L DQ+ QAFH+ ++ALLQ+ DR+
Sbjct  143   NEDPNNPYG-PSSPPGFWISFIRVMNGVVNFFGRISILIDQNTQAFHLFMSALLQIIDRT  201

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFVLR+LGI+ KP+K     +  L G   + G Q YIEGP+ A SG+WD
Sbjct  202   GLLY---GELARFVLRLLGIRKKPRKDQKLGSSELSGNSQVPG-QRYIEGPRDA-SGSWD  256

Query  1096  SVWGD  1082
             +VWGD
Sbjct  257   NVWGD  261


 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             S   G++PPPKPWE+ G+SSGP PFKPPS G TS+VVEASGT+  GE+VP   +   +  
Sbjct  3     STNSGATPPPKPWEQAGNSSGPAPFKPPSSGSTSEVVEASGTANAGEIVP-NAQRNTSTT  61

Query  1744  ntvARPVPTRPWEQRQTYGNTF  1679
             NT+ RPVP RPWE  Q+YGN++
Sbjct  62    NTLGRPVPPRPWE--QSYGNSY  81



>emb|CDY28038.1| BnaC05g44400D [Brassica napus]
Length=284

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 12/133 (9%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  155   QDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  214

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSA-----EGLPGPQSLQGNQHYIEGPK-AAP  1112
             +LY   GELARFVLR+LG++TKP+K+           GL  P    GN +YIEGPK AAP
Sbjct  215   MLY---GELARFVLRMLGVRTKPRKMQQQQQQPQGPNGLSLPHQPHGNHNYIEGPKTAAP  271

Query  1111  ---SGAWDSVWGD  1082
                 G WD+VWG+
Sbjct  272   GGGGGGWDNVWGN  284


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 4/85 (5%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat  1751
             S QP    PPKPWE+ G+  +SGP PF+PPS   T+D VEASGT+ PGELV + NR    
Sbjct  3     SSQPSGGRPPKPWEQEGNNNASGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTA  62

Query  1750  -nintvARPVPTRPWEQRQTYGNTF  1679
               +N ++RPVPTRPWEQ QTYGN +
Sbjct  63    PTMNGLSRPVPTRPWEQ-QTYGNIY  86



>ref|XP_006407824.1| hypothetical protein EUTSA_v10021215mg [Eutrema salsugineum]
 gb|ESQ49277.1| hypothetical protein EUTSA_v10021215mg [Eutrema salsugineum]
Length=303

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  178   QDPNDPFNEPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  237

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE---GPKAAPS  1109
             +LY   GELARFVLR+LGI+TKP+K+   P    GLP P    GNQ+YIE          
Sbjct  238   MLY---GELARFVLRMLGIRTKPRKMQQPPQGPNGLPLPHQPHGNQNYIEGPKAAAPGGG  294

Query  1108  GAWDSVWGD  1082
             G WD+VWG+
Sbjct  295   GGWDNVWGN  303


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             + QP    PPKPWE+ G++SGP PF+PPS   T+D VEASGT+ PGELVP+ NR      
Sbjct  3     TSQPSGGSPPKPWEQEGNTSGPKPFRPPSNTSTADSVEASGTANPGELVPSVNRTNTAAN  62

Query  1744  ntv-ARPVPTRPWEQRQTYGNTF  1679
                 +RPVPTRPWEQ Q YG+T+
Sbjct  63    MNALSRPVPTRPWEQ-QNYGSTY  84



>ref|XP_008796037.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera]
Length=268

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 6/125 (5%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              +DPNNP+G PSSPPGFWIS IRVM GVVNFF RI++L DQ+ QAFH+ ++ALLQ+ DR+
Sbjct  144   NEDPNNPYG-PSSPPGFWISFIRVMNGVVNFFGRISILIDQNTQAFHLFMSALLQIIDRT  202

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             GLLY   GELARFV R+LGI+ KP+K     +  L G   ++G Q YIEGP+ A SG+WD
Sbjct  203   GLLY---GELARFVFRLLGIRKKPRKHQQLGSSELSGNSEVRG-QKYIEGPRDA-SGSWD  257

Query  1096  SVWGD  1082
             +VWG+
Sbjct  258   NVWGN  262


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             S   G++PPPKPWE+ G+SSGP PFKPPS G TS+VVEASGT+  GE+VP   +   +  
Sbjct  3     STNSGATPPPKPWEQAGNSSGPAPFKPPSSGSTSEVVEASGTANAGEIVP-NAQRNTSTT  61

Query  1744  ntvARPVPTRPWEQRQTYGNTF  1679
             NT+ RP+P RPWE  Q+YGN++
Sbjct  62    NTLGRPLPPRPWE--QSYGNSY  81



>ref|XP_008237186.1| PREDICTED: peroxisomal membrane protein 13 [Prunus mume]
Length=303

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 8/124 (6%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+G P SPPGFWIS++RV QGVVNFF RIA+L DQ+ QAFH+ ++ALLQLFDRSG
Sbjct  180   QDPNDPYGGPPSPPGFWISVLRVTQGVVNFFGRIAILIDQNTQAFHMFMSALLQLFDRSG  239

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLP--GPQSLQGNQHYIEGPKAAPSGAW  1100
             LLY   GELARFVLRILG+KTKP KVHP    G P  GP    G Q+YIEGP+ APSG W
Sbjct  240   LLY---GELARFVLRILGVKTKPNKVHPQGPNGGPLHGP---HGPQNYIEGPRPAPSGGW  293

Query  1099  DSVW  1088
             D+VW
Sbjct  294   DNVW  297


 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME+N +   + PPPKPWER GSSSGP PFKPPS G TSDVVEASGT+KPGE+V +++RN 
Sbjct  1     MESNPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVSSSDRNA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
               N N +ARPVP+RPWE  Q YG++
Sbjct  61    TVNRNALARPVPSRPWE--QNYGSS  83



>ref|XP_008347893.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
13-like [Malus domestica]
Length=465

 Score =   154 bits (389),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 93/123 (76%), Gaps = 8/123 (7%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+ +G P SPPGFWIS++RVMQGVVNFF RIA+L D   QAFHV ++ALLQLFDRSG
Sbjct  180   QDPNDQYGPPPSPPGFWISVLRVMQGVVNFFGRIAILID---QAFHVFMSALLQLFDRSG  236

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQS-LQGNQHYIEGPKAAPSGAWD  1097
             LLY   G LARFVL ILG+KTK  KV PP   G  GP     GNQ++IEGP+ AP G WD
Sbjct  237   LLY---GGLARFVLSILGVKTK-LKVRPPGLNGFNGPHGPCGGNQNFIEGPRPAPGGGWD  292

Query  1096  SVW  1088
             +VW
Sbjct  293   NVW  295


 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 4/83 (5%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatni  1745
             S+   + PPPKPWER  SSSGPTPFKPPS G TSDVVEASGT+KPGE+VP+++RNTA N 
Sbjct  9     SQNQANGPPPKPWERASSSSGPTPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNTAVNR  68

Query  1744  ntvARPV--PTRPWEQRQTYGNT  1682
             N +ARPV  P+RPWE  Q YG+ 
Sbjct  69    NALARPVPFPSRPWE--QNYGSN  89



>ref|XP_009147062.1| PREDICTED: peroxisomal membrane protein 13 [Brassica rapa]
Length=289

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS + VMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  164   QDPNDPFNQPPSPPGFWISFLHVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  223

Query  1273  LLYGEFGELARFVLRILGIKTKPKKV--HPPSAEGLPGPQSLQGNQHYIE---GPKAAPS  1109
             +LY   GELARFVLR+LG++TKP+K+   P    GLP P    GNQ+YIE      A   
Sbjct  224   MLY---GELARFVLRMLGVRTKPRKMQQQPQGPNGLPLPHQPHGNQNYIEGPKAAAAPGG  280

Query  1108  GAWDSVWGD  1082
             G WD+VWG+
Sbjct  281   GGWDNVWGN  289


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 58/82 (71%), Gaps = 4/82 (5%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat  1751
             S QP    PPKPWE+ G+  ++GP PF+PPS   T+D VEASGT+ PGELV + NR    
Sbjct  3     SSQPSGGRPPKPWEQEGNNNAAGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTA  62

Query  1750  -nintvARPVPTRPWEQRQTYG  1688
               +N ++RPVPTRPWEQ QTYG
Sbjct  63    PTMNGLSRPVPTRPWEQ-QTYG  83



>ref|XP_009134980.1| PREDICTED: peroxisomal membrane protein 13-like [Brassica rapa]
Length=304

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 10/131 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  177   QDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  236

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE-----GPKAA  1115
             +LY   GELARFVLR+LG++TKP+K+   P    GLP P    GNQ++IE          
Sbjct  237   MLY---GELARFVLRMLGVRTKPRKMQQPPQGPNGLPLPHQPHGNQNFIEGPKGGAAPGG  293

Query  1114  PSGAWDSVWGD  1082
               G WD+VWG+
Sbjct  294   GGGGWDNVWGN  304


 Score = 70.1 bits (170),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = -3

Query  1900  PPKPWERVGS---SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vA  1733
             PPKPWE+ G+   +SGP PF+PPS   T+D VEASGT+ PGELV +ANR         + 
Sbjct  8     PPKPWEQEGNNNNASGPKPFRPPSNTSTADSVEASGTANPGELVSSANRTNTAATMNGLT  67

Query  1732  RPVPTRPWEQRQ  1697
             RPVP+RPWEQ+Q
Sbjct  68    RPVPSRPWEQQQ  79



>emb|CDY35943.1| BnaA05g30070D [Brassica napus]
Length=339

 Score =   150 bits (380),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+PF  P SPPGFWIS + VMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  214   QDPNDPFNQPPSPPGFWISFLHVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  273

Query  1273  LLYGEFGELARFVLRILGIKTKPKKV--HPPSAEGLPGPQSLQGNQHYIE---GPKAAPS  1109
             +LY   GELARFVLR+LG++TKP+K+   P    GLP P    GNQ+YIE      A   
Sbjct  274   MLY---GELARFVLRMLGVRTKPRKMQQQPQGPNGLPLPHQPHGNQNYIEGPKAAAAPGG  330

Query  1108  GAWDSVWGD  1082
             G WD+VWG+
Sbjct  331   GGWDNVWGN  339


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 58/82 (71%), Gaps = 4/82 (5%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat  1751
             S QP    PPKPWE+ G+  ++GP PF+PPS   T+D VEASGT+ PGELV + NR    
Sbjct  53    SSQPSGGRPPKPWEQEGNNNAAGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTA  112

Query  1750  -nintvARPVPTRPWEQRQTYG  1688
               +N ++RPVPTRPWEQ QTYG
Sbjct  113   PTMNGLSRPVPTRPWEQ-QTYG  133



>ref|XP_010486321.1| PREDICTED: peroxisomal membrane protein 13 [Camelina sativa]
Length=303

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 93/131 (71%), Gaps = 10/131 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  176   QDPNDPYNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  235

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE-----GPKAA  1115
             +LY   GELARFVLRILG++TKP+K+   P    GLP P     NQ+YIE      P   
Sbjct  236   MLY---GELARFVLRILGVRTKPRKMQQPPQGPNGLPLPHQPNRNQNYIEGPKAAAPAPG  292

Query  1114  PSGAWDSVWGD  1082
               G WD+VWG+
Sbjct  293   GGGGWDNVWGN  303


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat-n  1748
             + QP    PPKPWE+ G++SGP PF+PPS   T+  VEASGT+ PGE+V + NR   + N
Sbjct  2     ASQPTGGSPPKPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSINRTNTSPN  61

Query  1747  intvARPVPTRPWEQRQTYGNTF  1679
             +N ++RPVPTRPWEQ Q YG T 
Sbjct  62    MNALSRPVPTRPWEQ-QNYGTTM  83



>ref|XP_010464388.1| PREDICTED: peroxisomal membrane protein 13-like [Camelina sativa]
Length=304

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 10/131 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  177   QDPNDPYNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  236

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE-----GPKAA  1115
             +LY   GELARFVLR+LG++TKP+K+   P    G P P    GNQ+YIE      P   
Sbjct  237   MLY---GELARFVLRMLGVRTKPRKMQQPPQGPNGRPLPHQPNGNQNYIEGPKAAAPAPG  293

Query  1114  PSGAWDSVWGD  1082
               G WD+VWG+
Sbjct  294   GGGGWDNVWGN  304


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat-n  1748
             + QP    PPKPWE+ G++SGP PF+PPS   T+  VEASGT+ PGE+V + NR   + N
Sbjct  2     ASQPTGGSPPKPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSINRTNTSPN  61

Query  1747  intvARPVPTRPWEQRQTYGNTF  1679
             +N + RPVPTRPWEQ Q YG T 
Sbjct  62    MNALTRPVPTRPWEQ-QNYGTTM  83



>ref|XP_010454009.1| PREDICTED: peroxisomal membrane protein 13-like [Camelina sativa]
Length=298

 Score =   147 bits (372),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 10/131 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+  P SPPGFWIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G
Sbjct  171   QDPNDPYNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGG  230

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE-----GPKAA  1115
             +LY   GELARFVLR+LG++TKP+K+   P    GLP P     NQ+YIE      P   
Sbjct  231   MLY---GELARFVLRMLGVRTKPRKMQQPPQGPNGLPLPHQPNRNQNYIEGPKAAAPAPG  287

Query  1114  PSGAWDSVWGD  1082
               G WD+VWG+
Sbjct  288   GGGGWDNVWGN  298


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = -3

Query  1900  PPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat-nintvARPV  1724
             PPKPWE+ G++SGP PF+PPS   T+  VEASGT+ PGE+V + NR   + N+N ++RPV
Sbjct  10    PPKPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSINRTNTSPNMNALSRPV  69

Query  1723  PTRPWEQRQTYGNTF  1679
             PTRPWEQ Q YG T 
Sbjct  70    PTRPWEQ-QNYGTTM  83



>ref|XP_004152142.1| PREDICTED: uncharacterized protein LOC101221260 [Cucumis sativus]
 ref|XP_004164566.1| PREDICTED: uncharacterized LOC101221260 [Cucumis sativus]
 gb|KGN52996.1| hypothetical protein Csa_4G010950 [Cucumis sativus]
Length=298

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+G PSSPPGFW+S +RVM GVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  175   QDPNDPYGPPSSPPGFWMSFLRVMHGVVNFFGRISILIDQNTQAFHMFMTALLQLFDRSG  234

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             +LY   GELARFVLR+LGIKTKP+KV  P    +PG      +Q+ IEGPK AP GAWD+
Sbjct  235   MLY---GELARFVLRLLGIKTKPRKVLGPDGLPIPGAPHPHQSQNLIEGPKPAPDGAWDN  291

Query  1093  VW  1088
             VW
Sbjct  292   VW  293


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = -3

Query  1936  METNSRQP-GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++   QP  S+PPPKPWER G SSG  PF+PPS G TSDVVEASGT+KPGE+V +++R 
Sbjct  1     MDSKPPQPSASNPPPKPWERAGGSSGSAPFRPPSAGNTSDVVEASGTAKPGEIVSSSDRT  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNT  1682
              A N N++ RPVPTRPWE  Q YGN 
Sbjct  61    AAVNRNSLGRPVPTRPWE--QNYGNN  84



>ref|XP_010941061.1| PREDICTED: peroxisomal membrane protein 13-like [Elaeis guineensis]
 gb|AGE46029.1| putative peroxisome biogenesis factor 13 [Elaeis guineensis]
Length=284

 Score =   144 bits (362),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 8/124 (6%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPNNP+G PSSPPGFW+S IRVMQGVVNFF RI++L DQ+ QAFH+ ++ALLQLFDRSGL
Sbjct  162   DPNNPYGPPSSPPGFWMSFIRVMQGVVNFFGRISILIDQNTQAFHMFMSALLQLFDRSGL  221

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEG-LPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             LY   GELARFVLR+LGIKT+ +K HP    G LPGP      QHYIEGPKAA +G+WD+
Sbjct  222   LY---GELARFVLRLLGIKTRSRK-HPQLEPGRLPGPDG--NGQHYIEGPKAA-TGSWDN  274

Query  1093  VWGD  1082
             VWG+
Sbjct  275   VWGN  278


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGP-TPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M +NS +PG +PPPKPWER  ++SGP  PFKPPS G TSD+VEASGT+KPGE VP+  R+
Sbjct  1     MGSNSPRPGDAPPPKPWERATTTSGPPAPFKPPSSGSTSDIVEASGTAKPGEAVPSTERS  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNTF  1679
                N NT+ RP+P+RPW+  Q YG ++
Sbjct  61    VLPNRNTIGRPLPSRPWQ--QNYGTSY  85



>ref|XP_008454097.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
13 [Cucumis melo]
Length=296

 Score =   144 bits (363),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QDPN+P+G PSSPPGFW+S +RVM GVVNFF RI++L DQ+ QAFH+ +TALLQLFDRSG
Sbjct  173   QDPNDPYGPPSSPPGFWMSFLRVMHGVVNFFGRISILIDQNTQAFHMFMTALLQLFDRSG  232

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             +LY   GELARFVLR+LGIKTKP+KV  P    LP P      Q+ IEGPKAAP GAWD+
Sbjct  233   MLY---GELARFVLRLLGIKTKPRKVVGPDGLPLPEPPHPHQGQNLIEGPKAAPDGAWDN  289

Query  1093  VW  1088
             VW
Sbjct  290   VW  291


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = -3

Query  1936  METNSRQP-GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M++   QP  S+PPPKPWERVG SSG  PF+PPS G TSDVVEASGT+KPGE+V +++R 
Sbjct  1     MDSKPPQPSASNPPPKPWERVGGSSGSAPFRPPSAGNTSDVVEASGTAKPGEIVSSSDRT  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNT  1682
              A N N++ RPVPTRPWE  Q YGN 
Sbjct  61    AAVNRNSLGRPVPTRPWE--QNYGNN  84



>ref|XP_009399015.1| PREDICTED: peroxisomal membrane protein 13 [Musa acuminata subsp. 
malaccensis]
Length=278

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 8/125 (6%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPNNP+G PSSPPGFW+S +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  156   NQDPNNPYGPPSSPPGFWMSFLRVMQGVVNFFGRISILIDQNTQAFHMFMTALLQLFDRS  215

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLRILGI+T+ +K        LP P      Q Y+EGPK APSGAWD
Sbjct  216   GMLY---GELARFVLRILGIRTRSRKQQQLGPGELPAP----AGQQYLEGPK-APSGAWD  267

Query  1096  SVWGD  1082
             SVWG+
Sbjct  268   SVWGN  272


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +NS  PG+ PP KPWE  G++SGP PFKPPS G TSDVVEASGT+KPGE+VP A+RN 
Sbjct  1     MGSNSSPPGTLPP-KPWELAGTTSGPAPFKPPSSGSTSDVVEASGTAKPGEIVPTADRNV  59

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
               N  T+AR VP RPW   Q YG ++
Sbjct  60    TANTTTLARSVPPRPW---QNYGTSY  82



>ref|XP_008775485.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera]
Length=283

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 10/125 (8%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPNNP+G PSSPPGFWIS IRVMQGVVNFF RI++L DQ+ QAFH+ ++ALLQLFDRSG+
Sbjct  161   DPNNPYGPPSSPPGFWISFIRVMQGVVNFFGRISILIDQNTQAFHMFMSALLQLFDRSGV  220

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEG-LPGPQSLQGN-QHYIEGPKAAPSGAWD  1097
             LY   GELARFVLR+LGIKT+ +K HP  A G LPG   L GN Q YIEGPKA  +G+WD
Sbjct  221   LY---GELARFVLRLLGIKTRTRK-HPQLAPGTLPG---LDGNGQQYIEGPKAT-TGSWD  272

Query  1096  SVWGD  1082
             +VWGD
Sbjct  273   NVWGD  277


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +NS +PG +PPPKPWER  +SSGP PFKPPS G TSDVVEASG +KPGE VP   R+ 
Sbjct  1     MGSNSPRPGDTPPPKPWERATTSSGPAPFKPPSSGSTSDVVEASGAAKPGETVPNTERSV  60

Query  1756  atnintvARPVPTRPWEQRQTYGNTF  1679
               N NT+ RP+P RPW+  Q YG ++
Sbjct  61    LPNRNTIGRPLPPRPWQ--QNYGTSY  84



>ref|XP_009388497.1| PREDICTED: peroxisomal membrane protein 13-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDP++P+G PS PPGFWISLIRVM GVVNFF  I+ML DQ+  AFH+ +TALLQLFDRS
Sbjct  161   NQDPDDPYGPPS-PPGFWISLIRVMHGVVNFFGHISMLMDQNTHAFHMLMTALLQLFDRS  219

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHP-PSAEGLPGPQSLQGNQHYIEGPKAAPSGAW  1100
             G+LY   GELARFVLRILGI+ + +K     S EGL         Q +IEGPK  PSG+W
Sbjct  220   GVLY---GELARFVLRILGIRMRRRKQQQLRSGEGLGNDGH---GQRFIEGPK-DPSGSW  272

Query  1099  DSVWGD  1082
             D VW D
Sbjct  273   DCVWSD  278


 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = -3

Query  1897  PKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPT  1718
              KPWER G+SSGP PF+P S G+TS+VVEASGT+KPGE+V  + RN   N NT+ RP+P 
Sbjct  14    SKPWERAGTSSGPVPFRPQSSGRTSEVVEASGTAKPGEVVTGSERNATVNRNTLGRPLPP  73

Query  1717  RPWEQRQTYGNT  1682
             RPW+  Q YG +
Sbjct  74    RPWQ--QNYGTS  83



>ref|XP_010672281.1| PREDICTED: peroxisomal membrane protein 13 [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = -3

Query  1411  GFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVL  1232
             GFWIS +RVM+GVVNFF RI++L DQ+ QA H  ++ALLQLFDR G+LY   GELARFV 
Sbjct  183   GFWISFLRVMEGVVNFFGRISLLVDQNTQAVHFFMSALLQLFDRGGMLY---GELARFVF  239

Query  1231  RILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGD  1082
             RILG+  K KK+ P    GLP PQ+   +Q ++EGPKAAP+GAWD+VWG+
Sbjct  240   RILGLGRKSKKIAPAGPNGLPLPQN---DQKFLEGPKAAPAGAWDNVWGN  286


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M T  +Q  S PPPKPWER GSSSGP PF+PPS G TSDVVEASGT+KPGE+V  +NRNT
Sbjct  1     MSTTPQQGASGPPPKPWERSGSSSGPAPFRPPSSGATSDVVEASGTAKPGEIVSTSNRNT  60

Query  1756  atnintvARPVPTRPWEQR---QTYG  1688
             A N+N   RP+PTRPWE      TYG
Sbjct  61    AVNVNAAGRPLPTRPWENNYGTSTYG  86



>ref|XP_010910086.1| PREDICTED: peroxisomal membrane protein 13-like isoform X3 [Elaeis 
guineensis]
Length=288

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 6/124 (5%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPNN +G P S PGFW+S IRVM  VVNFF RI++L D++ QAFH+ ++ALLQLFDRSGL
Sbjct  165   DPNNLYGPPPSLPGFWMSFIRVMHVVVNFFGRISILIDENTQAFHMFMSALLQLFDRSGL  224

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSV  1091
             LY   GELARFVL++LG++TKP + +      L GP +    QH++EGP +  +G+WD+V
Sbjct  225   LY---GELARFVLKLLGVRTKPGRHYQLGPGELVGPNAK--GQHHVEGPNST-NGSWDTV  278

Query  1090  WGDK  1079
             WG+ 
Sbjct  279   WGEN  282


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = -3

Query  1930  TNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat  1751
             ++ +Q G+  PPK W++VGSSS   PFKPPS G TS+VVEASGT+KPG     A  N + 
Sbjct  7     SSQQQRGNITPPKHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESA  64

Query  1750  nintvARPVPTRPWEQRQTYGNTF  1679
             N + + + V +RPWEQ    GN++
Sbjct  65    NWSALGKSVRSRPWEQNN--GNSY  86



>ref|XP_010910084.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Elaeis 
guineensis]
Length=309

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 6/124 (5%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPNN +G P S PGFW+S IRVM  VVNFF RI++L D++ QAFH+ ++ALLQLFDRSGL
Sbjct  186   DPNNLYGPPPSLPGFWMSFIRVMHVVVNFFGRISILIDENTQAFHMFMSALLQLFDRSGL  245

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSV  1091
             LY   GELARFVL++LG++TKP + +      L GP +    QH++EGP +  +G+WD+V
Sbjct  246   LY---GELARFVLKLLGVRTKPGRHYQLGPGELVGPNAK--GQHHVEGPNST-NGSWDTV  299

Query  1090  WGDK  1079
             WG+ 
Sbjct  300   WGEN  303


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = -3

Query  1900  PPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVP  1721
             PPK W++VGSSS   PFKPPS G TS+VVEASGT+KPG     A  N + N + + + V 
Sbjct  38    PPKHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVR  95

Query  1720  TRPWEQRQTYGNTF  1679
             +RPWEQ    GN++
Sbjct  96    SRPWEQNN--GNSY  107



>gb|EYU36869.1| hypothetical protein MIMGU_mgv1a010448mg [Erythranthe guttata]
Length=312

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = -3

Query  1408  FWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLR  1229
             FWISL+RVMQGVV FF R+A+L DQ+ QAFH+ ++ALLQLFDRSG+LY   GELARFVLR
Sbjct  203   FWISLMRVMQGVVTFFGRVAILIDQNTQAFHMFMSALLQLFDRSGMLY---GELARFVLR  259

Query  1228  ILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPK-AAPS-GAWDSVWGD  1082
             ILG+++K  KVHPP  EG PGP +  GN +Y+EGPK AAPS GAWD VWGD
Sbjct  260   ILGVRSKHMKVHPPGMEGPPGPHNHPGNHNYMEGPKPAAPSGGAWDGVWGD  310


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -3

Query  1888  WERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTRPW  1709
             WER GSSSGP PFKP S G TS VVEASGT++PGE+V  ANR+T  N NT+ RPVP RPW
Sbjct  18    WERAGSSSGPGPFKPSSAGNTSAVVEASGTAQPGEVVSTANRSTTVNTNTLGRPVPARPW  77

Query  1708  EQRQ  1697
             EQ+Q
Sbjct  78    EQQQ  81



>ref|XP_009124313.1| PREDICTED: peroxisomal membrane protein 13-like [Brassica rapa]
Length=262

 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 10/131 (8%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
             QD N+P   P SPPGFWIS +RV+QG V+FF R+AML DQ+ QAFH+ ++ALLQL DR G
Sbjct  135   QDSNDPNNQPPSPPGFWISFLRVLQGAVSFFGRVAMLIDQNTQAFHMLMSALLQLCDRGG  194

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPS----AEGLPGPQSLQGNQHYIEGPKAAP--  1112
             +LY   GELARFVL +LG+KTKP+K+        + G+P P    GNQ+ +EG KAA   
Sbjct  195   MLY---GELARFVLCLLGVKTKPRKMQQQQQPQGSNGVPLPHQPHGNQNCVEGTKAAAPG  251

Query  1111  -SGAWDSVWGD  1082
               G WD++WG+
Sbjct  252   GGGGWDNLWGN  262


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 11/82 (13%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSG---PTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta  1754
             +  P    PPKPWER G+++    P PF+PPS   T+D VEASGT+           +T 
Sbjct  3     TSHPSGGRPPKPWERAGNNNTSGPPKPFRPPSNTSTADSVEASGTAD--------RNHTP  54

Query  1753  tnintvARPVPTRPWEQRQTYG  1688
              N+N ++RP+P RP +Q+QTYG
Sbjct  55    ANMNALSRPLPIRPRQQQQTYG  76



>ref|XP_010910085.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Elaeis 
guineensis]
Length=299

 Score =   138 bits (348),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 6/124 (5%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPNN +G P S PGFW+S IRVM  VVNFF RI++L D++ QAFH+ ++ALLQLFDRSGL
Sbjct  176   DPNNLYGPPPSLPGFWMSFIRVMHVVVNFFGRISILIDENTQAFHMFMSALLQLFDRSGL  235

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSV  1091
             LY   GELARFVL++LG++TKP + +      L GP +    QH++EGP +  +G+WD+V
Sbjct  236   LY---GELARFVLKLLGVRTKPGRHYQLGPGELVGPNA--KGQHHVEGPNST-NGSWDTV  289

Query  1090  WGDK  1079
             WG+ 
Sbjct  290   WGEN  293


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = -3

Query  1900  PPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVP  1721
             PPK W++VGSSS   PFKPPS G TS+VVEASGT+KPG     A  N + N + + + V 
Sbjct  38    PPKHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVR  95

Query  1720  TRPWEQ  1703
             +RPWEQ
Sbjct  96    SRPWEQ  101



>gb|KDP43909.1| hypothetical protein JCGZ_20919 [Jatropha curcas]
Length=263

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
              DP++P GAPSSPPGFWISL+++MQ VVN F  I++L DQ  QA H  ++ALLQLFD SG
Sbjct  141   HDPSDPHGAPSSPPGFWISLLQMMQRVVNCFGHISILIDQHTQALHTFMSALLQLFDLSG  200

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPPSAEGL--PGPQSLQGNQHYIEGPKAAPSGAW  1100
             +LY   GELARFV R+LG + K +KV PP   GL  P P+    NQH  EG K +PS  W
Sbjct  201   MLY---GELARFVFRLLGFRKKRQKVDPPGPTGLSPPAPE----NQHQSEGTKTSPSRTW  253

Query  1099  DSVW  1088
             D VW
Sbjct  254   DIVW  257


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaa-nrntatnintv  1736
              + PPPKPWER G  SG +PFKPPS G T+DVVEASGT+KP E V +        N  +V
Sbjct  4     ANKPPPKPWERAGVPSGSSPFKPPSTGSTNDVVEASGTAKPAETVASLGRNAMVNNRTSV  63

Query  1735  ARPVPTRPWE  1706
              RP+P RPWE
Sbjct  64    RRPIPVRPWE  73



>ref|XP_006657452.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Oryza 
brachyantha]
Length=276

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 90/127 (71%), Gaps = 13/127 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+ FG P+ PP  W+S +RVM GVVNFF R+A L +Q+ QAF++ +TA+LQLFDRS
Sbjct  161   NQDPNS-FGPPAPPPSVWVSFLRVMHGVVNFFGRVAFLVEQNTQAFYLFITAMLQLFDRS  219

Query  1276  GLLYGEFGELARFVLRILGIKTKPK--KVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LGI+TK K  KV  P A    GP      QH+IE PK   + +
Sbjct  220   GMLY---GELARFVLRMLGIRTKSKKGKVQGPDAPAFEGPA-----QHFIEAPKG--NNS  269

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  270   WDNVWGN  276


 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 3/69 (4%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatn-intvAR  1730
             PPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KPGE V AA RNT+ N  + V+R
Sbjct  5     PPKPWERAGAEGASGPAPFKPPSGGTTSDVVEASGTAKPGETVTAAERNTSANINSAVSR  64

Query  1729  PVPTRPWEQ  1703
             P+P RPW+Q
Sbjct  65    PMPQRPWQQ  73



>ref|XP_006657451.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Oryza 
brachyantha]
Length=278

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 90/127 (71%), Gaps = 13/127 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+ FG P+ PP  W+S +RVM GVVNFF R+A L +Q+ QAF++ +TA+LQLFDRS
Sbjct  163   NQDPNS-FGPPAPPPSVWVSFLRVMHGVVNFFGRVAFLVEQNTQAFYLFITAMLQLFDRS  221

Query  1276  GLLYGEFGELARFVLRILGIKTKPK--KVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LGI+TK K  KV  P A    GP      QH+IE PK   + +
Sbjct  222   GMLY---GELARFVLRMLGIRTKSKKGKVQGPDAPAFEGPA-----QHFIEAPKG--NNS  271

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  272   WDNVWGN  278


 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 3/69 (4%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatn-intvAR  1730
             PPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KPGE V AA RNT+ N  + V+R
Sbjct  7     PPKPWERAGAEGASGPAPFKPPSGGTTSDVVEASGTAKPGETVTAAERNTSANINSAVSR  66

Query  1729  PVPTRPWEQ  1703
             P+P RPW+Q
Sbjct  67    PMPQRPWQQ  75



>gb|ABK26417.1| unknown [Picea sitchensis]
Length=295

 Score =   135 bits (341),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 14/125 (11%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN+PFG P S P FW S++RVM GVV FF RI++L DQ+ QAFH  +TALLQLFDR+G+
Sbjct  179   DPNDPFGGPPSAPSFWQSMLRVMHGVVTFFGRISILVDQNTQAFHFFMTALLQLFDRTGV  238

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQG----NQHYIEGPKAAPSGA  1103
             LY   GELARFVLR+LGI+TKP+    PS    PGP+++ G      +YIE PK A +G 
Sbjct  239   LY---GELARFVLRLLGIRTKPRG---PSR---PGPKAIGGQGTPENYYIEEPKEA-AGG  288

Query  1102  WDSVW  1088
             W++VW
Sbjct  289   WENVW  293


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvA  1733
             GS PPPKPWERVGSSSGP+PF+PPS G TS+VVE+SG +K GE           N +T+ 
Sbjct  5     GSVPPPKPWERVGSSSGPSPFRPPSTGSTSNVVESSGVAKIGESSDTERNVPLANRSTIG  64

Query  1732  RPVPTRPWEQ  1703
             RP+P RPWEQ
Sbjct  65    RPMPARPWEQ  74



>ref|NP_001058908.1| Os07g0152800 [Oryza sativa Japonica Group]
 dbj|BAC84718.1| putative glycine-rich protein [Oryza sativa Japonica Group]
 dbj|BAF20822.1| Os07g0152800 [Oryza sativa Japonica Group]
 dbj|BAG89526.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81528.1| hypothetical protein OsI_24927 [Oryza sativa Indica Group]
 gb|EEE66580.1| hypothetical protein OsJ_23124 [Oryza sativa Japonica Group]
Length=280

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 13/127 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+ FG P+ PP  W+S +RVM GVVNFF R+A L +Q+ QAF++ +TA+LQLFDRS
Sbjct  165   NQDPNS-FGPPAPPPSVWVSFLRVMHGVVNFFGRVAFLVEQNTQAFYLFITAMLQLFDRS  223

Query  1276  GLLYGEFGELARFVLRILGIKTKPK--KVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LGI+TK K  KV  P      GP      Q +IE PK   + +
Sbjct  224   GMLY---GELARFVLRMLGIRTKSKKGKVQGPDTPAFEGPA-----QQFIEAPKG--NNS  273

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  274   WDNVWGN  280


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 3/69 (4%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vAR  1730
             PPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KPGE V A  RN + N+N  V+R
Sbjct  5     PPKPWERAGAEGTSGPAPFKPPSGGTTSDVVEASGTAKPGETVTATERNLSANVNNPVSR  64

Query  1729  PVPTRPWEQ  1703
             P+P RPW+Q
Sbjct  65    PMPQRPWQQ  73



>gb|EMT28271.1| hypothetical protein F775_30696 [Aegilops tauschii]
Length=287

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 12/125 (10%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN+ FG P++PPGFW+S +RVM G V+FF R+A L +Q+ QAF++ +TA+LQLFDRSG+
Sbjct  173   DPNS-FGPPAAPPGFWVSFLRVMHGAVSFFGRVAFLVEQNTQAFYLFITAMLQLFDRSGM  231

Query  1270  LYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             LY   GELARFVLR+LG++TK KK  V    A    GP      Q   E PKAA + +WD
Sbjct  232   LY---GELARFVLRLLGVRTKSKKGRVQGAEAPAFEGP-----GQQLFEAPKAA-NNSWD  282

Query  1096  SVWGD  1082
             +VWG+
Sbjct  283   NVWGN  287


 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 4/77 (5%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-AR  1730
             PPKPWER G+  +SGP+PFKPPS G TSDVVEASGT+KPGE + A  RN + N+N   +R
Sbjct  5     PPKPWERAGAEGTSGPSPFKPPSGGSTSDVVEASGTAKPGETIAATERNMSANVNNSISR  64

Query  1729  PVPTRPWEQRQTYGNTF  1679
             P+P RPW+Q   YGN++
Sbjct  65    PMPQRPWQQ-TGYGNSY  80



>ref|XP_006858184.1| hypothetical protein AMTR_s00062p00160630 [Amborella trichopoda]
 gb|ERN19651.1| hypothetical protein AMTR_s00062p00160630 [Amborella trichopoda]
Length=314

 Score =   130 bits (327),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 7/127 (6%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
               DPN+P G P+SPP FWIS++R M GVV+FF RIA+L DQ+  AFH+ ++ALLQLFDRS
Sbjct  192   NHDPNDPNGGPASPPSFWISVLRAMHGVVDFFGRIALLIDQNTHAFHMFMSALLQLFDRS  251

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEG-LPGPQSLQGNQHYIEGPKAAPSGAW  1100
             G+LY   GELARFVLR+LGIKTKP+K   P  +G LPG  +   N    E PK+    A 
Sbjct  252   GVLY---GELARFVLRLLGIKTKPRKSIQPGPQGALPGLNAHGNNS--TEAPKSN-YKAL  305

Query  1099  DSVWGDK  1079
             ++VW ++
Sbjct  306   EAVWENE  312


 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -3

Query  1903  PPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPV  1724
             PPPKPWERV SS+GP+PFKPP+ G+T+DVVEASGT+KPGE+ P A RNT  N N   RP 
Sbjct  33    PPPKPWERVESSAGPSPFKPPAPGRTTDVVEASGTAKPGEIAPVAERNTVVNGNPAGRPQ  92

Query  1723  PTRPWEQ-RQTYG  1688
             P RPWEQ R  YG
Sbjct  93    PVRPWEQDRNNYG  105



>gb|EMS58205.1| hypothetical protein TRIUR3_02268 [Triticum urartu]
Length=317

 Score =   130 bits (327),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 12/125 (10%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN+ FG P++PPGFW+S +RVM G V+FF R+A L +Q+ QAF++ +TA+LQLFDRSG+
Sbjct  203   DPNS-FGPPAAPPGFWVSFLRVMHGAVSFFGRVAFLVEQNTQAFYLFITAMLQLFDRSGM  261

Query  1270  LYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             LY   GELARFVLR+LG++TK KK  V    A    GP      Q   E PKAA + +WD
Sbjct  262   LY---GELARFVLRLLGVRTKSKKGRVQGAEAPAFEGP-----GQQLFEAPKAA-NNSWD  312

Query  1096  SVWGD  1082
             +VWG+
Sbjct  313   NVWGN  317


 Score = 77.4 bits (189),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 4/77 (5%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vAR  1730
             PPKPWER G+  +SGP+PFKPPS G TSDVVEASGT+KPGE + A   N + N+N  ++R
Sbjct  35    PPKPWERAGAEGTSGPSPFKPPSGGSTSDVVEASGTAKPGETIAATEGNMSANVNNPISR  94

Query  1729  PVPTRPWEQRQTYGNTF  1679
             P+P RPW+Q   YGN++
Sbjct  95    PMPQRPWQQ-TGYGNSY  110



>ref|XP_004955471.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Setaria 
italica]
Length=278

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 13/127 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN   G P+SPPGFW+S +RVM GVVNFF RI+ L +Q+ QA +  +TA+LQLFDRS
Sbjct  163   NQDPN-AMGPPASPPGFWVSFLRVMHGVVNFFGRISFLVEQNTQASYFFMTAMLQLFDRS  221

Query  1276  GLLYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LG+K KPKK  +  P A    GP     +Q ++E PK   +  
Sbjct  222   GMLY---GELARFVLRLLGVKRKPKKGSLQGPEAPAFEGP-----SQPFMEAPKGGNN--  271

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  272   WDNVWGN  278


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = -3

Query  1909  SSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatn-int  1739
             S  PPKPWER G   ++GP PFKPPS G TSDVVEASGT+KPGE V AA RN + N  +T
Sbjct  2     SGSPPKPWERSGGEGTAGPAPFKPPSGGSTSDVVEASGTAKPGENVSAAERNASGNVNST  61

Query  1738  vARPVPTRPWEQRQTYGNTF  1679
             V+RPVP RPW+Q   YGNT+
Sbjct  62    VSRPVPQRPWQQ-TGYGNTY  80



>dbj|BAJ86828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 12/125 (10%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN+ FG P++PPGFW+S +RVM G V+FF R+A L +Q+ QAF++ +TA+LQLFDRSG+
Sbjct  174   DPNS-FGPPAAPPGFWVSFLRVMHGAVSFFGRVAFLVEQNTQAFYLFITAMLQLFDRSGM  232

Query  1270  LYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             LY   GELARFVLR+LG++TK KK  V    A  L GP      Q   E PKA  + +WD
Sbjct  233   LY---GELARFVLRLLGVRTKSKKGRVQGTEAPALEGP-----GQQLFETPKAN-NNSWD  283

Query  1096  SVWGD  1082
             +VWG+
Sbjct  284   NVWGN  288


 Score = 76.6 bits (187),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 4/77 (5%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vAR  1730
             PPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KPGE + A  RN + N+N  ++R
Sbjct  5     PPKPWERAGAEGTSGPLPFKPPSGGSTSDVVEASGTAKPGETIAATERNMSANVNNPISR  64

Query  1729  PVPTRPWEQRQTYGNTF  1679
             P+P RPW+Q   YGN++
Sbjct  65    PMPQRPWQQ-TGYGNSY  80



>ref|XP_004955473.1| PREDICTED: peroxisomal membrane protein 13-like isoform X3 [Setaria 
italica]
Length=276

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 13/127 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN   G P+SPPGFW+S +RVM GVVNFF RI+ L +Q+ QA +  +TA+LQLFDRS
Sbjct  161   NQDPN-AMGPPASPPGFWVSFLRVMHGVVNFFGRISFLVEQNTQASYFFMTAMLQLFDRS  219

Query  1276  GLLYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LG+K KPKK  +  P A    GP     +Q ++E PK   +  
Sbjct  220   GMLY---GELARFVLRLLGVKRKPKKGSLQGPEAPAFEGP-----SQPFMEAPKGGNN--  269

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  270   WDNVWGN  276


 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -3

Query  1909  SSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatn-int  1739
             S  PPKPWER G   ++GP PFKPPS G TSDVVEASGT+KPGE V AA RN + N  +T
Sbjct  2     SGSPPKPWERSGGEGTAGPAPFKPPSGGSTSDVVEASGTAKPGENVSAAERNASGNVNST  61

Query  1738  vARPVPTRPWEQ  1703
             V+RPVP RPW+Q
Sbjct  62    VSRPVPQRPWQQ  73



>ref|XP_003557652.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Brachypodium 
distachyon]
Length=659

 Score =   134 bits (337),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 13/125 (10%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN+ FG P++PPGFW+S +RVM G V+FF R+A L +Q+ QAF++ +TA+LQLFDRSG+
Sbjct  167   DPNS-FGPPAAPPGFWVSFLRVMHGAVSFFGRVAFLVEQNTQAFYLFITAMLQLFDRSGM  225

Query  1270  LYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             LY   GELARFVLR+LG++TK KK  V  P A    GP      Q ++E PK   + +WD
Sbjct  226   LY---GELARFVLRLLGVRTKSKKGRVQGPEAPAFEGP-----GQQFLEAPKG--NNSWD  275

Query  1096  SVWGD  1082
             SVWG+
Sbjct  276   SVWGN  280


 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 5/79 (6%)
 Frame = -3

Query  1909  SSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv  1736
             +  PPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KPGE +      TA   N V
Sbjct  2     AGAPPKPWERAGAEGTSGPAPFKPPSGGSTSDVVEASGTAKPGETI---AATTANVSNPV  58

Query  1735  ARPVPTRPWEQRQTYGNTF  1679
             +R +P RPW+Q+  YGN++
Sbjct  59    SRTMPQRPWQQQTGYGNSY  77



>ref|XP_004955472.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Setaria 
italica]
Length=278

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 13/127 (10%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN   G P+SPPGFW+S +RVM GVVNFF RI+ L +Q+ QA +  +TA+LQLFDRS
Sbjct  163   NQDPN-AMGPPASPPGFWVSFLRVMHGVVNFFGRISFLVEQNTQASYFFMTAMLQLFDRS  221

Query  1276  GLLYGEFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGA  1103
             G+LY   GELARFVLR+LG+K KPKK  +  P A    GP     +Q ++E PK   +  
Sbjct  222   GMLY---GELARFVLRLLGVKRKPKKGSLQGPEAPAFEGP-----SQPFMEAPKGGNN--  271

Query  1102  WDSVWGD  1082
             WD+VWG+
Sbjct  272   WDNVWGN  278


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%), Gaps = 3/69 (4%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatn-intvAR  1730
             PPKPWER G   ++GP PFKPPS G TSDVVEASGT+KPGE V AA RN + N  +TV+R
Sbjct  7     PPKPWERSGGEGTAGPAPFKPPSGGSTSDVVEASGTAKPGENVSAAERNASGNVNSTVSR  66

Query  1729  PVPTRPWEQ  1703
             PVP RPW+Q
Sbjct  67    PVPQRPWQQ  75



>gb|ACG37046.1| glycine-rich protein [Zea mays]
Length=270

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 88/128 (69%), Gaps = 15/128 (12%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+  G P+SPPGFW+S +RVM GVVNFF RI+ L +Q+ QA +  +TA+LQLFDRS
Sbjct  155   NQDPNS-MGPPASPPGFWVSFLRVMHGVVNFFGRISFLVEQNTQASYFFMTAMLQLFDRS  213

Query  1276  GLLYGEFGELARFVLRILGIKTKPKK---VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSG  1106
             G+LY   GELARFVLR+LG++ KPKK   +  P A    GP     ++  IE PK   + 
Sbjct  214   GMLY---GELARFVLRLLGVRRKPKKGGSIQGPEALAFEGP-----SRQSIEAPK---TN  262

Query  1105  AWDSVWGD  1082
              WD+VWG+
Sbjct  263   NWDNVWGN  270


 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = -3

Query  1909  SSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnint  1739
             S PPPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KP E V A   N A    +T
Sbjct  2     SGPPPKPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNST  61

Query  1738  vARPVPTRPWEQ  1703
             ++RP+P RPW+Q
Sbjct  62    ISRPMPQRPWQQ  73



>emb|CDX74040.1| BnaA03g30070D [Brassica napus]
Length=298

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (73%), Gaps = 8/113 (7%)
 Frame = -3

Query  1405  WISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRI  1226
             WIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G+LY   GELARFVLR+
Sbjct  189   WISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGMLY---GELARFVLRM  245

Query  1225  LGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE---GPKAAPSGAWDSVWGD  1082
             LG++TKP+K+   P    GLP P    GNQ++IE   G  A   G WD+VWG+
Sbjct  246   LGVRTKPRKMQQPPQGPNGLPLPHQPHGNQNFIEGPKGGAAPGGGGWDNVWGN  298


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = -3

Query  1900  PPKPWERVGS---SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vA  1733
             PPKPWE+ G+   +SGP PF+PPS   T+D VEASGT+ PGELV + NR         + 
Sbjct  64    PPKPWEQEGNNNNTSGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAATMNGLT  123

Query  1732  RPVPTRPWEQRQTYGNT  1682
             RPVP+RPWEQ+QTYG+T
Sbjct  124   RPVPSRPWEQQQTYGST  140



>ref|XP_008667295.1| PREDICTED: uncharacterized protein LOC100194278 isoform X4 [Zea 
mays]
 tpg|DAA42629.1| TPA: glycine-rich protein [Zea mays]
Length=270

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 15/128 (12%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+  G P+SPPGFW+S +RVM GVVNFF RI+ L +Q+ QA +  +TA+LQLFDRS
Sbjct  155   NQDPNS-MGPPASPPGFWVSFLRVMHGVVNFFGRISFLVEQNTQASYFFMTAMLQLFDRS  213

Query  1276  GLLYGEFGELARFVLRILGIKTKPKK---VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSG  1106
             G+LY   GELARFVLR+LG++ KPKK   +  P A    GP     ++   E PK   + 
Sbjct  214   GMLY---GELARFVLRLLGVRRKPKKGGSIQGPEALAFEGP-----SRQSTEAPK---TN  262

Query  1105  AWDSVWGD  1082
              WD+VWG+
Sbjct  263   NWDNVWGN  270


 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = -3

Query  1909  SSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnint  1739
             S PPPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KP E V A   N A    +T
Sbjct  2     SGPPPKPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNST  61

Query  1738  vARPVPTRPWEQ  1703
             V+RP+P RPW+Q
Sbjct  62    VSRPMPQRPWQQ  73



>ref|XP_008667294.1| PREDICTED: uncharacterized protein LOC100194278 isoform X3 [Zea 
mays]
Length=284

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 15/128 (12%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPN+  G P+SPPGFW+S +RVM GVVNFF RI+ L +Q+ QA +  +TA+LQLFDRS
Sbjct  169   NQDPNS-MGPPASPPGFWVSFLRVMHGVVNFFGRISFLVEQNTQASYFFMTAMLQLFDRS  227

Query  1276  GLLYGEFGELARFVLRILGIKTKPKK---VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSG  1106
             G+LY   GELARFVLR+LG++ KPKK   +  P A    GP     ++   E PK   + 
Sbjct  228   GMLY---GELARFVLRLLGVRRKPKKGGSIQGPEALAFEGP-----SRQSTEAPK---TN  276

Query  1105  AWDSVWGD  1082
              WD+VWG+
Sbjct  277   NWDNVWGN  284


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -3

Query  1903  PPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnintvA  1733
             PPPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KP E V A   N A    +TV+
Sbjct  18    PPPKPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVS  77

Query  1732  RPVPTRPWEQ  1703
             RP+P RPW+Q
Sbjct  78    RPMPQRPWQQ  87



>emb|CDY07989.1| BnaC03g35340D [Brassica napus]
Length=340

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 10/115 (9%)
 Frame = -3

Query  1405  WISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRI  1226
             WIS +RVMQG VNFF R+AML DQ+ QAFH+ ++ALLQLFDR G+LY   GELARFVLR+
Sbjct  229   WISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGMLY---GELARFVLRM  285

Query  1225  LGIKTKPKKVH--PPSAEGLPGPQSLQGNQHYIE-----GPKAAPSGAWDSVWGD  1082
             LG++TKP+K+   P    GLP P    GNQ+YIE            G WD+VWG+
Sbjct  286   LGVRTKPRKMQQPPQGPNGLPLPHQPHGNQNYIEGPKGGAAPGGGGGGWDNVWGN  340


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 4/72 (6%)
 Frame = -3

Query  1900  PPKPWERVGS---SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vA  1733
             PPKPWE+ G+   +SGP PF+PPS   T+D VEASGT+ PGELV + NR         + 
Sbjct  92    PPKPWEQEGNNNNTSGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAATMNGLT  151

Query  1732  RPVPTRPWEQRQ  1697
             RPVP+RPWEQ+Q
Sbjct  152   RPVPSRPWEQQQ  163



>ref|XP_004981532.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Setaria 
italica]
Length=240

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 7/121 (6%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             N FG P+ PPGFW+S +RVM GVVNF  R++ L  Q+ QAFH+ +TALLQL DR+G+LY 
Sbjct  123   NSFGPPAPPPGFWVSFLRVMHGVVNFCGRVSFLVSQNTQAFHMFITALLQLCDRAGMLY-  181

Query  1261  EFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGD  1082
               GELARFVLR+LGIKTKPKK      +G   P     +Q ++E PKA  S +WDSVW +
Sbjct  182   --GELARFVLRLLGIKTKPKK---GGVKGSGAPPLEGTSQQFVEAPKATNS-SWDSVWTE  235

Query  1081  K  1079
              
Sbjct  236   N  236


 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaa-nrntatnintv  1736
             GS+ PPKPWER G+SSGP PFKPPS G T++VVEASGT+K GE+V A  N  T+   + +
Sbjct  4     GSNLPPKPWERAGASSGPAPFKPPSGGTTNEVVEASGTAKHGEIVSATGNNVTSNVTSNI  63

Query  1735  ARPVPTRPWEQR  1700
             +RPVP RPW+Q+
Sbjct  64    SRPVPPRPWQQQ  75



>ref|XP_004981531.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Setaria 
italica]
Length=263

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 7/121 (6%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             N FG P+ PPGFW+S +RVM GVVNF  R++ L  Q+ QAFH+ +TALLQL DR+G+LY 
Sbjct  146   NSFGPPAPPPGFWVSFLRVMHGVVNFCGRVSFLVSQNTQAFHMFITALLQLCDRAGMLY-  204

Query  1261  EFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGD  1082
               GELARFVLR+LGIKTKPKK      +G   P     +Q ++E PKA  S +WDSVW +
Sbjct  205   --GELARFVLRLLGIKTKPKK---GGVKGSGAPPLEGTSQQFVEAPKATNS-SWDSVWTE  258

Query  1081  K  1079
              
Sbjct  259   N  259


 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaa-nrntatnintv  1736
             GS+ PPKPWER G+SSGP PFKPPS G T++VVEASGT+K GE+V A  N  T+   + +
Sbjct  4     GSNLPPKPWERAGASSGPAPFKPPSGGTTNEVVEASGTAKHGEIVSATGNNVTSNVTSNI  63

Query  1735  ARPVPTRPWEQR  1700
             +RPVP RPW+Q+
Sbjct  64    SRPVPPRPWQQQ  75



>ref|XP_002466342.1| hypothetical protein SORBIDRAFT_01g005970 [Sorghum bicolor]
 gb|EER93340.1| hypothetical protein SORBIDRAFT_01g005970 [Sorghum bicolor]
Length=409

 Score =   124 bits (310),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 81/118 (69%), Gaps = 8/118 (7%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             N FG P+ PPGFW+S +RVM GVVNF  R++ L  Q+ QAFH+ +TA LQL DR+G+LY 
Sbjct  293   NSFGPPAPPPGFWMSFLRVMHGVVNFCGRVSFLISQNTQAFHMFITAFLQLCDRAGMLY-  351

Query  1261  EFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVW  1088
               GELARFVLR+LGIKTKPKK      +G   P S    Q ++E PKA  S  WDSVW
Sbjct  352   --GELARFVLRLLGIKTKPKK---GGVKGAGAPSSEGRGQQFVEAPKANSS--WDSVW  402


 Score = 75.1 bits (183),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = -3

Query  1906  SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-AR  1730
             +PPPKPWER G+SSG  PFKPPS G TSDVVEASGT+K GE+V AA  N A+N+N+  + 
Sbjct  149   NPPPKPWERAGASSGSVPFKPPSGGSTSDVVEASGTAKHGEVVSAAGNNVASNVNSNIST  208

Query  1729  PVPTRPWEQR  1700
             PVP RPW+Q+
Sbjct  209   PVPPRPWQQQ  218



>ref|NP_001051486.1| Os03g0786000 [Oryza sativa Japonica Group]
 gb|ABF99229.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13400.1| Os03g0786000 [Oryza sativa Japonica Group]
 gb|EAY92093.1| hypothetical protein OsI_13799 [Oryza sativa Indica Group]
 gb|EAZ28826.1| hypothetical protein OsJ_12860 [Oryza sativa Japonica Group]
 dbj|BAG87836.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=270

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 83/121 (69%), Gaps = 10/121 (8%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             N FG P+ PPGFW+S +RVM GVVNF  R+A L  Q+ QAFH+ ++ALLQL DR+G+LY 
Sbjct  154   NSFGPPAPPPGFWMSFLRVMHGVVNFCGRVAFLFSQNTQAFHMFISALLQLCDRTGMLY-  212

Query  1261  EFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQG-NQHYIEGPKAAPSGAWDSVWG  1085
               GELARFVLR+LGIKTK KK     AE      S +G   H+ E PKA  + +WDSVW 
Sbjct  213   --GELARFVLRLLGIKTKAKKGGVQGAE----TSSFEGPGHHFAEAPKA--NNSWDSVWT  264

Query  1084  D  1082
             D
Sbjct  265   D  265


 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-  1736
             GS+PPPKPWER G+SSGP PFKPPS G TSD+VEASGT+KPGE+V AA  N A+N+N+  
Sbjct  3     GSNPPPKPWERAGTSSGPAPFKPPSGGSTSDIVEASGTAKPGEVVSAAESNVASNVNSTI  62

Query  1735  ARPVPTRPWEQR  1700
             +RPVP RPW+Q+
Sbjct  63    SRPVPPRPWQQQ  74



>gb|ABC60343.1| putative glycine-rich protein [Musa acuminata AAA Group]
Length=166

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              QDPNNP+G PSSPPGFW+S +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQLFDRS
Sbjct  68    NQDPNNPYGPPSSPPGFWMSFLRVMQGVVNFFGRISILIDQNTQAFHMFMTALLQLFDRS  127

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGP  1163
             G+LY   GELARFVLRILGI+T+ +K        LP P
Sbjct  128   GMLY---GELARFVLRILGIRTRSRKQQQLGPGELPAP  162



>ref|XP_006650694.1| PREDICTED: peroxisomal membrane protein 13-like [Oryza brachyantha]
Length=269

 Score =   118 bits (295),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 83/122 (68%), Gaps = 13/122 (11%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             + FG P+ PPGFW+S +RVM GVVNF  R+A L  Q+ QAFH+ ++ALLQL DR+G+LY 
Sbjct  154   DSFGPPAPPPGFWMSFLRVMHGVVNFCGRVAFLFSQNTQAFHMFISALLQLCDRTGMLY-  212

Query  1261  EFGELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVW  1088
               GELARFVLR+LGIKTKPKK  V         GP    GNQ + E PKA    +WDSVW
Sbjct  213   --GELARFVLRLLGIKTKPKKGAVQGTETSSFQGP----GNQ-FAEAPKA---NSWDSVW  262

Query  1087  GD  1082
              D
Sbjct  263   TD  264


 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-  1736
             GS+PPPKPWE  G+SSGP PF+PPS G TSD+VEASGT+KPGE+V A   N  +N+N   
Sbjct  3     GSNPPPKPWEHAGTSSGPAPFRPPSGGSTSDIVEASGTAKPGEVVSATEGNVTSNVNGNI  62

Query  1735  ARPVPTRPWEQRQTYGNTF  1679
             +RP+P RPW+Q Q Y N++
Sbjct  63    SRPLPPRPWQQ-QGYANSY  80



>gb|ACL54731.1| unknown [Zea mays]
Length=264

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 82/123 (67%), Gaps = 10/123 (8%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              Q PN+ FG P+ PPGFW+S +RVM GVVNF  R++ L  Q+ QAFH+ +TALLQL DR+
Sbjct  145   NQGPNS-FGPPTPPPGFWVSFLRVMHGVVNFCGRVSFLVSQNTQAFHMFITALLQLCDRA  203

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LGIK KPKK      +G   P S    Q  +E PK     +WD
Sbjct  204   GMLY---GELARFVLRLLGIKRKPKK---SGVKGPGAPSSEGRGQQLVEAPKV---NSWD  254

Query  1096  SVW  1088
             SVW
Sbjct  255   SVW  257


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -3

Query  1906  SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-AR  1730
             +PPPKPWER G+SSGP PFKPPS G TSDVVEASGT+K GE+V AA  N A+N+N+  + 
Sbjct  6     NPPPKPWERAGNSSGPVPFKPPSGGSTSDVVEASGTAKHGEVVSAAGNNVASNVNSTISM  65

Query  1729  PVPTRPWEQRQTYGNTF  1679
             PVP RPW+Q Q Y N++
Sbjct  66    PVPPRPWQQ-QGYENSY  81



>tpg|DAA51783.1| TPA: glycine-rich protein [Zea mays]
Length=287

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRS  1277
              Q PN+ FG P+ PPGFW+S +RVM GVVNF  R++ L  Q+ QAFH+ +TALLQL DR+
Sbjct  168   NQGPNS-FGPPTPPPGFWVSFLRVMHGVVNFCGRVSFLVSQNTQAFHMFITALLQLCDRA  226

Query  1276  GLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWD  1097
             G+LY   GELARFVLR+LGIK KPKK      +G   P S    Q  +E PK     +WD
Sbjct  227   GMLY---GELARFVLRLLGIKRKPKK---SGVKGPGAPSSEGRGQQLVEAPKV---NSWD  277

Query  1096  SVWGDK  1079
             SVW + 
Sbjct  278   SVWTEN  283


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = -3

Query  1906  SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaa-nrntatnintvAR  1730
             +PPPKPWER G+SSGP PFKPPS G TSDVVEASGT+K GE+V AA N   +   +T++ 
Sbjct  29    NPPPKPWERAGNSSGPVPFKPPSGGSTSDVVEASGTAKHGEVVSAAGNNVASNVNSTISM  88

Query  1729  PVPTRPWEQRQTYGNTF  1679
             PVP RPW+Q Q Y N++
Sbjct  89    PVPPRPWQQ-QGYENSY  104



>ref|XP_008812815.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera]
Length=215

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 86/130 (66%), Gaps = 10/130 (8%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGF----WISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQL  1289
             EQ+  N +G   S   +    W+    +M+ VVN F RI++L D++++AFH+ ++ALLQL
Sbjct  86    EQNNGNSYGGYVSTMNYNLKRWMEEKNIMRVVVNIFGRISILIDENMKAFHMSMSALLQL  145

Query  1288  FDRSGLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPS  1109
             FDRSGLLY   GELA+FVLR+LG++TKP + +      L GP +    QH+IEGP    +
Sbjct  146   FDRSGLLY---GELAKFVLRLLGMRTKPGRHYQLGPGELIGPNAKW--QHHIEGPNFT-N  199

Query  1108  GAWDSVWGDK  1079
             G+WDSVWGD 
Sbjct  200   GSWDSVWGDN  209


 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -3

Query  1957  VVSS*YDMETNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELV  1778
             VV+    +  N    G+  P KPW+RVGSSS P PFKP S   TS+VVEASGT+KPGE  
Sbjct  3     VVNLVRRIRCNCNVAGNVTPLKPWQRVGSSSRPAPFKPLSPRSTSNVVEASGTAKPGEAA  62

Query  1777  PaanrntatnintvARPVPTRPWEQRQTYGNTF  1679
               A  N + N   + R VP+ PWEQ    GN++
Sbjct  63    SGAEGNASANWKALGRSVPSGPWEQNN--GNSY  93



>ref|NP_001132789.1| uncharacterized protein LOC100194278 [Zea mays]
 gb|ACF81784.1| unknown [Zea mays]
 tpg|DAA42630.1| TPA: hypothetical protein ZEAMMB73_006666 [Zea mays]
Length=297

 Score =   112 bits (280),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 87/155 (56%), Gaps = 42/155 (27%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRV---------------------------MQGVVNFFS  1358
              QDPN+  G P+SPPGFW+S +RV                           M GVVNFF 
Sbjct  155   NQDPNS-MGPPASPPGFWVSFLRVVLVTTTCSAITFTKCRITSLFISRRTQMHGVVNFFG  213

Query  1357  RIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRILGIKTKPKK---VHPP  1187
             RI+ L +Q+ QA +  +TA+LQLFDRSG+LY   GELARFVLR+LG++ KPKK   +  P
Sbjct  214   RISFLVEQNTQASYFFMTAMLQLFDRSGMLY---GELARFVLRLLGVRRKPKKGGSIQGP  270

Query  1186  SAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGD  1082
              A    GP     ++   E PK   +  WD+VWG+
Sbjct  271   EALAFEGP-----SRQSTEAPK---TNNWDNVWGN  297


 Score = 73.9 bits (180),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = -3

Query  1909  SSPPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnint  1739
             S PPPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KP E V A   N A    +T
Sbjct  2     SGPPPKPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNST  61

Query  1738  vARPVPTRPWEQ  1703
             V+RP+P RPW+Q
Sbjct  62    VSRPMPQRPWQQ  73



>ref|XP_008667293.1| PREDICTED: uncharacterized protein LOC100194278 isoform X2 [Zea 
mays]
Length=301

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 87/155 (56%), Gaps = 42/155 (27%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRV---------------------------MQGVVNFFS  1358
              QDPN+  G P+SPPGFW+S +RV                           M GVVNFF 
Sbjct  159   NQDPNS-MGPPASPPGFWVSFLRVVLVTTTCSAITFTKCRITSLFISRRTQMHGVVNFFG  217

Query  1357  RIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRILGIKTKPKK---VHPP  1187
             RI+ L +Q+ QA +  +TA+LQLFDRSG+LY   GELARFVLR+LG++ KPKK   +  P
Sbjct  218   RISFLVEQNTQASYFFMTAMLQLFDRSGMLY---GELARFVLRLLGVRRKPKKGGSIQGP  274

Query  1186  SAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGD  1082
              A    GP     ++   E PK   +  WD+VWG+
Sbjct  275   EALAFEGP-----SRQSTEAPK---TNNWDNVWGN  301


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -3

Query  1903  PPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnintvA  1733
             PPPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KP E V A   N A    +TV+
Sbjct  8     PPPKPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVS  67

Query  1732  RPVPTRPWEQ  1703
             RP+P RPW+Q
Sbjct  68    RPMPQRPWQQ  77



>ref|XP_008667292.1| PREDICTED: uncharacterized protein LOC100194278 isoform X1 [Zea 
mays]
Length=311

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 87/155 (56%), Gaps = 42/155 (27%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRV---------------------------MQGVVNFFS  1358
              QDPN+  G P+SPPGFW+S +RV                           M GVVNFF 
Sbjct  169   NQDPNS-MGPPASPPGFWVSFLRVVLVTTTCSAITFTKCRITSLFISRRTQMHGVVNFFG  227

Query  1357  RIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRILGIKTKPKK---VHPP  1187
             RI+ L +Q+ QA +  +TA+LQLFDRSG+LY   GELARFVLR+LG++ KPKK   +  P
Sbjct  228   RISFLVEQNTQASYFFMTAMLQLFDRSGMLY---GELARFVLRLLGVRRKPKKGGSIQGP  284

Query  1186  SAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGD  1082
              A    GP     ++   E PK   +  WD+VWG+
Sbjct  285   EALAFEGP-----SRQSTEAPK---TNNWDNVWGN  311


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -3

Query  1903  PPPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnintvA  1733
             PPPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KP E V A   N A    +TV+
Sbjct  18    PPPKPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVS  77

Query  1732  RPVPTRPWEQ  1703
             RP+P RPW+Q
Sbjct  78    RPMPQRPWQQ  87



>dbj|BAK08359.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 11/120 (9%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             N FG P+ PPGFW+S +RVM G+VNF  R+A L  Q+ QAFH+ +TALLQL D+S +LY 
Sbjct  153   NSFGPPAPPPGFWVSFLRVMHGIVNFSGRVAFLISQNTQAFHMFITALLQLCDKSEMLY-  211

Query  1261  EFGELARFVLRILGIKTKPKKVHPPSAEGLP--GPQSLQGNQHYIEGPKAAPSGAWDSVW  1088
               GELARF  R+LGIKTKPKK     A+  P  GP      Q ++E PKA  + +W++VW
Sbjct  212   --GELARFTFRLLGIKTKPKKGGIQGAQAPPFEGP-----GQQFVEAPKANKN-SWENVW  263


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnintv  1736
             G++PPPKPWERVG+SSGP PFKPPS G TSDVVEASGT+KPGE+V AA  N A    NTV
Sbjct  3     GNNPPPKPWERVGTSSGPAPFKPPSGGSTSDVVEASGTAKPGEVVSAAQSNAAFNVNNTV  62

Query  1735  ARPVPTRPWEQR  1700
             A PVP RPW+Q+
Sbjct  63    AGPVPPRPWQQQ  74



>ref|XP_002973297.1| hypothetical protein SELMODRAFT_173180 [Selaginella moellendorffii]
 gb|EFJ25671.1| hypothetical protein SELMODRAFT_173180 [Selaginella moellendorffii]
Length=297

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             +P++P+G P   P FW S++ V+ GV+ FF R+A+L D++ QAFH  +TALLQL DR+G+
Sbjct  173   NPDDPYGGPPRAPSFWQSMLSVLHGVMTFFGRLAILIDENTQAFHFFITALLQLCDRAGI  232

Query  1270  LYGEFGELARFVLRILGIKTK-PKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             LY   GELARFVLR+LG + + PK         L G ++ QG             G+WD+
Sbjct  233   LY---GELARFVLRLLGFRPRSPKARSVAGTRALAGAEAKQGGGDGAVVASLPKEGSWDN  289

Query  1093  VWGDK  1079
             VW +K
Sbjct  290   VWSNK  294



>ref|XP_002976607.1| hypothetical protein SELMODRAFT_443291 [Selaginella moellendorffii]
 gb|EFJ22276.1| hypothetical protein SELMODRAFT_443291 [Selaginella moellendorffii]
Length=297

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             +P++P+G P   P FW S++ V+ GV+ FF R+A+L D++ QAFH  +TALLQL DR+G+
Sbjct  173   NPDDPYGGPPRAPSFWQSMLSVLHGVMTFFGRLAILIDENTQAFHFFITALLQLCDRAGI  232

Query  1270  LYGEFGELARFVLRILGIKTK-PKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDS  1094
             LY   GELARFVLR+LG + + PK         L G ++ QG             G+WD+
Sbjct  233   LY---GELARFVLRLLGFRPRSPKARSVAGTRALAGAEAKQGGGDGAVVASLPKEGSWDN  289

Query  1093  VWGDK  1079
             VW +K
Sbjct  290   VWSNK  294



>ref|XP_003558107.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Brachypodium 
distachyon]
Length=699

 Score =   114 bits (286),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 79/118 (67%), Gaps = 8/118 (7%)
 Frame = -3

Query  1441  NPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYG  1262
             + FG P+ PPGFW+S +RVM G+VNF  R+A L  Q+ QAFH  +TALLQL D+SG+LY 
Sbjct  163   DSFGPPAPPPGFWVSFLRVMHGIVNFSGRVAFLISQNTQAFHSFITALLQLCDKSGMLY-  221

Query  1261  EFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVW  1088
                ELARFVLR+LG KTKPKK     AE    P      Q ++E PKA  + +WD+VW
Sbjct  222   --SELARFVLRLLGFKTKPKKGRVQGAE---SPSFKGSGQQFVEEPKA--NNSWDNVW  272


 Score = 98.2 bits (243),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntat-nintv  1736
             G++PPPKPWERVG+SSGP PFKPPS G TSD+VEASGT+KPGE+V AA  N A    NTV
Sbjct  3     GTNPPPKPWERVGTSSGPAPFKPPSGGTTSDIVEASGTAKPGEVVSAAQSNAALGVNNTV  62

Query  1735  ARPVPTRPWEQRQTYGNTF  1679
             +RPVP RPW+Q+Q +GN++
Sbjct  63    SRPVPPRPWQQQQGFGNSY  81



>gb|EMT00619.1| Putative peroxisomal (S)-2-hydroxy-acid oxidase 1 [Aegilops tauschii]
Length=756

 Score =   114 bits (286),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = -3

Query  1435  FGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEF  1256
             FG P+ PPGFW+S +RVM G+VNF  R+A L  Q+ QAFH+ +TALLQL D+SG+LY   
Sbjct  155   FGPPAPPPGFWVSFLRVMHGIVNFSGRVAFLISQNTQAFHMFITALLQLCDKSGMLY---  211

Query  1255  GELARFVLRILGIKTKPKK--VHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVW  1088
             GELARF  R+LGIKTKP K  +    A  L GP      Q ++E PKA+ + +W++VW
Sbjct  212   GELARFTFRLLGIKTKPNKGRIQGAQAPSLDGP-----GQQFVEAPKASKN-SWENVW  263


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnta-tnintv  1736
             G++PPPKPWERVG+SSGP PFKPPS G TSDVVEASGT+KPGE+V AA  N A    NTV
Sbjct  3     GNNPPPKPWERVGTSSGPAPFKPPSGGSTSDVVEASGTAKPGEVVSAAQSNAAFNVNNTV  62

Query  1735  ARPVPTRPWEQRQTYGNTF  1679
             A PVP RPW+Q Q YGNT+
Sbjct  63    AGPVPPRPWQQ-QGYGNTY  80



>gb|ABK22418.1| unknown [Picea sitchensis]
Length=289

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 75/127 (59%), Gaps = 22/127 (17%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPG-FWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDR  1280
              QDPNNP G     P  FW S++RVM GVV FF R+++L D++ QAFH  +TALLQLFDR
Sbjct  179   SQDPNNPLGGSPPSPPSFWQSMLRVMHGVVTFFGRVSILVDENTQAFHFFITALLQLFDR  238

Query  1279  SGLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAW  1100
             SG+LY   GELARFVLR LG   +P+      +E L               P AAP   W
Sbjct  239   SGVLY---GELARFVLRFLGFWGRPRIRPQGGSEAL---------------PVAAP---W  277

Query  1099  DSVWGDK  1079
             D+ W DK
Sbjct  278   DNTWQDK  284


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -3

Query  1909  SSPPPKPWERVGSSSGPTPFKPPSVGK-TSDVVEASGTSKPGELVPaanrnt-atnintv  1736
             S  PPKPWERVG SSGP+PF+ PS G  T++V ++ G +KP E      RN  + N   V
Sbjct  4     SGAPPKPWERVGGSSGPSPFRSPSTGNGTNNVGDSCGDTKPEEKNDNIQRNLPSGNGGIV  63

Query  1735  ARPVPTRPWEQR  1700
             ARP+P RPWE+ 
Sbjct  64    ARPMPQRPWERN  75



>ref|NP_001149646.1| LOC100283272 [Zea mays]
 gb|ACG36223.1| glycine-rich protein [Zea mays]
Length=264

 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = -3

Query  1417  PPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARF  1238
             PPGFW+S +RVM GVVNF  R++ L  Q+ QAFH+ +TALLQL DR+G+LY   GELARF
Sbjct  157   PPGFWVSFLRVMHGVVNFCGRVSFLVSQNTQAFHMFITALLQLCDRAGMLY---GELARF  213

Query  1237  VLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSVWGDK  1079
             VLR+LGIK KPKK      +G   P S    Q  +E PK     +WDSVW + 
Sbjct  214   VLRLLGIKRKPKK---SGVKGPGAPSSEGRGQELVEAPKV---NSWDSVWTEN  260


 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 2/77 (3%)
 Frame = -3

Query  1906  SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-AR  1730
             +PPPKPWER G+SSGP PFKPPS G TSDVVEASGT+K GE+V A+  N A+N+N+  + 
Sbjct  6     NPPPKPWERAGNSSGPVPFKPPSGGSTSDVVEASGTAKHGEVVSASGNNVASNVNSTISM  65

Query  1729  PVPTRPWEQRQTYGNTF  1679
             PVP RPW+Q Q Y N++
Sbjct  66    PVPPRPWQQ-QGYENSY  81



>gb|KCW87649.1| hypothetical protein EUGRSUZ_A00039 [Eucalyptus grandis]
Length=238

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGS-SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M +N + P S +PPPKPWER G+SSGP PFKPPS G TSDVVEASGT++PGE+V + +R 
Sbjct  1     MASNPQPPSSATPPPKPWERSGASSGPAPFKPPSAGSTSDVVEASGTARPGEIVASTDRT  60

Query  1759  tatnintvARPVPTRPWEQRQTYGN  1685
             T  N N + RPVPTRPWEQ Q+YGN
Sbjct  61    TTPNTNALGRPVPTRPWEQ-QSYGN  84


 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLF  1286
             QDPNNP+G PSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQ +
Sbjct  167   QDPNNPYGEPSSPPGFWISFLRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQKY  222



>gb|KCW87650.1| hypothetical protein EUGRSUZ_A00039 [Eucalyptus grandis]
Length=230

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -3

Query  1936  METNSRQPGS-SPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrn  1760
             M +N + P S +PPPKPWER G+SSGP PFKPPS G TSDVVEASGT++PGE+V + +R 
Sbjct  1     MASNPQPPSSATPPPKPWERSGASSGPAPFKPPSAGSTSDVVEASGTARPGEIVASTDRT  60

Query  1759  tatnintvARPVPTRPWEQRQTYGNT  1682
             T  N N + RPVPTRPWEQ Q+YGN 
Sbjct  61    TTPNTNALGRPVPTRPWEQ-QSYGNN  85


 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQL  1289
             QDPNNP+G PSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQ+
Sbjct  167   QDPNNPYGEPSSPPGFWISFLRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQV  221



>gb|AFK39269.1| unknown [Medicago truncatula]
Length=149

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   S+PPPKPWER GSSSGP PF+PPS G TSDVVEASGT+KPGE+V AA+R+ 
Sbjct  1     MASNPQPSASNPPPKPWERAGSSSGPAPFRPPSGGSTSDVVEASGTAKPGEIVTAADRSA  60

Query  1756  atnintvARPVPTRPWEQR  1700
             A N NT+ARPVPTRPWEQ 
Sbjct  61    AVNRNTLARPVPTRPWEQN  79



>ref|XP_006442934.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
 gb|ESR56174.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
Length=249

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLF  1286
             QDPN+P+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQ+F
Sbjct  175   QDPNDPYGAPSSPPGFWISALRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQVF  230


 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -3

Query  1897  PKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPT  1718
             PKPWE+ G++SGPTPFKPPS G TSDVVE+SGT+ PGE+V A++R    N N V RP+P+
Sbjct  15    PKPWEQAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPS  74

Query  1717  RPWEQRQTYGNT  1682
             RPWEQ   YG+T
Sbjct  75    RPWEQN--YGST  84



>gb|KDO50763.1| hypothetical protein CISIN_1g022548mg [Citrus sinensis]
Length=249

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLF  1286
             QDPN+P+GAPSSPPGFWIS +RVMQGVVNFF RI++L DQ+ QAFH+ +TALLQ+F
Sbjct  175   QDPNDPYGAPSSPPGFWISALRVMQGVVNFFGRISILIDQNTQAFHLFMTALLQVF  230


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -3

Query  1897  PKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPT  1718
             PKPWER G++SGPTPFKPPS G TSDVVE+SGT+ PGE+V A++R    N N V RP+P+
Sbjct  15    PKPWERAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPS  74

Query  1717  RPWEQRQTYGNT  1682
             RPWE  Q YG+T
Sbjct  75    RPWE--QNYGST  84



>ref|XP_001770268.1| predicted protein [Physcomitrella patens]
 gb|EDQ64943.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 97.4 bits (241),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = -3

Query  1456  EQDPNNPFGA-PSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDR  1280
             + DPNNP G  P   P FW  ++R + G + FF R++ML D++  A H  +TALLQLFDR
Sbjct  287   QGDPNNPMGGEPPQAPNFWQQMLRGLNGFLTFFGRLSMLVDENTHALHFFITALLQLFDR  346

Query  1279  SGLLYGEFGELARFVLRILGIKTKPK  1202
             +G+LY   GELARFVLR+LG+K+K +
Sbjct  347   AGVLY---GELARFVLRMLGVKSKAR  369



>ref|XP_011047732.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Populus 
euphratica]
Length=224

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQL  1289
             QDPNNPFGAP SPPGFWIS +RV+QGVVNFF RI++L DQ+ QAFH+ +TALLQL
Sbjct  155   QDPNNPFGAPPSPPGFWISFLRVLQGVVNFFGRISILIDQNTQAFHMLMTALLQL  209


 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +N +   ++PPPKPWE+ G SSG TPFKPPS G TSDVVEASGT++PGE+V   +  +
Sbjct  1     MASNPQPSANNPPPKPWEQAGGSSGATPFKPPSAGSTSDVVEASGTARPGEIV--QSSGS  58

Query  1756  atnintvARPVPTRPWEQRQT  1694
             A N N V RP+P+RPWEQ  +
Sbjct  59    AANTNAVGRPLPSRPWEQNYS  79



>gb|ACU21190.1| unknown [Glycine max]
Length=216

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             ME  ++   +SPPPKPWE+ GS SGP PFKPPS G TSDVVEASGT+KPGE+V +++R+ 
Sbjct  1     MEPKTQPQANSPPPKPWEQAGSPSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSA  60

Query  1756  atnintvARPVPTRPWEQRQTYGNT  1682
             A N NT+ RPVP+RPW   Q YGN+
Sbjct  61    AVNRNTLGRPVPSRPWG--QNYGNS  83


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQ  1325
             +QDPN+PFGAP SPPGFWIS++RVMQGVVNFF RI++L DQ+ Q
Sbjct  168   DQDPNDPFGAPPSPPGFWISVLRVMQGVVNFFGRISILIDQNTQ  211



>gb|EPS63109.1| hypothetical protein M569_11678, partial [Genlisea aurea]
Length=201

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 59/73 (81%), Gaps = 2/73 (3%)
 Frame = -3

Query  1894  KPWERVG-SSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPT  1718
             KPWER G SSSGP PF+PPS G TSDVVEASGT++PGE+V + +    TN NT+ RP+PT
Sbjct  1     KPWERAGGSSSGPAPFRPPSAGNTSDVVEASGTAQPGEVVSSTSDVNNTNRNTLGRPLPT  60

Query  1717  RPWEQRQTYGNTF  1679
             RPW+Q QTYGNTF
Sbjct  61    RPWDQ-QTYGNTF  72


 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQL  1289
             EQDPNNPFG+P SPPGFWISL+RVMQGVVNFF RIA+L DQ+ QAFH+ +TALLQ+
Sbjct  146   EQDPNNPFGSPPSPPGFWISLMRVMQGVVNFFGRIAILIDQNTQAFHMFMTALLQV  201



>gb|ACU23798.1| unknown [Glycine max]
Length=85

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 60/84 (71%), Gaps = 11/84 (13%)
 Frame = -3

Query  1309  VTALLQLFDRSGLLYGEFGELARFVLRILGIKTKPKKVH--------PPSAEGLPGPQSL  1154
             +TALLQLFDRSG+LYGE   LARFVLR+LGIKTK KKVH         P     PGP + 
Sbjct  1     MTALLQLFDRSGMLYGE---LARFVLRLLGIKTKSKKVHPPGPNGQPLPGPGPGPGPHNP  57

Query  1153  QGNQHYIEGPKAAPSGAWDSVWGD  1082
              GN +YIE PKA PSG+WD+VWG+
Sbjct  58    SGNVNYIEAPKATPSGSWDNVWGN  81



>ref|XP_009397409.1| PREDICTED: peroxisomal membrane protein 13-like [Musa acuminata 
subsp. malaccensis]
Length=64

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 5/63 (8%)
 Frame = -3

Query  1387  VMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRILGIKTK  1208
             +MQGVVNFF RI++L  Q+ Q+  + +TALLQLFDRSGLLY   GELARFVLRILG +T+
Sbjct  6     LMQGVVNFFHRISILIYQNTQS--MSMTALLQLFDRSGLLY---GELARFVLRILGFRTR  60

Query  1207  PKK  1199
             P+K
Sbjct  61    PRK  63



>ref|XP_005849539.1| hypothetical protein CHLNCDRAFT_142910 [Chlorella variabilis]
 gb|EFN57437.1| hypothetical protein CHLNCDRAFT_142910 [Chlorella variabilis]
Length=264

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN+P  AP  PP  W +++  + GVV+FF R++ L D++  A H  ++ALLQL DR G 
Sbjct  168   DPNDP-NAPPQPPSAWQAMLHAISGVVHFFGRLSFLVDENAHAVHFFISALLQLLDRFGS  226

Query  1270  LYGEFGELARFVLRILGIKTKPKKV  1196
             LY   GELARFVLR+LG K + KK 
Sbjct  227   LY---GELARFVLRLLGFKPRDKKT  248



>gb|ABF99230.1| expressed protein [Oryza sativa Japonica Group]
Length=190

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintv-  1736
             GS+PPPKPWER G+SSGP PFKPPS G TSD+VEASGT+KPGE+V AA  N A+N+N+  
Sbjct  3     GSNPPPKPWERAGTSSGPAPFKPPSGGSTSDIVEASGTAKPGEVVSAAESNVASNVNSTI  62

Query  1735  ARPVPTRPWEQR  1700
             +RPVP RPW+Q+
Sbjct  63    SRPVPPRPWQQQ  74



>ref|XP_008809368.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Phoenix 
dactylifera]
Length=221

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -3

Query  1936  METNSRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrnt  1757
             M +NS  PG++PPPKPW+R G+S GP+PFKP S G TSDVVEASGT+KPGE+VP  N   
Sbjct  1     MGSNSPLPGNTPPPKPWDRAGTSPGPSPFKPQSSGGTSDVVEASGTAKPGEIVP-NNERN  59

Query  1756  atnintvARPVPTRPWEQRQ  1697
             A N N V RP+P RPW+Q  
Sbjct  60    ALNNNIVGRPLPPRPWQQNH  79


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQ-LFDRSG  1274
             D +NP+G PSSPP FWIS +R MQGV+NFF RI +L  Q+ QAFH+ ++ALLQ LFD S 
Sbjct  160   DTSNPYGPPSSPPAFWISFVRSMQGVINFFGRITILIVQNTQAFHMFMSALLQVLFDSSI  219

Query  1273  LL  1268
             LL
Sbjct  220   LL  221



>ref|XP_010910087.1| PREDICTED: peroxisomal membrane protein 13-like isoform X4 [Elaeis 
guineensis]
Length=278

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 67/124 (54%), Gaps = 37/124 (30%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPNN +G P S PGFW+S IRV                               LFDRSGL
Sbjct  186   DPNNLYGPPPSLPGFWMSFIRV-------------------------------LFDRSGL  214

Query  1270  LYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSGAWDSV  1091
             LY   GELARFVL++LG++TKP + +      L GP +    QH++EGP +  +G+WD+V
Sbjct  215   LY---GELARFVLKLLGVRTKPGRHYQLGPGELVGPNAK--GQHHVEGPNST-NGSWDTV  268

Query  1090  WGDK  1079
             WG+ 
Sbjct  269   WGEN  272


 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 4/74 (5%)
 Frame = -3

Query  1900  PPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVP  1721
             PPK W++VGSSS   PFKPPS G TS+VVEASGT+KPG     A  N + N + + + V 
Sbjct  38    PPKHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVR  95

Query  1720  TRPWEQRQTYGNTF  1679
             +RPWEQ    GN++
Sbjct  96    SRPWEQNN--GNSY  107



>ref|XP_002503524.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64782.1| predicted protein [Micromonas sp. RCC299]
Length=319

 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -3

Query  1444  NNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLY  1265
             N+P G P+ PP  W  ++R + GVV F  +++ L D++ QA H  +TA+LQL DR+GLLY
Sbjct  197   NDPNG-PTPPPTAWQRILRSLSGVVMFAGKMSWLVDENAQAMHFFMTAMLQLLDRAGLLY  255

Query  1264  GEFGELARFVLRILGIKTKPK  1202
                GELARFVLR+LG K  P+
Sbjct  256   ---GELARFVLRLLGYKVPPR  273



>gb|KCW87079.1| hypothetical protein EUGRSUZ_B03613 [Eucalyptus grandis]
Length=91

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 52/70 (74%), Gaps = 1/70 (1%)
 Frame = -3

Query  1894  KPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTR  1715
              PWER G SSGP PFKPPS G TSD+VEASGT++PGE+V   +R    N N++ARPVPTR
Sbjct  21    DPWERAGGSSGPAPFKPPSSGSTSDIVEASGTARPGEIVSTTDRTIPVNANSIARPVPTR  80

Query  1714  PWEQRQTYGN  1685
             P    Q+YGN
Sbjct  81    PCAH-QSYGN  89



>gb|EPS69103.1| hypothetical protein M569_05665, partial [Genlisea aurea]
Length=64

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 50/70 (71%), Gaps = 13/70 (19%)
 Frame = -3

Query  1297  LQLFDRSGLLYGEFGELARFVLRILGIKTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKA  1118
             LQLFDRSG+LYGE   LARFVLRILGIKTK KKVHPP+A    G          IEGPK 
Sbjct  8     LQLFDRSGMLYGE---LARFVLRILGIKTKSKKVHPPNAAPRGGS---------IEGPK-  54

Query  1117  APSGAWDSVW  1088
              P+G+WD+VW
Sbjct  55    LPTGSWDTVW  64



>ref|XP_008809369.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Phoenix 
dactylifera]
Length=215

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQ-LFDRSG  1274
             D +NP+G PSSPP FWIS +R MQGV+NFF RI +L  Q+ QAFH+ ++ALLQ LFD S 
Sbjct  154   DTSNPYGPPSSPPAFWISFVRSMQGVINFFGRITILIVQNTQAFHMFMSALLQVLFDSSI  213

Query  1273  LL  1268
             LL
Sbjct  214   LL  215


 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -3

Query  1912  GSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvA  1733
             G++PPPKPW+R G+S GP+PFKP S G TSDVVEASGT+KPGE+VP  N   A N N V 
Sbjct  3     GNTPPPKPWDRAGTSPGPSPFKPQSSGGTSDVVEASGTAKPGEIVP-NNERNALNNNIVG  61

Query  1732  RPVPTRPWEQRQ  1697
             RP+P RPW+Q  
Sbjct  62    RPLPPRPWQQNH  73



>ref|XP_005645103.1| hypothetical protein COCSUDRAFT_43976 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20559.1| hypothetical protein COCSUDRAFT_43976 [Coccomyxa subellipsoidea 
C-169]
Length=224

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 14/110 (13%)
 Frame = -3

Query  1396  LIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRILGI  1217
             ++  + G+V+FF R++ L D++  A H  ++ALLQL DR+G LY   GELARFVLRILG 
Sbjct  124   MLHAIGGIVHFFGRLSFLVDENAHAVHFFISALLQLLDRAGSLY---GELARFVLRILGY  180

Query  1216  KTKPKKVHPPSAEGLPGPQSLQGNQHYIEGPKAAPSG-----AWDSVWGD  1082
             K KPK+        + GPQ + G    + G  AAP        WD++WG 
Sbjct  181   KGKPKE-----QSLMGGPQGMMGPPR-LPGLPAAPCAQPGAPEWDNMWGS  224



>gb|KCW81100.1| hypothetical protein EUGRSUZ_C02476 [Eucalyptus grandis]
Length=84

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  1891  PWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTRP  1712
             PWER G SSGP PFKPPS G TSD VEAS T++PGE+V   ++    N N++ARPVPTRP
Sbjct  22    PWERAGGSSGPAPFKPPSSGSTSDRVEASETARPGEIVSTTDKTIPVNANSIARPVPTRP  81

Query  1711  WEQ  1703
             WEQ
Sbjct  82    WEQ  84



>ref|XP_007033847.1| Uncharacterized protein TCM_019948 [Theobroma cacao]
 gb|EOY04773.1| Uncharacterized protein TCM_019948 [Theobroma cacao]
Length=89

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  1456  EQDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDR  1280
              +DPNNP+GAP SPPGFWIS+++V+QG+VN F R + L DQ+ +AFH+ +  L+ L  R
Sbjct  28    ARDPNNPYGAPPSPPGFWISVLQVVQGMVNVFGRTSFLIDQNTRAFHMFINFLMALVYR  86



>dbj|BAH56952.1| AT3G07560 [Arabidopsis thaliana]
Length=140

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = -3

Query  1924  SRQPGSSPPPKPWERVGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELV--Paanrntat  1751
             + QP    PPKPWE+ G++SGP PF+PPS   T+  VEASGT+ PGE+V  P    NTA 
Sbjct  2     ASQPAGGSPPKPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAA  61

Query  1750  nintvARPVPTRPWEQRQTYGNTF  1679
             N+N+++RPVP RPWEQ Q YG+T 
Sbjct  62    NMNSLSRPVPARPWEQ-QNYGSTM  84



>dbj|BAJ85612.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (77%), Gaps = 4/77 (5%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnint-vAR  1730
             PPKPWER G+  +SGP PFKPPS G TSDVVEASGT+KPGE + A  RN + N+N  ++R
Sbjct  5     PPKPWERAGAEGTSGPLPFKPPSGGSTSDVVEASGTAKPGETIAATERNMSANVNNPISR  64

Query  1729  PVPTRPWEQRQTYGNTF  1679
             P+P RPW+Q   YGN++
Sbjct  65    PMPQRPWQQ-TGYGNSY  80


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHV  1313
             DPN+ FG P++PPGFW+S +RVM G V+FF R+A L +Q+     +
Sbjct  174   DPNS-FGPPAAPPGFWVSFLRVMHGAVSFFGRVAFLVEQNTSLLFI  218



>ref|XP_003055612.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60864.1| predicted protein [Micromonas pusilla CCMP1545]
Length=443

 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 9/89 (10%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
              DPN P       P  W  ++R + G+V  F RI+ L D++ QA H  +  L+QL DR+G
Sbjct  313   DDPNGPA------PTAWQRIMRALHGIVTVFGRISWLVDENSQALHFFMMGLMQLLDRAG  366

Query  1273  LLYGEFGELARFVLRILGIKTKPKKVHPP  1187
             +LY   GELARF LR+LG K   +   PP
Sbjct  367   VLY---GELARFALRLLGYKVPDRPKAPP  392



>gb|KDD75299.1| hypothetical protein H632_c758p1 [Helicosporidium sp. ATCC 50920]
Length=323

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = -3

Query  1453  QDPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSG  1274
               PN P G P  PP  W +++  + GV++FF R++ L D++  A H  V+ALLQL DR+G
Sbjct  192   HGPNGPMG-PPIPPSGWQAMLAGLSGVMHFFGRLSFLVDENTHAVHFFVSALLQLLDRAG  250

Query  1273  LLYGEFGELARFV  1235
              LY   GELARFV
Sbjct  251   SLY---GELARFV  260



>gb|KFM22936.1| Peroxisomal membrane protein 13 [Auxenochlorella protothecoides]
Length=161

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = -3

Query  1375  VVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRILGIKTKPKKV  1196
             +++FF R++ L D++  A H  V+ALLQL DR+G LY   GELARF+LRILG++   K  
Sbjct  60    LMHFFGRLSFLVDENAHAVHFFVSALLQLLDRAGSLY---GELARFILRILGVRRAKKAG  116

Query  1195  HPPSAEGLPG  1166
                 A   PG
Sbjct  117   QALVAASGPG  126



>ref|XP_002949297.1| hypothetical protein VOLCADRAFT_104235 [Volvox carteri f. nagariensis]
 gb|EFJ49790.1| hypothetical protein VOLCADRAFT_104235 [Volvox carteri f. nagariensis]
Length=158

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = -3

Query  1399  SLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRIL  1223
             S + ++ GV++FF R++ L D++  A H  ++ALLQL DR+G LY    E+ARFVLR+L
Sbjct  4     SFMHMVNGVMHFFGRLSFLVDENTHAVHFFISALLQLLDRAGSLY---AEIARFVLRLL  59



>ref|XP_001420118.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98411.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=291

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -3

Query  1405  WISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRI  1226
             W +L+  +  VV+ F +I+ L D++ QA H  + +LLQL DR G LY   GE++R +L+ 
Sbjct  194   WQALMHSLSSVVHLFGKISFLVDENTQALHFFIMSLLQLLDRGGHLY---GEMSRILLKA  250

Query  1225  LGIKTKPK  1202
             +G    P+
Sbjct  251   MGYPVPPR  258



>ref|XP_001693517.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP08771.1| predicted protein [Chlamydomonas reinhardtii]
Length=233

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  1405  WISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRI  1226
             W   + V+ GV++FF R++ L D++  A H  ++ALLQL DR+G LY    E+ARFVLR+
Sbjct  37    WQQFMGVINGVMHFFGRLSFLVDENTHAVHFFISALLQLLDRAGSLY---AEIARFVLRL  93

Query  1225  L  1223
             L
Sbjct  94    L  94



>emb|CEF99344.1| unnamed product [Ostreococcus tauri]
Length=283

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 6/86 (7%)
 Frame = -3

Query  1405  WISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGLLYGEFGELARFVLRI  1226
             W +L++ +  VV+ F +I+ L D++ QA H  + +LL L DR G LY    EL+R +LR+
Sbjct  187   WQALMQSLSSVVHLFGKISFLVDENTQALHFFIMSLLGLLDRGGHLY---SELSRLLLRM  243

Query  1225  LGIKTKPK---KVHPPSAEGLPGPQS  1157
             +G    P+   +  PP +    GP S
Sbjct  244   MGYPVPPRPPQQFGPPPSGAYRGPSS  269



>tpg|DAA39779.1| TPA: hypothetical protein ZEAMMB73_031103 [Zea mays]
Length=358

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = -3

Query  1909  SSPPPKPWER--VGSSSGPTPFKPPSVGKTSDVVEASGTSKPGELV  1778
             +  PP PWER     +SGP PFKPPS G TSDVVEASGT+KP E V
Sbjct  100   ADSPPNPWERSRAEGASGPAPFKPPSAGSTSDVVEASGTAKPDENV  145



>ref|XP_007510404.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18749.1| predicted protein [Bathycoccus prasinos]
Length=243

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = -3

Query  1450  DPNNPFGAPSSPPGFWISLIRVMQGVVNFFSRIAMLTDQSVQAFHVGVTALLQLFDRSGL  1271
             DPN P     S    W  ++R +  VV+FF +I+ L D++ QA H  V +LL + DR  +
Sbjct  109   DPNEPVNPAMSA---WSKIMRTLSDVVHFFGKISFLVDENTQALHFFVGSLLGMLDRGHV  165

Query  1270  LYGEFGELARFVLRILG  1220
             LY    E++R VL+ LG
Sbjct  166   LY---KEMSRIVLKTLG  179



>gb|AFW87992.1| hypothetical protein ZEAMMB73_343017 [Zea mays]
Length=507

 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = -3

Query  1900  PPKPWERVGS--SSGPTPFKPPSVGKTSDVVEASGTSKPGELV  1778
             PP PWER G+  + GP PFK PS G TSDVVEASGT+KP E V
Sbjct  110   PPNPWERSGAEGAYGPAPFKSPSGGSTSDVVEASGTAKPDENV  152



>ref|XP_006859049.1| hypothetical protein AMTR_s00068p00188230 [Amborella trichopoda]
 gb|ERN20516.1| hypothetical protein AMTR_s00068p00188230 [Amborella trichopoda]
Length=145

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -3

Query  1873  SSSGPTPFKPPSVGKTSDVVEASGTSKPGELVPaanrntatnintvARPVPTRPWEQRQT  1694
             SS+G +PFKPP+ G+T+DVV ASGT+KPG  VP A  N   N N   RP P+R WEQ + 
Sbjct  3     SSAGLSPFKPPAPGRTADVVAASGTAKPG--VPVAQWNPVMNGNPAGRPQPSRAWEQNRN  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6033350497260