BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22985_g1_i3 len=1435 path=[5649:0-259 6382:260-260 1294:261-296
@1330@!:297-629 1663:630-1434]

Length=1435
                                                                      Score     E

emb|CDO99843.1|  unnamed protein product                                529   0.0      
ref|XP_009787071.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    522   0.0      
ref|XP_010312579.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    514   5e-178   
ref|XP_006360494.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    515   9e-178   
ref|XP_004250010.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    514   2e-177   
ref|XP_009602174.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    509   1e-175   
ref|XP_011077238.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    502   1e-172   
gb|EYU19767.1|  hypothetical protein MIMGU_mgv1a008792mg                494   2e-169   
gb|KDP45042.1|  hypothetical protein JCGZ_01542                         478   2e-163   
emb|CBI40198.3|  unnamed protein product                                475   7e-163   
ref|XP_007218187.1|  hypothetical protein PRUPE_ppa007690mg             477   8e-163   
ref|XP_008233244.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    475   3e-162   
ref|XP_011024279.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    476   3e-162   
ref|XP_002315350.2|  hypothetical protein POPTR_0010s23930g             475   7e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010110198.1|  mRNA cap guanine-N7 methyltransferase 2            475   8e-162   
ref|XP_008376263.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    474   8e-162   
ref|XP_010658688.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    472   1e-161   
ref|XP_010658687.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    471   1e-160   
ref|XP_009368955.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    471   2e-160   
ref|XP_009368954.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    471   2e-160   
ref|XP_008446791.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    471   8e-160   
ref|XP_010067168.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    466   3e-159   
ref|XP_007010145.1|  S-adenosyl-L-methionine-dependent methyltran...    467   7e-159   
gb|KGN52214.1|  hypothetical protein Csa_5G616340                       468   1e-158   
ref|XP_011024280.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    466   1e-158   
ref|XP_004142453.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    464   7e-158   
ref|XP_010067165.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    462   4e-157   
ref|XP_006436605.1|  hypothetical protein CICLE_v10031936mg             459   2e-156   
ref|XP_009602175.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    459   3e-156   
ref|XP_010908936.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    458   3e-155   
ref|XP_006436608.1|  hypothetical protein CICLE_v10031936mg             456   1e-154   
ref|XP_010908935.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    456   2e-154   
ref|XP_004307331.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    455   6e-154   
ref|XP_004502631.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    454   8e-154   
ref|XP_006578921.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    452   1e-153   
ref|XP_006578919.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    452   2e-153   
ref|XP_006581635.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    452   3e-153   
ref|XP_010667618.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    452   5e-153   
ref|XP_003526702.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    451   7e-153   
ref|XP_006578920.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    447   2e-151   
ref|XP_007136560.1|  hypothetical protein PHAVU_009G055100g             447   3e-151   
ref|XP_010243264.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    446   2e-150   
ref|XP_010529027.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    429   3e-144   
ref|XP_003602217.1|  mRNA cap guanine-N7 methyltransferase              429   4e-144   
ref|XP_006360495.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    425   4e-144   
ref|XP_010312581.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    424   1e-143   
emb|CDX73651.1|  BnaC08g23520D                                          427   2e-143   
ref|XP_009115930.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    425   2e-142   
emb|CDX78072.1|  BnaA09g32670D                                          425   2e-142   
ref|XP_010515676.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    423   6e-142   
ref|XP_010067169.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    421   1e-141   
ref|XP_009602176.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    419   3e-141   
ref|XP_006403826.1|  hypothetical protein EUTSA_v10010496mg             421   4e-141   
ref|XP_010067166.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    421   6e-141   
gb|AIU50867.1|  S-adenosyl-L-methionine-dependent methyltransfera...    417   6e-141   
ref|XP_010426832.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    421   8e-141   
ref|XP_010908937.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    420   1e-140   
gb|AIU50875.1|  S-adenosyl-L-methionine-dependent methyltransfera...    415   4e-140   
ref|XP_006851777.1|  hypothetical protein AMTR_s00040p00232710          420   6e-140   
ref|XP_009393125.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    419   1e-139   
ref|XP_006291397.1|  hypothetical protein CARUB_v10017536mg             417   2e-139   
ref|XP_010503952.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    416   4e-139   
ref|XP_009393124.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    417   4e-139   
ref|NP_190789.3|  S-adenosyl-L-methionine-dependent methyltransfe...    416   5e-139   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030844.1|  S-adenosyl-L-methionine-dependent methyltran...    416   7e-139   Arabidopsis thaliana [mouse-ear cress]
gb|AIU50879.1|  S-adenosyl-L-methionine-dependent methyltransfera...    412   7e-139   
ref|XP_002876130.1|  mRNA capping enzyme family protein                 414   4e-138   
dbj|BAD43168.1|  putative protein                                       414   5e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426835.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    412   9e-138   
gb|AIU50869.1|  S-adenosyl-L-methionine-dependent methyltransfera...    409   1e-137   
gb|AIU50882.1|  S-adenosyl-L-methionine-dependent methyltransfera...    405   2e-136   
gb|AIU50864.1|  S-adenosyl-L-methionine-dependent methyltransfera...    404   6e-136   
ref|NP_001048305.1|  Os02g0780600                                       406   3e-135   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74116.1|  hypothetical protein OsI_09172                          405   3e-135   Oryza sativa Indica Group [Indian rice]
gb|AIU50839.1|  S-adenosyl-L-methionine-dependent methyltransfera...    401   1e-134   
gb|AIU50865.1|  S-adenosyl-L-methionine-dependent methyltransfera...    400   4e-134   
ref|XP_006648009.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    403   5e-134   
gb|AIU50878.1|  S-adenosyl-L-methionine-dependent methyltransfera...    399   7e-134   
gb|AIU50868.1|  S-adenosyl-L-methionine-dependent methyltransfera...    397   3e-133   
gb|EEE57913.1|  hypothetical protein OsJ_08607                          399   1e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648010.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    399   2e-132   
gb|AIU50851.1|  S-adenosyl-L-methionine-dependent methyltransfera...    395   2e-132   
gb|AIU50852.1|  S-adenosyl-L-methionine-dependent methyltransfera...    395   3e-132   
gb|AIU50854.1|  S-adenosyl-L-methionine-dependent methyltransfera...    394   9e-132   
ref|XP_010426831.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    395   4e-131   
ref|XP_004976295.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    394   2e-130   
gb|AIU50859.1|  S-adenosyl-L-methionine-dependent methyltransfera...    390   2e-130   
tpg|DAA36851.1|  TPA: S-adenosylmethionine-dependent methyltransf...    392   1e-129   
gb|ACN34047.1|  unknown                                                 391   2e-129   Zea mays [maize]
gb|AIU50847.1|  S-adenosyl-L-methionine-dependent methyltransfera...    388   2e-129   
ref|XP_002446819.1|  hypothetical protein SORBIDRAFT_06g023140          391   3e-129   Sorghum bicolor [broomcorn]
ref|XP_008667195.1|  PREDICTED: hypothetical protein isoform X3         393   6e-129   
ref|XP_008667196.1|  PREDICTED: hypothetical protein isoform X4         392   1e-128   
gb|AIU50844.1|  S-adenosyl-L-methionine-dependent methyltransfera...    386   1e-128   
gb|ACG35412.1|  S-adenosylmethionine-dependent methyltransferase/...    389   1e-128   Zea mays [maize]
ref|XP_010426834.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    388   4e-128   
ref|XP_009368956.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    384   7e-128   
gb|AIU50858.1|  S-adenosyl-L-methionine-dependent methyltransfera...    382   3e-127   
gb|AIU50846.1|  S-adenosyl-L-methionine-dependent methyltransfera...    382   4e-127   
ref|XP_010240157.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    383   2e-126   
gb|AIU50853.1|  S-adenosyl-L-methionine-dependent methyltransfera...    379   5e-126   
gb|AIU50835.1|  S-adenosyl-L-methionine-dependent methyltransfera...    379   8e-126   
gb|AIU50872.1|  S-adenosyl-L-methionine-dependent methyltransfera...    377   4e-125   
ref|XP_006578922.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    377   5e-125   
gb|AIU50863.1|  S-adenosyl-L-methionine-dependent methyltransfera...    376   7e-125   
ref|XP_006436603.1|  hypothetical protein CICLE_v10031936mg             375   1e-124   
ref|XP_006436604.1|  hypothetical protein CICLE_v10031936mg             375   2e-124   
gb|AIU50841.1|  S-adenosyl-L-methionine-dependent methyltransfera...    374   5e-124   
gb|AIU50856.1|  S-adenosyl-L-methionine-dependent methyltransfera...    373   1e-123   
gb|AIU50880.1|  S-adenosyl-L-methionine-dependent methyltransfera...    373   1e-123   
gb|AIU50855.1|  S-adenosyl-L-methionine-dependent methyltransfera...    372   2e-123   
gb|AIU50862.1|  S-adenosyl-L-methionine-dependent methyltransfera...    371   9e-123   
gb|AIU50842.1|  S-adenosyl-L-methionine-dependent methyltransfera...    370   2e-122   
gb|AIU50873.1|  S-adenosyl-L-methionine-dependent methyltransfera...    369   4e-122   
tpg|DAA36850.1|  TPA: hypothetical protein ZEAMMB73_136245              373   9e-122   
ref|NP_001132200.1|  hypothetical protein                               373   1e-121   Zea mays [maize]
ref|XP_008667193.1|  PREDICTED: hypothetical protein isoform X1         374   5e-121   
ref|XP_008667194.1|  PREDICTED: hypothetical protein isoform X2         374   7e-121   
gb|AIU50860.1|  S-adenosyl-L-methionine-dependent methyltransfera...    365   2e-120   
gb|AIU50861.1|  S-adenosyl-L-methionine-dependent methyltransfera...    364   3e-120   
gb|AIU50877.1|  S-adenosyl-L-methionine-dependent methyltransfera...    361   5e-119   
gb|AIU50837.1|  S-adenosyl-L-methionine-dependent methyltransfera...    360   8e-119   
gb|ACF83829.1|  unknown                                                 362   2e-118   Zea mays [maize]
gb|AIU50849.1|  S-adenosyl-L-methionine-dependent methyltransfera...    359   3e-118   
gb|AIU50845.1|  S-adenosyl-L-methionine-dependent methyltransfera...    358   6e-118   
gb|AIU50884.1|  S-adenosyl-L-methionine-dependent methyltransfera...    357   2e-117   
gb|AIU50836.1|  S-adenosyl-L-methionine-dependent methyltransfera...    357   3e-117   
gb|AIU50870.1|  S-adenosyl-L-methionine-dependent methyltransfera...    356   4e-117   
gb|AIU50874.1|  S-adenosyl-L-methionine-dependent methyltransfera...    355   9e-117   
ref|XP_002533936.1|  mRNA (guanine-7-)methyltransferase, putative       353   5e-116   Ricinus communis
gb|AIU50840.1|  S-adenosyl-L-methionine-dependent methyltransfera...    353   8e-116   
gb|AIU50885.1|  S-adenosyl-L-methionine-dependent methyltransfera...    350   8e-115   
gb|AIU50876.1|  S-adenosyl-L-methionine-dependent methyltransfera...    346   5e-113   
tpg|DAA36848.1|  TPA: hypothetical protein ZEAMMB73_136245              349   5e-112   
ref|NP_001030843.1|  S-adenosyl-L-methionine-dependent methyltran...    337   1e-109   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18036.1|  unknown                                                 335   4e-109   Glycine max [soybeans]
gb|EMT21912.1|  mRNA cap guanine-N7 methyltransferase 2                 332   2e-106   
gb|AIU50888.1|  S-adenosyl-L-methionine-dependent methyltransfera...    322   4e-104   
emb|CAB41341.1|  putative protein                                       308   7e-97    Arabidopsis thaliana [mouse-ear cress]
gb|ABK24280.1|  unknown                                                 316   2e-96    Picea sitchensis
emb|CAN61601.1|  hypothetical protein VITISV_013027                     311   5e-96    Vitis vinifera
gb|AIU50871.1|  S-adenosyl-L-methionine-dependent methyltransfera...    285   2e-90    
gb|AIU50857.1|  S-adenosyl-L-methionine-dependent methyltransfera...    284   9e-90    
gb|KHG12995.1|  hypothetical protein F383_17234                         286   4e-89    
ref|XP_001784495.1|  predicted protein                                  254   2e-77    
gb|AIU50881.1|  S-adenosyl-L-methionine-dependent methyltransfera...    245   3e-75    
gb|AFW68041.1|  hypothetical protein ZEAMMB73_002313                    236   4e-71    
ref|XP_008646540.1|  PREDICTED: uncharacterized protein LOC103628030    239   2e-69    
gb|AIU50843.1|  S-adenosyl-L-methionine-dependent methyltransfera...    223   5e-67    
gb|EMS65843.1|  mRNA cap guanine-N7 methyltransferase 2                 213   3e-61    
gb|AIU50887.1|  S-adenosyl-L-methionine-dependent methyltransfera...    202   3e-59    
ref|XP_002974031.1|  hypothetical protein SELMODRAFT_414216             205   3e-54    
gb|AIU50866.1|  S-adenosyl-L-methionine-dependent methyltransfera...    177   8e-50    
ref|XP_008779406.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    170   3e-47    
dbj|GAM16871.1|  hypothetical protein SAMD00019534_000460               168   1e-44    
gb|EPS64069.1|  hypothetical protein M569_10714                         142   2e-37    
ref|XP_008646312.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    130   1e-32    
gb|AIU50848.1|  S-adenosyl-L-methionine-dependent methyltransfera...    129   3e-32    
gb|EFA77214.1|  hypothetical protein PPL_12423                          132   5e-32    Heterostelium album PN500
gb|AIU50838.1|  S-adenosyl-L-methionine-dependent methyltransfera...    125   3e-31    
ref|XP_006485235.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    126   8e-31    
gb|AIU50886.1|  S-adenosyl-L-methionine-dependent methyltransfera...    124   9e-31    
gb|AIU50883.1|  S-adenosyl-L-methionine-dependent methyltransfera...    118   2e-28    
ref|XP_636615.1|  hypothetical protein DDB_G0288673                     117   3e-26    Dictyostelium discoideum AX4
ref|XP_008652626.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    109   3e-25    
ref|XP_003292737.1|  hypothetical protein DICPUDRAFT_89950              114   4e-25    
ref|XP_003384780.1|  PREDICTED: hypothetical protein LOC100638295       116   3e-24    
gb|ACN25940.1|  unknown                                                 107   1e-23    Zea mays [maize]
ref|XP_004336754.1|  mRNA cap guanineN7 methyltransferase               109   2e-23    
ref|XP_004361416.1|  hypothetical protein DFA_05698                     108   9e-23    
gb|KFH64894.1|  hypothetical protein MVEG_09622                         107   2e-22    
ref|XP_005713890.1|  unnamed protein product                            109   2e-22    
ref|XP_005837438.1|  hypothetical protein GUITHDRAFT_46422              104   6e-22    
ref|XP_010253752.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    106   6e-22    
gb|ESA23124.1|  hypothetical protein GLOINDRAFT_60236                   104   1e-21    
gb|EHJ64133.1|  putative mrna (guanine-7-)methyltransferase             105   2e-21    
gb|EXX66554.1|  hypothetical protein RirG_122710                        104   2e-21    
ref|XP_002051506.1|  GJ11848                                            105   3e-21    Drosophila virilis
gb|EMS52353.1|  mRNA cap guanine-N7 methyltransferase 1                 103   4e-21    
emb|CEG74798.1|  Putative mRNA cap guanine-N7 methyltransferase         103   4e-21    
ref|XP_006843480.1|  hypothetical protein AMTR_s00053p00199490          103   7e-21    
emb|CEG77672.1|  Putative mRNA cap guanine-N7 methyltransferase         102   7e-21    
gb|EMT00917.1|  mRNA cap guanine-N7 methyltransferase 1                 103   9e-21    
emb|CEI94856.1|  Putative mRNA cap guanine-N7 methyltransferase         102   9e-21    
ref|XP_010253751.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    102   1e-20    
ref|XP_003573408.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    102   2e-20    
ref|XP_011097946.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    101   3e-20    
ref|XP_010253750.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    101   4e-20    
ref|XP_004246767.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    101   4e-20    
ref|XP_002283163.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    100   5e-20    Vitis vinifera
ref|XP_006659891.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    100   5e-20    
ref|XP_002066486.1|  GK18308                                            101   6e-20    Drosophila willistoni
gb|EMT24712.1|  mRNA cap guanine-N7 methyltransferase 1                 100   8e-20    
ref|XP_010062933.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    100   9e-20    
ref|XP_002528402.1|  mRNA (guanine-7-)methyltransferase, putative       100   9e-20    Ricinus communis
ref|NP_001061136.1|  Os08g0180000                                       100   1e-19    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05808.1|  hypothetical protein OsI_28045                          100   1e-19    Oryza sativa Indica Group [Indian rice]
ref|XP_009412669.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    100   1e-19    
ref|XP_010931870.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...    100   1e-19    
gb|KHN82523.1|  mRNA cap guanine-N7 methyltransferase                   102   1e-19    
ref|XP_005537778.1|  mRNA (guanine-7-)methyltransferase               99.8    1e-19    
dbj|BAJ98497.1|  predicted protein                                    99.4    2e-19    
gb|ACN40623.1|  unknown                                               99.4    2e-19    Picea sitchensis
ref|XP_010234336.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  99.4    2e-19    
ref|NP_001149962.1|  mRNA                                             99.4    2e-19    Zea mays [maize]
ref|XP_004972710.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  99.0    2e-19    
ref|XP_001987970.1|  GH10912                                          99.8    2e-19    Drosophila grimshawi
ref|XP_008454587.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  99.0    2e-19    
ref|XP_004151971.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  99.0    3e-19    
ref|XP_003699309.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  99.8    3e-19    
ref|XP_001961496.1|  GF14902                                          99.4    3e-19    Drosophila ananassae
ref|XP_010234337.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  97.8    3e-19    
ref|XP_002587527.1|  hypothetical protein BRAFLDRAFT_156010           97.4    3e-19    Branchiostoma floridae
ref|XP_004235844.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  98.6    4e-19    
ref|XP_002089335.1|  GE19056                                          99.4    4e-19    Drosophila yakuba
ref|XP_001968929.1|  GG25137                                          99.0    5e-19    Drosophila erecta
tpg|DAA50954.1|  TPA: hypothetical protein ZEAMMB73_770353            97.8    5e-19    
gb|EFN84098.1|  mRNA cap guanine-N7 methyltransferase                 97.4    6e-19    
ref|XP_002464010.1|  hypothetical protein SORBIDRAFT_01g010530        97.4    7e-19    Sorghum bicolor [broomcorn]
ref|XP_010253749.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  97.8    7e-19    
gb|EFA03004.1|  hypothetical protein TcasGA2_TC010427                 96.7    7e-19    
ref|XP_011095296.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  97.1    8e-19    
ref|XP_011095295.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  97.4    9e-19    
ref|XP_002018845.1|  GL26022                                          97.8    9e-19    Drosophila persimilis
ref|XP_009419607.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  97.4    9e-19    
ref|XP_001357357.2|  GA17612                                          97.8    1e-18    Drosophila pseudoobscura pseudoobscura
ref|XP_002987067.1|  hypothetical protein SELMODRAFT_158424           96.7    1e-18    
gb|KFK39384.1|  hypothetical protein AALP_AA3G238000                  97.1    1e-18    
emb|CDP05825.1|  unnamed protein product                              96.7    1e-18    
ref|XP_007021149.1|  MRNA capping enzyme family protein isoform 2     96.3    1e-18    
ref|XP_009110293.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  96.7    1e-18    
emb|CDY53618.1|  BnaA01g25610D                                        96.7    1e-18    
ref|XP_009614611.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  96.7    2e-18    
gb|EPB83352.1|  hypothetical protein HMPREF1544_09885                 95.9    2e-18    
ref|XP_002002342.1|  GI13226                                          97.1    2e-18    Drosophila mojavensis
ref|XP_002985502.1|  hypothetical protein SELMODRAFT_424575           96.3    2e-18    
ref|XP_007021148.1|  MRNA capping enzyme family protein isoform 1     96.3    2e-18    
ref|XP_005107770.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  96.7    2e-18    
gb|EMS47623.1|  mRNA cap guanine-N7 methyltransferase 1               97.1    2e-18    
ref|XP_008200424.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  96.7    2e-18    
ref|XP_005107771.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  96.3    2e-18    
ref|XP_009796829.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  95.9    3e-18    
ref|XP_008365909.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  95.5    3e-18    
ref|XP_004294320.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  95.5    3e-18    
ref|XP_002445157.1|  hypothetical protein SORBIDRAFT_07g005000        95.5    4e-18    Sorghum bicolor [broomcorn]
ref|XP_002127709.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  95.9    4e-18    Ciona intestinalis [sea vase]
emb|CDY43068.1|  BnaCnng10740D                                        95.1    5e-18    
gb|EIE77819.1|  hypothetical protein RO3G_02523                       95.1    5e-18    
ref|XP_006678461.1|  hypothetical protein BATDEDRAFT_24462            95.1    5e-18    
emb|CCH40561.1|  mRNA cap guanine-N7 methyltransferase                96.3    6e-18    
gb|KEH24710.1|  mRNA cap guanine-N7 methyltransferase                 94.7    6e-18    
ref|XP_010545558.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  94.7    7e-18    
gb|KEH24709.1|  mRNA cap guanine-N7 methyltransferase                 94.7    7e-18    
emb|CDY29449.1|  BnaC05g32210D                                        94.7    7e-18    
emb|CDS05349.1|  hypothetical protein LRAMOSA07878                    94.0    7e-18    
ref|XP_010466267.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  94.4    8e-18    
ref|XP_002885392.1|  mRNA capping enzyme family protein               94.4    9e-18    
gb|ERG85035.1|  mrna cap guanine-n7 methyltransferase                 95.9    1e-17    
ref|XP_009614613.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  94.0    1e-17    
ref|XP_002508889.1|  predicted protein                                93.2    1e-17    Micromonas commoda
ref|NP_523568.2|  lethal (2) 35Bd                                     94.7    1e-17    Drosophila melanogaster
gb|EYU33581.1|  hypothetical protein MIMGU_mgv1a008429mg              94.0    1e-17    
ref|XP_009145603.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  94.0    1e-17    
ref|XP_002894293.1|  mRNA capping enzyme family protein               94.0    1e-17    
gb|EFX85802.1|  hypothetical protein DAPPUDRAFT_45556                 93.6    1e-17    
emb|CDY19618.1|  BnaA05g20260D                                        94.0    1e-17    
ref|XP_010509183.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  93.6    2e-17    
ref|XP_006297940.1|  hypothetical protein CARUB_v10013983mg           93.6    2e-17    
ref|XP_010488052.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  93.6    2e-17    
gb|KHG00186.1|  hypothetical protein F383_20413                       93.6    2e-17    
emb|CDQ04724.1|  Protein BM-TAG-72, isoform b                         93.6    2e-17    
ref|XP_004521012.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  94.7    2e-17    
ref|XP_008226794.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  93.6    2e-17    
ref|XP_002035870.1|  GM15862                                          94.4    2e-17    Drosophila sechellia
ref|XP_002079506.1|  GD23987                                          94.0    2e-17    Drosophila simulans
ref|XP_011063917.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  94.0    2e-17    
gb|KDR24008.1|  mRNA cap guanine-N7 methyltransferase                 94.0    3e-17    
ref|NP_188701.2|  mRNA cap guanine-N7 methyltransferase 1             92.8    3e-17    Arabidopsis thaliana [mouse-ear cress]
gb|EPS61393.1|  hypothetical protein M569_13404                       92.4    3e-17    
dbj|BAO38694.1|  mRNA cap guanine-N7 methyltransferase                93.2    3e-17    
ref|NP_974346.1|  mRNA cap guanine-N7 methyltransferase 1             92.4    4e-17    
ref|XP_001847275.1|  mRNA cap guanine-N7 methyltransferase            93.6    4e-17    
gb|KDQ18455.1|  hypothetical protein BOTBODRAFT_171303                94.4    4e-17    
ref|XP_011063910.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  93.6    4e-17    
gb|EFN69462.1|  mRNA cap guanine-N7 methyltransferase                 93.2    5e-17    
ref|XP_009419606.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  92.4    5e-17    
ref|XP_007211459.1|  hypothetical protein PRUPE_ppa007365mg           92.0    6e-17    
ref|XP_007764294.1|  guanine-N(7)-methyltransferase                   92.0    6e-17    
emb|CCA69844.1|  related to RNA (guanine-N7-) methyltransferase       92.4    6e-17    
ref|XP_001655637.1|  mrna (guanine-7-)methyltransferase               92.4    7e-17    
ref|XP_009355555.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  91.7    8e-17    
ref|XP_004515076.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  91.7    8e-17    
ref|XP_001419872.1|  predicted protein                                91.7    9e-17    
ref|XP_006406362.1|  hypothetical protein EUTSA_v10020966mg           91.3    1e-16    
emb|CDO95804.1|  unnamed protein product                              91.7    1e-16    
gb|KGN57943.1|  hypothetical protein Csa_3G402470                     91.7    1e-16    
gb|KDP38721.1|  hypothetical protein JCGZ_04074                       91.3    2e-16    
gb|KDQ33531.1|  hypothetical protein PLEOSDRAFT_1080721               90.9    2e-16    
ref|XP_003626016.1|  mRNA cap guanine-N7 methyltransferase            90.5    2e-16    
ref|XP_003697237.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  91.3    2e-16    
ref|XP_002317555.1|  mRNA capping enzyme family protein               90.5    2e-16    
gb|KFM66263.1|  mRNA cap guanine-N7 methyltransferase                 89.7    2e-16    
ref|XP_006614134.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  91.3    2e-16    
ref|XP_010092274.1|  mRNA cap guanine-N7 methyltransferase 1          90.1    2e-16    
ref|XP_008359294.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  90.1    2e-16    
emb|CDH52329.1|  mrna (guanine-n7-)-methyltransferase                 89.4    3e-16    
ref|XP_003527304.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  90.1    3e-16    
ref|XP_003398904.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  90.9    3e-16    
ref|XP_003081423.1|  P0455A11.11 gene product (ISS)                   90.1    3e-16    
ref|XP_011030909.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  89.7    3e-16    
ref|XP_007133037.1|  hypothetical protein PHAVU_011G146000g           89.7    3e-16    
ref|XP_010230030.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  89.4    4e-16    
gb|EZA62748.1|  mRNA cap guanine-N7 methyltransferase                 90.5    4e-16    
gb|KFD51999.1|  hypothetical protein M513_07131                       90.1    4e-16    
ref|XP_003487207.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  90.1    5e-16    
gb|KFD71384.1|  hypothetical protein M514_16316                       89.0    6e-16    
gb|KFD52001.1|  hypothetical protein M513_07133                       88.6    6e-16    
ref|XP_003293647.1|  hypothetical protein DICPUDRAFT_42334            89.7    7e-16    
ref|XP_006452120.1|  hypothetical protein CICLE_v10008689mg           89.0    7e-16    
gb|KHJ48936.1|  mRNA capping enzyme, large subunit                    88.6    7e-16    
ref|XP_455559.1|  hypothetical protein                                89.7    7e-16    
ref|XP_001632609.1|  predicted protein                                87.8    7e-16    
ref|XP_001761591.1|  predicted protein                                88.2    8e-16    
ref|XP_006566407.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  89.4    9e-16    
ref|XP_005948865.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  88.2    9e-16    
ref|XP_004923021.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  88.6    1e-15    
ref|XP_003743272.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  87.8    1e-15    
ref|XP_005465352.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  87.0    1e-15    
ref|XP_005816227.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  87.8    1e-15    
gb|EPT00087.1|  mRNA-methyltransferase                                89.0    1e-15    
ref|XP_003531699.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  87.8    1e-15    
ref|XP_004259013.1|  mRNA cap guanine-N7 methyltransferase, putative  86.3    2e-15    
gb|EGA63219.1|  Abd1p                                                 87.8    2e-15    
ref|XP_009058451.1|  hypothetical protein LOTGIDRAFT_122655           87.0    2e-15    
gb|EGA79959.1|  Abd1p                                                 87.8    2e-15    
gb|EDV11879.1|  RNA (guanine-7-)methyltransferase                     87.8    2e-15    
gb|EIW12174.1|  Abd1p                                                 87.8    2e-15    
ref|XP_009265802.1|  mRNA cap guanine-N7 methyltransferase            89.0    3e-15    
ref|NP_009795.3|  Abd1p                                               87.8    3e-15    
gb|AAT92789.1|  YBR236C                                               87.8    3e-15    
gb|EMS25039.1|  mRNA (guanine-N7-)-methyltransferase                  87.4    3e-15    
ref|XP_002428646.1|  methyltransferase, putative                      87.0    3e-15    
ref|XP_005744767.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.7    3e-15    
gb|EHN03572.1|  Abd1p                                                 87.4    3e-15    
ref|XP_008793622.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.7    3e-15    
ref|XP_006795292.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  87.0    4e-15    
gb|EWG97428.1|  Abd1p                                                 87.4    4e-15    
dbj|GAA21782.1|  K7_Abd1p                                             87.4    4e-15    
gb|EDZ73662.1|  YBR236Cp-like protein                                 87.4    4e-15    
ref|XP_003747248.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.3    4e-15    
ref|XP_007578311.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.5    4e-15    
gb|KFK36597.1|  hypothetical protein AALP_AA4G144400                  85.5    4e-15    
ref|XP_004564476.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.7    5e-15    
gb|EOB02292.1|  mRNA cap guanine-N7 methyltransferase                 85.5    6e-15    
emb|CCA39514.1|  mRNA (guanine-N7-)-methyltransferase                 87.0    6e-15    
ref|XP_003459706.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.3    6e-15    
ref|XP_008036947.1|  hypothetical protein TRAVEDRAFT_64128            87.8    6e-15    
ref|XP_007254739.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.9    6e-15    
ref|XP_010288990.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.9    7e-15    
ref|XP_010146810.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.3    7e-15    
ref|XP_010113505.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  86.3    7e-15    
gb|KFQ74708.1|  mRNA cap guanine-N7 methyltransferase                 85.1    8e-15    
ref|XP_009507022.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.5    8e-15    
tpg|DAA50953.1|  TPA: hypothetical protein ZEAMMB73_770353            83.6    8e-15    
gb|KFV92051.1|  mRNA cap guanine-N7 methyltransferase                 86.3    8e-15    
ref|XP_007345685.1|  guanine-N(7)-methyltransferase                   86.3    9e-15    
ref|XP_006958426.1|  guanine-N(7)-methyltransferase                   85.5    9e-15    
emb|CDW57807.1|  mRNA cap guanine N7 methyltransferase                85.1    1e-14    
ref|XP_002673081.1|  predicted protein                                85.9    1e-14    
ref|XP_003677788.1|  hypothetical protein NCAS_0H01290                85.9    1e-14    
gb|ACI49224.1|  hypothetical protein Csp3_JD05.009                    84.7    1e-14    
ref|XP_006365592.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    1e-14    
ref|XP_002414685.1|  mRNA cap methyltransferase, putative             85.1    1e-14    
ref|XP_005018253.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.1    1e-14    
gb|KFP22009.1|  mRNA cap guanine-N7 methyltransferase                 85.5    1e-14    
ref|XP_009976329.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.5    1e-14    
ref|XP_009644498.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.5    1e-14    
ref|XP_010307347.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  85.5    2e-14    
gb|KFO14118.1|  mRNA cap guanine-N7 methyltransferase                 85.1    2e-14    
gb|EMC81662.1|  mRNA cap guanine-N7 methyltransferase                 84.0    2e-14    
ref|NP_001038465.1|  mRNA cap guanine-N7 methyltransferase            85.1    2e-14    
gb|AAI34974.1|  Si:ch211-105d11.3                                     84.7    2e-14    
ref|XP_004180370.1|  hypothetical protein TBLA_0D03510                85.1    2e-14    
ref|XP_010694292.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.0    3e-14    
gb|EDL09613.1|  RNA (guanine-7-) methyltransferase, isoform CRA_c     83.6    3e-14    
ref|XP_007863022.1|  mRNA guanine-N 7-methyltransferase               84.3    3e-14    
ref|XP_010707076.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    3e-14    
ref|XP_004207444.1|  PREDICTED: LOW QUALITY PROTEIN: mRNA cap gua...  85.1    3e-14    
ref|XP_009908204.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    3e-14    
gb|KFU96625.1|  mRNA cap guanine-N7 methyltransferase                 84.7    3e-14    
gb|KFV62479.1|  mRNA cap guanine-N7 methyltransferase                 84.3    3e-14    
ref|XP_010005182.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    3e-14    
gb|KFV50603.1|  mRNA cap guanine-N7 methyltransferase                 84.3    3e-14    
gb|KFP60187.1|  mRNA cap guanine-N7 methyltransferase                 83.6    3e-14    
ref|XP_008359295.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.0    3e-14    
gb|KFZ68134.1|  mRNA cap guanine-N7 methyltransferase                 84.3    3e-14    
ref|XP_005241332.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    3e-14    
gb|KFW63339.1|  mRNA cap guanine-N7 methyltransferase                 84.3    3e-14    
gb|KFV98352.1|  mRNA cap guanine-N7 methyltransferase                 84.3    4e-14    
ref|XP_009585226.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    4e-14    
gb|AAT40464.1|  mRNA 5' cap-methyltransferase                         84.7    4e-14    
gb|KFO81419.1|  mRNA cap guanine-N7 methyltransferase                 84.3    4e-14    
ref|XP_008420586.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.0    4e-14    
gb|KHG00185.1|  hypothetical protein F383_20413                       84.0    4e-14    
ref|XP_009316795.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    4e-14    
ref|XP_009566298.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.3    4e-14    
ref|XP_008329051.1|  PREDICTED: LOW QUALITY PROTEIN: mRNA cap gua...  83.6    4e-14    
ref|XP_007510568.1|  predicted protein                                84.0    4e-14    
ref|XP_419132.1|  PREDICTED: mRNA cap guanine-N7 methyltransferas...  84.0    5e-14    
ref|XP_009965003.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.0    5e-14    
ref|XP_008288787.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.6    5e-14    
ref|XP_009705715.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    5e-14    
ref|XP_010080499.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.6    5e-14    
ref|XP_005356296.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.0    6e-14    
ref|XP_003375274.1|  mRNA cap guanine-N7 methyltransferase            82.8    6e-14    
ref|XP_005510881.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.6    6e-14    
gb|EDM14756.1|  RNA (guanine-7-) methyltransferase, isoform CRA_d     82.8    6e-14    
ref|XP_007364685.1|  hypothetical protein DICSQDRAFT_135582           84.7    6e-14    
ref|XP_005510882.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.6    6e-14    
ref|XP_011030910.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    6e-14    
ref|XP_007410069.1|  hypothetical protein MELLADRAFT_36007            81.6    6e-14    
ref|XP_006164127.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  84.0    7e-14    
emb|CAG11655.1|  unnamed protein product                              82.4    7e-14    
ref|XP_008940486.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    7e-14    
ref|XP_010140605.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    7e-14    
emb|CDR40123.1|  CYFA0S04e04082g1_1                                   84.0    7e-14    
ref|XP_008628301.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    8e-14    
gb|EGT45145.1|  hypothetical protein CAEBREN_25445                    82.8    8e-14    
gb|KFV00995.1|  mRNA cap guanine-N7 methyltransferase                 83.2    8e-14    
ref|XP_009937237.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    8e-14    
ref|XP_006970144.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.6    8e-14    
gb|KFQ19038.1|  mRNA cap guanine-N7 methyltransferase                 83.2    8e-14    
ref|XP_010080498.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    8e-14    
gb|KFR14203.1|  mRNA cap guanine-N7 methyltransferase                 82.8    9e-14    
gb|KFR03335.1|  mRNA cap guanine-N7 methyltransferase                 82.8    1e-13    
ref|XP_002683266.1|  predicted protein                                81.6    1e-13    
ref|NP_080716.1|  mRNA cap guanine-N7 methyltransferase isoform 1     83.2    1e-13    
ref|XP_008824145.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    1e-13    
ref|XP_009915343.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    1e-13    
ref|XP_002187753.2|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  80.9    1e-13    
gb|KDO74405.1|  hypothetical protein CISIN_1g017369mg                 80.1    1e-13    
gb|KFO56375.1|  mRNA cap guanine-N7 methyltransferase                 82.4    1e-13    
ref|XP_009887362.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.8    1e-13    
gb|EDL09611.1|  RNA (guanine-7-) methyltransferase, isoform CRA_a     82.8    1e-13    
ref|XP_005517347.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.8    1e-13    
ref|XP_007422870.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    1e-13    
dbj|BAC97940.1|  mKIAA0398 protein                                    82.8    1e-13    
ref|XP_004073799.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    1e-13    
ref|XP_005153513.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    1e-13    
ref|XP_003219750.2|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  83.2    1e-13    
gb|KFP93956.1|  mRNA cap guanine-N7 methyltransferase                 82.4    1e-13    
ref|XP_009915346.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    1e-13    
ref|XP_009468972.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    1e-13    
gb|KFQ20079.1|  mRNA cap guanine-N7 methyltransferase                 82.4    1e-13    
ref|XP_010191715.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    1e-13    
gb|KDO74404.1|  hypothetical protein CISIN_1g017369mg                 80.5    1e-13    
gb|ENN71965.1|  hypothetical protein YQE_11399                        82.8    1e-13    
gb|AEE62767.1|  unknown                                               82.8    1e-13    
gb|ACI49108.1|  hypothetical protein Cbre_JD13.010                    82.0    1e-13    
ref|XP_008106926.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.8    1e-13    
ref|XP_009867052.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    2e-13    
emb|CCK72920.1|  hypothetical protein KNAG_0M00670                    82.4    2e-13    
ref|XP_007422867.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    2e-13    
gb|EJT46986.1|  hypothetical protein A1Q1_04229                       83.2    2e-13    
gb|EKD03654.1|  mRNA (guanine-N7-)-methyltransferase                  83.2    2e-13    
ref|XP_005334940.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    2e-13    
gb|KFP76507.1|  mRNA cap guanine-N7 methyltransferase                 82.0    2e-13    
gb|KFP96267.1|  mRNA cap guanine-N7 methyltransferase                 82.0    2e-13    
ref|XP_005415218.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  79.7    2e-13    
emb|CCJ29693.1|  unnamed protein product                              82.0    2e-13    
ref|XP_009069127.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.0    2e-13    
ref|XP_001602514.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.4    2e-13    
ref|XP_007874049.1|  hypothetical protein PNEG_02068                  82.0    2e-13    
ref|XP_005187370.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.0    2e-13    
ref|NP_001082004.1|  mRNA cap guanine-N7 methyltransferase            81.6    2e-13    
ref|XP_009959375.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.6    2e-13    
ref|XP_010205620.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.6    3e-13    
gb|KFO97383.1|  mRNA cap guanine-N7 methyltransferase                 81.6    3e-13    
gb|KFP26949.1|  mRNA cap guanine-N7 methyltransferase                 81.3    3e-13    
ref|XP_004620190.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.6    3e-13    
ref|XP_002187444.2|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.0    3e-13    
sp|Q9I8S2.1|MCES_XENLA  RecName: Full=mRNA cap guanine-N7 methylt...  81.3    3e-13    
pdb|3BGV|A  Chain A, Crystal Structure Of Mrna Cap Guanine-N7 Met...  80.1    3e-13    
ref|XP_008469762.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  82.0    3e-13    
ref|XP_005996577.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.3    3e-13    
emb|CDO74870.1|  hypothetical protein BN946_scf185004.g20             82.0    4e-13    
ref|XP_008503727.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.3    4e-13    
ref|XP_003760131.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.6    4e-13    
ref|NP_001017053.1|  mRNA cap guanine-N7 methyltransferase            80.9    4e-13    
ref|XP_003679747.1|  hypothetical protein TDEL_0B04070                81.3    4e-13    
ref|XP_009282358.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  80.9    4e-13    
gb|KFM10780.1|  mRNA cap guanine-N7 methyltransferase                 80.9    4e-13    
ref|XP_003035950.1|  hypothetical protein SCHCODRAFT_51792            81.3    4e-13    
ref|XP_003800513.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  81.3    4e-13    
ref|XP_008779343.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  76.3    5e-13    
gb|KDE06696.1|  hypothetical protein MVLG_03042                       80.9    5e-13    
ref|XP_007301337.1|  hypothetical protein STEHIDRAFT_166579           81.6    5e-13    
ref|NP_001008300.1|  mRNA cap guanine-N7 methyltransferase            80.9    5e-13    
ref|XP_009493050.1|  hypothetical protein H696_00888                  80.9    6e-13    
ref|XP_004310527.1|  PREDICTED: mRNA cap guanine-N7 methyltransfe...  79.0    6e-13    



>emb|CDO99843.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 281/322 (87%), Gaps = 3/322 (1%)
 Frame = -2

Query  1236  ATSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGH  1057
             A S+P    R  +ES HHRLI++VK ALIKIFVSPYATVCELYCGKV DE+KWD+AQIGH
Sbjct  3     AGSYP--GQRILSESTHHRLIEVVKTALIKIFVSPYATVCELYCGKVADEDKWDDAQIGH  60

Query  1056  YIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQ  877
             YIGIDV TSG+ E +EAWESQRK YT++  E++PCTED+  HLQDK+ QAD++ C+H+LQ
Sbjct  61    YIGIDVGTSGVGEVREAWESQRKSYTSDFFELEPCTEDISLHLQDKEIQADVICCLHHLQ  120

Query  876   LCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVP  697
             LCFE+E+KA++LLHNVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHNK SGMKPNIVP
Sbjct  121   LCFETEDKAKRLLHNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNKSSGMKPNIVP  180

Query  696   NCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIE  517
             NCIRSESY I FEVEEEKFPFFGKKYQ+KFAN+ISAET CLVHFPSLIRLAREAGL+Y+E
Sbjct  181   NCIRSESYMITFEVEEEKFPFFGKKYQLKFANEISAETHCLVHFPSLIRLAREAGLEYVE  240

Query  516   IQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPL  337
             IQNLTDFYDD R QF GMLQD  HN +DPRGRLLPR+YDVLGLFTTF+FQKPDPDI PPL
Sbjct  241   IQNLTDFYDDNRAQFAGMLQDSGHNFVDPRGRLLPRSYDVLGLFTTFIFQKPDPDIGPPL  300

Query  336   MTPFIV-RRNNDDEASEYHSTK  274
             MTP +    +N+DEAS Y+  K
Sbjct  301   MTPVLEDGSHNNDEASLYNIGK  322



>ref|XP_009787071.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Nicotiana 
sylvestris]
Length=356

 Score =   522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/301 (81%), Positives = 271/301 (90%), Gaps = 1/301 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             ES HHRL+D VK ALIKIFVSPYATVC++YCGKV D EKWDEA+IGHYIGIDVATSG+NE
Sbjct  10    ESTHHRLLDFVKTALIKIFVSPYATVCDMYCGKVADVEKWDEARIGHYIGIDVATSGVNE  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              KEAWESQRK YT+E IE+DPC ED+ ++ QDK+ QADIVFCMHNLQ+CF+SEEKAR+LL
Sbjct  70    VKEAWESQRKAYTSEFIELDPCIEDIDSYWQDKEKQADIVFCMHNLQVCFDSEEKARRLL  129

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
             HNVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+   MKPNIVPNCIRSE+Y I+FE
Sbjct  130   HNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGAMKPNIVPNCIRSENYMISFE  189

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             VEEEKFPFFGKKYQ+KFA+DISAET CLVHFPSL+RLAREAGL+Y EIQNLTDFYDD R 
Sbjct  190   VEEEKFPFFGKKYQLKFASDISAETYCLVHFPSLLRLAREAGLEYTEIQNLTDFYDDNRA  249

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI-VRRNNDD  301
             Q +GMLQD  HN+IDPRGRLLPR+YDVLGLFTTF+FQKPDPDI PPL TPF+ V  +N D
Sbjct  250   QVLGMLQDAGHNIIDPRGRLLPRSYDVLGLFTTFIFQKPDPDIAPPLTTPFLPVGSHNPD  309

Query  300   E  298
             E
Sbjct  310   E  310



>ref|XP_010312579.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Solanum lycopersicum]
Length=318

 Score =   514 bits (1323),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 241/309 (78%), Positives = 270/309 (87%), Gaps = 3/309 (1%)
 Frame = -2

Query  1248  MIPPATSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEA  1069
             M+  A SFPI  HRP  ES HHRL+D VK  LI IFVSPYATVC++YCGKVPD EKWDEA
Sbjct  1     MMMMANSFPI--HRP-AESTHHRLLDFVKNVLIGIFVSPYATVCDMYCGKVPDVEKWDEA  57

Query  1068  QIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCM  889
             QIGHYIGIDV  SG+NE KEAWESQRK YT+E IE+D C ED+++  +DK+ QAD+VFCM
Sbjct  58    QIGHYIGIDVEASGVNEVKEAWESQRKAYTSEFIELDLCIEDIESFWKDKEKQADVVFCM  117

Query  888   HNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKP  709
             HNLQ CF+SEEKAR+LLHNVS+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+  GMKP
Sbjct  118   HNLQACFDSEEKARRLLHNVSALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGGMKP  177

Query  708   NIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGL  529
             NIVP+CIRSE+Y I FEVEEEKFPFFGKKYQ+KFA+DISAETQCLVHFPSL+RLAREAGL
Sbjct  178   NIVPSCIRSENYMITFEVEEEKFPFFGKKYQLKFASDISAETQCLVHFPSLLRLAREAGL  237

Query  528   DYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDI  349
             ++ EIQNLTDFYDD R QF+GMLQD  HN  DPRGRLLPR+YDVLGL+TTF+FQK DPDI
Sbjct  238   EHTEIQNLTDFYDDNRAQFLGMLQDAGHNFFDPRGRLLPRSYDVLGLYTTFIFQKHDPDI  297

Query  348   TPPLMTPFI  322
              PPL TPF+
Sbjct  298   APPLTTPFL  306



>ref|XP_006360494.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=359

 Score =   515 bits (1326),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 240/305 (79%), Positives = 268/305 (88%), Gaps = 3/305 (1%)
 Frame = -2

Query  1236  ATSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGH  1057
             A SFP   HRP  ES HHRL+D VK  LI IFVSPYATVC++YCGKVPD EKWDEAQIGH
Sbjct  4     ANSFP--THRP-AESTHHRLLDFVKSVLINIFVSPYATVCDMYCGKVPDVEKWDEAQIGH  60

Query  1056  YIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQ  877
             YIGIDV TSG+NE KEAW+SQRK YT+E IE+DPC ED+ +  +DK+ QAD+VFCMHNLQ
Sbjct  61    YIGIDVETSGVNEVKEAWKSQRKAYTSEFIELDPCIEDIDSFWKDKEKQADVVFCMHNLQ  120

Query  876   LCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVP  697
              CF+SEEKAR+LLHNVS+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+  GMKPNIVP
Sbjct  121   ACFDSEEKARRLLHNVSALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGGMKPNIVP  180

Query  696   NCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIE  517
             +CIRSE+Y I FEVEEEKFPFFGKKYQ+KFA+DISAETQCLVHFPSL+RLAREAGL++ E
Sbjct  181   SCIRSENYMITFEVEEEKFPFFGKKYQLKFASDISAETQCLVHFPSLLRLAREAGLEHTE  240

Query  516   IQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPL  337
             IQNLTDFYDD R QF+GMLQD  HN  DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL
Sbjct  241   IQNLTDFYDDNRAQFLGMLQDAGHNFFDPRGRLLPRSYDVLGLYTTFIFQKHDPDIAPPL  300

Query  336   MTPFI  322
              TPF+
Sbjct  301   TTPFL  305



>ref|XP_004250010.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Solanum lycopersicum]
Length=360

 Score =   514 bits (1324),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 241/309 (78%), Positives = 270/309 (87%), Gaps = 3/309 (1%)
 Frame = -2

Query  1248  MIPPATSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEA  1069
             M+  A SFPI  HRP  ES HHRL+D VK  LI IFVSPYATVC++YCGKVPD EKWDEA
Sbjct  1     MMMMANSFPI--HRP-AESTHHRLLDFVKNVLIGIFVSPYATVCDMYCGKVPDVEKWDEA  57

Query  1068  QIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCM  889
             QIGHYIGIDV  SG+NE KEAWESQRK YT+E IE+D C ED+++  +DK+ QAD+VFCM
Sbjct  58    QIGHYIGIDVEASGVNEVKEAWESQRKAYTSEFIELDLCIEDIESFWKDKEKQADVVFCM  117

Query  888   HNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKP  709
             HNLQ CF+SEEKAR+LLHNVS+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+  GMKP
Sbjct  118   HNLQACFDSEEKARRLLHNVSALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGGMKP  177

Query  708   NIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGL  529
             NIVP+CIRSE+Y I FEVEEEKFPFFGKKYQ+KFA+DISAETQCLVHFPSL+RLAREAGL
Sbjct  178   NIVPSCIRSENYMITFEVEEEKFPFFGKKYQLKFASDISAETQCLVHFPSLLRLAREAGL  237

Query  528   DYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDI  349
             ++ EIQNLTDFYDD R QF+GMLQD  HN  DPRGRLLPR+YDVLGL+TTF+FQK DPDI
Sbjct  238   EHTEIQNLTDFYDDNRAQFLGMLQDAGHNFFDPRGRLLPRSYDVLGLYTTFIFQKHDPDI  297

Query  348   TPPLMTPFI  322
              PPL TPF+
Sbjct  298   APPLTTPFL  306



>ref|XP_009602174.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Nicotiana tomentosiformis]
Length=356

 Score =   509 bits (1312),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/307 (79%), Positives = 267/307 (87%), Gaps = 2/307 (1%)
 Frame = -2

Query  1215  AHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVA  1036
             +HRP  E  HHRL+D VK ALIKIFVSPYATVC++YCGKV D EKWDEAQIGHYIGIDVA
Sbjct  5     SHRP-GELTHHRLLDFVKTALIKIFVSPYATVCDMYCGKVADVEKWDEAQIGHYIGIDVA  63

Query  1035  TSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEE  856
              SG+ E KEAWESQRK YT+E IE+DPC ED+ ++ +DK+ QADIVFCMHNLQLCF SEE
Sbjct  64    MSGVKEVKEAWESQRKAYTSEFIELDPCIEDIDSYWKDKEKQADIVFCMHNLQLCFNSEE  123

Query  855   KARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSES  676
             KAR+LLHNVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+   MKPNIVPNCIRSE+
Sbjct  124   KARRLLHNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGAMKPNIVPNCIRSEN  183

Query  675   YTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF  496
             Y I FEVEEEKF FFGKKYQ+KFA+DISAET CLVHFPSL+RLAREAGL+  EIQNLTDF
Sbjct  184   YMITFEVEEEKFSFFGKKYQLKFASDISAETHCLVHFPSLLRLAREAGLENTEIQNLTDF  243

Query  495   YDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI-V  319
             YDD R Q +G+LQD  H+ IDPRGRLLPR+YDVLGLFTTF+FQKPDPDI PPL TPF+ V
Sbjct  244   YDDNRAQVLGILQDAGHSFIDPRGRLLPRSYDVLGLFTTFIFQKPDPDIAPPLTTPFLPV  303

Query  318   RRNNDDE  298
               +N DE
Sbjct  304   GSHNPDE  310



>ref|XP_011077238.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Sesamum indicum]
Length=364

 Score =   502 bits (1293),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 234/304 (77%), Positives = 264/304 (87%), Gaps = 1/304 (0%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             PTES HHRLI+ VK ALI IFVSPYATVC+LYCGKVPDE KWDEAQIGHYIGIDVATSG+
Sbjct  10    PTESIHHRLIEFVKTALINIFVSPYATVCDLYCGKVPDEAKWDEAQIGHYIGIDVATSGV  69

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             +E +EAWES+RK YT+E +E DPC E++  + ++K+NQADIVFCM +L LC E+EEK R+
Sbjct  70    SEVREAWESRRKAYTSEFLEFDPCIEEVDLYWKNKENQADIVFCMQHLPLCVETEEKVRR  129

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LLHNVSSLLKPGGYFLGIT DSSTIW+KYQKNVEAYHNK +GMKPNI PNCIRSESY I 
Sbjct  130   LLHNVSSLLKPGGYFLGITPDSSTIWSKYQKNVEAYHNKSAGMKPNIFPNCIRSESYMIT  189

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFPFFGKKYQ+KFA D+SAET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD 
Sbjct  190   FEVEEEKFPFFGKKYQLKFAGDMSAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDN  249

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIV-RRNN  307
             R Q  GML D  HNL+D RGRLL R+YDVLGL+TTF+FQKPDPDI PPLMTP +    +N
Sbjct  250   RAQLAGMLMDAGHNLVDQRGRLLQRSYDVLGLYTTFIFQKPDPDIAPPLMTPLLEDASHN  309

Query  306   DDEA  295
              DEA
Sbjct  310   HDEA  313



>gb|EYU19767.1| hypothetical protein MIMGU_mgv1a008792mg [Erythranthe guttata]
Length=362

 Score =   494 bits (1271),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/297 (77%), Positives = 259/297 (87%), Gaps = 1/297 (0%)
 Frame = -2

Query  1215  AHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVA  1036
             AHRP TES HHRLI+ VK ALI IFVSPYATVC+LYCGKVPDEEKWDEAQIGHYIGIDV 
Sbjct  7     AHRP-TESIHHRLIEFVKAALINIFVSPYATVCDLYCGKVPDEEKWDEAQIGHYIGIDVE  65

Query  1035  TSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEE  856
             TSG++E +EAWES+RK YT+E +E DPC ED+  H ++K+NQADIVFCM +L LC E+EE
Sbjct  66    TSGVSEVREAWESRRKGYTSEFLEFDPCIEDIDLHWKNKENQADIVFCMQHLPLCVETEE  125

Query  855   KARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSES  676
             K ++LL N+S+LLKPGGYFLGIT DSSTIWAKYQKNVEA HN+  GMKPNIVPNCIRSES
Sbjct  126   KVKRLLSNISTLLKPGGYFLGITPDSSTIWAKYQKNVEACHNRAGGMKPNIVPNCIRSES  185

Query  675   YTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF  496
             Y I FEVEEEKFPFFGKKYQ+KFA D+SAET  LVHFPSL+RLAREAGL+++EIQNLT+F
Sbjct  186   YMITFEVEEEKFPFFGKKYQLKFAGDMSAETHYLVHFPSLLRLAREAGLEHVEIQNLTEF  245

Query  495   YDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPF  325
             YDD R Q  GML D  HNL+D RGRLLPR+YDVLGL+TTF+FQKPDPDI PPLMTP 
Sbjct  246   YDDNRAQLAGMLVDAGHNLVDQRGRLLPRSYDVLGLYTTFIFQKPDPDIAPPLMTPL  302



>gb|KDP45042.1| hypothetical protein JCGZ_01542 [Jatropha curcas]
Length=362

 Score =   478 bits (1231),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 257/315 (82%), Gaps = 0/315 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P TES HHRL +  K ALIKIFV PYATVC+LYCG   D EKWD AQ GHYIGIDV++ G
Sbjct  8     PRTESTHHRLYEFAKAALIKIFVHPYATVCDLYCGGSADAEKWDGAQFGHYIGIDVSSFG  67

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             +NE +EAWESQRK YTTE  E DPC+E+ +  LQ+K NQAD+V C+ NLQLCFE+EE AR
Sbjct  68    INEIREAWESQRKSYTTEFFEADPCSENFEMQLQEKANQADLVCCLQNLQLCFETEESAR  127

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             KLLHNVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKPNIVPNCIRSESY I
Sbjct  128   KLLHNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPNIVPNCIRSESYMI  187

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVEEEKFP FGKKYQ+KFA+DISAET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD
Sbjct  188   TFEVEEEKFPLFGKKYQLKFAHDISAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDD  247

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN  307
              R  F GM+ +   NL+DPRGRLLPR++DVLGL+TTF+F+KP+PD+ PPL +P +   + 
Sbjct  248   NRMHFAGMVMNAVPNLVDPRGRLLPRSFDVLGLYTTFIFKKPNPDVAPPLTSPLLPEESY  307

Query  306   DDEASEYHSTKHILQ  262
             + +  E+ +   + +
Sbjct  308   NHDEREWQAATTVWR  322



>emb|CBI40198.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 257/308 (83%), Gaps = 2/308 (1%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIFVSPYATVC+LY G   D +KWDEAQIGHYIGIDV++SG++
Sbjct  10    AESTHHRLFEFAKTALIKIFVSPYATVCDLYAGAGSDADKWDEAQIGHYIGIDVSSSGIS  69

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
               KE WESQRK Y  +  E+DP  E+L+ +LQDK N AD+V C+ +LQL FE+E+K R+L
Sbjct  70    HTKEVWESQRKSYNADFYELDPSMENLELNLQDKCNTADVVCCLQHLQLGFENEDKGRRL  129

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+GS MKPNIVPNCIRSESY I F
Sbjct  130   LHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRGSSMKPNIVPNCIRSESYMITF  189

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFPFFGKKYQ+KF+ND SAET CLVHFPSLIRLAREAGL+Y+EIQNLTDFYDD R
Sbjct  190   EVEEEKFPFFGKKYQLKFSNDTSAETYCLVHFPSLIRLAREAGLEYVEIQNLTDFYDDNR  249

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVR--RNN  307
              QF GML +   NL+DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL +PFI++   +N
Sbjct  250   AQFAGMLLNSGPNLVDPRGRLLPRSYDVLGLYTTFIFQKVDPDIVPPLTSPFIIKDGSHN  309

Query  306   DDEASEYH  283
              +EAS  H
Sbjct  310   YEEASSNH  317



>ref|XP_007218187.1| hypothetical protein PRUPE_ppa007690mg [Prunus persica]
 gb|EMJ19386.1| hypothetical protein PRUPE_ppa007690mg [Prunus persica]
Length=359

 Score =   477 bits (1227),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 250/295 (85%), Gaps = 0/295 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P  ES HHRL +  K AL +IFV PYATVCELYCG   D EKWDEAQIGHYIGID ++SG
Sbjct  7     PRAESTHHRLYEFAKAALTRIFVHPYATVCELYCGGGVDAEKWDEAQIGHYIGIDGSSSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             +N+++EAWESQRK YT +  E+DPC ED++ HL+D+ N AD+V C+ NLQLCFE+EE+AR
Sbjct  67    INQRREAWESQRKAYTADFFELDPCMEDVEIHLKDQTNPADLVCCLKNLQLCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             KLL NVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SGMKPNIVPNCIRSE+Y I
Sbjct  127   KLLLNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSSGMKPNIVPNCIRSENYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVE+EKFP FGKKYQ+KFANDIS E  CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD
Sbjct  187   TFEVEDEKFPLFGKKYQLKFANDISPEIHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              R QF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL TP +
Sbjct  247   NRAQFAGMIMNFGPNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLTTPLL  301



>ref|XP_008233244.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Prunus mume]
Length=359

 Score =   475 bits (1223),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 250/295 (85%), Gaps = 0/295 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P  ES HHRL +  K AL +IFV PYATVCELYCG   D EKWDEAQIGHYIGID ++SG
Sbjct  7     PRAESTHHRLYEFAKAALTRIFVHPYATVCELYCGGGVDAEKWDEAQIGHYIGIDGSSSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             +++++EAWESQRK YT +  E+DPC ED++ HL+D+ N AD+V C+ NLQLCFE+EE+AR
Sbjct  67    ISQRREAWESQRKAYTADFFELDPCMEDVEIHLKDQTNPADLVCCLKNLQLCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             KLL NVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SGMKPNIVPNCIRSE+Y I
Sbjct  127   KLLFNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSSGMKPNIVPNCIRSENYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVE+EKFP FGKKYQ+KFANDIS E  CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD
Sbjct  187   TFEVEDEKFPLFGKKYQLKFANDISPEIHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              R QF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL TP +
Sbjct  247   NRAQFAGMIMNFGPNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLTTPLL  301



>ref|XP_011024279.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Populus euphratica]
Length=368

 Score =   476 bits (1224),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 222/318 (70%), Positives = 257/318 (81%), Gaps = 4/318 (1%)
 Frame = -2

Query  1233  TSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHY  1054
             + FPI    P TES HHRL +  K A+IKIF  PYATVC+LYCG   D EKWD AQI HY
Sbjct  2     SGFPI----PRTESTHHRLYEFAKSAIIKIFAHPYATVCDLYCGGGVDLEKWDAAQITHY  57

Query  1053  IGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQL  874
             IGIDVA+SG++E KE WES +K YT +  + DPC+E+ +T LQ+K NQAD+V C+ NLQL
Sbjct  58    IGIDVASSGISEVKETWESLKKNYTADFFQADPCSENFETQLQEKANQADLVCCLQNLQL  117

Query  873   CFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPN  694
             CFE+EE ARKLLHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKPNIVPN
Sbjct  118   CFETEESARKLLHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPNIVPN  177

Query  693   CIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEI  514
             CIRSESY I FEVEEEKFP FGKKYQ+KFA+DISAET CLVHFPSLIRLAREAGL+Y+EI
Sbjct  178   CIRSESYMITFEVEEEKFPLFGKKYQLKFAHDISAETHCLVHFPSLIRLAREAGLEYVEI  237

Query  513   QNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
             QNLT+FYDD R QF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL 
Sbjct  238   QNLTEFYDDNRTQFAGMIMNAGLNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLT  297

Query  333   TPFIVRRNNDDEASEYHS  280
             TP +       + SE+ +
Sbjct  298   TPLLQHDGYTIDESEWQA  315



>ref|XP_002315350.2| hypothetical protein POPTR_0010s23930g [Populus trichocarpa]
 gb|EEF01521.2| hypothetical protein POPTR_0010s23930g [Populus trichocarpa]
Length=368

 Score =   475 bits (1222),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 222/318 (70%), Positives = 257/318 (81%), Gaps = 4/318 (1%)
 Frame = -2

Query  1233  TSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHY  1054
             + FPI    P TES HHRL +  K A+IKIF  PYATVC+LYCG   D EKWD AQI HY
Sbjct  2     SGFPI----PRTESTHHRLYEFAKSAIIKIFAHPYATVCDLYCGGGVDIEKWDAAQITHY  57

Query  1053  IGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQL  874
             IGIDVA+SG++E KE WES +K YT +  + DPC+E+ +T LQ+K NQAD+V C+ NLQL
Sbjct  58    IGIDVASSGISEVKETWESLKKNYTADFFQADPCSENFETQLQEKANQADLVCCLQNLQL  117

Query  873   CFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPN  694
             CFE+EE ARKLLHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKPNIVPN
Sbjct  118   CFETEESARKLLHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPNIVPN  177

Query  693   CIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEI  514
             CIRSESY I FEVEEEKFP FGKKYQ+KFA+DISAET CLVHFPSLIRLAREAGL+Y+EI
Sbjct  178   CIRSESYMITFEVEEEKFPLFGKKYQLKFAHDISAETHCLVHFPSLIRLAREAGLEYVEI  237

Query  513   QNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
             QNLT+FYDD R QF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL 
Sbjct  238   QNLTEFYDDNRTQFAGMIMNAGLNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLT  297

Query  333   TPFIVRRNNDDEASEYHS  280
             TP +       + SE+ +
Sbjct  298   TPLLQHDGYTIDESEWQA  315



>ref|XP_010110198.1| mRNA cap guanine-N7 methyltransferase 2 [Morus notabilis]
 gb|EXC25436.1| mRNA cap guanine-N7 methyltransferase 2 [Morus notabilis]
Length=377

 Score =   475 bits (1223),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 259/307 (84%), Gaps = 2/307 (1%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P TES H+RL +  K AL+KIFV PYATVC+LYCG   D +KWDEAQIGHYIGIDV++SG
Sbjct  7     PRTESTHYRLYEFAKSALVKIFVHPYATVCDLYCGGGVDADKWDEAQIGHYIGIDVSSSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHL-QDKDNQADIVFCMHNLQLCFESEEKA  850
             +++++EAWESQRKVYT E  E+DPC E ++THL ++K N  D V C+ +LQLCF++EE+A
Sbjct  67    ISQRREAWESQRKVYTAEFFEVDPCMESIETHLKEEKSNSGDFVCCLQHLQLCFQTEERA  126

Query  849   RKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYT  670
             R+LLHNVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+GS MKPNIVPNCIRSESY 
Sbjct  127   RRLLHNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRGSSMKPNIVPNCIRSESYM  186

Query  669   IAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYD  490
             I FEVEEEKFP FGKKYQ+KFAND+S ET CLVHFPS IRL REAGL+Y+EIQNLT+F+D
Sbjct  187   ITFEVEEEKFPLFGKKYQLKFANDVSPETHCLVHFPSFIRLGREAGLEYVEIQNLTEFFD  246

Query  489   DYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRN  310
             D R Q  G++  +  NL+DPRGRLLPR++DVLGL+TTF+FQKPDPD  PPLMTP++   +
Sbjct  247   DNRAQLAGLITTLYPNLVDPRGRLLPRSFDVLGLYTTFIFQKPDPDFGPPLMTPYLQDGS  306

Query  309   -NDDEAS  292
              N DEAS
Sbjct  307   FNHDEAS  313



>ref|XP_008376263.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Malus domestica]
Length=359

 Score =   474 bits (1221),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 215/293 (73%), Positives = 251/293 (86%), Gaps = 0/293 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K AL +IFV PYATVCELYCG   D EKWD+AQIGHYIGID+++SG++
Sbjct  9     AESTHHRLYEFAKAALTRIFVHPYATVCELYCGGGVDAEKWDDAQIGHYIGIDISSSGIS  68

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             +++EAWESQRK YT +  E+DPC ED++ HL+DK N  D+V C+ NLQ+CF++EE+ARKL
Sbjct  69    QRREAWESQRKAYTADFFELDPCMEDVEMHLKDKANTTDLVCCLQNLQMCFQTEERARKL  128

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+  GMKPNIVPNCIRSE+YTI F
Sbjct  129   LLNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGGMKPNIVPNCIRSENYTITF  188

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFANDIS E+  LVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  189   EVEEEKFPIFGKKYQLKFANDISPESYHLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  248

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              QF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPDITPPLMTP +
Sbjct  249   AQFAGMIMNSCSNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDITPPLMTPVL  301



>ref|XP_010658688.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Vitis vinifera]
Length=312

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 250/295 (85%), Gaps = 0/295 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIFVSPYATVC+LY G   D +KWDEAQIGHYIGIDV++SG++
Sbjct  10    AESTHHRLFEFAKTALIKIFVSPYATVCDLYAGAGSDADKWDEAQIGHYIGIDVSSSGIS  69

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
               KE WESQRK Y  +  E+DP  E+L+ +LQDK N AD+V C+ +LQL FE+E+K R+L
Sbjct  70    HTKEVWESQRKSYNADFYELDPSMENLELNLQDKCNTADVVCCLQHLQLGFENEDKGRRL  129

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+GS MKPNIVPNCIRSESY I F
Sbjct  130   LHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRGSSMKPNIVPNCIRSESYMITF  189

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFPFFGKKYQ+KF+ND SAET CLVHFPSLIRLAREAGL+Y+EIQNLTDFYDD R
Sbjct  190   EVEEEKFPFFGKKYQLKFSNDTSAETYCLVHFPSLIRLAREAGLEYVEIQNLTDFYDDNR  249

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVR  316
              QF GML +   NL+DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL +PFI++
Sbjct  250   AQFAGMLLNSGPNLVDPRGRLLPRSYDVLGLYTTFIFQKVDPDIVPPLTSPFIIK  304



>ref|XP_010658687.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Vitis vinifera]
Length=358

 Score =   471 bits (1213),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 218/295 (74%), Positives = 250/295 (85%), Gaps = 0/295 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIFVSPYATVC+LY G   D +KWDEAQIGHYIGIDV++SG++
Sbjct  10    AESTHHRLFEFAKTALIKIFVSPYATVCDLYAGAGSDADKWDEAQIGHYIGIDVSSSGIS  69

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
               KE WESQRK Y  +  E+DP  E+L+ +LQDK N AD+V C+ +LQL FE+E+K R+L
Sbjct  70    HTKEVWESQRKSYNADFYELDPSMENLELNLQDKCNTADVVCCLQHLQLGFENEDKGRRL  129

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+GS MKPNIVPNCIRSESY I F
Sbjct  130   LHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRGSSMKPNIVPNCIRSESYMITF  189

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFPFFGKKYQ+KF+ND SAET CLVHFPSLIRLAREAGL+Y+EIQNLTDFYDD R
Sbjct  190   EVEEEKFPFFGKKYQLKFSNDTSAETYCLVHFPSLIRLAREAGLEYVEIQNLTDFYDDNR  249

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVR  316
              QF GML +   NL+DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL +PFI++
Sbjct  250   AQFAGMLLNSGPNLVDPRGRLLPRSYDVLGLYTTFIFQKVDPDIVPPLTSPFIIK  304



>ref|XP_009368955.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009342468.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Pyrus x bretschneideri]
Length=360

 Score =   471 bits (1212),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/293 (74%), Positives = 247/293 (84%), Gaps = 0/293 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K AL +IFV PYATVCELYCG   D EKWD+AQIGHYIGIDV++SG++
Sbjct  10    AESTHHRLYEFAKSALTRIFVHPYATVCELYCGGGVDAEKWDDAQIGHYIGIDVSSSGIS  69

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             +++EAWESQRK YT +  E+DPC ED++ HL+DK N AD+V C+ NLQLCF++EEKARKL
Sbjct  70    QRREAWESQRKAYTADFFELDPCMEDVEMHLKDKANTADLVCCLQNLQLCFQTEEKARKL  129

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLLKP GYF GIT DSSTIWAKYQKNVEAYHN+  GMKPNIVPNCIRSE+Y I F
Sbjct  130   LLNVSSLLKPRGYFFGITPDSSTIWAKYQKNVEAYHNRSGGMKPNIVPNCIRSENYMITF  189

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND S E   LVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  190   EVEEEKFPIFGKKYQLKFANDFSPENHVLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  249

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              QF GM+     NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPDITPPLMTP +
Sbjct  250   AQFAGMIMSSCSNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDITPPLMTPVL  302



>ref|XP_009368954.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009368964.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009342467.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Pyrus x bretschneideri]
Length=361

 Score =   471 bits (1212),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/293 (74%), Positives = 247/293 (84%), Gaps = 0/293 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K AL +IFV PYATVCELYCG   D EKWD+AQIGHYIGIDV++SG++
Sbjct  10    AESTHHRLYEFAKSALTRIFVHPYATVCELYCGGGVDAEKWDDAQIGHYIGIDVSSSGIS  69

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             +++EAWESQRK YT +  E+DPC ED++ HL+DK N AD+V C+ NLQLCF++EEKARKL
Sbjct  70    QRREAWESQRKAYTADFFELDPCMEDVEMHLKDKANTADLVCCLQNLQLCFQTEEKARKL  129

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLLKP GYF GIT DSSTIWAKYQKNVEAYHN+  GMKPNIVPNCIRSE+Y I F
Sbjct  130   LLNVSSLLKPRGYFFGITPDSSTIWAKYQKNVEAYHNRSGGMKPNIVPNCIRSENYMITF  189

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND S E   LVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  190   EVEEEKFPIFGKKYQLKFANDFSPENHVLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  249

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              QF GM+     NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPDITPPLMTP +
Sbjct  250   AQFAGMIMSSCSNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDITPPLMTPVL  302



>ref|XP_008446791.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Cucumis melo]
Length=392

 Score =   471 bits (1211),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 215/310 (69%), Positives = 252/310 (81%), Gaps = 0/310 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P  E  HHRL D  K ALIKIF  PY TVC+LYC +  D EKWDEAQI HYIGID +TSG
Sbjct  7     PRGEWTHHRLCDFAKTALIKIFSHPYVTVCDLYCARGADAEKWDEAQISHYIGIDESTSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + + +EAWESQ+K YT E  E+DPC E+++T L+DK   AD V C+ +LQ+CFE+EE+AR
Sbjct  67    IGQMREAWESQKKAYTAEFFEVDPCVENIETQLKDKTETADRVCCLQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LLHNVS+LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ +GMKPNIVPNCIRSESY I
Sbjct  127   RLLHNVSALLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSAGMKPNIVPNCIRSESYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
             +FEVEEEKFP FGKKYQ+KFAND SAET CLVHFPS IRLAREAGL+YIEIQNLT+F+DD
Sbjct  187   SFEVEEEKFPLFGKKYQLKFANDPSAETHCLVHFPSFIRLAREAGLEYIEIQNLTEFFDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN  307
             +R Q   ML +   N++DPRGRLLPR+YDVLGL+TTF+FQKPDPDITPP+MTP +   + 
Sbjct  247   HRAQLADMLMNFGQNILDPRGRLLPRSYDVLGLYTTFIFQKPDPDITPPIMTPLLPEISY  306

Query  306   DDEASEYHST  277
             D E  E+   
Sbjct  307   DHEEIEWQGN  316



>ref|XP_010067168.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X3 
[Eucalyptus grandis]
Length=316

 Score =   466 bits (1200),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 249/301 (83%), Gaps = 0/301 (0%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  + ALIKIFV PYATVCELYCG   + E+W+EAQIGHYIGIDV +SG++EK+E
Sbjct  13    HHRLHEFARNALIKIFVHPYATVCELYCGGGLEAERWEEAQIGHYIGIDVTSSGISEKRE  72

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES RK YTT+  E+DPCTEDL+ HLQ+K NQAD+V C+ +LQLCFESE+K RKLLHNV
Sbjct  73    AWESLRKAYTTDFYELDPCTEDLEAHLQEKMNQADLVCCLQHLQLCFESEDKVRKLLHNV  132

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKP IVPNCIRSESY I FE EE
Sbjct  133   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPGIVPNCIRSESYMITFEGEE  192

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+K A D+ AET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +  F 
Sbjct  193   EKFPSFGKRYQLKLAGDMPAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKAIFA  252

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDEASE  289
             GML     +++DPRGRLLPR+YDVLGL+T F+FQKPDPD  PPL TP +V  N+ +E + 
Sbjct  253   GMLMGYGASVVDPRGRLLPRSYDVLGLYTMFIFQKPDPDAAPPLTTPLLVESNHHEEEAS  312

Query  288   Y  286
             +
Sbjct  313   F  313



>ref|XP_007010145.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY18955.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=357

 Score =   467 bits (1201),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 215/310 (69%), Positives = 253/310 (82%), Gaps = 0/310 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P  ES HHRL ++ K ALIKIFV PYATVC+LYCG   D EKWD AQI HYIGID  +SG
Sbjct  7     PRAESTHHRLYELAKTALIKIFVHPYATVCDLYCGGGADAEKWDGAQISHYIGIDGLSSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             +NE +EAWESQRK +T+E  E DPC ++L+T L++K  QAD+V C+ +LQ  FE+EEKAR
Sbjct  67    INEMREAWESQRKSFTSEFFEADPCIDNLETQLKEKAIQADLVCCLQHLQFGFETEEKAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LL+NVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHNK S MKPNIVPNCIRSESY I
Sbjct  127   RLLNNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNKNSSMKPNIVPNCIRSESYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FE+EEEKFP FGKKYQ+KFA+D SAE   LVHFPSLIRLAREAGL+Y+EIQNLT+FYDD
Sbjct  187   TFEIEEEKFPLFGKKYQLKFASDASAEIHSLVHFPSLIRLAREAGLEYVEIQNLTEFYDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN  307
              RPQF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PP+ TP +   + 
Sbjct  247   NRPQFAGMMMNAGPNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVVPPIATPLLQDSSY  306

Query  306   DDEASEYHST  277
             + + SE+   
Sbjct  307   NHDESEWQGA  316



>gb|KGN52214.1| hypothetical protein Csa_5G616340 [Cucumis sativus]
Length=392

 Score =   468 bits (1203),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 250/307 (81%), Gaps = 0/307 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P  E  HHRL D  K ALIKIF  PY TVC+LYC +  D EKWDE QI HYIGID +TSG
Sbjct  7     PRGEWTHHRLCDFAKTALIKIFSHPYVTVCDLYCARGADAEKWDETQISHYIGIDESTSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + + +EAWESQ+K YT E  E+DPC E+++T L+DK    D V C+ +LQ+CFE+EE+AR
Sbjct  67    IGQMREAWESQKKAYTAEFFEVDPCVENIETQLKDKTETVDRVCCLQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LLHNVS+LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ +GMKPNIVPNCIRSESY I
Sbjct  127   RLLHNVSALLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSAGMKPNIVPNCIRSESYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
             +FEVEEEKFP FGKKYQ+KFAND SAET CLVHFPS IRLAREAGL+YIEIQNLT+F+DD
Sbjct  187   SFEVEEEKFPLFGKKYQLKFANDPSAETHCLVHFPSFIRLAREAGLEYIEIQNLTEFFDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN  307
             +R Q   ML +   N++DPRGRLLPR+YDVLGL+TTF+FQKPDPDITPP+MTP +     
Sbjct  247   HRAQLADMLMNFGQNILDPRGRLLPRSYDVLGLYTTFIFQKPDPDITPPIMTPLLPETIY  306

Query  306   DDEASEY  286
             D E +E+
Sbjct  307   DHEETEW  313



>ref|XP_011024280.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Populus euphratica]
Length=366

 Score =   466 bits (1200),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 255/318 (80%), Gaps = 6/318 (2%)
 Frame = -2

Query  1233  TSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHY  1054
             + FPI    P TES HHRL +  K A+IKIF  PYATVC+LYCG   D EKWD AQI HY
Sbjct  2     SGFPI----PRTESTHHRLYEFAKSAIIKIFAHPYATVCDLYCGGGVDLEKWDAAQITHY  57

Query  1053  IGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQL  874
             IGI  A+SG++E KE WES +K YT +  + DPC+E+ +T LQ+K NQAD+V C+ NLQL
Sbjct  58    IGI--ASSGISEVKETWESLKKNYTADFFQADPCSENFETQLQEKANQADLVCCLQNLQL  115

Query  873   CFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPN  694
             CFE+EE ARKLLHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKPNIVPN
Sbjct  116   CFETEESARKLLHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPNIVPN  175

Query  693   CIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEI  514
             CIRSESY I FEVEEEKFP FGKKYQ+KFA+DISAET CLVHFPSLIRLAREAGL+Y+EI
Sbjct  176   CIRSESYMITFEVEEEKFPLFGKKYQLKFAHDISAETHCLVHFPSLIRLAREAGLEYVEI  235

Query  513   QNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
             QNLT+FYDD R QF GM+ +   NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL 
Sbjct  236   QNLTEFYDDNRTQFAGMIMNAGLNLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLT  295

Query  333   TPFIVRRNNDDEASEYHS  280
             TP +       + SE+ +
Sbjct  296   TPLLQHDGYTIDESEWQA  313



>ref|XP_004142453.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Cucumis 
sativus]
 ref|XP_004164269.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Cucumis 
sativus]
Length=354

 Score =   464 bits (1194),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 248/305 (81%), Gaps = 0/305 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P  E  HHRL D  K ALIKIF  PY TVC+LYC +  D EKWDE QI HYIGID +TSG
Sbjct  7     PRGEWTHHRLCDFAKTALIKIFSHPYVTVCDLYCARGADAEKWDETQISHYIGIDESTSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + + +EAWESQ+K YT E  E+DPC E+++T L+DK    D V C+ +LQ+CFE+EE+AR
Sbjct  67    IGQMREAWESQKKAYTAEFFEVDPCVENIETQLKDKTETVDRVCCLQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LLHNVS+LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ +GMKPNIVPNCIRSESY I
Sbjct  127   RLLHNVSALLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSAGMKPNIVPNCIRSESYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
             +FEVEEEKFP FGKKYQ+KFAND SAET CLVHFPS IRLAREAGL+YIEIQNLT+F+DD
Sbjct  187   SFEVEEEKFPLFGKKYQLKFANDPSAETHCLVHFPSFIRLAREAGLEYIEIQNLTEFFDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN  307
             +R Q   ML +   N++DPRGRLLPR+YDVLGL+TTF+FQKPDPDITPP+MTP +     
Sbjct  247   HRAQLADMLMNFGQNILDPRGRLLPRSYDVLGLYTTFIFQKPDPDITPPIMTPLLPETIY  306

Query  306   DDEAS  292
             D E +
Sbjct  307   DHEEA  311



>ref|XP_010067165.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Eucalyptus grandis]
 gb|KCW65242.1| hypothetical protein EUGRSUZ_G02721 [Eucalyptus grandis]
 gb|KCW65243.1| hypothetical protein EUGRSUZ_G02721 [Eucalyptus grandis]
Length=357

 Score =   462 bits (1190),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 212/293 (72%), Positives = 244/293 (83%), Gaps = 0/293 (0%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  + ALIKIFV PYATVCELYCG   + E+W+EAQIGHYIGIDV +SG++EK+E
Sbjct  13    HHRLHEFARNALIKIFVHPYATVCELYCGGGLEAERWEEAQIGHYIGIDVTSSGISEKRE  72

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES RK YTT+  E+DPCTEDL+ HLQ+K NQAD+V C+ +LQLCFESE+K RKLLHNV
Sbjct  73    AWESLRKAYTTDFYELDPCTEDLEAHLQEKMNQADLVCCLQHLQLCFESEDKVRKLLHNV  132

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKP IVPNCIRSESY I FE EE
Sbjct  133   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPGIVPNCIRSESYMITFEGEE  192

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+K A D+ AET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +  F 
Sbjct  193   EKFPSFGKRYQLKLAGDMPAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKAIFA  252

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRN  310
             GML     +++DPRGRLLPR+YDVLGL+T F+FQKPDPD  PPL TP +V  N
Sbjct  253   GMLMGYGASVVDPRGRLLPRSYDVLGLYTMFIFQKPDPDAAPPLTTPLLVESN  305



>ref|XP_006436605.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|ESR49845.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|KDO55328.1| hypothetical protein CISIN_1g018352mg [Citrus sinensis]
Length=312

 Score =   459 bits (1181),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 247/305 (81%), Gaps = 4/305 (1%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P +E  HHRL +  K ALIKI+  PY TVC+LYCG   D +KW+ A I +YIGIDVATSG
Sbjct  7     PRSELTHHRLYEFAKTALIKIYSHPYVTVCDLYCGAGVDVDKWETALIANYIGIDVATSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + E ++ WE+QRK +  E  E DPC E+ +T +Q+K NQAD+V C  +LQ+CFE+EE+AR
Sbjct  67    IGEARDTWENQRKNFIAEFFEADPCAENFETQMQEKANQADLVCCFQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LL NVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+ S MKPN+VPNCIRSESY I
Sbjct  127   RLLQNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSSSMKPNLVPNCIRSESYVI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVEEEKFP FGKKYQ+KFANDISAETQCLVHFPSLIRLAREAGL+Y+EIQNL +FYDD
Sbjct  187   TFEVEEEKFPLFGKKYQLKFANDISAETQCLVHFPSLIRLAREAGLEYVEIQNLNEFYDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN  307
              R  F GML     NLIDPRGRLLPR+YDVLGL++TF+FQKPDPD+ PPL TP +     
Sbjct  247   NRALFAGMLMSAGPNLIDPRGRLLPRSYDVLGLYSTFIFQKPDPDVAPPLATPLL----Q  302

Query  306   DDEAS  292
             D+EAS
Sbjct  303   DNEAS  307



>ref|XP_009602175.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Nicotiana tomentosiformis]
Length=333

 Score =   459 bits (1181),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 247/307 (80%), Gaps = 25/307 (8%)
 Frame = -2

Query  1215  AHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVA  1036
             +HRP  E  HHRL+D VK ALIKIFVSPYATVC++YCGKV D EKWDEAQIGHYIGIDVA
Sbjct  5     SHRP-GELTHHRLLDFVKTALIKIFVSPYATVCDMYCGKVADVEKWDEAQIGHYIGIDVA  63

Query  1035  TSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEE  856
              SG+ E KEAWESQRK YT+E IE+DPC ED+ ++ +DK+ QADIVFCMHNLQLCF SEE
Sbjct  64    MSGVKEVKEAWESQRKAYTSEFIELDPCIEDIDSYWKDKEKQADIVFCMHNLQLCFNSEE  123

Query  855   KARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSES  676
             KAR+LLHNVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+   MKPNIVPNCIRSE+
Sbjct  124   KARRLLHNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGAMKPNIVPNCIRSEN  183

Query  675   YTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF  496
             Y I FEVEEEKF FFGKKYQ+KFA+DISAET CLVHFPSL+                   
Sbjct  184   YMITFEVEEEKFSFFGKKYQLKFASDISAETHCLVHFPSLL-------------------  224

Query  495   YDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI-V  319
                 R Q +G+LQD  H+ IDPRGRLLPR+YDVLGLFTTF+FQKPDPDI PPL TPF+ V
Sbjct  225   ----RAQVLGILQDAGHSFIDPRGRLLPRSYDVLGLFTTFIFQKPDPDIAPPLTTPFLPV  280

Query  318   RRNNDDE  298
               +N DE
Sbjct  281   GSHNPDE  287



>ref|XP_010908936.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Elaeis guineensis]
Length=375

 Score =   458 bits (1179),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 215/321 (67%), Positives = 250/321 (78%), Gaps = 8/321 (2%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIFV PYATVC+LYCG   D +KWDEAQIGHYIGID +TSG++
Sbjct  21    AESAHHRLYEFAKTALIKIFVFPYATVCDLYCGGGADTDKWDEAQIGHYIGIDASTSGIS  80

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             E +E WESQRK YT E  E+DP  E+L + LQDK   ADIV C+ +L LCFE+EE+AR L
Sbjct  81    EAREVWESQRKPYTAEFCELDPSVENLDSSLQDKGIPADIVCCLQHLHLCFENEERARSL  140

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYF GIT DSSTIW KYQKNVEA H KGSG+KPN VPNCIRSE+Y I F
Sbjct  141   LHNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHGKGSGLKPNTVPNCIRSENYVITF  200

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFANDI++ET CLVHFPSLIRLAREAGL+Y+E+QNLT+FYDD R
Sbjct  201   EVEEEKFPLFGKKYQLKFANDITSETHCLVHFPSLIRLAREAGLEYVEMQNLTEFYDDNR  260

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDD  301
              QF GML     N +DPRG+LL R+YD+LGL++ FVFQKPDPD+ PP+MTP +   N+  
Sbjct  261   AQFAGMLFSYGANFVDPRGKLLARSYDLLGLYSIFVFQKPDPDVVPPIMTPMLQDGNHAH  320

Query  300   EASEYHSTKHILQVSHSWNYQ  238
             E  E+        +  SW  Q
Sbjct  321   EEHEW--------IGSSWRQQ  333



>ref|XP_006436608.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 ref|XP_006485236.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR49848.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|KDO55327.1| hypothetical protein CISIN_1g018352mg [Citrus sinensis]
Length=357

 Score =   456 bits (1173),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 208/295 (71%), Positives = 242/295 (82%), Gaps = 0/295 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P +E  HHRL +  K ALIKI+  PY TVC+LYCG   D +KW+ A I +YIGIDVATSG
Sbjct  7     PRSELTHHRLYEFAKTALIKIYSHPYVTVCDLYCGAGVDVDKWETALIANYIGIDVATSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + E ++ WE+QRK +  E  E DPC E+ +T +Q+K NQAD+V C  +LQ+CFE+EE+AR
Sbjct  67    IGEARDTWENQRKNFIAEFFEADPCAENFETQMQEKANQADLVCCFQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LL NVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+ S MKPN+VPNCIRSESY I
Sbjct  127   RLLQNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSSSMKPNLVPNCIRSESYVI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVEEEKFP FGKKYQ+KFANDISAETQCLVHFPSLIRLAREAGL+Y+EIQNL +FYDD
Sbjct  187   TFEVEEEKFPLFGKKYQLKFANDISAETQCLVHFPSLIRLAREAGLEYVEIQNLNEFYDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              R  F GML     NLIDPRGRLLPR+YDVLGL++TF+FQKPDPD+ PPL TP +
Sbjct  247   NRALFAGMLMSAGPNLIDPRGRLLPRSYDVLGLYSTFIFQKPDPDVAPPLATPLL  301



>ref|XP_010908935.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Elaeis guineensis]
Length=376

 Score =   456 bits (1173),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 244/301 (81%), Gaps = 0/301 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIFV PYATVC+LYCG   D +KWDEAQIGHYIGID +TSG++
Sbjct  21    AESAHHRLYEFAKTALIKIFVFPYATVCDLYCGGGADTDKWDEAQIGHYIGIDASTSGIS  80

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             E +E WESQRK YT E  E+DP  E+L + LQDK   ADIV C+ +L LCFE+EE+AR L
Sbjct  81    EAREVWESQRKPYTAEFCELDPSVENLDSSLQDKGIPADIVCCLQHLHLCFENEERARSL  140

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYF GIT DSSTIW KYQKNVEA H KGSG+KPN VPNCIRSE+Y I F
Sbjct  141   LHNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHGKGSGLKPNTVPNCIRSENYVITF  200

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFANDI++ET CLVHFPSLIRLAREAGL+Y+E+QNLT+FYDD R
Sbjct  201   EVEEEKFPLFGKKYQLKFANDITSETHCLVHFPSLIRLAREAGLEYVEMQNLTEFYDDNR  260

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDD  301
              QF GML     N +DPRG+LL R+YD+LGL++ FVFQKPDPD+ PP+MTP +   N+  
Sbjct  261   AQFAGMLFSYGANFVDPRGKLLARSYDLLGLYSIFVFQKPDPDVVPPIMTPMLQDGNHAH  320

Query  300   E  298
             E
Sbjct  321   E  321



>ref|XP_004307331.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Fragaria 
vesca subsp. vesca]
Length=371

 Score =   455 bits (1170),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 246/301 (82%), Gaps = 1/301 (0%)
 Frame = -2

Query  1227  FPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVP-DEEKWDEAQIGHYI  1051
              P +   P  +S H+RL +  K ALIKIFV PYA+VCELYCG    D EKWDEAQIGHYI
Sbjct  4     LPQHPAAPRADSPHNRLYEFAKAALIKIFVHPYASVCELYCGSGGVDAEKWDEAQIGHYI  63

Query  1050  GIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLC  871
             GIDV+TSG+ +K+EAWESQRK YT +  E+DPC ED++ HL ++   AD+V C+ NLQLC
Sbjct  64    GIDVSTSGIRQKREAWESQRKGYTADFFELDPCMEDIEPHLNEETVLADLVCCLQNLQLC  123

Query  870   FESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNC  691
             F++EEKAR+LL NVS+LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ +GMKPNIVPNC
Sbjct  124   FQTEEKARRLLLNVSALLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSAGMKPNIVPNC  183

Query  690   IRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQ  511
             IRSE+Y I FE+EEEKFP FGKKY +K AND+  ET CLVHFPS IRLAREAGL+Y+EIQ
Sbjct  184   IRSENYVITFEIEEEKFPLFGKKYLLKLANDLPPETHCLVHFPSFIRLAREAGLEYVEIQ  243

Query  510   NLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMT  331
             NLT+FYDD R  F GML +   NL DPRGRLLPR+YDVLGL+TTF+F KPDPDI PP+MT
Sbjct  244   NLTEFYDDNRAHFAGMLMNFGPNLADPRGRLLPRSYDVLGLYTTFIFHKPDPDIAPPIMT  303

Query  330   P  328
             P
Sbjct  304   P  304



>ref|XP_004502631.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Cicer 
arietinum]
Length=360

 Score =   454 bits (1168),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 208/308 (68%), Positives = 252/308 (82%), Gaps = 2/308 (1%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             +ES H RL D  K+ALIKIF  PYATVCELYCG   D +K+ +AQI HYIGIDV++SG++
Sbjct  9     SESSHQRLYDFAKMALIKIFAHPYATVCELYCGGGADADKYLDAQIAHYIGIDVSSSGID  68

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             + ++AWES RK YT +   +DP  ++++THL++K N AD V C+ +LQLCFE+EEKAR+L
Sbjct  69    QIRQAWESNRKSYTADFFHLDPSADNIETHLEEKTNTADFVCCLQHLQLCFETEEKARRL  128

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLLKPGGYFLGIT DSSTIWAKYQKNVE+YHNK S MKPNIVPNCIR+E+Y I F
Sbjct  129   LQNVSSLLKPGGYFLGITPDSSTIWAKYQKNVESYHNKSSSMKPNIVPNCIRTENYMITF  188

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KF ND+SAET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  189   EVEEEKFPLFGKKYQLKFVNDVSAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNR  248

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI--VRRNN  307
              Q  G+L +   NL+D RGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP +     N+
Sbjct  249   AQLAGLLTNYAPNLLDTRGRLLPRSYDALGLYTTFIFQKPDPEIVPPIATPLLQDATYNH  308

Query  306   DDEASEYH  283
             DD  ++YH
Sbjct  309   DDMTNDYH  316



>ref|XP_006578921.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X3 [Glycine max]
Length=342

 Score =   452 bits (1164),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 243/293 (83%), Gaps = 1/293 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             ++S   RL D  K+ALI IF  PYATVC+LYCG   D +KW +AQIGHYIGID  +SG+ 
Sbjct  2     SQSTQQRLYDFAKMALINIFAHPYATVCDLYCGDA-DADKWVDAQIGHYIGIDAPSSGIE  60

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             + +EAWE  RK YT E  E+DPCT++ +THL++K N AD+V C+ +LQLCFE+EEKARKL
Sbjct  61    QMREAWEIHRKSYTAEFFELDPCTKNTETHLEEKTNVADVVCCLQHLQLCFETEEKARKL  120

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I F
Sbjct  121   LHNVSSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITF  180

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  181   EVEEEKFPLFGKKYQLKFANDVSAETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  240

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              Q  G+L     NL+DPRGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP +
Sbjct  241   AQLAGLLTHYVPNLLDPRGRLLPRSYDALGLYTTFIFQKPDPEIAPPIATPLL  293



>ref|XP_006578919.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Glycine max]
 gb|KHN44222.1| mRNA cap guanine-N7 methyltransferase 2 [Glycine soja]
Length=346

 Score =   452 bits (1163),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 243/293 (83%), Gaps = 1/293 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             ++S   RL D  K+ALI IF  PYATVC+LYCG   D +KW +AQIGHYIGID  +SG+ 
Sbjct  2     SQSTQQRLYDFAKMALINIFAHPYATVCDLYCGDA-DADKWVDAQIGHYIGIDAPSSGIE  60

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             + +EAWE  RK YT E  E+DPCT++ +THL++K N AD+V C+ +LQLCFE+EEKARKL
Sbjct  61    QMREAWEIHRKSYTAEFFELDPCTKNTETHLEEKTNVADVVCCLQHLQLCFETEEKARKL  120

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I F
Sbjct  121   LHNVSSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITF  180

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  181   EVEEEKFPLFGKKYQLKFANDVSAETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  240

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              Q  G+L     NL+DPRGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP +
Sbjct  241   AQLAGLLTHYVPNLLDPRGRLLPRSYDALGLYTTFIFQKPDPEIAPPIATPLL  293



>ref|XP_006581635.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Glycine max]
Length=347

 Score =   452 bits (1163),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 247/301 (82%), Gaps = 3/301 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
               RL D  K+ALI IFV PYATVC+LYCG   D +KW  AQIGHYIGID  +SG+++ +E
Sbjct  6     QQRLYDFAKMALINIFVHPYATVCDLYCGDA-DADKWAHAQIGHYIGIDAPSSGIDQMRE  64

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE+ RK YT E  E+DPCTE+++THL++K N  D+V C+ +LQLCFE+EEKARKLLHNV
Sbjct  65    TWETHRKSYTAEFFELDPCTENIETHLEEKTNMTDVVCCLQHLQLCFETEEKARKLLHNV  124

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I FEVEE
Sbjct  125   SSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITFEVEE  184

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R Q  
Sbjct  185   EKFPLFGKKYQLKFANDVSAETYCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQLA  244

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI--VRRNNDDEA  295
             G+L     NL+DPRGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP +  V  N D++ 
Sbjct  245   GLLTHYVPNLLDPRGRLLPRSYDALGLYTTFIFQKPDPEIAPPIPTPLLPDVSYNLDEQV  304

Query  294   S  292
             +
Sbjct  305   T  305



>ref|XP_010667618.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=363

 Score =   452 bits (1163),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 210/289 (73%), Positives = 246/289 (85%), Gaps = 1/289 (0%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRLID  K AL KIF+ PYA+VCEL+CG+VPD EK+D+A IGHYIGIDV TS +++ K 
Sbjct  21    HHRLIDFAKTALFKIFMFPYASVCELFCGQVPDVEKFDDALIGHYIGIDVETSYVSQVKL  80

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK YT++  E+DPCTE+L+ HL DK N  DIV CM +LQ+CF+SEE+AR LLHNV
Sbjct  81    AWESQRKAYTSQFFELDPCTENLEQHLLDKGNTVDIVCCMQHLQICFKSEERARVLLHNV  140

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSS IWAKYQKNVEAYHN+ SGMKPNIVPNCIRSESY I FEVEE
Sbjct  141   SSLLKPGGYFFGITPDSSMIWAKYQKNVEAYHNR-SGMKPNIVPNCIRSESYMITFEVEE  199

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFA+D+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  200   EKFPLFGKKYQLKFASDVSAETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQFG  259

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              ++     NL+DPRGRLLPR+YDVLGL+TTF+F+KPDP++ PP+ TP +
Sbjct  260   SLILKFGPNLVDPRGRLLPRSYDVLGLYTTFIFKKPDPEMAPPITTPVL  308



>ref|XP_003526702.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Glycine max]
 gb|KHN23381.1| mRNA cap guanine-N7 methyltransferase 2 [Glycine soja]
Length=346

 Score =   451 bits (1160),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 206/289 (71%), Positives = 241/289 (83%), Gaps = 1/289 (0%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
               RL D  K+ALI IFV PYATVC+LYCG   D +KW  AQIGHYIGID  +SG+++ +E
Sbjct  6     QQRLYDFAKMALINIFVHPYATVCDLYCGDA-DADKWAHAQIGHYIGIDAPSSGIDQMRE  64

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE+ RK YT E  E+DPCTE+++THL++K N  D+V C+ +LQLCFE+EEKARKLLHNV
Sbjct  65    TWETHRKSYTAEFFELDPCTENIETHLEEKTNMTDVVCCLQHLQLCFETEEKARKLLHNV  124

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I FEVEE
Sbjct  125   SSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITFEVEE  184

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R Q  
Sbjct  185   EKFPLFGKKYQLKFANDVSAETYCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQLA  244

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
             G+L     NL+DPRGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP +
Sbjct  245   GLLTHYVPNLLDPRGRLLPRSYDALGLYTTFIFQKPDPEIAPPIPTPLL  293



>ref|XP_006578920.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Glycine max]
Length=345

 Score =   447 bits (1151),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 242/293 (83%), Gaps = 2/293 (1%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             ++S   RL D  K+ALI IF  PYATVC+LYCG   D +KW +AQIGHYIGID  +SG+ 
Sbjct  2     SQSTQQRLYDFAKMALINIFAHPYATVCDLYCGDA-DADKWVDAQIGHYIGIDAPSSGIE  60

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             + +EAWE  RK YT E  E+DPCT + +THL++K N AD+V C+ +LQLCFE+EEKARKL
Sbjct  61    QMREAWEIHRKSYTAEFFELDPCT-NTETHLEEKTNVADVVCCLQHLQLCFETEEKARKL  119

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I F
Sbjct  120   LHNVSSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITF  179

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  180   EVEEEKFPLFGKKYQLKFANDVSAETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  239

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              Q  G+L     NL+DPRGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP +
Sbjct  240   AQLAGLLTHYVPNLLDPRGRLLPRSYDALGLYTTFIFQKPDPEIAPPIATPLL  292



>ref|XP_007136560.1| hypothetical protein PHAVU_009G055100g [Phaseolus vulgaris]
 gb|ESW08554.1| hypothetical protein PHAVU_009G055100g [Phaseolus vulgaris]
Length=345

 Score =   447 bits (1149),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 203/293 (69%), Positives = 243/293 (83%), Gaps = 1/293 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             ++S H RL D  K+ALI IF  PYATVC+LYC    D +KW +AQIGHYIGID ++SG+ 
Sbjct  2     SQSTHQRLYDFAKMALINIFAHPYATVCDLYCAD-SDADKWVDAQIGHYIGIDASSSGIE  60

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             + +EAWES RK YT +  ++DP  E+++THL++K N AD+V C+ +LQLCFE+EEKARKL
Sbjct  61    QMREAWESHRKSYTAQFFQVDPSMENIETHLEEKINVADVVCCLQHLQLCFETEEKARKL  120

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I F
Sbjct  121   LHNVSSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITF  180

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  181   EVEEEKFPLFGKKYQLKFANDVSAETNCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  240

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              Q  G+L     NL+D RGRL+PR+YD LGL+TTF+FQKPDP+I PP+ TP +
Sbjct  241   AQLAGLLTHYVPNLLDSRGRLVPRSYDALGLYTTFIFQKPDPEIAPPVATPLV  293



>ref|XP_010243264.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Nelumbo nucifera]
Length=363

 Score =   446 bits (1146),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 205/281 (73%), Positives = 238/281 (85%), Gaps = 0/281 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P TES H RL D  K ALIKIFVSPYATVC+LYCG   D +KWDEAQIGHYIGID ++SG
Sbjct  7     PRTESAHFRLYDFAKTALIKIFVSPYATVCDLYCGGGVDTDKWDEAQIGHYIGIDASSSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             ++E +E WESQRK YT +  E+DPC E+L+++LQDK   AD+V C+ +LQLCFE+EE+AR
Sbjct  67    ISEAREIWESQRKPYTADFCELDPCVENLESYLQDKGIPADVVCCLQHLQLCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
              LLHNVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHNK + MKPNIVPNCIRSESY I
Sbjct  127   SLLHNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNKAASMKPNIVPNCIRSESYMI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVEEEKFP FGKKYQ+KFAND+++ET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD
Sbjct  187   TFEVEEEKFPLFGKKYQLKFANDVTSETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDD  246

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
              R QF GML     N +D RG+L+PR++DVLGL+TTF+FQK
Sbjct  247   NRAQFAGMLHSYGPNFVDARGKLVPRSFDVLGLYTTFIFQK  287



>ref|XP_010529027.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Tarenaya 
hassleriana]
Length=357

 Score =   429 bits (1104),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 196/302 (65%), Positives = 233/302 (77%), Gaps = 1/302 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             TE  HHRL D  K AL+KIF  PYATVCELYCG  PD +KW+ A +GHYIGIDV++SG+ 
Sbjct  13    TEQTHHRLYDFAKTALVKIFAHPYATVCELYCGGAPDADKWESASVGHYIGIDVSSSGIV  72

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
               +EAWESQRK Y  E  E DPC ++L+  L  K  +AD+V C  +LQLCF +EE AR+L
Sbjct  73    AVREAWESQRKNYPVEFFEADPCKDNLENQLSAKAGEADLVCCWQHLQLCFGNEESARRL  132

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L+NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+  GMKPN+ PNCIRSE+Y I F
Sbjct  133   LNNVAHLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGGMKPNVFPNCIRSENYLITF  192

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGK+YQ+KF+ D ++E   LVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  193   EVEEEKFPLFGKRYQLKFSGDDNSENHFLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNR  252

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRN-ND  304
              QF  ML +   N +DPRGRLLPR +D+LGL+ TF+ QKPDPD+ PPL TP    +  N 
Sbjct  253   TQFASMLMNAGPNFLDPRGRLLPRPFDLLGLYATFILQKPDPDLAPPLTTPVAFEQTYNH  312

Query  303   DE  298
             DE
Sbjct  313   DE  314



>ref|XP_003602217.1| mRNA cap guanine-N7 methyltransferase [Medicago truncatula]
 gb|AES72468.1| mRNA cap guanine-N7 methyltransferase [Medicago truncatula]
Length=359

 Score =   429 bits (1104),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 244/305 (80%), Gaps = 2/305 (1%)
 Frame = -2

Query  1194  SFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEK  1015
             S H RL D  K+ALIKIF  PYATVCELYCG+  D  KW ++QI +YIGIDV++S + + 
Sbjct  16    SNHQRLYDFAKMALIKIFAHPYATVCELYCGEASDAHKWLDSQIANYIGIDVSSSAIQQI  75

Query  1014  KEAW-ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
             +++  ++  K  TT    +DP TE ++  L+DK N  D V C+ +LQLCFE+EEKAR+LL
Sbjct  76    RQSLGDNNNKSCTTHFFHLDPSTESIEIRLEDKTNTVDFVCCLQHLQLCFETEEKARRLL  135

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NVSSLLKPGGYFLGIT DSSTIWAKYQKNVE+YHN+ S MKPNIVPNCIR+E+YTIAFE
Sbjct  136   QNVSSLLKPGGYFLGITPDSSTIWAKYQKNVESYHNRSSSMKPNIVPNCIRTENYTIAFE  195

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             VEEEKFP FGKKYQ+KFAND+SAET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R 
Sbjct  196   VEEEKFPLFGKKYQLKFANDVSAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRA  255

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRN-NDD  301
             Q  G+L +   NL+D RG+LLPR+YDVLGL+TTF+FQKPDP+I PP+ TP +   + N D
Sbjct  256   QLAGLLTNYAPNLLDTRGKLLPRSYDVLGLYTTFIFQKPDPEIAPPITTPILQDASYNLD  315

Query  300   EASEY  286
             E + +
Sbjct  316   EGTSW  320



>ref|XP_006360495.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=252

 Score =   425 bits (1093),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 199/250 (80%), Positives = 222/250 (89%), Gaps = 3/250 (1%)
 Frame = -2

Query  1236  ATSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGH  1057
             A SFP   HRP  ES HHRL+D VK  LI IFVSPYATVC++YCGKVPD EKWDEAQIGH
Sbjct  4     ANSFP--THRP-AESTHHRLLDFVKSVLINIFVSPYATVCDMYCGKVPDVEKWDEAQIGH  60

Query  1056  YIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQ  877
             YIGIDV TSG+NE KEAW+SQRK YT+E IE+DPC ED+ +  +DK+ QAD+VFCMHNLQ
Sbjct  61    YIGIDVETSGVNEVKEAWKSQRKAYTSEFIELDPCIEDIDSFWKDKEKQADVVFCMHNLQ  120

Query  876   LCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVP  697
              CF+SEEKAR+LLHNVS+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+  GMKPNIVP
Sbjct  121   ACFDSEEKARRLLHNVSALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGGMKPNIVP  180

Query  696   NCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIE  517
             +CIRSE+Y I FEVEEEKFPFFGKKYQ+KFA+DISAETQCLVHFPSL+RLAREAGL++ E
Sbjct  181   SCIRSENYMITFEVEEEKFPFFGKKYQLKFASDISAETQCLVHFPSLLRLAREAGLEHTE  240

Query  516   IQNLTDFYDD  487
             IQNLTDFYDD
Sbjct  241   IQNLTDFYDD  250



>ref|XP_010312581.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X3 
[Solanum lycopersicum]
Length=253

 Score =   424 bits (1090),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/254 (79%), Positives = 224/254 (88%), Gaps = 3/254 (1%)
 Frame = -2

Query  1248  MIPPATSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEA  1069
             M+  A SFPI  HRP  ES HHRL+D VK  LI IFVSPYATVC++YCGKVPD EKWDEA
Sbjct  1     MMMMANSFPI--HRP-AESTHHRLLDFVKNVLIGIFVSPYATVCDMYCGKVPDVEKWDEA  57

Query  1068  QIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCM  889
             QIGHYIGIDV  SG+NE KEAWESQRK YT+E IE+D C ED+++  +DK+ QAD+VFCM
Sbjct  58    QIGHYIGIDVEASGVNEVKEAWESQRKAYTSEFIELDLCIEDIESFWKDKEKQADVVFCM  117

Query  888   HNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKP  709
             HNLQ CF+SEEKAR+LLHNVS+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+  GMKP
Sbjct  118   HNLQACFDSEEKARRLLHNVSALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGGMKP  177

Query  708   NIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGL  529
             NIVP+CIRSE+Y I FEVEEEKFPFFGKKYQ+KFA+DISAETQCLVHFPSL+RLAREAGL
Sbjct  178   NIVPSCIRSENYMITFEVEEEKFPFFGKKYQLKFASDISAETQCLVHFPSLLRLAREAGL  237

Query  528   DYIEIQNLTDFYDD  487
             ++ EIQNLTDFYDD
Sbjct  238   EHTEIQNLTDFYDD  251



>emb|CDX73651.1| BnaC08g23520D [Brassica napus]
Length=356

 Score =   427 bits (1099),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 232/303 (77%), Gaps = 1/303 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+IKIF  PY TVCELYCG+ PD EKW+ A IGHYIGID ++SGM+ 
Sbjct  11    EQSHHRLFDFAKTAIIKIFAHPYTTVCELYCGEAPDTEKWEAALIGHYIGIDTSSSGMSC  70

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWES RK Y  E  E DP  EDL+  ++    + D+V C  +LQLCFE+EE AR+LL
Sbjct  71    VREAWESHRKSYNVEFFEADPSKEDLEIKVEKIVGEVDLVSCWRHLQLCFETEESARRLL  130

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+  G KPN+ PN IRSESY I FE
Sbjct  131   SNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGGTKPNVFPNYIRSESYMITFE  190

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             VEEEKFP FGK+YQ+KF+ D   E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  191   VEEEKFPLFGKRYQLKFSGDNPPEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  250

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNND-D  301
             QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP     +ND D
Sbjct  251   QFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLSTPIPFENSNDND  310

Query  300   EAS  292
             EAS
Sbjct  311   EAS  313



>ref|XP_009115930.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Brassica 
rapa]
Length=355

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 232/304 (76%), Gaps = 0/304 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+IKIF  PY TVCELYCG+ PD EKW+ A IGHYIGID ++SG++ 
Sbjct  12    EQSHHRLFDFAKTAIIKIFAHPYTTVCELYCGEAPDTEKWEAALIGHYIGIDTSSSGISC  71

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWES RK Y  E  E DP  EDL+  ++    + D+V C  +LQLCFE+EE AR+LL
Sbjct  72    VREAWESHRKSYNVEFFEADPSKEDLEIKVEKIVGEVDLVSCWRHLQLCFETEENARRLL  131

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+  G KPN+ PN IRSESY I FE
Sbjct  132   TNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGGTKPNVFPNYIRSESYMITFE  191

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             VEEEKFP FGK+YQ+KF+ D   E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  192   VEEEKFPLFGKRYQLKFSGDNPPEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  251

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
             QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP     +ND++
Sbjct  252   QFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLSTPIPFESSNDND  311

Query  297   ASEY  286
               E+
Sbjct  312   EREF  315



>emb|CDX78072.1| BnaA09g32670D [Brassica napus]
Length=357

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/303 (65%), Positives = 232/303 (77%), Gaps = 1/303 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+IKIF  PY TVCELYCG+ PD EKW+ A IGHYIGID ++SG++ 
Sbjct  12    EQSHHRLFDFAKTAIIKIFAHPYTTVCELYCGEAPDTEKWEAALIGHYIGIDTSSSGISC  71

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWES RK Y  E  E DP  EDL+  ++    + D+V C  +LQLCFE+EE AR+LL
Sbjct  72    VREAWESHRKSYNVEFFEADPSKEDLEIKVEKIVGEVDLVSCWRHLQLCFETEENARRLL  131

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+  G KPN+ PN IRSESY I FE
Sbjct  132   TNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGGTKPNVFPNYIRSESYMITFE  191

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             VEEEKFP FGK+YQ+KF+ D   E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  192   VEEEKFPLFGKRYQLKFSGDNPPEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  251

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNND-D  301
             QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP     +ND D
Sbjct  252   QFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLSTPIPFESSNDND  311

Query  300   EAS  292
             EAS
Sbjct  312   EAS  314



>ref|XP_010515676.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Camelina 
sativa]
Length=350

 Score =   423 bits (1088),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 235/301 (78%), Gaps = 3/301 (1%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL DI K A+I IF  PY TVCELYCG+ PD +KW+ A IGHYIGID ++SG++ 
Sbjct  10    EQSHHRLFDIAKTAIINIFAHPYTTVCELYCGEAPDTDKWEAAPIGHYIGIDTSSSGISS  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +DL+T LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  70    VREAWESQRKNYDVEFFEADPSKDDLETQLQKKLGQADLVSCWRHLQLCFETEESARRLL  129

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPNI PN IRSESY I FE
Sbjct  130   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGTKPNIFPNYIRSESYVITFE  188

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGKKYQ+KF+ + ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  189   LEEEKFPLFGKKYQLKFSGENASEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  248

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMT--PFIVRRNND  304
                 +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL T  PF V  N+D
Sbjct  249   HTGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTPVPFEVSNNHD  308

Query  303   D  301
             +
Sbjct  309   E  309



>ref|XP_010067169.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X4 
[Eucalyptus grandis]
 ref|XP_010067170.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X4 
[Eucalyptus grandis]
Length=295

 Score =   421 bits (1081),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/289 (69%), Positives = 228/289 (79%), Gaps = 9/289 (3%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  + ALIKIFV PYATVCELYCG   + E+W+EAQIGHYIGIDV +SG++EK+E
Sbjct  13    HHRLHEFARNALIKIFVHPYATVCELYCGGGLEAERWEEAQIGHYIGIDVTSSGISEKRE  72

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES RK YTT+  E+DPCTEDL+ HLQ+K NQAD+V C+ +LQLCFESE+K RKLLHNV
Sbjct  73    AWESLRKAYTTDFYELDPCTEDLEAHLQEKMNQADLVCCLQHLQLCFESEDKVRKLLHNV  132

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKP IVPNCIRSESY I FE EE
Sbjct  133   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPGIVPNCIRSESYMITFEGEE  192

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+K A D+ AET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +  F 
Sbjct  193   EKFPSFGKRYQLKLAGDMPAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKAIFA  252

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
             GML     +++DPRGRLLPR+YDVL         +  P    P   P I
Sbjct  253   GMLMGYGASVVDPRGRLLPRSYDVL---------EARPGCCAPTYNPLI  292



>ref|XP_009602176.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X3 
[Nicotiana tomentosiformis]
Length=289

 Score =   419 bits (1078),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/245 (80%), Positives = 216/245 (88%), Gaps = 1/245 (0%)
 Frame = -2

Query  1215  AHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVA  1036
             +HRP  E  HHRL+D VK ALIKIFVSPYATVC++YCGKV D EKWDEAQIGHYIGIDVA
Sbjct  5     SHRP-GELTHHRLLDFVKTALIKIFVSPYATVCDMYCGKVADVEKWDEAQIGHYIGIDVA  63

Query  1035  TSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEE  856
              SG+ E KEAWESQRK YT+E IE+DPC ED+ ++ +DK+ QADIVFCMHNLQLCF SEE
Sbjct  64    MSGVKEVKEAWESQRKAYTSEFIELDPCIEDIDSYWKDKEKQADIVFCMHNLQLCFNSEE  123

Query  855   KARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSES  676
             KAR+LLHNVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+   MKPNIVPNCIRSE+
Sbjct  124   KARRLLHNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSGAMKPNIVPNCIRSEN  183

Query  675   YTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF  496
             Y I FEVEEEKF FFGKKYQ+KFA+DISAET CLVHFPSL+RLAREAGL+  EIQNLTDF
Sbjct  184   YMITFEVEEEKFSFFGKKYQLKFASDISAETHCLVHFPSLLRLAREAGLENTEIQNLTDF  243

Query  495   YDDYR  481
             YDD R
Sbjct  244   YDDNR  248



>ref|XP_006403826.1| hypothetical protein EUTSA_v10010496mg [Eutrema salsugineum]
 gb|ESQ45279.1| hypothetical protein EUTSA_v10010496mg [Eutrema salsugineum]
Length=353

 Score =   421 bits (1083),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 237/318 (75%), Gaps = 1/318 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             +E  HHRL D  K A+I IF  PY TVCELYCG+ PD +KW+ A IGHYIGID ++SG++
Sbjct  9     SEQSHHRLFDFAKTAIINIFAHPYTTVCELYCGEAPDIDKWEAAPIGHYIGIDTSSSGIS  68

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
               +EAWESQRK Y  E    DP  +DL+  LQ    QAD+V C  +LQLCFE+EE AR+L
Sbjct  69    CVREAWESQRKNYDVEFFGADPSKDDLEIQLQKNVGQADLVSCWRHLQLCFETEESARRL  128

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+  G KPN+ PN IRSESY I F
Sbjct  129   LSNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGGTKPNVFPNYIRSESYMITF  188

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             E+EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+Y+EIQNLTDFYDD R
Sbjct  189   ELEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEYVEIQNLTDFYDDNR  248

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNN-D  304
              QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP     +N  
Sbjct  249   AQFATLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLTTPIPFDCSNIH  308

Query  303   DEASEYHSTKHILQVSHS  250
             DEA    +T+ I     S
Sbjct  309   DEAKLSGNTETIAPAEDS  326



>ref|XP_010067166.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Eucalyptus grandis]
Length=343

 Score =   421 bits (1081),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 194/265 (73%), Positives = 223/265 (84%), Gaps = 0/265 (0%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  + ALIKIFV PYATVCELYCG   + E+W+EAQIGHYIGIDV +SG++EK+E
Sbjct  13    HHRLHEFARNALIKIFVHPYATVCELYCGGGLEAERWEEAQIGHYIGIDVTSSGISEKRE  72

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES RK YTT+  E+DPCTEDL+ HLQ+K NQAD+V C+ +LQLCFESE+K RKLLHNV
Sbjct  73    AWESLRKAYTTDFYELDPCTEDLEAHLQEKMNQADLVCCLQHLQLCFESEDKVRKLLHNV  132

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+   MKP IVPNCIRSESY I FE EE
Sbjct  133   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSGSMKPGIVPNCIRSESYMITFEGEE  192

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+K A D+ AET CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +  F 
Sbjct  193   EKFPSFGKRYQLKLAGDMPAETHCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKAIFA  252

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVL  394
             GML     +++DPRGRLLPR+YDVL
Sbjct  253   GMLMGYGASVVDPRGRLLPRSYDVL  277



>gb|AIU50867.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Solanum tuberosum]
Length=255

 Score =   417 bits (1072),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 207/287 (72%), Positives = 232/287 (81%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL+D VK  LI IFVSPYATVC++YCG V   EKWDEAQIGHYIGID         KE
Sbjct  1     HHRLLDFVKSVLINIFVSPYATVCDMYCGDV---EKWDEAQIGHYIGID---------KE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AW+SQRK YT+E IE+DPC ED+ +  +DKD    +VFCMHNLQ CF+SEEKAR+LLHNV
Sbjct  49    AWKSQRKAYTSEFIELDPCIEDIDSFWKDKD----VVFCMHNLQACFDSEEKARRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+      NIVP+CIRSE+Y I FEVEE
Sbjct  105   SALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNR------NIVPSCIRSENYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA+D     QCLVHFPSL+RLAREAGL++ EIQNLTDFYDD R QF+
Sbjct  159   EKFPFFGKKYQLKFASD-----QCLVHFPSLLRLAREAGLEHTEIQNLTDFYDDNRAQFL  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N  DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL TP
Sbjct  214   GML-----NFFDPRGRLLPRSYDVLGLYTTFIFQKHDPDIAPPLTTP  255



>ref|XP_010426832.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Camelina sativa]
Length=350

 Score =   421 bits (1081),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/301 (65%), Positives = 234/301 (78%), Gaps = 3/301 (1%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL DI K A+I IF  PY TVCELYCG+ PD +KW+ A IGHYIGID A+SG++ 
Sbjct  10    EQSHHRLFDIAKTAIINIFAHPYTTVCELYCGEAPDTDKWEAAPIGHYIGIDTASSGISY  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +DL+  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  70    VREAWESQRKNYDVEFFEADPSKDDLEIQLQKKLGQADLVSCWRHLQLCFETEESARRLL  129

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  130   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGTKPNVFPNYIRSESYVITFE  188

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGK+YQ+KF+ + ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  189   LEEEKFPLFGKRYQLKFSGETASEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  248

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMT--PFIVRRNND  304
                 +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL T  PF V  N+D
Sbjct  249   HTGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTPVPFEVSNNHD  308

Query  303   D  301
             +
Sbjct  309   E  309



>ref|XP_010908937.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X3 
[Elaeis guineensis]
Length=352

 Score =   420 bits (1080),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 228/301 (76%), Gaps = 24/301 (8%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIFV PYATVC+LYCG   D +KWDEAQIGHYIGID +TSG++
Sbjct  21    AESAHHRLYEFAKTALIKIFVFPYATVCDLYCGGGADTDKWDEAQIGHYIGIDASTSGIS  80

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             E +E WESQRK YT E  E+DP                          LCFE+EE+AR L
Sbjct  81    EAREVWESQRKPYTAEFCELDPSV------------------------LCFENEERARSL  116

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYF GIT DSSTIW KYQKNVEA H KGSG+KPN VPNCIRSE+Y I F
Sbjct  117   LHNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHGKGSGLKPNTVPNCIRSENYVITF  176

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFANDI++ET CLVHFPSLIRLAREAGL+Y+E+QNLT+FYDD R
Sbjct  177   EVEEEKFPLFGKKYQLKFANDITSETHCLVHFPSLIRLAREAGLEYVEMQNLTEFYDDNR  236

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDD  301
              QF GML     N +DPRG+LL R+YD+LGL++ FVFQKPDPD+ PP+MTP +   N+  
Sbjct  237   AQFAGMLFSYGANFVDPRGKLLARSYDLLGLYSIFVFQKPDPDVVPPIMTPMLQDGNHAH  296

Query  300   E  298
             E
Sbjct  297   E  297



>gb|AIU50875.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Solanum lycopersicum]
Length=255

 Score =   415 bits (1067),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/287 (72%), Positives = 232/287 (81%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL+D VK  LI IFVSPYATVC++YCG V   EKWDEAQIGHYIGID         KE
Sbjct  1     HHRLLDFVKNVLIGIFVSPYATVCDMYCGDV---EKWDEAQIGHYIGID---------KE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK YT+E IE+D C ED+++  +DKD    +VFCMHNLQ CF+SEEKAR+LLHNV
Sbjct  49    AWESQRKAYTSEFIELDLCIEDIESFWKDKD----VVFCMHNLQACFDSEEKARRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S+LLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+      NIVP+CIRSE+Y I FEVEE
Sbjct  105   SALLKPGGYFLGITPDSSTIWAKYQKNVEAYHNR------NIVPSCIRSENYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA+D     QCLVHFPSL+RLAREAGL++ EIQNLTDFYDD R QF+
Sbjct  159   EKFPFFGKKYQLKFASD-----QCLVHFPSLLRLAREAGLEHTEIQNLTDFYDDNRAQFL  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N  DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL TP
Sbjct  214   GML-----NFFDPRGRLLPRSYDVLGLYTTFIFQKHDPDIAPPLTTP  255



>ref|XP_006851777.1| hypothetical protein AMTR_s00040p00232710 [Amborella trichopoda]
 gb|ERN13244.1| hypothetical protein AMTR_s00040p00232710 [Amborella trichopoda]
Length=406

 Score =   420 bits (1080),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 235/293 (80%), Gaps = 2/293 (1%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             TES H+RL +  K ALIKIFVSPY++VC+LYCG   D +KW EAQI HYIGID ++SG+N
Sbjct  8     TESIHYRLYEFAKTALIKIFVSPYSSVCDLYCGGGEDTDKWYEAQISHYIGIDASSSGIN  67

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             E +E WESQR+ YT E  E+DPC E L+  LQDK    D+V C+ +LQLCFE+EE+A+ L
Sbjct  68    EAREMWESQRRPYTAEFCELDPCVETLELFLQDKGIPTDLVCCLQHLQLCFETEERAKSL  127

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSS+LKPGG+F GIT DSSTIW+KYQKN+EA HNKG  +K +++P CIRSESYTI F
Sbjct  128   LRNVSSILKPGGFFFGITPDSSTIWSKYQKNIEALHNKGINLK-SMLPICIRSESYTITF  186

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             E E+EKFP FGKKYQ+KFA D+S+ET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  187   EAEDEKFPLFGKKYQLKFAGDVSSETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  246

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFI  322
              QF G L     NL+DPRGRLL R++DVLGL+TTFVFQKPD D+ P + TP +
Sbjct  247   AQFAGFLSS-GGNLVDPRGRLLARSFDVLGLYTTFVFQKPDRDVVPSIGTPIM  298



>ref|XP_009393125.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=382

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 242/305 (79%), Gaps = 0/305 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIF  PYATVC+LYCG   + +KWD+AQIGHYIG+D + SG++
Sbjct  28    AESAHHRLYEFAKTALIKIFAFPYATVCDLYCGGGANTDKWDDAQIGHYIGVDASLSGIS  87

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             E ++ WE QRK YT E  E+DP  E+L ++L DK   ADIV C+ +LQ CFESEEK R L
Sbjct  88    EARDMWEGQRKPYTAEFCELDPSVENLDSYLHDKGTPADIVCCLQHLQSCFESEEKVRSL  147

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLL+PGGYF GIT DSSTIWAKYQKNVEA HNKG GMKPN VP+CIRSE+Y I F
Sbjct  148   LRNVSSLLRPGGYFFGITPDSSTIWAKYQKNVEACHNKGIGMKPNAVPSCIRSENYVITF  207

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND+++ET CLVHFPSLIRLAR+AGL+Y+EIQNL +FYDD R
Sbjct  208   EVEEEKFPLFGKKYQLKFANDMTSETHCLVHFPSLIRLARDAGLEYVEIQNLAEFYDDNR  267

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDD  301
              QF GML     N +DPRG+LL R++D+LGL++TFVFQKPDPD+ PP++TP ++  N   
Sbjct  268   TQFAGMLFSYGANFVDPRGKLLARSFDLLGLYSTFVFQKPDPDVVPPVVTPMLLDGNYSH  327

Query  300   EASEY  286
             E  E+
Sbjct  328   EEHEW  332



>ref|XP_006291397.1| hypothetical protein CARUB_v10017536mg [Capsella rubella]
 gb|EOA24295.1| hypothetical protein CARUB_v10017536mg [Capsella rubella]
Length=352

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 239/314 (76%), Gaps = 7/314 (2%)
 Frame = -2

Query  1233  TSFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHY  1054
             + FP+      +E  HHRL D+ K A+I IF  PY TVCELYCG+  D +KW+ A IGHY
Sbjct  2     SGFPVSK----SEQSHHRLFDLAKTAIINIFAHPYTTVCELYCGEAHDTDKWEAAPIGHY  57

Query  1053  IGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQL  874
             IGID ++SG++  +EAWESQRK Y  E  E DP  +DL   LQ K  QAD+V C  +LQ+
Sbjct  58    IGIDTSSSGISSVREAWESQRKNYDVEFFEADPSKDDLGIQLQTKLGQADLVSCWRHLQV  117

Query  873   CFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPN  694
             CFE+EE AR+LL NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN
Sbjct  118   CFETEESARRLLTNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGTKPNVFPN  176

Query  693   CIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEI  514
              IRSE+Y I FE+EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+Y+EI
Sbjct  177   YIRSETYMITFELEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEYVEI  236

Query  513   QNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
             Q+LTDFYDD R Q   +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL 
Sbjct  237   QSLTDFYDDNRAQIGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLT  296

Query  333   T--PFIVRRNNDDE  298
             T  PF V  N+D++
Sbjct  297   TPIPFEVSNNHDEK  310



>ref|XP_010503952.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Camelina 
sativa]
Length=349

 Score =   416 bits (1070),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 193/300 (64%), Positives = 230/300 (77%), Gaps = 1/300 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL DI K A+I IF  PY TVCEL+CG+ PD +KW+ A IGHY GI  ++SG++ 
Sbjct  10    EQSHHRLFDIAKTAIINIFAHPYTTVCELHCGEAPDTDKWEAAPIGHYFGIATSSSGISS  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +DL+ HLQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  70    VREAWESQRKNYDVEFFEADPSKDDLEIHLQKKLGQADLVSCWRHLQLCFETEESARRLL  129

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  130   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGTKPNVFPNYIRSESYVITFE  188

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGK+YQ+KF+ + ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  189   LEEEKFPLFGKRYQLKFSGENASEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  248

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
                 +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL TP      N DE
Sbjct  249   HTGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTPVPFEVTNHDE  308



>ref|XP_009393124.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=383

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 240/301 (80%), Gaps = 0/301 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K ALIKIF  PYATVC+LYCG   + +KWD+AQIGHYIG+D + SG++
Sbjct  28    AESAHHRLYEFAKTALIKIFAFPYATVCDLYCGGGANTDKWDDAQIGHYIGVDASLSGIS  87

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             E ++ WE QRK YT E  E+DP  E+L ++L DK   ADIV C+ +LQ CFESEEK R L
Sbjct  88    EARDMWEGQRKPYTAEFCELDPSVENLDSYLHDKGTPADIVCCLQHLQSCFESEEKVRSL  147

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLL+PGGYF GIT DSSTIWAKYQKNVEA HNKG GMKPN VP+CIRSE+Y I F
Sbjct  148   LRNVSSLLRPGGYFFGITPDSSTIWAKYQKNVEACHNKGIGMKPNAVPSCIRSENYVITF  207

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND+++ET CLVHFPSLIRLAR+AGL+Y+EIQNL +FYDD R
Sbjct  208   EVEEEKFPLFGKKYQLKFANDMTSETHCLVHFPSLIRLARDAGLEYVEIQNLAEFYDDNR  267

Query  480   PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDD  301
              QF GML     N +DPRG+LL R++D+LGL++TFVFQKPDPD+ PP++TP ++  N   
Sbjct  268   TQFAGMLFSYGANFVDPRGKLLARSFDLLGLYSTFVFQKPDPDVVPPVVTPMLLDGNYSH  327

Query  300   E  298
             E
Sbjct  328   E  328



>ref|NP_190789.3| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q5HZ60.1|MCES2_ARATH RecName: Full=mRNA cap guanine-N7 methyltransferase 2; AltName: 
Full=mRNA (guanine-N(7)-)-methyltransferase 2; AltName: Full=mRNA 
cap methyltransferase 2 [Arabidopsis thaliana]
 gb|AAW38965.1| At3g52210 [Arabidopsis thaliana]
 gb|AAW78590.1| At3g52210 [Arabidopsis thaliana]
 gb|AEE78914.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=354

 Score =   416 bits (1069),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 232/303 (77%), Gaps = 2/303 (1%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+I IF  PYATVCELYCG  P+ +KW+ A IGHYIGID  +SG++ 
Sbjct  10    EQSHHRLFDFAKTAIINIFAHPYATVCELYCGGAPETDKWEAAPIGHYIGIDT-SSGISS  68

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +D +  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  69    VREAWESQRKNYDVEFFEADPSKDDFEIQLQKKLEQADLVSCWRHLQLCFETEESARRLL  128

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  129   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGAKPNVFPNYIRSESYMITFE  187

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+++EIQ+LTDFYDD R 
Sbjct  188   LEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEFVEIQSLTDFYDDNRA  247

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
             QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPDI PPL TP     +N+ +
Sbjct  248   QFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDIEPPLTTPIPFESSNNHD  307

Query  297   ASE  289
               E
Sbjct  308   ERE  310



>ref|NP_001030844.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE78916.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   416 bits (1069),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 231/303 (76%), Gaps = 1/303 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+I IF  PYATVCELYCG  P+ +KW+ A IGHYIGI   +SG++ 
Sbjct  10    EQSHHRLFDFAKTAIINIFAHPYATVCELYCGGAPETDKWEAAPIGHYIGIVDTSSGISS  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +D +  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  70    VREAWESQRKNYDVEFFEADPSKDDFEIQLQKKLEQADLVSCWRHLQLCFETEESARRLL  129

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  130   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGAKPNVFPNYIRSESYMITFE  188

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+++EIQ+LTDFYDD R 
Sbjct  189   LEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEFVEIQSLTDFYDDNRA  248

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
             QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPDI PPL TP     +N+ +
Sbjct  249   QFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDIEPPLTTPIPFESSNNHD  308

Query  297   ASE  289
               E
Sbjct  309   ERE  311



>gb|AIU50879.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Lactuca sativa]
Length=255

 Score =   412 bits (1058),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/287 (71%), Positives = 231/287 (80%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL+++VK ALIKIFVSPYATVC+LYCG   DEE+WDEAQIGH+IGID         +E
Sbjct  1     HHRLLEVVKTALIKIFVSPYATVCDLYCG---DEERWDEAQIGHFIGID---------QE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK YT++  E+DPC E+L+ +L DKD    IV CM +LQ CFESEEK R+LLHNV
Sbjct  49    AWESQRKTYTSDFYELDPCIENLEPNLGDKD----IVCCMQHLQFCFESEEKVRRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGY +GIT DSSTIWAKYQKNVEAYHN+      N+VPNCIRSE+Y I FEVEE
Sbjct  105   SSLLKPGGYLIGITLDSSTIWAKYQKNVEAYHNR------NLVPNCIRSENYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQMK AND      CLVHFPSLIRLAREAGL+Y+EIQNL +FYDD R QF 
Sbjct  159   EKFPFFGKKYQMKIAND-----HCLVHFPSLIRLAREAGLEYVEIQNLLEFYDDNRAQFS  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML      L+DPRGRLLP+ YDVLGL+TTF+FQKPDPD+ PPLMTP
Sbjct  214   GML-----GLVDPRGRLLPKFYDVLGLYTTFIFQKPDPDVAPPLMTP  255



>ref|XP_002876130.1| mRNA capping enzyme family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52389.1| mRNA capping enzyme family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 234/310 (75%), Gaps = 2/310 (1%)
 Frame = -2

Query  1218  YAHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDV  1039
             +A   P +S + RL D  K A+I IF  PY TVCELYCG  PD +KW+ A IGHYIGI  
Sbjct  4     FAVSKPEQSLY-RLFDFAKTAIINIFAHPYTTVCELYCGGAPDTDKWEAAPIGHYIGIVD  62

Query  1038  ATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESE  859
              +SG++  +EAWESQRK Y  E  E DP  +DL+  LQ K  QAD+V C  +LQLCFE+E
Sbjct  63    TSSGISSVREAWESQRKNYDVEFFEADPSKDDLEIQLQKKLGQADLVSCWRHLQLCFETE  122

Query  858   EKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSE  679
             E AR+LL NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSE
Sbjct  123   ESARRLLTNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGAKPNVFPNYIRSE  181

Query  678   SYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             SY I FE+EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTD
Sbjct  182   SYMITFELEEEKFPLFGKRYQLKFSGDSASEDHCLVHFPSLIRLAREAGLEYVEIQSLTD  241

Query  498   FYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIV  319
             FYDD R QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP   
Sbjct  242   FYDDNRAQFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLTTPIPF  301

Query  318   RRNNDDEASE  289
               +N+ +  E
Sbjct  302   ESSNNHDERE  311



>dbj|BAD43168.1| putative protein [Arabidopsis thaliana]
Length=355

 Score =   414 bits (1063),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 230/303 (76%), Gaps = 1/303 (0%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+I IF  PYATVCELYCG  P+ +KW+ A IGHYIGI   +SG++ 
Sbjct  10    EQSHHRLFDFAKTAIINIFAHPYATVCELYCGGAPETDKWEAAPIGHYIGIVDTSSGISS  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y     E DP  +D +  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  70    VREAWESQRKNYDVGFFEADPSKDDFEIQLQKKLEQADLVSCWRHLQLCFETEESARRLL  129

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  130   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGAKPNVFPNYIRSESYMITFE  188

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+++EIQ+LTDFYDD R 
Sbjct  189   LEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEFVEIQSLTDFYDDNRA  248

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
             QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPDPDI PPL TP     +N+ +
Sbjct  249   QFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPDPDIEPPLTTPIPFESSNNHD  308

Query  297   ASE  289
               E
Sbjct  309   ERE  311



>ref|XP_010426835.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X4 [Camelina sativa]
Length=348

 Score =   412 bits (1060),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 233/301 (77%), Gaps = 5/301 (2%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL DI K A+I IF  PY TVCELYCG+ PD +KW+ A IGHYIGI  A+SG++ 
Sbjct  10    EQSHHRLFDIAKTAIINIFAHPYTTVCELYCGEAPDTDKWEAAPIGHYIGI--ASSGISY  67

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +DL+  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  68    VREAWESQRKNYDVEFFEADPSKDDLEIQLQKKLGQADLVSCWRHLQLCFETEESARRLL  127

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  128   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGTKPNVFPNYIRSESYVITFE  186

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRP  478
             +EEEKFP FGK+YQ+KF+ + ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R 
Sbjct  187   LEEEKFPLFGKRYQLKFSGETASEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRA  246

Query  477   QFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMT--PFIVRRNND  304
                 +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL T  PF V  N+D
Sbjct  247   HTGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTPVPFEVSNNHD  306

Query  303   D  301
             +
Sbjct  307   E  307



>gb|AIU50869.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Prunus persica]
Length=255

 Score =   409 bits (1050),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 227/287 (79%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K AL +IFV PYATVCELYCG   D EKWDEAQIGHYIGID         +E
Sbjct  1     HHRLYEFAKAALTRIFVHPYATVCELYCG---DAEKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK YT +  E+DPC ED++ HL+D+D    +V C+ NLQLCFE+EE+ARKLL NV
Sbjct  49    AWESQRKAYTADFFELDPCMEDVEIHLKDQD----LVCCLKNLQLCFETEERARKLLLNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      NIVPNCIRSE+Y I FEVE+
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NIVPNCIRSENYMITFEVED  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFAND-----HCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GM+     NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL TP
Sbjct  214   GMI-----NLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLTTP  255



>gb|AIU50882.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Platanus x acerifolia]
Length=255

 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 229/287 (80%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H+RL +  K +LIKIFVSPYATVC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HYRLYEFAKTSLIKIFVSPYATVCDLYCG---DTDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT +  E+DPC E+L++HLQ+KD    IV C+ +LQLCFE+EE+AR LLHNV
Sbjct  49    IWESQRKPYTADFCEVDPCVENLESHLQEKD----IVCCLQHLQLCFETEERARSLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEA HNK      NIVPNCIRSESY I FEVEE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEASHNK------NIVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+K AND      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKLAND-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRGRLLPR++DVLGL+TTF+FQKP+PD+TPP++TP
Sbjct  214   GML-----NFVDPRGRLLPRSFDVLGLYTTFIFQKPNPDVTPPILTP  255



>gb|AIU50864.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Manihot esculenta]
Length=255

 Score =   404 bits (1039),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 224/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K+ALIKIFV PYATVC+LYCG   D EKWD AQIGHYIGID         +E
Sbjct  1     HHRLYEFAKLALIKIFVHPYATVCDLYCG---DAEKWDGAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES+RK YT E  E DPCTE+    LQ+KD    +V C+ NLQLCFE+EE ARKLLHNV
Sbjct  49    AWESRRKSYTAEFFEADPCTENFGVQLQEKD----LVCCLQNLQLCFENEESARKLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      NIVPNCIRSESY I FEVEE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NIVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFA+D      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +    
Sbjct  159   EKFPLFGKKYQLKFAHD-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKMHLA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     NL+DPRGRLLPR++DVLGL+TTF+FQKPDPD+ PPL TP
Sbjct  214   GML-----NLVDPRGRLLPRSFDVLGLYTTFIFQKPDPDVAPPLATP  255



>ref|NP_001048305.1| Os02g0780600 [Oryza sativa Japonica Group]
 sp|Q6K833.1|MCES2_ORYSJ RecName: Full=mRNA cap guanine-N7 methyltransferase 2; AltName: 
Full=mRNA (guanine-N(7)-)-methyltransferase 2; AltName: Full=mRNA 
cap methyltransferase 2 [Oryza sativa Japonica Group]
 dbj|BAD19434.1| mRNA capping enzyme family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF10219.1| Os02g0780600 [Oryza sativa Japonica Group]
 dbj|BAG90499.1| unnamed protein product [Oryza sativa Japonica Group]
Length=339

 Score =   406 bits (1043),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 232/297 (78%), Gaps = 4/297 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYC    D +KW +AQIGHYIGID + SG+N+ +E
Sbjct  6     HHRLYEFAKTALIKIFAFPYATVCDLYCDGGVDTDKWGDAQIGHYIGIDASASGVNDARE  65

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES++K++T+E IE+DP  +D +  +Q+K  QADIV CM +LQLCFESEE A+KLL+NV
Sbjct  66    LWESRKKLFTSEFIELDPSADDFEAQMQEKGIQADIVCCMQHLQLCFESEEHAQKLLNNV  125

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF+GI  DSSTIW KYQKNVEA HNKG       VPN IRSE+Y I FEVEE
Sbjct  126   SSLLKPGGYFVGIIPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYVITFEVEE  181

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAN+   E  CLVHFPS +RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  182   EKFPFFGKKYQLKFANESMFENHCLVHFPSFMRLAREAGLEYVEIQNLTEFYDDNRTQFA  241

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
              +L     +L+DPRG+L+ R++D+LGL++TFVFQKPDPD  PP++TP +    ND E
Sbjct  242   PLLGGYGSSLVDPRGKLVARSFDILGLYSTFVFQKPDPDAMPPIVTPELHDPENDQE  298



>gb|EEC74116.1| hypothetical protein OsI_09172 [Oryza sativa Indica Group]
Length=339

 Score =   405 bits (1042),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 232/297 (78%), Gaps = 4/297 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYC    D +KW +AQIGHYIGID + SG+N+ +E
Sbjct  6     HHRLYEFAKTALIKIFAFPYATVCDLYCDDGVDTDKWGDAQIGHYIGIDASASGVNDARE  65

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES++K++T+E IE+DP  +D +  +Q+K  QADIV CM +LQLCFESEE A+KLL+NV
Sbjct  66    LWESRKKLFTSEFIELDPSADDFEAQMQEKGIQADIVCCMQHLQLCFESEEHAQKLLNNV  125

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF+GI  DSSTIW KYQKNVEA HNKG       VPN IRSE+Y I FEVEE
Sbjct  126   SSLLKPGGYFVGIIPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYVITFEVEE  181

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAN+   E  CLVHFPS +RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  182   EKFPFFGKKYQLKFANESMFENHCLVHFPSFMRLAREAGLEYVEIQNLTEFYDDNRTQFA  241

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
              +L     +L+DPRG+L+ R++D+LGL++TFVFQKPDPD  PP++TP +    ND E
Sbjct  242   PLLGGYGSSLVDPRGKLVARSFDILGLYSTFVFQKPDPDAMPPIVTPELHDPENDQE  298



>gb|AIU50839.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Magnolia denudata]
Length=255

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/287 (69%), Positives = 224/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL D  K ALIKIFVSPYATVC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRLYDFAKTALIKIFVSPYATVCDLYCG---DTDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT +  E+DPC E+L++HLQDKD    IV C+ +LQLCFE+EE+ R LLHNV
Sbjct  49    MWESQRKPYTADFCELDPCVENLESHLQDKD----IVCCLQHLQLCFETEERVRSLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGIT DSSTIW KYQKNVEA HNK S      VPNCIRSESY I FEVEE
Sbjct  105   SSLLKPGGYFLGITPDSSTIWTKYQKNVEASHNKNS------VPNCIRSESYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KF ND      CLVHFPSLIRLARE GL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFTND-----HCLVHFPSLIRLAREVGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     N +DPRG+LL R++DVLGL+TTF+FQKPDP++ PP+MTP
Sbjct  214   GLL-----NFVDPRGKLLARSFDVLGLYTTFIFQKPDPNVEPPIMTP  255



>gb|AIU50865.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Erythranthe guttata]
Length=255

 Score =   400 bits (1027),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 227/287 (79%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRLI+ VK ALI IFVSPYATVC+LYCG   DEEKWDEAQIGHYIGID         +E
Sbjct  1     HHRLIEFVKAALINIFVSPYATVCDLYCG---DEEKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES+RK YT+E +E DPC ED+  H ++KD    IVFCM +L LC E+EEK ++LL N+
Sbjct  49    AWESRRKGYTSEFLEFDPCIEDIDLHWKNKD----IVFCMQHLPLCVETEEKVKRLLSNI  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S+LLKPGGYFLGIT DSSTIWAKYQKNVEA HN+      NIVPNCIRSESY I FEVEE
Sbjct  105   STLLKPGGYFLGITPDSSTIWAKYQKNVEACHNR------NIVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA D       LVHFPSL+RLAREAGL+++EIQNLT+FYDD R Q  
Sbjct  159   EKFPFFGKKYQLKFAGD-----HYLVHFPSLLRLAREAGLEHVEIQNLTEFYDDNRAQLA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     NL+D RGRLLPR+YDVLGL+TTF+FQKPDPDI PPLMTP
Sbjct  214   GML-----NLVDQRGRLLPRSYDVLGLYTTFIFQKPDPDIAPPLMTP  255



>ref|XP_006648009.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Oryza brachyantha]
Length=342

 Score =   403 bits (1035),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 234/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYC    D +KW +AQIG YIGID +  G+N+ +E
Sbjct  6     HHRLYEFAKTALIKIFAFPYATVCDLYCDGGVDTDKWGDAQIGQYIGIDASALGVNDARE  65

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES+RK +T E I++DP  +D +  +Q+K  QADIV CM +LQ CF+SEE A+KLL+NV
Sbjct  66    LWESKRKPFTAEFIKLDPSADDFEAQMQEKGIQADIVCCMQHLQSCFQSEEHAQKLLNNV  125

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF+GI  DSSTIW KYQKNVEA H K  G+K   VPN IRSE+Y I FE+EE
Sbjct  126   SSLLKPGGYFVGIIPDSSTIWTKYQKNVEASHGKVQGLK--AVPNSIRSENYVITFEIEE  183

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAN+   E  CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  184   EKFPFFGKKYQLKFANESIFENHCLVHFPSLMRLAREAGLEYVEIQNLTEFYDDNRTQFA  243

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDEASE  289
              +L   + +L+DPRG+L+ R+YD+LGL++TFVFQKPDPD  PP++TP +    N  E  E
Sbjct  244   PLLGSFSASLVDPRGKLVARSYDILGLYSTFVFQKPDPDAIPPIVTPEVHDPENAQEEQE  303

Query  288   YHSTKH  271
             +H T+ 
Sbjct  304   WHWTQQ  309



>gb|AIU50878.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Vitis vinifera]
Length=255

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 225/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFVSPYATVC+LY G   D +KWDEAQIGHYIGID         KE
Sbjct  1     HHRLFEFAKTALIKIFVSPYATVCDLYAG---DADKWDEAQIGHYIGID---------KE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK Y  +  E+DP  E+L+ +LQDKD    +V C+ +LQL FE+E+K R+LLHNV
Sbjct  49    VWESQRKSYNADFYELDPSMENLELNLQDKD----VVCCLQHLQLGFENEDKGRRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             +SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      NIVPNCIRSESY I FEVEE
Sbjct  105   ASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NIVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KF+ND      CLVHFPSLIRLAREAGL+Y+EIQNLTDFYDD R QF 
Sbjct  159   EKFPFFGKKYQLKFSNDY-----CLVHFPSLIRLAREAGLEYVEIQNLTDFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     NL+DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL +P
Sbjct  214   GML-----NLVDPRGRLLPRSYDVLGLYTTFIFQKVDPDIVPPLTSP  255



>gb|AIU50868.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Populus trichocarpa]
Length=255

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 223/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K A+IKIF  PYATVC+LYCG   D EKWD AQI HYIGID         KE
Sbjct  1     HHRLYEFAKSAIIKIFAHPYATVCDLYCG---DIEKWDAAQITHYIGID---------KE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES +K YT +  + DPC+E+ +T LQ+KD    +V C+ NLQLCFE+EE ARKLLHNV
Sbjct  49    TWESLKKNYTADFFQADPCSENFETQLQEKD----LVCCLQNLQLCFETEESARKLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             +SLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      NIVPNCIRSESY I FEVEE
Sbjct  105   ASLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NIVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFA+D      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFAHD-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRTQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GM+     NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL TP
Sbjct  214   GMI-----NLVDPRGRLLPRSYDVLGLYTTFIFQKPDPDVAPPLTTP  255



>gb|EEE57913.1| hypothetical protein OsJ_08607 [Oryza sativa Japonica Group]
Length=344

 Score =   399 bits (1026),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 232/302 (77%), Gaps = 9/302 (3%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYC    D +KW +AQIGHYIGID + SG+N+ +E
Sbjct  6     HHRLYEFAKTALIKIFAFPYATVCDLYCDGGVDTDKWGDAQIGHYIGIDASASGVNDARE  65

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQ-----LCFESEEKARK  844
              WES++K++T+E IE+DP  +D +  +Q+K  QADIV CM +LQ     LCFESEE A+K
Sbjct  66    LWESRKKLFTSEFIELDPSADDFEAQMQEKGIQADIVCCMQHLQASCLQLCFESEEHAQK  125

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSLLKPGGYF+GI  DSSTIW KYQKNVEA HNKG       VPN IRSE+Y I 
Sbjct  126   LLNNVSSLLKPGGYFVGIIPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYVIT  181

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFPFFGKKYQ+KFAN+   E  CLVHFPS +RLAREAGL+Y+EIQNLT+FYDD 
Sbjct  182   FEVEEEKFPFFGKKYQLKFANESMFENHCLVHFPSFMRLAREAGLEYVEIQNLTEFYDDN  241

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNND  304
             R QF  +L     +L+DPRG+L+ R++D+LGL++TFVFQKPDPD  PP++TP +    ND
Sbjct  242   RTQFAPLLGGYGSSLVDPRGKLVARSFDILGLYSTFVFQKPDPDAMPPIVTPELHDPEND  301

Query  303   DE  298
              E
Sbjct  302   QE  303



>ref|XP_006648010.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Oryza brachyantha]
Length=341

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 234/306 (76%), Gaps = 3/306 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYC    D +KW +AQIG YIGID +  G+N+ +E
Sbjct  6     HHRLYEFAKTALIKIFAFPYATVCDLYCDGGVDTDKWGDAQIGQYIGIDASALGVNDARE  65

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES+RK +T E I++DP  +D +  +Q+K  QADIV CM +LQ CF+SEE A+KLL+NV
Sbjct  66    LWESKRKPFTAEFIKLDPSADDFEAQMQEKGIQADIVCCMQHLQSCFQSEEHAQKLLNNV  125

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF+GI  DSSTIW KYQKNVEA H K  G+K   VPN IRSE+Y I FE+EE
Sbjct  126   SSLLKPGGYFVGIIPDSSTIWTKYQKNVEASHGKVQGLK--AVPNSIRSENYVITFEIEE  183

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAN+   E  CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  184   EKFPFFGKKYQLKFANESIFENHCLVHFPSLMRLAREAGLEYVEIQNLTEFYDDNRTQFA  243

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDEASE  289
              +L   + +L+DPRG+L+ R+YD+LGL++TFVFQKPDPD  PP++TP +    N  E  E
Sbjct  244   PLLGSFSASLVDPRGKLVARSYDILGLYSTFVFQKPDPDAIPPIVTPEVHDPENAQE-EE  302

Query  288   YHSTKH  271
             +H T+ 
Sbjct  303   WHWTQQ  308



>gb|AIU50851.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Eucalyptus grandis]
Length=255

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 224/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  + ALIKIFV PYATVCELYCG+    E+W+EAQIGHYIGID         +E
Sbjct  1     HHRLHEFARNALIKIFVHPYATVCELYCGEA---ERWEEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWES RK YTT+  E+DPCTEDL+ HLQ+KD    +V C+ +LQLCFESE+K RKLLHNV
Sbjct  49    AWESLRKAYTTDFYELDPCTEDLEAHLQEKD----LVCCLQHLQLCFESEDKVRKLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+G      IVPNCIRSESY I FE EE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRG------IVPNCIRSESYMITFEGEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+K A D      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +  F 
Sbjct  159   EKFPSFGKRYQLKLAGD-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKAIFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     +++DPRGRLLPR+YDVLGL+T F+FQKPDPD  PPL TP
Sbjct  214   GML-----SVVDPRGRLLPRSYDVLGLYTMFIFQKPDPDAAPPLTTP  255



>gb|AIU50852.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Glycine max]
Length=255

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 224/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
               RL D  K+ALI IFV PYATVC+LYCG   D +KW  AQIGHYIGID         +E
Sbjct  1     QQRLYDFAKMALINIFVHPYATVCDLYCG---DADKWAHAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE+ RK YT E  E+DPCTE+++THL++KD    +V C+ +LQLCFE+EEKARKLLHNV
Sbjct  49    TWETHRKSYTAEFFELDPCTENIETHLEEKD----VVCCLQHLQLCFETEEKARKLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK      NIVPNCIR+E+Y I FEVEE
Sbjct  105   SSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNK------NIVPNCIRTENYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R Q  
Sbjct  159   EKFPLFGKKYQLKFANDY-----CLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQLA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     NL+DPRGRLLPR+YD LGL+TTF+FQKPDP+I PP+ TP
Sbjct  214   GLL-----NLLDPRGRLLPRSYDALGLYTTFIFQKPDPEIAPPIPTP  255



>gb|AIU50854.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Buxus sinica]
Length=255

 Score =   394 bits (1011),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 228/287 (79%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H+RL +  K ALIKIFVSPYA VC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HYRLYEFAKTALIKIFVSPYAKVCDLYCG---DTDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              W+SQRK YT +  E+DPC E+L+++LQDKD    +V C+ +LQLCFE+EE+AR LL+NV
Sbjct  49    IWDSQRKPYTADFCELDPCVENLESYLQDKD----LVCCLQHLQLCFETEERARSLLNNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVE  HNKG      I+PNCIRSE+Y I FEV+E
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEVCHNKG------IIPNCIRSENYMITFEVDE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKK+Q+KFAND      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPFFGKKFQLKFAND-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRGRLLPR++DVLGL+TTF+FQKPD D+TPP++TP
Sbjct  214   GML-----NFVDPRGRLLPRSFDVLGLYTTFIFQKPDRDLTPPILTP  255



>ref|XP_010426831.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Camelina sativa]
Length=352

 Score =   395 bits (1016),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/303 (63%), Positives = 232/303 (77%), Gaps = 5/303 (2%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL DI K A+I IF  PY TVCELYCG+ PD +KW+ A IGHYIGID A+SG++ 
Sbjct  10    EQSHHRLFDIAKTAIINIFAHPYTTVCELYCGEAPDTDKWEAAPIGHYIGIDTASSGISY  69

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +DL+  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  70    VREAWESQRKNYDVEFFEADPSKDDLEIQLQKKLGQADLVSCWRHLQLCFETEESARRLL  129

Query  837   HNVSSLLKPGGYF-LGITTDS-STIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              NV+ LLKPGGYF +G+ + + S+  AKYQKNVEAYHN+ SG KPN+ PN IRSESY I 
Sbjct  130   TNVACLLKPGGYFFVGLRSLTFSSHRAKYQKNVEAYHNR-SGTKPNVFPNYIRSESYVIT  188

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FE+EEEKFP FGK+YQ+KF+ + ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD 
Sbjct  189   FELEEEKFPLFGKRYQLKFSGETASEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDN  248

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMT--PFIVRRN  310
             R     +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL T  PF V  N
Sbjct  249   RAHTGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTPVPFEVSNN  308

Query  309   NDD  301
             +D+
Sbjct  309   HDE  311



>ref|XP_004976295.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X1 [Setaria italica]
 ref|XP_004976296.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Setaria italica]
 ref|XP_004976297.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X3 [Setaria italica]
Length=344

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/297 (63%), Positives = 231/297 (78%), Gaps = 4/297 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL +  K ALIKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+++ +E
Sbjct  12    HLRLYEFAKTALIKIFSFPYATVCDLYCDGGVDTDKWCDAQVGHYIGIDASASGVSDARE  71

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++RK +T E IE+DP  +D +  +Q+K  QADIV CM +LQLCFESEE+A+KLL+NV
Sbjct  72    LWENKRKPFTAEFIELDPSDDDFEAQVQEKGIQADIVCCMQHLQLCFESEERAKKLLNNV  131

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF G+T DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEE
Sbjct  132   SSLLKPGGYFFGMTPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEE  187

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA++   E  CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  188   EKFPFFGKKYQLKFASEAVFENHCLVHFPSLMRLAREAGLEYVEIQNLTEFYDDNRIQFA  247

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
              ML   + + +D RG+L+ R+YD+LGL++TFVFQKPDPD  PP++TP +   +N  E
Sbjct  248   PMLGGYSASFLDARGKLVTRSYDILGLYSTFVFQKPDPDAIPPIVTPDLHDTDNAHE  304



>gb|AIU50859.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Pandanus utilis]
Length=255

 Score =   390 bits (1002),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 225/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF SPYATVC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRLYEFAKTALIKIFASPYATVCDLYCG---DLDKWDEAQIGHYIGID---------QE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             +WESQRK YT E  E+DPC EDL++HLQ+KD    +V C+ +LQLCFESEE+A++LLHNV
Sbjct  49    SWESQRKPYTAEFCELDPCAEDLESHLQEKD----MVCCLQHLQLCFESEERAKRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEA H+K      N VPNCIRS++Y I FEV+E
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEASHSK------NAVPNCIRSDNYVITFEVDE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFAND-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     N +DPRG+LL R+YD+L L+TTFVF+KPDP+  PP +TP
Sbjct  214   GIL-----NFVDPRGKLLSRSYDILVLYTTFVFRKPDPETIPPSLTP  255



>tpg|DAA36851.1| TPA: S-adenosylmethionine-dependent methyltransferase/ catalytic 
[Zea mays]
Length=344

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 232/306 (76%), Gaps = 4/306 (1%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+
Sbjct  6     PPQSPHLRLYDFAKSAIIKIFAFPYATVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGV  65

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+K
Sbjct  66    NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKK  125

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSLLKPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  126   LLNNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTIT  181

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFPFFGKKYQ+KFA+D   E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD 
Sbjct  182   FEVEEEKFPFFGKKYQLKFASDAVFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDN  241

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNND  304
             R QF  ML     + +D RG+L+ R+YD+LGL++ FVFQKPDP+  PP++TP +   +  
Sbjct  242   RTQFAPMLGGYGASFLDARGKLVARSYDILGLYSAFVFQKPDPEAIPPIVTPDLPDPDKG  301

Query  303   DEASEY  286
              E  E+
Sbjct  302   HEEQEW  307



>gb|ACN34047.1| unknown [Zea mays]
Length=343

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/292 (63%), Positives = 227/292 (78%), Gaps = 4/292 (1%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+
Sbjct  6     PPQSPHLRLYDFAKSAIIKIFAFPYATVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGV  65

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+K
Sbjct  66    NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKK  125

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSLLKPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  126   LLNNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTIT  181

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFPFFGKKYQ+KFA+D   E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD 
Sbjct  182   FEVEEEKFPFFGKKYQLKFASDAVFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDN  241

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             R QF  ML     + +D RG+L+ R+YD+LGL++ FVFQKPDP+  PP++TP
Sbjct  242   RTQFAPMLGGYGASFLDARGKLVARSYDILGLYSAFVFQKPDPEAIPPIVTP  293



>gb|AIU50847.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Gossypium raimondii]
Length=255

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 225/287 (78%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HH+L +  K ALIKIFV PYATVC+LYCG   D EKWD AQI HY+GID         +E
Sbjct  1     HHKLYEFAKTALIKIFVHPYATVCDLYCG---DAEKWDGAQISHYVGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK +T+E  E DPCT++L+T LQ+KD    +V C+ +LQL FE+E+KAR+LL NV
Sbjct  49    AWESQRKSFTSEFFEADPCTDNLETLLQEKD----LVCCLQHLQLRFETEDKARRLLSNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      NIVPNCIRSE+Y I FE+EE
Sbjct  105   SFLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NIVPNCIRSENYMITFEIEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KF++D      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD +  F 
Sbjct  159   EKFPLFGKKYQLKFSSD-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNKSLFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GM+     NL+DPRGRLLPR+YDVLGL+TTF+FQKPDPD+ PPL TP
Sbjct  214   GMM-----NLLDPRGRLLPRSYDVLGLYTTFIFQKPDPDVVPPLATP  255



>ref|XP_002446819.1| hypothetical protein SORBIDRAFT_06g023140 [Sorghum bicolor]
 gb|EES11147.1| hypothetical protein SORBIDRAFT_06g023140 [Sorghum bicolor]
Length=344

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/306 (60%), Positives = 233/306 (76%), Gaps = 4/306 (1%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL +  K ALI+IF  PYATVC+LYC    D +KW + Q+GHYIGID + SG+
Sbjct  6     PPQSPHLRLYEFAKSALIRIFAFPYATVCDLYCDGGVDTDKWCDCQVGHYIGIDASASGV  65

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N+ +E W+++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQLCFESEE+A+K
Sbjct  66    NDARELWDNKRKPFTAEFIELDPTDDGFEAQVQEKGIQADMVCCMQHLQLCFESEERAKK  125

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSLLKPGGYF G+T DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  126   LLNNVSSLLKPGGYFFGLTPDSSTIWTKYQKNVEASHNKGL----KAVPNSIRSENYTIT  181

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFP FGKKYQ+KFA+D   E  CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD 
Sbjct  182   FEVEEEKFPVFGKKYQLKFASDAVFENHCLVHFPSLLRLAREAGLEYVEIQNLTEFYDDN  241

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNND  304
             R QF  ML   + + +D RG+L+ R+YD+LGL++TFVFQKPDPD  PP+++P +   +N 
Sbjct  242   RTQFAPMLGGYSASFLDARGKLVARSYDILGLYSTFVFQKPDPDAIPPIVSPDLHDPDNA  301

Query  303   DEASEY  286
              E  E+
Sbjct  302   HEEQEW  307



>ref|XP_008667195.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=424

 Score =   393 bits (1009),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 232/306 (76%), Gaps = 4/306 (1%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+
Sbjct  86    PPQSPHLRLYDFAKSAIIKIFAFPYATVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGV  145

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+K
Sbjct  146   NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKK  205

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSLLKPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  206   LLNNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTIT  261

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFPFFGKKYQ+KFA+D   E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD 
Sbjct  262   FEVEEEKFPFFGKKYQLKFASDAVFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDN  321

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNND  304
             R QF  ML     + +D RG+L+ R+YD+LGL++ FVFQKPDP+  PP++TP +   +  
Sbjct  322   RTQFAPMLGGYGASFLDARGKLVARSYDILGLYSAFVFQKPDPEAIPPIVTPDLPDPDKG  381

Query  303   DEASEY  286
              E  E+
Sbjct  382   HEEQEW  387



>ref|XP_008667196.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=423

 Score =   392 bits (1007),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/292 (63%), Positives = 227/292 (78%), Gaps = 4/292 (1%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+
Sbjct  86    PPQSPHLRLYDFAKSAIIKIFAFPYATVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGV  145

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+K
Sbjct  146   NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKK  205

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSLLKPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  206   LLNNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTIT  261

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FEVEEEKFPFFGKKYQ+KFA+D   E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD 
Sbjct  262   FEVEEEKFPFFGKKYQLKFASDAVFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDN  321

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             R QF  ML     + +D RG+L+ R+YD+LGL++ FVFQKPDP+  PP++TP
Sbjct  322   RTQFAPMLGGYGASFLDARGKLVARSYDILGLYSAFVFQKPDPEAIPPIVTP  373



>gb|AIU50844.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Acorus calamus]
Length=255

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 220/287 (77%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFVSPYATVC+LYCG   D +KWD+AQIGHYIGID          E
Sbjct  1     HHRLYEFAKAALIKIFVSPYATVCDLYCG---DADKWDDAQIGHYIGID---------GE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             +WESQRK YT E  E DPC+E L++ L+DKD    +V C+ +LQLCFESEE+ R LLHNV
Sbjct  49    SWESQRKEYTAEFFEFDPCSETLESRLKDKD----VVCCLQHLQLCFESEERVRSLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLL+PGGYF GI  DSSTIW KYQKNVEA HN+ +      VPNCIRSE+Y I FE EE
Sbjct  105   SSLLRPGGYFFGIIPDSSTIWTKYQKNVEASHNRST------VPNCIRSENYVITFETEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+KFAND       LVHFPSLIR AREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKRYQLKFAND-----HFLVHFPSLIRWAREAGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRGRLLPR++DVLGL++TF+FQKPDPD+ PP+M+P
Sbjct  214   GML-----NFVDPRGRLLPRSFDVLGLYSTFIFQKPDPDMVPPIMSP  255



>gb|ACG35412.1| S-adenosylmethionine-dependent methyltransferase/ catalytic [Zea 
mays]
Length=340

 Score =   389 bits (999),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 224/287 (78%), Gaps = 4/287 (1%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+N  +E
Sbjct  8     HLRLYDFAKSAIIKIFAFPYATVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARE  67

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++RK +T E IE+DP  +  +  +Q+K  Q+D+V CM +LQLCFE+EE+A+KLL+NV
Sbjct  68    LWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQSDMVCCMQHLQLCFENEERAKKLLNNV  127

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEE
Sbjct  128   SSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEE  183

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA+D   E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF 
Sbjct  184   EKFPFFGKKYQLKFASDAVFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFA  243

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     + +D RG+L+ R+YD+LGL++ FVFQKPDPD  PP++TP
Sbjct  244   PMLGGYGASFLDARGKLVARSYDILGLYSAFVFQKPDPDAIPPIVTP  290



>ref|XP_010426834.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X3 [Camelina sativa]
Length=350

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 231/303 (76%), Gaps = 7/303 (2%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL DI K A+I IF  PY TVCELYCG+ PD +KW+ A IGHYIGI  A+SG++ 
Sbjct  10    EQSHHRLFDIAKTAIINIFAHPYTTVCELYCGEAPDTDKWEAAPIGHYIGI--ASSGISY  67

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +DL+  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  68    VREAWESQRKNYDVEFFEADPSKDDLEIQLQKKLGQADLVSCWRHLQLCFETEESARRLL  127

Query  837   HNVSSLLKPGGYF-LGITTDS-STIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              NV+ LLKPGGYF +G+ + + S+  AKYQKNVEAYHN+ SG KPN+ PN IRSESY I 
Sbjct  128   TNVACLLKPGGYFFVGLRSLTFSSHRAKYQKNVEAYHNR-SGTKPNVFPNYIRSESYVIT  186

Query  663   FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
             FE+EEEKFP FGK+YQ+KF+ + ++E  CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD 
Sbjct  187   FELEEEKFPLFGKRYQLKFSGETASEDHCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDN  246

Query  483   RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMT--PFIVRRN  310
             R     +L +   NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL T  PF V  N
Sbjct  247   RAHTGSLLMNAGPNLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTPVPFEVSNN  306

Query  309   NDD  301
             +D+
Sbjct  307   HDE  309



>ref|XP_009368956.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X3 [Pyrus x bretschneideri]
 ref|XP_009368965.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009342469.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X3 [Pyrus x bretschneideri]
Length=261

 Score =   384 bits (986),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 202/240 (84%), Gaps = 0/240 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
              ES HHRL +  K AL +IFV PYATVCELYCG   D EKWD+AQIGHYIGIDV++SG++
Sbjct  10    AESTHHRLYEFAKSALTRIFVHPYATVCELYCGGGVDAEKWDDAQIGHYIGIDVSSSGIS  69

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             +++EAWESQRK YT +  E+DPC ED++ HL+DK N AD+V C+ NLQLCF++EEKARKL
Sbjct  70    QRREAWESQRKAYTADFFELDPCMEDVEMHLKDKANTADLVCCLQNLQLCFQTEEKARKL  129

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NVSSLLKP GYF GIT DSSTIWAKYQKNVEAYHN+  GMKPNIVPNCIRSE+Y I F
Sbjct  130   LLNVSSLLKPRGYFFGITPDSSTIWAKYQKNVEAYHNRSGGMKPNIVPNCIRSENYMITF  189

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             EVEEEKFP FGKKYQ+KFAND S E   LVHFPS IRLAREAGL+Y+EIQNLT+FYDD R
Sbjct  190   EVEEEKFPIFGKKYQLKFANDFSPENHVLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNR  249



>gb|AIU50858.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Chimonanthus praecox]
Length=255

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 219/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H+RL +  K ALIKIFVSPYA VC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HYRLYEFAKTALIKIFVSPYAAVCDLYCG---DIDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK    E  ++DPC E L+++LQDKD    IV C+ +LQL FESEE+AR LLHNV
Sbjct  49    LWESQRKPCAAEFCDLDPCVEKLESYLQDKD----IVCCLQHLQLSFESEERARALLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLL+PGGYF GIT DSSTIW KYQKNVEA HNK      N V NCIR+ESY I FEVEE
Sbjct  105   SSLLRPGGYFFGITPDSSTIWTKYQKNVEASHNK------NTVANCIRTESYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KF ND      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFTND-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRAQFS  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRG+LL R++DVLGL++TF+FQKPDPD+ PP+MTP
Sbjct  214   GML-----NFVDPRGKLLARSFDVLGLYSTFIFQKPDPDLMPPIMTP  255



>gb|AIU50846.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Citrus clementina]
 gb|AIU50850.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Citrus sinensis]
Length=255

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 219/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKI+  PY TVC+LYCG V   +KW+ A I +YIGID         ++
Sbjct  1     HHRLYEFAKTALIKIYSHPYVTVCDLYCGDV---DKWETALIANYIGID---------RD  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE+QRK +  E  E DPC E+ +T +Q+KD    +V C  +LQ+CFE+EE+AR+LL NV
Sbjct  49    TWENQRKNFIAEFFEADPCAENFETQMQEKD----LVCCFQHLQMCFETEERARRLLQNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+      N+VPNCIRSESY I FEVEE
Sbjct  105   SSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNR------NLVPNCIRSESYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND     QCLVHFPSLIRLAREAGL+Y+EIQNL +FYDD R  F 
Sbjct  159   EKFPLFGKKYQLKFAND-----QCLVHFPSLIRLAREAGLEYVEIQNLNEFYDDNRALFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     NLIDPRGRLLPR+YDVLGL++TF+FQKPDPD+ PPL TP
Sbjct  214   GML-----NLIDPRGRLLPRSYDVLGLYSTFIFQKPDPDVAPPLATP  255



>ref|XP_010240157.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2 [Brachypodium 
distachyon]
Length=327

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/297 (62%), Positives = 221/297 (74%), Gaps = 15/297 (5%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC++YC    D +KW EAQIGHYIGID +   +++  E
Sbjct  6     HHRLYEFAKAALIKIFAFPYATVCDMYCNGGADTDKWGEAQIGHYIGIDASAPAVSDAHE  65

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++ K +T E I+++P  +D +  LQ+K  +ADIV CM NLQLCFESEE+A+KLL+NV
Sbjct  66    LWENKWKHFTAEFIKLNPSADDFEAQLQEKGIEADIVCCMQNLQLCFESEEQAKKLLNNV  125

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGI  DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI FE+EE
Sbjct  126   SSLLKPGGYFLGIIPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEIEE  181

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAN++  E  CLVHFPSL+RLAREAGL+Y+EIQNLTDFYDD RPQF 
Sbjct  182   EKFPFFGKKYQLKFANEVMFENHCLVHFPSLMRLAREAGLEYVEIQNLTDFYDDNRPQFA  241

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDE  298
              ML +   NL+DPR           GL++ FVFQKPDPD  PP++TP +   +N  E
Sbjct  242   PMLSNFGSNLVDPR-----------GLYSIFVFQKPDPDAIPPIVTPDLHGSDNAHE  287



>gb|AIU50853.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Illicium henryi]
Length=255

 Score =   379 bits (973),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 221/287 (77%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H+RL +  K ALIKIFV PYATVC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HYRLHEFAKTALIKIFVHPYATVCDLYCG---DIDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES+RK YT +  ++DPC E+L++HLQDKD    IV C+ +LQ+CFE+EE+AR LL NV
Sbjct  49    IWESKRKPYTADFRDLDPCMENLESHLQDKD----IVCCLQHLQVCFETEERARSLLCNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSST+W KYQKNVEA HNK      NIVPNCIRSESY+I FE EE
Sbjct  105   SSLLKPGGYFFGITPDSSTLWTKYQKNVEASHNK------NIVPNCIRSESYSITFEAEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFA+D      CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFASD-----HCLVHFPSFIRLAREAGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N ID RGRLL R++D+LGL++TF+FQKPDPD+ PP  +P
Sbjct  214   GML-----NFIDNRGRLLARSFDILGLYSTFIFQKPDPDVVPPSNSP  255



>gb|AIU50835.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Aquilegia coerulea]
Length=255

 Score =   379 bits (972),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 217/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H+RL +  K ALIKIFVSPYATVC+LY G   D +KWDEAQIGHYIGID         +E
Sbjct  1     HYRLYEFAKTALIKIFVSPYATVCDLYSG---DIDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT    E DPC E+L   LQDKD    IV C+ +LQLCFE+EE+AR  L+NV
Sbjct  49    KWESQRKPYTAHFCEFDPCEENLGFLLQDKD----IVCCLQHLQLCFETEERARSFLYNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SS+L+PGGYF GIT DSSTIWAKYQKNVEA HNK      N VPNCIRSESY I FEVEE
Sbjct  105   SSMLRPGGYFFGITPDSSTIWAKYQKNVEASHNK------NQVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+K+AND      CLVHFPSLIRL+REAGL+++EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKYAND-----HCLVHFPSLIRLSREAGLEFVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML       +D RGRLLPR+ DVLGL+TTF+FQKPDPD  PP+MTP
Sbjct  214   GML-----TFVDNRGRLLPRSLDVLGLYTTFIFQKPDPDAIPPIMTP  255



>gb|AIU50872.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Dioscorea oppositifolia]
Length=255

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 218/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFVSPYA++C+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRLYEFAKTALIKIFVSPYASICDLYCG---DLDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
               ESQRK YT E  E+DPC E+L++HL DKD    +  C+ +LQLCFESEE+A+ LL NV
Sbjct  49    VLESQRKPYTAEFCELDPCAENLESHLHDKD----VACCLQHLQLCFESEERAKTLLRNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIW KYQKNVEA HNK S      VPNCIRSE+Y I+FEV+E
Sbjct  105   SSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKNS------VPNCIRSENYVISFEVDE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+KFAN+      CLVHFPSLIRLARE GL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKRYQLKFANE-----HCLVHFPSLIRLAREVGLEYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     N +D RGRLL R+YD+LGL+T FVFQKP+PD  PP +TP
Sbjct  214   GLL-----NFLDHRGRLLSRSYDILGLYTIFVFQKPNPDAIPPSLTP  255



>ref|XP_006578922.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X4 [Glycine max]
Length=253

 Score =   377 bits (967),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 201/238 (84%), Gaps = 1/238 (0%)
 Frame = -2

Query  1200  TESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMN  1021
             ++S   RL D  K+ALI IF  PYATVC+LYCG   D +KW +AQIGHYIGID  +SG+ 
Sbjct  2     SQSTQQRLYDFAKMALINIFAHPYATVCDLYCGDA-DADKWVDAQIGHYIGIDAPSSGIE  60

Query  1020  EKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
             + +EAWE  RK YT E  E+DPCT++ +THL++K N AD+V C+ +LQLCFE+EEKARKL
Sbjct  61    QMREAWEIHRKSYTAEFFELDPCTKNTETHLEEKTNVADVVCCLQHLQLCFETEEKARKL  120

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             LHNVSSLLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I F
Sbjct  121   LHNVSSLLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITF  180

Query  660   EVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
             EVEEEKFP FGKKYQ+KFAND+SAET CLVHFPS IRLAREAGL+Y+EIQNLT+FYDD
Sbjct  181   EVEEEKFPLFGKKYQLKFANDVSAETHCLVHFPSFIRLAREAGLEYVEIQNLTEFYDD  238



>gb|AIU50863.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Canna indica]
Length=255

 Score =   376 bits (966),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 217/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYCG   D +KWD+AQIGHYIG+D         +E
Sbjct  1     HHRLYEFAKTALIKIFAFPYATVCDLYCG---DTDKWDDAQIGHYIGVD---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
               ESQRK YTTE  ++DP  E+L++HL DKD    IV C+ +LQ CFESEEKAR LL NV
Sbjct  49    MLESQRKPYTTEFCKLDPSVENLESHLHDKD----IVCCLQHLQSCFESEEKARSLLRNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEA HNK      NIVP+CIRSE+Y I FEVEE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEASHNK------NIVPSCIRSENYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK YQ+KFAND      CLVHFPSLIRLAR+AGL+Y+EIQNL +FYDD R QF 
Sbjct  159   EKFPSFGKIYQLKFAND-----HCLVHFPSLIRLARDAGLEYVEIQNLAEFYDDNRSQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     N +DPRGRLL R++D+LGL++ FVFQKPDPD  PP+MTP
Sbjct  214   SML-----NFVDPRGRLLARSFDLLGLYSIFVFQKPDPDAAPPIMTP  255



>ref|XP_006436603.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 ref|XP_006436606.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|ESR49843.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|ESR49846.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|KDO55330.1| hypothetical protein CISIN_1g018352mg [Citrus sinensis]
 gb|KDO55331.1| hypothetical protein CISIN_1g018352mg [Citrus sinensis]
Length=248

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P +E  HHRL +  K ALIKI+  PY TVC+LYCG   D +KW+ A I +YIGIDVATSG
Sbjct  7     PRSELTHHRLYEFAKTALIKIYSHPYVTVCDLYCGAGVDVDKWETALIANYIGIDVATSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + E ++ WE+QRK +  E  E DPC E+ +T +Q+K NQAD+V C  +LQ+CFE+EE+AR
Sbjct  67    IGEARDTWENQRKNFIAEFFEADPCAENFETQMQEKANQADLVCCFQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LL NVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+ S MKPN+VPNCIRSESY I
Sbjct  127   RLLQNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSSSMKPNLVPNCIRSESYVI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVEEEKFP FGKKYQ+KFANDISAETQCLVHFPSLIRLAREAGL+Y+EIQNL +FYDD
Sbjct  187   TFEVEEEKFPLFGKKYQLKFANDISAETQCLVHFPSLIRLAREAGLEYVEIQNLNEFYDD  246

Query  486   YR  481
              R
Sbjct  247   NR  248



>ref|XP_006436604.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 ref|XP_006436607.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 ref|XP_006485237.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|ESR49844.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|ESR49847.1| hypothetical protein CICLE_v10031936mg [Citrus clementina]
 gb|KDO55329.1| hypothetical protein CISIN_1g018352mg [Citrus sinensis]
Length=258

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 200/242 (83%), Gaps = 0/242 (0%)
 Frame = -2

Query  1206  PPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSG  1027
             P +E  HHRL +  K ALIKI+  PY TVC+LYCG   D +KW+ A I +YIGIDVATSG
Sbjct  7     PRSELTHHRLYEFAKTALIKIYSHPYVTVCDLYCGAGVDVDKWETALIANYIGIDVATSG  66

Query  1026  MNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
             + E ++ WE+QRK +  E  E DPC E+ +T +Q+K NQAD+V C  +LQ+CFE+EE+AR
Sbjct  67    IGEARDTWENQRKNFIAEFFEADPCAENFETQMQEKANQADLVCCFQHLQMCFETEERAR  126

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             +LL NVSSLLKPGGYFLGIT DSSTIWAKYQKNVEAYHN+ S MKPN+VPNCIRSESY I
Sbjct  127   RLLQNVSSLLKPGGYFLGITPDSSTIWAKYQKNVEAYHNRSSSMKPNLVPNCIRSESYVI  186

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FEVEEEKFP FGKKYQ+KFANDISAETQCLVHFPSLIRLAREAGL+Y+EIQNL +FYDD
Sbjct  187   TFEVEEEKFPLFGKKYQLKFANDISAETQCLVHFPSLIRLAREAGLEYVEIQNLNEFYDD  246

Query  486   YR  481
              R
Sbjct  247   NR  248



>gb|AIU50841.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Pinellia ternata]
Length=254

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 218/287 (76%), Gaps = 33/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL D  K ALIKIFVSPYATVC+LYCG   D EKWD+AQIGHYIGID         +E
Sbjct  1     HHRLYDFAKTALIKIFVSPYATVCDLYCG---DTEKWDDAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT E +E+DP  E+L+ HL+DKD    +V C+ +LQ CFESEE+AR LL NV
Sbjct  49    TWESQRKPYTAEFLELDPSVENLELHLEDKD----VVCCLQHLQ-CFESEERARSLLRNV  103

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             + LLKPGGYFLGIT+DSST+W KYQKNVEA HNK      N+VPN IRSE+Y I FE EE
Sbjct  104   AVLLKPGGYFLGITSDSSTLWTKYQKNVEASHNK------NVVPNSIRSENYIITFETEE  157

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKY +KFAND      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  158   EKFPLFGKKYHLKFAND-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRAQFA  212

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +D RG+LL R +D+LGL++ FVFQKPDP++  P++TP
Sbjct  213   GML-----NFVDLRGKLLARPFDILGLYSIFVFQKPDPNVVLPVLTP  254



>gb|AIU50856.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Chloranthus japonicus]
Length=255

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 215/287 (75%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL +  K ALIKIFVSPY TVC+LY G   D +KWDEAQIGHYIGID         +E
Sbjct  1     HRRLYEFAKTALIKIFVSPYDTVCDLYGG---DTDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT    E+DP +E L++HLQ+KD    IV C+ +LQLCFE+EE+AR LLHNV
Sbjct  49    LWESQRKPYTAFFCELDPSSEKLESHLQEKD----IVCCLQHLQLCFETEERARSLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGG+F GIT DSSTIW KYQKNVEA HNK      N VP+ IRSESY I FEVEE
Sbjct  105   SSLLKPGGFFFGITPDSSTIWTKYQKNVEASHNK------NTVPSSIRSESYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPSLIRLAREAGLDY+EIQNLT+FYDD R QF 
Sbjct  159   EKFPMFGKKYQLKFAND-----HCLVHFPSLIRLAREAGLDYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +D RG+LL R++DVLGL+TTFVFQK DP+  PP  TP
Sbjct  214   GML-----NFVDSRGKLLARSFDVLGLYTTFVFQKLDPNAVPPSSTP  255



>gb|AIU50880.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Ceratophyllum platyacanthum subsp. oryzetorum]
Length=255

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 217/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHR+ D VK ALIKIF SPYATVC+LY G   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRIYDFVKTALIKIFASPYATVCDLYSG---DMDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             +WE+QRK YT + +E DP  ++L++ LQDKD    IV C+  LQLCFESEE+AR+LLHNV
Sbjct  49    SWENQRKPYTAKFLEQDPSVDNLESLLQDKD----IVCCLQQLQLCFESEERARRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GI  DSSTIW KYQKNVE  H+K      ++VPNCIRSE+Y I FEVEE
Sbjct  105   SSLLKPGGYFFGIVPDSSTIWTKYQKNVETAHSK------SMVPNCIRSENYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAND      CLVHF S IRLAREAGLDY+EIQNLT+FYDD R Q  
Sbjct  159   EKFPFFGKKYQLKFAND-----HCLVHFASFIRLAREAGLDYVEIQNLTEFYDDNRAQLA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRG+L+ R+YD+LGL+++FVFQKPD    P LMTP
Sbjct  214   GML-----NFVDPRGKLVTRSYDILGLYSSFVFQKPDLTDAPLLMTP  255



>gb|AIU50855.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Iris japonica]
Length=253

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 216/287 (75%), Gaps = 34/287 (12%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFVSPYA+VC+LYCG   D +KWDEAQIGHYIG+D         +E
Sbjct  1     HHRLYEFAKKALIKIFVSPYASVCDLYCG---DTDKWDEAQIGHYIGVD---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT E  E+DP  EDL + L DKD    IV C+ +LQLCFE+EE+AR LLHNV
Sbjct  49    IWESQRKPYTAEFCELDPSVEDLGSLLHDKD----IVCCLQHLQLCFENEERARSLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIW KYQK VEA HNK        V NCIRS+++ I FEVEE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWTKYQKIVEASHNK--------VQNCIRSDNFVITFEVEE  156

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKY +KFAND      CLVHFPSLIRLAREAGL+Y+EIQNL +FYDD R QF 
Sbjct  157   EKFPFFGKKYMLKFAND-----HCLVHFPSLIRLAREAGLEYVEIQNLAEFYDDNRAQFA  211

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRG+LL R++D+LGL++ FVFQK DPD +PP++TP
Sbjct  212   GML-----NFLDPRGKLLARSFDILGLYSIFVFQKSDPDASPPILTP  253



>gb|AIU50862.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Medicago truncatula]
Length=256

 Score =   371 bits (952),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 216/287 (75%), Gaps = 31/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL D  K+ALIKIF  PYATVCELYCG   D  KW ++QI +YIGID  + G N  K 
Sbjct  1     HQRLYDFAKMALIKIFAHPYATVCELYCG---DAHKWLDSQIANYIGIDRQSLGDNNNKS  57

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
                      TT    +DP TE ++  L+DKD     V C+ +LQLCFE+EEKAR+LL NV
Sbjct  58    C--------TTHFFHLDPSTESIEIRLEDKD----FVCCLQHLQLCFETEEKARRLLQNV  105

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGIT DSSTIWAKYQKNVE+YHN+      NIVPNCIR+E+YTIAFEVEE
Sbjct  106   SSLLKPGGYFLGITPDSSTIWAKYQKNVESYHNR------NIVPNCIRTENYTIAFEVEE  159

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R Q  
Sbjct  160   EKFPLFGKKYQLKFAND-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRAQLA  214

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     NL+D RG+LLPR+YDVLGL+TTF+FQKPDP+I PP+ TP
Sbjct  215   GLL-----NLLDTRGKLLPRSYDVLGLYTTFIFQKPDPEIAPPITTP  256



>gb|AIU50842.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Brachypodium distachyon]
Length=255

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 218/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC++YC    D +KW EAQIGHYIGID          E
Sbjct  1     HHRLYEFAKAALIKIFAFPYATVCDMYCN---DTDKWGEAQIGHYIGID---------HE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++ K +T E I+++P  +D +  LQ+KD    IV CM NLQLCFESEE+A+KLL+NV
Sbjct  49    LWENKWKHFTAEFIKLNPSADDFEAQLQEKD----IVCCMQNLQLCFESEEQAKKLLNNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYFLGI  DSSTIW KYQKNVEA HNK +      VPN IRSE+YTI FE+EE
Sbjct  105   SSLLKPGGYFLGIIPDSSTIWTKYQKNVEASHNKKT------VPNSIRSENYTITFEIEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFAN+      CLVHFPSL+RLAREAGL+Y+EIQNLTDFYDD RPQF 
Sbjct  159   EKFPFFGKKYQLKFANE-----HCLVHFPSLMRLAREAGLEYVEIQNLTDFYDDNRPQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     NL+DPRG+L+ R+YD+LGL++ FVFQKPDPD  PP++TP
Sbjct  214   PML-----NLVDPRGKLIARSYDILGLYSIFVFQKPDPDAIPPIVTP  255



>gb|AIU50873.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Yucca filamentosa]
Length=255

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 213/287 (74%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFVSPYATVC+LYCG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRLYEFAKAALIKIFVSPYATVCDLYCG---DADKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES  K YT E  E DP  E+L+ HLQDKD    IV C+ +LQ+ FESEE+AR LL NV
Sbjct  49    LWESDLKPYTAEFCEFDPSVENLEAHLQDKD----IVCCLQHLQVSFESEERARSLLQNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S++L+PGGYF GIT DSSTIW KYQK VEA HNK S      VPNCIRSE+Y I FEVEE
Sbjct  105   SAMLRPGGYFFGITPDSSTIWTKYQKIVEAAHNKNS------VPNCIRSENYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KF  D     QCLVHFPSLIRLAREAGL+++EIQNLT+FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFFED-----QCLVHFPSLIRLAREAGLEFVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     +  DPRGRLL RA+DVLGL+ TFVFQK DPD+ PP+ TP
Sbjct  214   GIL-----HFTDPRGRLLVRAFDVLGLYATFVFQKTDPDLAPPIFTP  255



>tpg|DAA36850.1| TPA: hypothetical protein ZEAMMB73_136245 [Zea mays]
Length=381

 Score =   373 bits (957),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 232/343 (68%), Gaps = 41/343 (12%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVC-------------------------------  1117
             P +S H RL D  K A+IKIF  PYATVC                               
Sbjct  6     PPQSPHLRLYDFAKSAIIKIFAFPYATVCYMLLSFMIFSSFQISEKLRRNPESNFTFIGC  65

Query  1116  ------ELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDP  955
                   +LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP
Sbjct  66    QMPKVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDP  125

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSS  775
               +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+KLL+NVSSLLKPGGYF GIT DSS
Sbjct  126   SDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKKLLNNVSSLLKPGGYFFGITPDSS  185

Query  774   TIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDI  595
             TIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEEEKFPFFGKKYQ+KFA+D 
Sbjct  186   TIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEEEKFPFFGKKYQLKFASDA  241

Query  594   SAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLL  415
               E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF  ML     + +D RG+L+
Sbjct  242   VFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFAPMLGGYGASFLDARGKLV  301

Query  414   PRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDEASEY  286
              R+YD+LGL++ FVFQKPDP+  PP++TP +   +   E  E+
Sbjct  302   ARSYDILGLYSAFVFQKPDPEAIPPIVTPDLPDPDKGHEEQEW  344



>ref|NP_001132200.1| hypothetical protein [Zea mays]
 gb|ACF80954.1| unknown [Zea mays]
 tpg|DAA36849.1| TPA: hypothetical protein ZEAMMB73_136245 [Zea mays]
Length=380

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/329 (56%), Positives = 227/329 (69%), Gaps = 41/329 (12%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVC-------------------------------  1117
             P +S H RL D  K A+IKIF  PYATVC                               
Sbjct  6     PPQSPHLRLYDFAKSAIIKIFAFPYATVCYMLLSFMIFSSFQISEKLRRNPESNFTFIGC  65

Query  1116  ------ELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDP  955
                   +LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP
Sbjct  66    QMPKVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDP  125

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSS  775
               +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+KLL+NVSSLLKPGGYF GIT DSS
Sbjct  126   SDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKKLLNNVSSLLKPGGYFFGITPDSS  185

Query  774   TIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDI  595
             TIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEEEKFPFFGKKYQ+KFA+D 
Sbjct  186   TIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEEEKFPFFGKKYQLKFASDA  241

Query  594   SAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLL  415
               E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF  ML     + +D RG+L+
Sbjct  242   VFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFAPMLGGYGASFLDARGKLV  301

Query  414   PRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              R+YD+LGL++ FVFQKPDP+  PP++TP
Sbjct  302   ARSYDILGLYSAFVFQKPDPEAIPPIVTP  330



>ref|XP_008667193.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=461

 Score =   374 bits (960),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 232/343 (68%), Gaps = 41/343 (12%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVC-------------------------------  1117
             P +S H RL D  K A+IKIF  PYATVC                               
Sbjct  86    PPQSPHLRLYDFAKSAIIKIFAFPYATVCYMLLSFMIFSSFQISEKLRRNPESNFTFIGC  145

Query  1116  ------ELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDP  955
                   +LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP
Sbjct  146   QMPKVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDP  205

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSS  775
               +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+KLL+NVSSLLKPGGYF GIT DSS
Sbjct  206   SDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKKLLNNVSSLLKPGGYFFGITPDSS  265

Query  774   TIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDI  595
             TIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEEEKFPFFGKKYQ+KFA+D 
Sbjct  266   TIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEEEKFPFFGKKYQLKFASDA  321

Query  594   SAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLL  415
               E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF  ML     + +D RG+L+
Sbjct  322   VFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFAPMLGGYGASFLDARGKLV  381

Query  414   PRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDEASEY  286
              R+YD+LGL++ FVFQKPDP+  PP++TP +   +   E  E+
Sbjct  382   ARSYDILGLYSAFVFQKPDPEAIPPIVTPDLPDPDKGHEEQEW  424



>ref|XP_008667194.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=460

 Score =   374 bits (959),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 184/329 (56%), Positives = 227/329 (69%), Gaps = 41/329 (12%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVC-------------------------------  1117
             P +S H RL D  K A+IKIF  PYATVC                               
Sbjct  86    PPQSPHLRLYDFAKSAIIKIFAFPYATVCYMLLSFMIFSSFQISEKLRRNPESNFTFIGC  145

Query  1116  ------ELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDP  955
                   +LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP
Sbjct  146   QMPKVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDP  205

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSS  775
               +  +  +Q+K  QAD+V CM +LQLCFE+EE+A+KLL+NVSSLLKPGGYF GIT DSS
Sbjct  206   SDDGFEAQVQEKGIQADMVCCMQHLQLCFENEEQAKKLLNNVSSLLKPGGYFFGITPDSS  265

Query  774   TIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDI  595
             TIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEEEKFPFFGKKYQ+KFA+D 
Sbjct  266   TIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEEEKFPFFGKKYQLKFASDA  321

Query  594   SAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLL  415
               E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF  ML     + +D RG+L+
Sbjct  322   VFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFAPMLGGYGASFLDARGKLV  381

Query  414   PRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              R+YD+LGL++ FVFQKPDP+  PP++TP
Sbjct  382   ARSYDILGLYSAFVFQKPDPEAIPPIVTP  410



>gb|AIU50860.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Asparagus officinalis]
Length=255

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/287 (64%), Positives = 215/287 (75%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL D  K ALIKIFVSPYATVC+LYCG   D +KW++A IGHYIGID         +E
Sbjct  1     HHRLYDFAKSALIKIFVSPYATVCDLYCG---DIDKWEDAHIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WES  K YT E  E DP  E+L+ HLQDKD    IV C+ ++Q+CFESEE+AR LL NV
Sbjct  49    VWESDLKPYTAEFCEFDPSVENLELHLQDKD----IVCCLQHVQVCFESEERARSLLQNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S+LL+PGGYF GIT DSSTIW KYQKNVEA HN+      N VPNCIRSE+Y I FEVEE
Sbjct  105   SALLRPGGYFFGITLDSSTIWTKYQKNVEASHNR------NAVPNCIRSENYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKK Q+KF++D      CLVHFPSLIRLAREAGL+++EIQN T+FYDD R Q  
Sbjct  159   EKFPLFGKKCQLKFSDD-----HCLVHFPSLIRLAREAGLEFVEIQNWTEFYDDNRAQLA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             G+L     + +DPRG+LL RA+DVLGL++TFVFQKPDPDI PP+ +P
Sbjct  214   GIL-----HFVDPRGKLLIRAFDVLGLYSTFVFQKPDPDIAPPIFSP  255



>gb|AIU50861.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Aristolochia tagala]
Length=254

 Score =   364 bits (934),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 216/286 (76%), Gaps = 32/286 (11%)
 Frame = -2

Query  1185  HRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEA  1006
             +RL +  K ALIKIF +PYA VC+ YCG   D +KW++AQIGHY+GID         +E 
Sbjct  1     YRLYEFAKTALIKIFATPYAAVCDFYCG---DTDKWNDAQIGHYVGID---------REL  48

Query  1005  WESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVS  826
             WESQ K YT E  E+DPCTE+L+ +LQDKD    IV CM +LQLCFE+EE+AR LL NV+
Sbjct  49    WESQTKPYTAEFCELDPCTENLEAYLQDKD----IVCCMQHLQLCFETEERARSLLQNVA  104

Query  825   SLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEE  646
             SLLKPGGYF G T DSSTIWAKYQK VEA HNK      N V NCIRSE+Y I FEVEEE
Sbjct  105   SLLKPGGYFFGFTPDSSTIWAKYQKVVEASHNK------NPVANCIRSENYIITFEVEEE  158

Query  645   KFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVG  466
             KFPFFGKKYQ+KF ND +     LVHFPSLIRLAREAGL+ +EIQNLT+FY+D R QF G
Sbjct  159   KFPFFGKKYQLKFTNDYN-----LVHFPSLIRLAREAGLECVEIQNLTEFYEDNRAQFAG  213

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             +L     NLIDPRG+LL R++D+LGL++TF+FQKPDP+  PP+ TP
Sbjct  214   LL-----NLIDPRGKLLARSFDILGLYSTFIFQKPDPEFIPPVTTP  254



>gb|AIU50877.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Eutrema parvulum]
Length=255

 Score =   361 bits (927),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 209/287 (73%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL D  K A+I IF  PY TVCELYCG   D +KW+ A IGHYIGID         +E
Sbjct  1     HHRLFDFAKTAIINIFAHPYTTVCELYCG---DIDKWEAAPIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK Y  E    DP  +DL+  LQ    + D+V C  +LQLCFE+EE AR+LL NV
Sbjct  49    AWESQRKNYDVEFFGADPSKDDLEIQLQ----KNDLVSCWRHLQLCFETEESARRLLSNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             + LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      N+ PN IRSESY I FE+EE
Sbjct  105   ACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NVFPNYIRSESYMITFELEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+KF+ D      CLVHFPSLIRLAREAGL+Y+EIQNLTDFYDD R QF 
Sbjct  159   EKFPLFGKRYQLKFSGD-----HCLVHFPSLIRLAREAGLEYVEIQNLTDFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              +L     N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP
Sbjct  214   TLL-----NFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLTTP  255



>gb|AIU50837.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Arabidopsis thaliana]
Length=255

 Score =   360 bits (925),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 180/287 (63%), Positives = 209/287 (73%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL D  K A+I IF  PYATVCELYCG+    +KW+ A IGHYIGI          +E
Sbjct  1     HHRLFDFAKTAIINIFAHPYATVCELYCGET---DKWEAAPIGHYIGI---------VRE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK Y  E  E DP  +D +  LQ KD    +V C  +LQLCFE+EE AR+LL NV
Sbjct  49    AWESQRKNYDVEFFEADPSKDDFEIQLQKKD----LVSCWRHLQLCFETEESARRLLTNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             + LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      N+ PN IRSESY I FE+EE
Sbjct  105   ACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NVFPNYIRSESYMITFELEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+KF+ D      CLVHFPSLIRLAREAGL+++EIQ+LTDFYDD R QF 
Sbjct  159   EKFPLFGKRYQLKFSGD-----HCLVHFPSLIRLAREAGLEFVEIQSLTDFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              +L     N +DPRG+LLPRA+D+LGL+ TF+FQKPDPDI PPL TP
Sbjct  214   SLL-----NFVDPRGKLLPRAFDLLGLYATFIFQKPDPDIEPPLTTP  255



>gb|ACF83829.1| unknown [Zea mays]
 tpg|DAA36847.1| TPA: hypothetical protein ZEAMMB73_136245 [Zea mays]
Length=315

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/279 (61%), Positives = 214/279 (77%), Gaps = 4/279 (1%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTED  943
             VC+LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP  + 
Sbjct  4     VCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDPSDDG  63

Query  942   LKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWA  763
              +  +Q+K  QAD+V CM +LQLCFE+EE+A+KLL+NVSSLLKPGGYF GIT DSSTIW 
Sbjct  64    FEAQVQEKGIQADMVCCMQHLQLCFENEEQAKKLLNNVSSLLKPGGYFFGITPDSSTIWT  123

Query  762   KYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAET  583
             KYQKNVEA HNKG       VPN IRSE+YTI FEVEEEKFPFFGKKYQ+KFA+D   E 
Sbjct  124   KYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEEEKFPFFGKKYQLKFASDAVFEN  179

Query  582   QCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAY  403
             QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF  ML     + +D RG+L+ R+Y
Sbjct  180   QCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFAPMLGGYGASFLDARGKLVARSY  239

Query  402   DVLGLFTTFVFQKPDPDITPPLMTPFIVRRNNDDEASEY  286
             D+LGL++ FVFQKPDP+  PP++TP +   +   E  E+
Sbjct  240   DILGLYSAFVFQKPDPEAIPPIVTPDLPDPDKGHEEQEW  278



>gb|AIU50849.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Capsella rubella]
Length=255

 Score =   359 bits (921),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/287 (63%), Positives = 209/287 (73%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL D+ K A+I IF  PY TVCELYCG   D +KW+ A IGHYIGID         +E
Sbjct  1     HHRLFDLAKTAIINIFAHPYTTVCELYCG---DTDKWEAAPIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK Y  E  E DP  +DL   LQ KD    +V C  +LQ+CFE+EE AR+LL NV
Sbjct  49    AWESQRKNYDVEFFEADPSKDDLGIQLQTKD----LVSCWRHLQVCFETEESARRLLTNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             + LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      N+ PN IRSE+Y I FE+EE
Sbjct  105   ACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NVFPNYIRSETYMITFELEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGK+YQ+KF+ D      CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R Q  
Sbjct  159   EKFPLFGKRYQLKFSGD-----HCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRAQIG  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              +L     NL+DPRG+LLPRA D+LGL+ TF+FQKPDPD+ PPL TP
Sbjct  214   SLL-----NLVDPRGKLLPRALDLLGLYATFIFQKPDPDLEPPLTTP  255



>gb|AIU50845.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Sarcandra glabra]
Length=255

 Score =   358 bits (919),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 184/287 (64%), Positives = 210/287 (73%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL +  KIALIKIFVSPY TVC+LY G   D +KWDEAQIGHYIGID         +E
Sbjct  1     HRRLYEFAKIALIKIFVSPYDTVCDLYSG---DTDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT    E+DP +E L+ HLQDKD    IV C+ +LQLCFE+EE+AR LL NV
Sbjct  49    LWESQRKPYTAFFCELDPSSEKLELHLQDKD----IVCCLQHLQLCFETEERARSLLRNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGG+F G+         KYQKNVEA HNK      N VP+ IRSESY I FE+EE
Sbjct  105   SSLLKPGGFFFGLEPMVIIFRTKYQKNVEASHNK------NTVPSSIRSESYVITFEIEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPSLIRLAREAGLDY+EIQNLT+FYDD R QF 
Sbjct  159   EKFPMFGKKYQLKFAND-----HCLVHFPSLIRLAREAGLDYVEIQNLTEFYDDNRAQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML       +DPRG+LL R++DVLGL+TTFVFQKPDP+  PP++TP
Sbjct  214   GML-----TFVDPRGKLLARSFDVLGLYTTFVFQKPDPNAVPPILTP  255



>gb|AIU50884.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Houttuynia cordata]
Length=254

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/286 (62%), Positives = 214/286 (75%), Gaps = 32/286 (11%)
 Frame = -2

Query  1185  HRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEA  1006
             +RL +  K ALIKIF SPYA VCELYCG   D  KW +AQIGHYIG+D         +E 
Sbjct  1     YRLYEFAKTALIKIFASPYAAVCELYCG---DTHKWLDAQIGHYIGVD---------REV  48

Query  1005  WESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVS  826
             WESQ K       +IDPCTE++++HLQDKD    IV C+ +LQ+CFE+EE+AR+LLHNVS
Sbjct  49    WESQPKPCAVHFFDIDPCTENVESHLQDKD----IVCCLQHLQVCFETEERARRLLHNVS  104

Query  825   SLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEE  646
             +LLKPGGYFLGIT DSSTIW KYQK VEA H+K      N VPN IRSE+Y I FE +EE
Sbjct  105   ALLKPGGYFLGITPDSSTIWTKYQKMVEASHSK------NTVPNYIRSENYIITFEADEE  158

Query  645   KFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVG  466
             KFP FGK+YQ+KFA +      CLVHFPSLIRLAREAGL+Y+EIQNLT+FYDD R QF G
Sbjct  159   KFPLFGKRYQLKFATE-----HCLVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRSQFAG  213

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             +L     N +DPRG+LL R++D+LGL+T+ VFQKPDPD+ PP +TP
Sbjct  214   LL-----NFVDPRGKLLARSFDMLGLYTSIVFQKPDPDVIPPNLTP  254



>gb|AIU50836.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Arabidopsis lyrata]
Length=255

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 208/286 (73%), Gaps = 32/286 (11%)
 Frame = -2

Query  1185  HRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEA  1006
             +RL D  K A+I IF  PY TVCELYCG   D +KW+ A IGHYIGI          +EA
Sbjct  2     YRLFDFAKTAIINIFAHPYTTVCELYCG---DTDKWEAAPIGHYIGI---------VREA  49

Query  1005  WESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVS  826
             WESQRK Y  E  E DP  +DL+  LQ KD    +V C  +LQLCFE+EE AR+LL NV+
Sbjct  50    WESQRKNYDVEFFEADPSKDDLEIQLQKKD----LVSCWRHLQLCFETEESARRLLTNVA  105

Query  825   SLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEE  646
              LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      N+ PN IRSESY I FE+EEE
Sbjct  106   CLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NVFPNYIRSESYMITFELEEE  159

Query  645   KFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVG  466
             KFP FGK+YQ+KF+ D      CLVHFPSLIRLAREAGL+Y+EIQ+LTDFYDD R QF  
Sbjct  160   KFPLFGKRYQLKFSGD-----HCLVHFPSLIRLAREAGLEYVEIQSLTDFYDDNRAQFAS  214

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             +L     N +DPRG+LLPRA+D+LGL+ TF+FQKPDPD+ PPL TP
Sbjct  215   LL-----NFVDPRGKLLPRAFDLLGLYATFIFQKPDPDLEPPLTTP  255



>gb|AIU50870.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Panicum virgatum]
Length=255

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/287 (62%), Positives = 217/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL +  K AL+KIF  PYATVC+LYC    D +KW +AQ+GHYIGID         +E
Sbjct  1     HLRLYEFAKTALVKIFAFPYATVCDLYCD---DTDKWCDAQVGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++RK +T E IE+DP  +D +  +Q+KD    IV CM +LQLCFESEE+A+KLL+NV
Sbjct  49    LWENKRKPFTAEFIELDPSDDDFEAQVQEKD----IVCCMQHLQLCFESEERAKKLLNNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF G+T DSSTIW KYQKNVEA HNK +      VPN IRSE+YTI FEVEE
Sbjct  105   SSLLKPGGYFFGMTPDSSTIWTKYQKNVEASHNKKA------VPNSIRSENYTITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA++      CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPFFGKKYQLKFASE-----HCLVHFPSLMRLAREAGLEYVEIQNLTEFYDDNRTQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     + +D RG+L+ R+YD+LGL++TFVFQKPDPD  PP++TP
Sbjct  214   PML-----SFLDARGKLVTRSYDILGLYSTFVFQKPDPDAIPPIVTP  255



>gb|AIU50874.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Setaria italica]
Length=255

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 217/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL +  K ALIKIF  PYATVC+LYC    D +KW +AQ+GHYIGID         +E
Sbjct  1     HLRLYEFAKTALIKIFSFPYATVCDLYCD---DTDKWCDAQVGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++RK +T E IE+DP  +D +  +Q+KD    IV CM +LQLCFESEE+A+KLL+NV
Sbjct  49    LWENKRKPFTAEFIELDPSDDDFEAQVQEKD----IVCCMQHLQLCFESEERAKKLLNNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF G+T DSSTIW KYQKNVEA HNK +      VPN IRSE+YTI FEVEE
Sbjct  105   SSLLKPGGYFFGMTPDSSTIWTKYQKNVEASHNKKT------VPNSIRSENYTITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA++      CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPFFGKKYQLKFASE-----HCLVHFPSLMRLAREAGLEYVEIQNLTEFYDDNRIQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     + +D RG+L+ R+YD+LGL++TFVFQKPDPD  PP++TP
Sbjct  214   PML-----SFLDARGKLVTRSYDILGLYSTFVFQKPDPDAIPPIVTP  255



>ref|XP_002533936.1| mRNA (guanine-7-)methyltransferase, putative [Ricinus communis]
 gb|EEF28443.1| mRNA (guanine-7-)methyltransferase, putative [Ricinus communis]
Length=258

 Score =   353 bits (907),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 188/234 (80%), Gaps = 12/234 (5%)
 Frame = -2

Query  1230  SFPIYAHRPPTESFHHRLIDIVKIALIKIFVSPYATV--------CELYCGKVPDEEKWD  1075
             SFPI    P TES HHRL +  K ALIKIFV PY TV        C+LYCG V D EKWD
Sbjct  7     SFPI----PRTESTHHRLYEFAKSALIKIFVHPYVTVSALSLNSVCDLYCGGVVDAEKWD  62

Query  1074  EAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVF  895
              AQIGHY+GIDV++SG++E +EAWESQRK YT E  E DPC+E  +  LQ+K NQAD+V 
Sbjct  63    IAQIGHYVGIDVSSSGVSELREAWESQRKNYTAEFFEADPCSEIFEKQLQEKANQADLVC  122

Query  894   CMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGM  715
             C+ NLQLCFE+EE ARKLLHNVSSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ S M
Sbjct  123   CLQNLQLCFETEESARKLLHNVSSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNRSSSM  182

Query  714   KPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLI  553
             KPNIVPNCIRSESY I FEVEEEKFP FGKKYQ+KFA+DISAET CLVHFPSLI
Sbjct  183   KPNIVPNCIRSESYMITFEVEEEKFPLFGKKYQLKFAHDISAETHCLVHFPSLI  236



>gb|AIU50840.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Musa acuminata]
Length=255

 Score =   353 bits (906),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 217/287 (76%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIF  PYATVC+LYCG   + +KWD+AQIGHYIG+D         ++
Sbjct  1     HHRLYEFAKTALIKIFAFPYATVCDLYCG---NTDKWDDAQIGHYIGVD---------RD  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE QRK YT E  E+DP  E+L ++L DKD    IV C+ +LQ CFESEEK R LL NV
Sbjct  49    MWEGQRKPYTAEFCELDPSVENLDSYLHDKD----IVCCLQHLQSCFESEEKVRSLLRNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLL+PGGYF GIT DSSTIWAKYQKNVEA HNK      N VP+CIRSE+Y I FEVEE
Sbjct  105   SSLLRPGGYFFGITPDSSTIWAKYQKNVEACHNK------NAVPSCIRSENYVITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFAND      CLVHFPSLIRLAR+AGL+Y+EIQNL +FYDD R QF 
Sbjct  159   EKFPLFGKKYQLKFAND-----HCLVHFPSLIRLARDAGLEYVEIQNLAEFYDDNRTQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             GML     N +DPRG+LL R++D+LGL++TFVFQKPDPD+ PP++TP
Sbjct  214   GML-----NFVDPRGKLLARSFDLLGLYSTFVFQKPDPDVVPPVVTP  255



>gb|AIU50885.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Zea mays]
Length=255

 Score =   350 bits (899),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 216/287 (75%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID         +E
Sbjct  1     HLRLYDFAKSAIIKIFAFPYATVCDLYCD---DTDKWCDAQVGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WE++RK +T E IE+DP  +  +  +Q+KD    +V CM +LQLCFE+EE+A+KLL+NV
Sbjct  49    LWENRRKPFTAEFIELDPSDDGFEAQVQEKD----MVCCMQHLQLCFENEEQAKKLLNNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIW KYQKNVEA HNK +      VPN IRSE+YTI FEVEE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKKT------VPNSIRSENYTITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFPFFGKKYQ+KFA+D     QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPFFGKKYQLKFASD-----QCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     + +D RG+L+ R+YD+LGL++ FVFQKPDP+  PP++TP
Sbjct  214   PML-----SFLDARGKLVARSYDILGLYSAFVFQKPDPEAIPPIVTP  255



>gb|AIU50876.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Sorghum bicolor]
Length=255

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 214/287 (75%), Gaps = 32/287 (11%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             H RL +  K ALI+IF  PYATVC+LYC    D +KW + Q+GHYIGID         +E
Sbjct  1     HLRLYEFAKSALIRIFAFPYATVCDLYCD---DTDKWCDCQVGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              W+++RK +T E IE+DP  +  +  +Q+KD    +V CM +LQLCFESEE+A+KLL+NV
Sbjct  49    LWDNKRKPFTAEFIELDPTDDGFEAQVQEKD----MVCCMQHLQLCFESEERAKKLLNNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF G+T DSSTIW KYQKNVEA HNK +      VPN IRSE+YTI FEVEE
Sbjct  105   SSLLKPGGYFFGLTPDSSTIWTKYQKNVEASHNKKA------VPNSIRSENYTITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFV  469
             EKFP FGKKYQ+KFA+D      CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF 
Sbjct  159   EKFPVFGKKYQLKFASD-----HCLVHFPSLLRLAREAGLEYVEIQNLTEFYDDNRTQFA  213

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              ML     + +D RG+L+ R+YD+LGL++TFVFQKPDPD  PP+++P
Sbjct  214   PML-----SFLDARGKLVARSYDILGLYSTFVFQKPDPDAIPPIVSP  255



>tpg|DAA36848.1| TPA: hypothetical protein ZEAMMB73_136245 [Zea mays]
Length=420

 Score =   349 bits (896),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 186/382 (49%), Positives = 232/382 (61%), Gaps = 80/382 (21%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVC-------------------------------  1117
             P +S H RL D  K A+IKIF  PYATVC                               
Sbjct  6     PPQSPHLRLYDFAKSAIIKIFAFPYATVCYMLLSFMIFSSFQISEKLRRNPESNFTFIGC  65

Query  1116  ------ELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDP  955
                   +LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP
Sbjct  66    QMPKVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDP  125

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQ--------------LCFESEEKARKLLHNVSSLL  817
               +  +  +Q+K  QAD+V CM +LQ              LCFE+EE+A+KLL+NVSSLL
Sbjct  126   SDDGFEAQVQEKGIQADMVCCMQHLQASWLFSRTVEYDMLLCFENEEQAKKLLNNVSSLL  185

Query  816   KPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFP  637
             KPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI FEVEEEKFP
Sbjct  186   KPGGYFFGITPDSSTIWTKYQKNVEASHNKGL----KTVPNSIRSENYTITFEVEEEKFP  241

Query  636   FFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQ  457
             FFGKKYQ+KFA+D   E QCLVHFP+L+RL+REAGL+Y+EIQNLT+FYDD R QF  ML 
Sbjct  242   FFGKKYQLKFASDAVFENQCLVHFPTLMRLSREAGLEYVEIQNLTEFYDDNRTQFAPMLG  301

Query  456   DVNHNLIDPRGRLLPRAYDV-------------------------LGLFTTFVFQKPDPD  352
                 + +D RG+L+ R+YD+                         LGL++ FVFQKPDP+
Sbjct  302   GYGASFLDARGKLVARSYDILGGVEFFFFLEGQAWCNDESCLTESLGLYSAFVFQKPDPE  361

Query  351   ITPPLMTPFIVRRNNDDEASEY  286
               PP++TP +   +   E  E+
Sbjct  362   AIPPIVTPDLPDPDKGHEEQEW  383



>ref|NP_001030843.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAD44372.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44390.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE78915.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=250

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 186/237 (78%), Gaps = 2/237 (1%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+I IF  PYATVCELYCG  P+ +KW+ A IGHYIGID  +SG++ 
Sbjct  10    EQSHHRLFDFAKTAIINIFAHPYATVCELYCGGAPETDKWEAAPIGHYIGIDT-SSGISS  68

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP  +D +  LQ K  QAD+V C  +LQLCFE+EE AR+LL
Sbjct  69    VREAWESQRKNYDVEFFEADPSKDDFEIQLQKKLEQADLVSCWRHLQLCFETEESARRLL  128

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              NV+ LLKPGGYF GIT DSSTIWAKYQKNVEAYHN+ SG KPN+ PN IRSESY I FE
Sbjct  129   TNVACLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR-SGAKPNVFPNYIRSESYMITFE  187

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
             +EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+++EIQ+LTDFYDD
Sbjct  188   LEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEFVEIQSLTDFYDD  244



>gb|ACU18036.1| unknown [Glycine max]
Length=231

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 177/210 (84%), Gaps = 1/210 (0%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             RL D  K+ALI IFV PYATVC+LYCG   D +KW  AQIGHYIGID  +SG+++ +E W
Sbjct  8     RLYDFAKMALINIFVHPYATVCDLYCGDA-DADKWAHAQIGHYIGIDAPSSGIDQMRETW  66

Query  1002  ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSS  823
             E+ RK YT E  E+DPCTE+++THL++K N  D+V C+ +LQLCFE+EEKARKLLHNVSS
Sbjct  67    ETHRKSYTAEFFELDPCTENIETHLEEKTNMTDVVCCLQHLQLCFETEEKARKLLHNVSS  126

Query  822   LLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEK  643
             LLKPGGYFLGIT DSSTIWAKYQ+NVEAYHNK S MKPNIVPNCIR+E+Y I FEVEEEK
Sbjct  127   LLKPGGYFLGITPDSSTIWAKYQRNVEAYHNKSSSMKPNIVPNCIRTENYMITFEVEEEK  186

Query  642   FPFFGKKYQMKFANDISAETQCLVHFPSLI  553
             FP FGKKYQ+KFAND+SAET CLVHFPS I
Sbjct  187   FPLFGKKYQLKFANDVSAETYCLVHFPSFI  216



>gb|EMT21912.1| mRNA cap guanine-N7 methyltransferase 2 [Aegilops tauschii]
Length=341

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 206/317 (65%), Gaps = 58/317 (18%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDV----------  1039
             HH L +  K ALIKIF  PYATVC++YC    D EKW +AQ G YIGI+           
Sbjct  6     HHLLYEFAKAALIKIFAFPYATVCDMYCNGGADTEKWADAQAGRYIGIEYLNLLLIVNLL  65

Query  1038  -------ATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNL  880
                    A++  ++ +E WE++ K +TTE IE++P                         
Sbjct  66    LSVIDASASAVSSDDRELWENKWKPFTTEFIELNPSA-----------------------  102

Query  879   QLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIV  700
              LCFESEE A+KLL+NVSSLLKPGGYF GI  DSSTIW KYQKNVEA HNKG      +V
Sbjct  103   -LCFESEEHAKKLLNNVSSLLKPGGYFFGIIPDSSTIWTKYQKNVEASHNKGL----KVV  157

Query  699   PNCIRSESYTIAFEVEEEK-------------FPFFGKKYQMKFANDISAETQCLVHFPS  559
             PN IRS++YTI FE+EEEK             FPFFGKKYQ+KFAN+   E  CLVHFPS
Sbjct  158   PNSIRSDNYTITFEIEEEKYELNFCIYVRLNRFPFFGKKYQLKFANEAMFENHCLVHFPS  217

Query  558   LIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTT  379
             L+RLAREAGL+Y+EIQNLT+FYDD R QF  ML     NL+DPRG+L+ R+YD+LGL++T
Sbjct  218   LMRLAREAGLEYVEIQNLTEFYDDNRTQFAPMLGSCGANLVDPRGKLIARSYDILGLYST  277

Query  378   FVFQKPDPDITPPLMTP  328
             FVFQKPDPD  PP +TP
Sbjct  278   FVFQKPDPDAIPPAVTP  294



>gb|AIU50888.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Cabomba caroliniana]
Length=232

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 198/265 (75%), Gaps = 33/265 (12%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTED  943
             VC+LYCG   D  KW+EAQIGHYIGID         +EAWESQRK YT    E+DPC ++
Sbjct  1     VCDLYCG---DLTKWNEAQIGHYIGID---------REAWESQRKPYTASFCELDPCMDN  48

Query  942   LKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWA  763
             L + LQDKD    IV C+ +LQLCFE+E +AR LL NVSSLLKPGGYF G+T DSSTIW+
Sbjct  49    LGSCLQDKD----IVCCLQHLQLCFENEGRARSLLLNVSSLLKPGGYFFGVTPDSSTIWS  104

Query  762   KYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAET  583
             KYQKN+EA HNK       IVPNCIRSE+Y I FE EEEKFP FGKKYQ+KF  D     
Sbjct  105   KYQKNIEASHNK-------IVPNCIRSENYVITFETEEEKFPLFGKKYQLKFTGD-----  152

Query  582   QCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAY  403
              CLVHFPSLIRLARE GL+Y+EIQNLT+FYDD R QF G+L     N +DPRG+LL R++
Sbjct  153   HCLVHFPSLIRLAREVGLEYVEIQNLTEFYDDNRVQFAGLL-----NFVDPRGKLLARSF  207

Query  402   DVLGLFTTFVFQKPDPDITPPLMTP  328
             D+LGL+TTF+FQKPDP + PP+ TP
Sbjct  208   DILGLYTTFIFQKPDPGLLPPICTP  232



>emb|CAB41341.1| putative protein [Arabidopsis thaliana]
Length=371

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 198/335 (59%), Gaps = 72/335 (21%)
 Frame = -2

Query  1197  ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE  1018
             E  HHRL D  K A+I IF  PYATVCELYCG  P+ +KW+ A IGHYIGID  +SG++ 
Sbjct  10    EQSHHRLFDFAKTAIINIFAHPYATVCELYCGGAPETDKWEAAPIGHYIGIDT-SSGISS  68

Query  1017  KKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
              +EAWESQRK Y  E  E DP                                 KAR   
Sbjct  69    VREAWESQRKNYDVEFFEADPS--------------------------------KARPF-  95

Query  837   HNVSSLLKPGGYFLGITTDSSTIW---AKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
                        +       S T W   AKYQKNVEAYHN+ SG KPN+ PN IRSESY I
Sbjct  96    -----------FVFPFGLRSLTFWSNRAKYQKNVEAYHNR-SGAKPNVFPNYIRSESYMI  143

Query  666   AFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDD  487
              FE+EEEKFP FGK+YQ+KF+ D ++E  CLVHFPSLIRLAREAGL+++EIQ+LTDFYDD
Sbjct  144   TFELEEEKFPLFGKRYQLKFSGDNASEDHCLVHFPSLIRLAREAGLEFVEIQSLTDFYDD  203

Query  486   YR-----------------PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPD  358
              R                  QF  +L +   N +DPRG+LLPRA+D+LGL+ TF+FQKPD
Sbjct  204   NRFEVSHTCRFSIFYHELLAQFASLLMNAGPNFVDPRGKLLPRAFDLLGLYATFIFQKPD  263

Query  357   PDITPPLMTPF-IVRRNNDDEASEY-----HSTKH  271
             PDI PPL TP      NN DEAS +      ST+H
Sbjct  264   PDIEPPLTTPIPFESSNNHDEASTFVLSYSRSTQH  298



>gb|ABK24280.1| unknown [Picea sitchensis]
Length=652

 Score =   316 bits (810),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 207/289 (72%), Gaps = 3/289 (1%)
 Frame = -2

Query  1194  SFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEK  1015
             S H RL + VKI+L+KI V PYATVC+LYCG   D EKW +AQIG YIGID++ S ++E 
Sbjct  11    SVHTRLHEFVKISLMKILVDPYATVCDLYCGCGADTEKWAQAQIGQYIGIDLSASALSEA  70

Query  1014  KEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLH  835
             ++ WE  R+ Y  +  E+DPC E+L+++L DK    DIV C+ +LQ CF SEE+A+ LL 
Sbjct  71    RDQWEYHRRPYPADFYELDPCVENLESYLPDKYIPTDIVCCLRHLQDCFASEEQAKSLLQ  130

Query  834   NVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEV  655
             NV+SLLKPGGYF GIT DSSTIW+KYQK VE     G+ +K N +   +R++ Y I F  
Sbjct  131   NVASLLKPGGYFFGITADSSTIWSKYQKAVEGAIKAGN-LKVNGMLPRVRTDQYVITF--  187

Query  654   EEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQ  475
             E+++F  FG KYQ++F+  + ++TQ LVHFPSLIRLA E GL+ IEIQN+ +FY+DYR Q
Sbjct  188   EDDRFTPFGMKYQIQFSEGLPSQTQLLVHFPSLIRLATEVGLECIEIQNMLEFYEDYRIQ  247

Query  474   FVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
             F G+LQ    NL+D + RL  R +D+L LFTTF+F+KPD   T P+ TP
Sbjct  248   FTGILQITCGNLLDNKVRLPHRTHDLLSLFTTFIFRKPDHYATGPMSTP  296



>emb|CAN61601.1| hypothetical protein VITISV_013027 [Vitis vinifera]
Length=517

 Score =   311 bits (797),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 186/265 (70%), Gaps = 37/265 (14%)
 Frame = -2

Query  1272  RRDDDAVAMIPPATSFPIYAHRPPT-ESFHHRLIDIVKIALIKIFVSPYATVCELYCGKV  1096
             R D +A A  P  TS P     P T ES HHRL +  K ALIKIFVSPYATVC+LY G  
Sbjct  40    RPDWEATAR-PTMTSIPA----PRTAESTHHRLFEFAKTALIKIFVSPYATVCDLYAGAG  94

Query  1095  PDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKD  916
              D +KWDEAQIGHYIGIDV++SG++  KE WESQRK Y  +  E+DP  E+L+ +LQDK 
Sbjct  95    SDADKWDEAQIGHYIGIDVSSSGISHTKEVWESQRKSYNADFYELDPSMENLELNLQDKC  154

Query  915   NQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAY  736
             N AD+V C+ +LQL FE+E+K R+LLHNV+SLLKPGGYF GIT DSSTIWAKYQKNVEAY
Sbjct  155   NTADVVCCLQHLQLGFENEDKGRRLLHNVASLLKPGGYFFGITPDSSTIWAKYQKNVEAY  214

Query  735   HNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSL  556
             HN+GS MKPNIVPNCIRSESY I FEVEEEK                             
Sbjct  215   HNRGSSMKPNIVPNCIRSESYMITFEVEEEK-----------------------------  245

Query  555   IRLAREAGLDYIEIQNLTDFYDDYR  481
               LAREAGL+Y+EIQNLTDFYDD R
Sbjct  246   --LAREAGLEYVEIQNLTDFYDDNR  268


 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = -2

Query  483  RPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTPFIVR--RN  310
            + QF GML +   NL+DPRGRLLPR+YDVLGL+TTF+FQK DPDI PPL +PFI++   +
Sbjct  441  QAQFAGMLLNSGPNLVDPRGRLLPRSYDVLGLYTTFIFQKVDPDIVPPLTSPFIIKDGSH  500

Query  309  NDDEAS  292
            N +EAS
Sbjct  501  NYEEAS  506



>gb|AIU50871.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Ricinus communis]
Length=185

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 159/212 (75%), Gaps = 27/212 (13%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFV PY TVC+LYCG   D EKWD AQIGHY+GID         +E
Sbjct  1     HHRLYEFAKSALIKIFVHPYVTVCDLYCG---DAEKWDIAQIGHYVGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             AWESQRK YT E  E DPC+E  +  LQ+KD    +V C+ NLQLCFE+EE ARKLLHNV
Sbjct  49    AWESQRKNYTAEFFEADPCSEIFEKQLQEKD----LVCCLQNLQLCFETEESARKLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GIT DSSTIWAKYQKNVEAYHN+      NIVPNCIRSESY I FEVEE
Sbjct  105   SSLLKPGGYFFGITPDSSTIWAKYQKNVEAYHNR------NIVPNCIRSESYMITFEVEE  158

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLI  553
             EKFP FGKKYQ+KFA+D      CLVHFPSLI
Sbjct  159   EKFPLFGKKYQLKFAHD-----HCLVHFPSLI  185



>gb|AIU50857.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Ceratophyllum demersum]
Length=208

 Score =   284 bits (727),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 177/236 (75%), Gaps = 28/236 (12%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHR+ D VK ALIKIF SPYATVC+LY G   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRIYDFVKTALIKIFASPYATVCDLYSG---DMDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             +WE+QRK YT E +E DP  ++L++ LQDKD    IV C+  LQLCFESEE+AR+LLHNV
Sbjct  49    SWENQRKPYTAEFLEQDPSVDNLESLLQDKD----IVCCLQQLQLCFESEERARRLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             SSLLKPGGYF GI  DSSTIW KYQKNVE  H+K      ++VPNCIRSE+Y I     E
Sbjct  105   SSLLKPGGYFFGIVPDSSTIWTKYQKNVETAHSK------SMVPNCIRSENYVIT-FEVE  157

Query  648   EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
             E+FPFFGKKYQ+KFAND      CLVHF S IRLAREAGLDY+EIQNLT+FYDD R
Sbjct  158   EEFPFFGKKYQLKFAND-----HCLVHFASFIRLAREAGLDYVEIQNLTEFYDDNR  208



>gb|KHG12995.1| hypothetical protein F383_17234 [Gossypium arboreum]
Length=304

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 167/215 (78%), Gaps = 21/215 (10%)
 Frame = -2

Query  1044  DVATSGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFE  865
             +V +SG+NE +EAWESQRK +T+E  E DPCT++L+T LQ+KD QAD+V C+ +LQL FE
Sbjct  45    NVVSSGINEVREAWESQRKSFTSEFFEADPCTDNLETLLQEKDIQADLVCCLQHLQLGFE  104

Query  864   SEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIR  685
             +++KAR+LL  V                     AKYQKNVEAYHN+ S MKPNIVPNCIR
Sbjct  105   TKDKARRLLSKV---------------------AKYQKNVEAYHNRSSSMKPNIVPNCIR  143

Query  684   SESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNL  505
             SE+Y I FE+EEEKFP FGKKYQ+KF++D++AET CLVHFPSLIRLAREAGL+Y+EIQNL
Sbjct  144   SENYMITFEIEEEKFPLFGKKYQLKFSSDVAAETHCLVHFPSLIRLAREAGLEYVEIQNL  203

Query  504   TDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYD  400
             T+FYDD +  F GM+ +   NL+DPRGRLLPR+YD
Sbjct  204   TEFYDDNKSLFAGMMMNAGPNLLDPRGRLLPRSYD  238



>ref|XP_001784495.1| predicted protein [Physcomitrella patens]
 gb|EDQ50708.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 174/262 (66%), Gaps = 6/262 (2%)
 Frame = -2

Query  1131  YATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPC  952
             Y  VC+LYCG+  D E W  AQ+G Y+G+D+++S + E KE WE   K +     E++PC
Sbjct  1     YLQVCDLYCGRGVDTENWAAAQVGKYVGVDLSSSALEEAKEQWEKNGKPFAARFCELNPC  60

Query  951   TEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSST  772
               DL+ +L +    AD++ C+ +LQ CF +E+  R+LL NV++LLKPGGYF G T DSST
Sbjct  61    MIDLEKNLGEDRLSADVITCLAHLQDCFATEDMVRQLLKNVATLLKPGGYFFGATPDSST  120

Query  771   IWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFAND-I  595
             IW KYQK VE     GS      +P  +R++ Y+I+F  E+++F  +G +YQ++F +D +
Sbjct  121   IWYKYQKAVEGAMKAGSLRANGHLPR-VRTDLYSISF--EDDRFNQYGSRYQLRFTDDTV  177

Query  594   SAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLL  415
               ++Q LVHFPSLIR A E GL+Y+EIQNLT+FY+DYR  F   LQ+    L+D +G LL
Sbjct  178   PPQSQILVHFPSLIRHAEEFGLEYVEIQNLTEFYEDYRVSFAETLQNSCGTLVDSKGNLL  237

Query  414   --PRAYDVLGLFTTFVFQKPDP  355
                  Y   GL+TTF+F+KPDP
Sbjct  238   IIGSPYSFAGLYTTFIFKKPDP  259



>gb|AIU50881.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Cinnamomum camphora]
Length=163

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 140/185 (76%), Gaps = 22/185 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             RL +  K ALIKIFVSPYATVC+LYCG   D +KWDEAQIGHYIGID         +E W
Sbjct  1     RLFEFAKTALIKIFVSPYATVCDLYCG---DIDKWDEAQIGHYIGID---------RETW  48

Query  1002  ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSS  823
             ESQRK YT    E+DPC E+L++ +QDKD    IV C+ +LQLCFE+E++AR+LL NVSS
Sbjct  49    ESQRKPYTAHFCELDPCVENLESFVQDKD----IVCCLQHLQLCFETEDRARRLLRNVSS  104

Query  822   LLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEK  643
             LLKPGGYF GITTDSSTIW KYQKNVEA HNK      N VPNCIRSE+Y I FEVEEEK
Sbjct  105   LLKPGGYFFGITTDSSTIWTKYQKNVEASHNK------NTVPNCIRSENYVITFEVEEEK  158

Query  642   FPFFG  628
             FP FG
Sbjct  159   FPLFG  163



>gb|AFW68041.1| hypothetical protein ZEAMMB73_002313 [Zea mays]
Length=198

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 140/188 (74%), Gaps = 4/188 (2%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+
Sbjct  6     PPQSPHLRLYDCAKSAIIKIFAFPYATVCDLYCDSGMDTDKWCDAQVGHYIGIDASASGV  65

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQ CFE+EE+A+K
Sbjct  66    NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQADMVCCMQHLQSCFENEERAKK  125

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSL KPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  126   LLNNVSSLPKPGGYFFGITPDSSTIWTKYQKNVEAAHNKGL----KTVPNSIRSENYTIT  181

Query  663   FEVEEEKF  640
             FEVEEEK+
Sbjct  182   FEVEEEKY  189



>ref|XP_008646540.1| PREDICTED: uncharacterized protein LOC103628030 [Zea mays]
Length=452

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 140/188 (74%), Gaps = 4/188 (2%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H RL D  K A+IKIF  PYATVC+LYC    D +KW +AQ+GHYIGID + SG+
Sbjct  260   PPQSPHLRLYDCAKSAIIKIFAFPYATVCDLYCDSGMDTDKWCDAQVGHYIGIDASASGV  319

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  QAD+V CM +LQ CFE+EE+A+K
Sbjct  320   NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQADMVCCMQHLQSCFENEERAKK  379

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
             LL+NVSSL KPGGYF GIT DSSTIW KYQKNVEA HNKG       VPN IRSE+YTI 
Sbjct  380   LLNNVSSLPKPGGYFFGITPDSSTIWTKYQKNVEAAHNKGL----KTVPNSIRSENYTIT  435

Query  663   FEVEEEKF  640
             FEVEEEK+
Sbjct  436   FEVEEEKY  443



>gb|AIU50843.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Theobroma cacao]
Length=130

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 16/146 (11%)
 Frame = -2

Query  765  AKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAE  586
            AKYQKNVEAYHNK      NIVPNCIRSESY I FE+EEEKFP FGKKYQ+KFA+D S  
Sbjct  1    AKYQKNVEAYHNK------NIVPNCIRSESYMITFEIEEEKFPLFGKKYQLKFASDHS--  52

Query  585  TQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRA  406
               LVHFPSLIRLAREAGL+Y+EIQNLT+FYDD RPQF GM+     NL+DPRGRLLPR+
Sbjct  53   ---LVHFPSLIRLAREAGLEYVEIQNLTEFYDDNRPQFAGMM-----NLVDPRGRLLPRS  104

Query  405  YDVLGLFTTFVFQKPDPDITPPLMTP  328
            YDVLGL+TTF+FQKPDPD+ PP+ TP
Sbjct  105  YDVLGLYTTFIFQKPDPDVVPPIATP  130



>gb|EMS65843.1| mRNA cap guanine-N7 methyltransferase 2 [Triticum urartu]
Length=282

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 155/289 (54%), Gaps = 61/289 (21%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HH L +  K ALIKIF  PYATVC++YC    D EKW +AQ G YIGI   T        
Sbjct  6     HHLLYEFAKAALIKIFAFPYATVCDMYCNGGADTEKWADAQAGRYIGIGRPT--------  57

Query  1008  AWESQRKVYTTELIEI-DPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHN  832
                     Y   L  + + CT    T   DK     +     N++    S  K  K++ N
Sbjct  58    --HYDPSPYLVTLFRLPESCTYSELTAFCDKTLLRQLTKYQKNVE---ASHNKGLKVVPN  112

Query  831   VSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVE  652
                          I +D+ TI                                   FE+E
Sbjct  113   ------------SIRSDNYTI----------------------------------TFEIE  126

Query  651   EEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQF  472
             EEKFPFFGKKYQ+KFAN+ + E  CLVHFPSL+RLAREAGL+Y+EIQNLT+FYDD R QF
Sbjct  127   EEKFPFFGKKYQLKFANEATVENHCLVHFPSLMRLAREAGLEYVEIQNLTEFYDDNRTQF  186

Query  471   VGMLQDVNHNLIDPRGRLLPRAYDVL-GLFTTFVFQKPDPDITPPLMTP  328
               ML     NL+DPRG+L+ R+YD+L GL++TFVFQKPDPD  PP++TP
Sbjct  187   APMLGSCGANLVDPRGKLIARSYDILGGLYSTFVFQKPDPDAIPPVVTP  235



>gb|AIU50887.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Trachycarpus fortunei]
Length=138

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 116/154 (75%), Gaps = 16/154 (10%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFV PYATVC+L+CG   D +KWDEAQIGHYIGID         +E
Sbjct  1     HHRLYEFAKTALIKIFVFPYATVCDLHCG---DTDKWDEAQIGHYIGID---------RE  48

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              WESQRK YT E  E+DP  E+L ++LQDKD    IV C+ +L LCFESEE+AR LLHNV
Sbjct  49    IWESQRKPYTAEFCELDPSVENLDSNLQDKD----IVCCLQHLHLCFESEERARSLLHNV  104

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNK  727
             SSLLKPGGYF GIT DSSTIW KYQKNVEA H+K
Sbjct  105   SSLLKPGGYFFGITPDSSTIWTKYQKNVEASHSK  138



>ref|XP_002974031.1| hypothetical protein SELMODRAFT_414216 [Selaginella moellendorffii]
 gb|EFJ24986.1| hypothetical protein SELMODRAFT_414216 [Selaginella moellendorffii]
Length=912

 Score =   205 bits (522),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 166/274 (61%), Gaps = 27/274 (10%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             RL D VK  L++  VSP A V                + + H            + +E W
Sbjct  18    RLHDFVKTVLLQQLVSPGAAVAS-------------HSHLPHS----------KDAEEEW  54

Query  1002  ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSS  823
              +  K YT    ++DP   DL++ LQDK+   D + C+ +LQ  F SEEK ++LL NV S
Sbjct  55    RTLGKPYTASFCQLDPFLGDLESKLQDKELPFDTICCLGHLQDSFSSEEKVKQLLENVVS  114

Query  822   LLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEK  643
             LLK GG F GIT D+ST+W+KYQK VE+    G+ ++P      +++E YTI F  ++++
Sbjct  115   LLKFGGIFFGITADASTLWSKYQKAVESALKTGT-LRPGSTIPRVKAELYTITF--DDDR  171

Query  642   FPFFGKKYQMKFAND-ISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVG  466
             F  FG +YQ++FA+D ++ ++Q LVHFPSLIRLA+EAGL++IEIQNL +F++DYR  F  
Sbjct  172   FNIFGTRYQLRFADDGLAPQSQLLVHFPSLIRLAKEAGLEFIEIQNLDEFFEDYRHLFAD  231

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
                    + +DP+G+L+    DVL L+TTF+F+K
Sbjct  232   AFTSNCSSFLDPKGKLMAPIRDVLSLYTTFIFRK  265



>gb|AIU50866.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Nuphar advena]
Length=114

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 10/124 (8%)
 Frame = -2

Query  699  PNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYI  520
            P+CIRSE+Y I FE EEEKFP FGKKYQ+KF  D      CLVHFPSLIRLAREAGL+Y+
Sbjct  1    PSCIRSENYIITFETEEEKFPIFGKKYQLKFTGD-----HCLVHFPSLIRLAREAGLEYV  55

Query  519  EIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPP  340
            EIQNLT+FYDD R QF G+L     N +DPRG+LL R++D+LGL+TTF+FQKPDP++ PP
Sbjct  56   EIQNLTEFYDDNRAQFAGLL-----NFVDPRGKLLARSFDLLGLYTTFIFQKPDPNLVPP  110

Query  339  LMTP  328
            + TP
Sbjct  111  VCTP  114



>ref|XP_008779406.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like, partial 
[Phoenix dactylifera]
Length=103

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  765  AKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAE  586
             KYQKNVEA H+KGSG+KPN VPNCIRSE+Y I FEVEEEKFP FGKKYQ+KF+NDI++E
Sbjct  9    TKYQKNVEASHSKGSGLKPNTVPNCIRSENYVITFEVEEEKFPLFGKKYQLKFSNDITSE  68

Query  585  TQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
            T CLVHFPSLIRLAREAGL+Y+E+QNLT+FYDD R
Sbjct  69   THCLVHFPSLIRLAREAGLEYVEMQNLTEFYDDNR  103



>dbj|GAM16871.1| hypothetical protein SAMD00019534_000460 [Acytostelium subglobosum 
LB1]
Length=278

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/268 (37%), Positives = 140/268 (52%), Gaps = 19/268 (7%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK  988
             VK  LI   V     V EL+CG   D  KW+ A+IG YIGID   S + E + +W+ ++ 
Sbjct  20    VKTILISELVEVDGNVAELFCGSGLDLGKWERARIGRYIGIDTIQSSLKEAEASWQQRKC  79

Query  987   VYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPG  808
              Y  + + ID    +L   L   D Q D+V C   +Q  F   E+A   + N SS LK G
Sbjct  80    TYDAQFLNIDTLNTNLNEQL-PTDMQFDVVSCFDGMQRAFSDMEQANTFIKNASSRLKNG  138

Query  807   GYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFG  628
             GYF GI  DSS IW K QK         SG+       CI+S  + I F    + F FFG
Sbjct  139   GYFFGILPDSSAIWYKSQKVT-------SGLP------CIKSTLFNIDF--GSDTFSFFG  183

Query  627   KKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
               Y M    D S+ T+ LVHFP+ I L ++ GL +IE  NL++FY+D +  +   L+   
Sbjct  184   STYNMSM-KDGSSITESLVHFPTFISLCKQHGLLFIEASNLSEFYEDNKKNYDAKLK--Q  240

Query  447   HNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
               ++  +G++ P   +++ L+TTF+F K
Sbjct  241   SGVLVGKGKIEPAQMELISLYTTFIFYK  268



>gb|EPS64069.1| hypothetical protein M569_10714, partial [Genlisea aurea]
Length=94

 Score =   142 bits (359),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = -2

Query  1215  AHRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVA  1036
             +HR   ES HHRLID VK ALI IFV+PYATVC LYCGKVPDE KWDEA IGHYIGIDV 
Sbjct  7     SHRT-AESIHHRLIDSVKNALINIFVAPYATVCVLYCGKVPDEAKWDEAHIGHYIGIDVL  65

Query  1035  TSGMNEKKEAWESQRKVYTTELIEIDPC  952
             TSG+ E +EAWES+RK YT+E +E DPC
Sbjct  66    TSGVGEVREAWESRRKTYTSEFLEFDPC  93



>ref|XP_008646312.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Zea 
mays]
 gb|AFW73627.1| hypothetical protein ZEAMMB73_477001 [Zea mays]
Length=114

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 72/88 (82%), Gaps = 4/88 (5%)
 Frame = -2

Query  903  IVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKG  724
            +V CM +LQ CFE+EE+A+KLL+NVSSLLKPGGYF GIT DSSTIW KYQKNVEA HNKG
Sbjct  1    MVCCMQHLQSCFENEERAKKLLNNVSSLLKPGGYFFGITPDSSTIWTKYQKNVEASHNKG  60

Query  723  SGMKPNIVPNCIRSESYTIAFEVEEEKF  640
                   VPN IRSE+YTI FEVEEEK+
Sbjct  61   ----LKTVPNSIRSENYTITFEVEEEKY  84



>gb|AIU50848.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Carica papaya]
Length=101

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 85/140 (61%), Gaps = 39/140 (28%)
 Frame = -2

Query  1188  HHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKE  1009
             HHRL +  K ALIKIFV PYATVC+LYCG   D +KW+ AQIGHYIGID           
Sbjct  1     HHRLYEFAKTALIKIFVHPYATVCDLYCG---DTDKWEAAQIGHYIGID-----------  46

Query  1008  AWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
                                  +L+   Q+K    D+V C+ +LQLCFE+E+ AR+LL NV
Sbjct  47    ---------------------NLEIQFQEK----DLVCCLQHLQLCFETEDTARRLLQNV  81

Query  828   SSLLKPGGYFLGITTDSSTI  769
             +S+LKPGGYF GIT DSSTI
Sbjct  82    ASVLKPGGYFFGITPDSSTI  101



>gb|EFA77214.1| hypothetical protein PPL_12423 [Polysphondylium pallidum PN500]
Length=234

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 107/223 (48%), Gaps = 18/223 (8%)
 Frame = -2

Query  1212  HRPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVAT  1033
              R P   F     + VK  LI   V    +V EL+CG   D  KW+ A+IG YIGID   
Sbjct  2     QRTPIWQFR-AFQNWVKTVLISELVEKDGSVAELFCGHGLDTGKWERAKIGSYIGIDTDR  60

Query  1032  SGMNEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEK  853
               + E +  W+ +   YT + + ID     +   L   D Q DIV C   +Q  F     
Sbjct  61    IALTEAESKWQQKNCPYTAQFLNIDLLERSVDKELA-PDIQFDIVTCFDGMQKAFSDLSH  119

Query  852   ARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESY  673
             A   LHNVSS LK GGYF GI  DSS IW K QK +       SG+       CI+S  +
Sbjct  120   ANTFLHNVSSRLKDGGYFFGIIPDSSAIWYKSQKVI-------SGLP------CIKSSLF  166

Query  672   TIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLA  544
              I F  + + F FFG +YQ+    D S  T  L+HFP+ I L 
Sbjct  167   NIDF--DSDIFTFFGSRYQLS-MKDGSNVTDNLIHFPTFINLV  206



>gb|AIU50838.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Lilium brownii]
Length=85

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 71/96 (74%), Gaps = 11/96 (11%)
 Frame = -2

Query  843  LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
            L+ NVS++L+PGGYF GIT DSS IW KYQKNVEA HNK      N VP CI+SE+Y I 
Sbjct  1    LMCNVSAMLRPGGYFFGITADSSAIWTKYQKNVEASHNK------NTVPTCIKSENYVIT  54

Query  663  FEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSL  556
            FEVEEEKFP FGK+YQ+KF ND       LVHFPSL
Sbjct  55   FEVEEEKFPCFGKRYQIKFPND-----HYLVHFPSL  85



>ref|XP_006485235.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Citrus 
sinensis]
Length=136

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  555  IRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTF  376
            +RLAREAGL+Y+EIQNL +FYDD R  F GML     NLIDPRGRLLPR+YDVLGL++TF
Sbjct  3    LRLAREAGLEYVEIQNLNEFYDDNRALFAGMLMSAGPNLIDPRGRLLPRSYDVLGLYSTF  62

Query  375  VFQKPDPDITPPLMTPFI  322
            +FQKPDPD+ PPL TP +
Sbjct  63   IFQKPDPDVAPPLATPLL  80



>gb|AIU50886.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Alisma plantago-aquatica]
Length=99

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 16/115 (14%)
 Frame = -2

Query  1125  TVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDPCTE  946
             TVC+ YC    D +KW++ QIGHY+GID         +E WESQRK YT    E+DP TE
Sbjct  1     TVCDFYC---DDFDKWNDLQIGHYVGID---------RETWESQRKPYTAHFCELDPSTE  48

Query  945   DLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTD  781
             +L ++L DKD    IV CM NLQL FE+EEKA++LL+NV+SLLK GGYFL IT D
Sbjct  49    NLASYLHDKD----IVCCMQNLQLSFETEEKAKRLLNNVASLLKLGGYFLSITPD  99



>gb|AIU50883.1| S-adenosyl-L-methionine-dependent methyltransferase superfamily 
protein, partial [Ginkgo biloba]
Length=108

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 85/120 (71%), Gaps = 12/120 (10%)
 Frame = -2

Query  687  RSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQN  508
            R++ Y I FE  +++F  FG KYQ++F++      Q LVHFPSLIRLA E GL+Y+EIQN
Sbjct  1    RTDQYVITFE--DDRFTPFGMKYQLQFSDG-----QLLVHFPSLIRLATEVGLEYVEIQN  53

Query  507  LTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
            + +FY+D+R QF G+L     +L+DP+GRL  R +DVL L+TTF+F+KPD +   P  TP
Sbjct  54   MLEFYEDHRIQFAGIL-----SLLDPKGRLFHRVHDVLSLYTTFIFRKPDQNPIVPERTP  108



>ref|XP_636615.1| hypothetical protein DDB_G0288673 [Dictyostelium discoideum AX4]
 gb|EAL63113.1| hypothetical protein DDB_G0288673 [Dictyostelium discoideum AX4]
Length=323

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 140/314 (45%), Gaps = 56/314 (18%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK  988
             VK  LI   V    T  E+Y     D  KW+ A+I  Y   + + S   E K  W+++ +
Sbjct  20    VKTILITELVEENDTAAEIYSAIGLDTGKWERAKIKRYYCFESSKSNATESKNKWQAKNE  79

Query  987   VYTTELIEIDPCTEDLKTHLQ---------------------------------------  925
              +  + I +D   +++++ LQ                                       
Sbjct  80    PFEADFITMDLNKDNIESFLQPIPNNNNNINNNINNNINNSTNNNINNNNNNNNNNNINI  139

Query  924   DKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNV  745
              K  Q D++ C   LQ  F    +A + + N SS LK GG+F G+  DSS +W K QK  
Sbjct  140   SKLPQFDVIACFDGLQNSFTDPTQAEQFIKNASSRLKVGGFFFGMMPDSSALWYKAQKET  199

Query  744   EAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHF  565
              +     SG+        I+S  + I F+ E +   FFG KY +    +++  ++ LVHF
Sbjct  200   SS-----SGLP------IIKSNLFNITFDSEIQ--SFFGCKYNLTIPTELNL-SENLVHF  245

Query  564   PSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLF  385
             PS + L ++  L  +E  NL++FYD+ +  +   L+  +   I+   ++     D++GL+
Sbjct  246   PSFLNLCKKYNLTLVEATNLSEFYDENKKNYESKLKQ-SGVYINGIKKIEQNQLDLIGLY  304

Query  384   TTFVFQK--PDPDI  349
             TTF+F K  P P I
Sbjct  305   TTFIFVKELPQPKI  318



>ref|XP_008652626.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 2-like [Zea 
mays]
Length=110

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM  1024
             P +S H  L D  K A+I  F  PYATVC LYC    D +KW ++Q+GHYIGI  + SG+
Sbjct  6     PPQSPHLHLYDFAKSAIINFFAFPYATVCGLYCDGGMDTDKWCDSQVGHYIGISASASGV  65

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCM  889
             N  +E WE++RK +T E IE+DP  +  +  +Q+K  Q DIV CM
Sbjct  66    NYARELWENRRKPFTAEFIELDPSDDGFEAQVQEKGIQVDIVCCM  110



>ref|XP_003292737.1| hypothetical protein DICPUDRAFT_89950 [Dictyostelium purpureum]
 gb|EGC30726.1| hypothetical protein DICPUDRAFT_89950 [Dictyostelium purpureum]
Length=312

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 142/311 (46%), Gaps = 58/311 (19%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK  988
             VK  LI   V     V + YC  + D  KW+ ++I  Y G D +   ++  +   + ++ 
Sbjct  16    VKTILISEMVDEKDMVADFYCNGM-DTGKWERSKIHCYYGFDPSPEELSIAESKLKQKKN  74

Query  987   VYTTELIEIDPCTEDLKTHLQDKDNQA---------------------------------  907
              Y+ + ++ +   + + T +++  NQ                                  
Sbjct  75    PYSAKFLKCNFNEDQIDTIIKNDTNQIIGMDVDNNNNNTRNNNYNNSFNIDQNGINNSSG  134

Query  906   ---DIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAY  736
                D+V C + +Q  F S + A +L+ NVS LLK GG+F GI  DSS+IW + QK    +
Sbjct  135   VIFDVVSCFNGVQNSFSSAQDAEQLIKNVSVLLKDGGFFFGIIPDSSSIWYRSQKVSSGF  194

Query  735   HNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSL  556
                            ++S  YTI F  E     FFG KY++    D S   + L+HFPS 
Sbjct  195   PG-------------VKSALYTIEFNSEISN--FFGCKYKLTLK-DGSIIEENLIHFPSF  238

Query  555   IRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNLIDPRG--RLLPRAYDVLGLFT  382
             I + ++  L  +E  N TDFYD+ +  +  +L++     + P+G  ++     +++GL+T
Sbjct  239   INICKKYNLTLVEAINFTDFYDENKKTYEKLLKNSG---VLPQGIKKIDQPQMELIGLYT  295

Query  381   TFVFQKPDPDI  349
             TF+F K  P+I
Sbjct  296   TFIFVKEKPEI  306



>ref|XP_003384780.1| PREDICTED: hypothetical protein LOC100638295 [Amphimedon queenslandica]
Length=758

 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 135/288 (47%), Gaps = 29/288 (10%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM--------NEKK  1012
             VK  LI+ ++ P ATV +L CGK  D  KW E  I + +G D++ + +        + K 
Sbjct  481   VKSVLIRTYLPPSATVLDLCCGKGGDLNKWKEGNIHYLVGADISETSIENCIGRYNSNKL  540

Query  1011  EAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHN  832
                 +++  +  E I  D C   L+    +   +  +  C  +L   FES EKA  +L N
Sbjct  541   MDRRTKKPAFEAEFIVADCCQVRLQDEYTNPARRFHVTSCQFSLHYAFESFEKATMMLRN  600

Query  831   VSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVE  652
                 L+PGGYF+G T D++ + ++          +  G +       I ++ Y+++ + E
Sbjct  601   ACENLRPGGYFIGTTVDANELISRL---------RDRGTQDESGSWSISNDVYSVSLDKE  651

Query  651   ------EEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYD  490
                   E   P FG KY  + A  ++   + L+H+P L+ + +E  +  +  QN  DF+ 
Sbjct  652   FDPHDTEAPLPLFGCKYHFQLAGVVNV-PEFLLHYPLLVEMLKEWDMIEVRHQNFYDFFS  710

Query  489   DYR--PQFVGMLQDVNHNLIDPR-GRLLPRAYDVLGLFTTFVFQKPDP  355
             ++R  P    +L  +     D R G +    ++ +GL+  FVFQK  P
Sbjct  711   EHRHIPDDASLLYRM--QAFDKRTGTMSAPEWEAIGLYLIFVFQKKGP  756



>gb|ACN25940.1| unknown [Zea mays]
Length=192

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 76/146 (52%), Gaps = 37/146 (25%)
 Frame = -2

Query  1203  PTESFHHRLIDIVKIALIKIFVSPYATVC-------------------------------  1117
             P +S H RL D  K A+IKIF  PYATVC                               
Sbjct  6     PPQSPHLRLYDFAKSAIIKIFAFPYATVCYMLLSFMIFSSFQISEKLRRNPESNFTFIGC  65

Query  1116  ------ELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYTTELIEIDP  955
                   +LYC    D +KW +AQ+GHYIGID + SG+N  +E WE++RK +T E IE+DP
Sbjct  66    QMPKVCDLYCDGGMDTDKWCDAQVGHYIGIDASASGVNYARELWENRRKPFTAEFIELDP  125

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQ  877
               +  +  +Q+K  QAD+V CM +LQ
Sbjct  126   SDDGFEAQVQEKGIQADMVCCMQHLQ  151



>ref|XP_004336754.1| mRNA cap guanineN7 methyltransferase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14741.1| mRNA cap guanineN7 methyltransferase [Acanthamoeba castellanii 
str. Neff]
Length=315

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 123/265 (46%), Gaps = 26/265 (10%)
 Frame = -2

Query  1122  VCELYCGKVPDEEK------------WDEAQIGHYIGIDVATSGMNEKKEAWESQRKVYT  979
             V E+ CG    E+             +   +I H   +D + + +   +  WE  ++ + 
Sbjct  57    VLEISCGHTGAEDSNTGGAGGGTHHTYARHKIQHLTTVDSSATVVAAAQRKWEKTKR-FD  115

Query  978   TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYF  799
              E    D  T  L   L++     D+V C   +Q  F SEE A   L + +  L+ GGYF
Sbjct  116   AEFATADLYTISLDQVLRE-GRSFDVVVCFDGMQNSFASEETAEMFLRSATCRLREGGYF  174

Query  798   LGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKY  619
             LG   DSS IW+K  K     ++KG     +  P     + Y I F  +  +F  FG  Y
Sbjct  175   LGFLPDSSAIWSKAAK----VNSKG-----DEAPK-FGGDLYKIEFNDDLSRFQPFGTSY  224

Query  618   QMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVNHNL  439
               +   ++    Q LVHFP+L++LAR+  L+ +E+ N  DFY+D++      L ++    
Sbjct  225   THRM-REMEDRKQYLVHFPTLLQLARKLQLEMVEVVNFIDFYEDHKKSHEAALTEI-MGW  282

Query  438   IDPRGRLLPRAYDVLGLFTTFVFQK  364
                  +L P   +++GL TTFVF+K
Sbjct  283   TKTNKKLFPNQLELIGLRTTFVFRK  307



>ref|XP_004361416.1| hypothetical protein DFA_05698 [Dictyostelium fasciculatum]
 gb|EGG23565.1| hypothetical protein DFA_05698 [Dictyostelium fasciculatum]
Length=325

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 83/321 (26%), Positives = 134/321 (42%), Gaps = 81/321 (25%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIG--------------------  1048
             VK  +I   V     V E++CG   D  KW+ A+IG Y+G                    
Sbjct  16    VKTIMISELVENDEVVAEMFCGTGLDTGKWERAKIGKYVGYGMYHNHSINQKKHRCQTKT  75

Query  1047  ----------------------IDVATSGMNEKKEAWESQRKVYTTELIEID--------  958
                                   +D +   + E +  W+ ++  Y  E  +++        
Sbjct  76    NHHSSCVDHPSHVIIDGYYSLSLDPSRENLAEAEIKWKHKKCPYEAEFKQVNLIEESIDP  135

Query  957   -------PCTEDLKTHLQDKDNQADIVF----CMHNLQLCFESEEKARKLLHNVSSLLKP  811
                    P  ED+K  + D  +    +F    C   LQ  F+S E A   + NVSS LK 
Sbjct  136   TIIGSTTPIGEDIK--MGDGSSGVKEIFGVVSCFDGLQSAFDSVEHATTFIQNVSSRLKN  193

Query  810   GGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFF  631
             GGYF GI  DSS IW K QK +              +P  I+S  + I F  + + F F+
Sbjct  194   GGYFFGIIPDSSAIWYKSQKVLTG------------LP-AIKSSLFNIEF--DSDNFTFY  238

Query  630   GKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDV  451
             G KY +    D +   + L+HFP+ I L ++  L +IE  NL+DFY+D +  +   L+  
Sbjct  239   GTKYNLNMK-DGTNVNENLIHFPTFINLCKQNNLLFIEASNLSDFYEDNKKNYEAKLKQ-  296

Query  450   NHNLIDPRGRLLPRAYDVLGL  388
                ++  +G++ P   +++ +
Sbjct  297   -SGVLSSKGKIEPPQLELIKI  316



>gb|KFH64894.1| hypothetical protein MVEG_09622 [Mortierella verticillata NRRL 
6337]
Length=323

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 130/275 (47%), Gaps = 28/275 (10%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK  988
             +K  LI  +  P   V ++  GK  D  KW +A+I  +IG D+A+  + + +E + + R 
Sbjct  69    LKSVLIGRYARPRDRVLDVGVGKGGDLLKWSKARIQFFIGCDIASKSIEQARERYRTMRN  128

Query  987   V-YTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLC----FESEEKARKLLHNVSS  823
             V +      +D  +E +   +      A+ VF M ++Q C    FE+E KAR +LHNVSS
Sbjct  129   VPFEAHFHAMDCYSEPISNVVP-----AEQVFDMVSMQFCLHYSFETETKARMMLHNVSS  183

Query  822   LLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEK  643
              LKPGG F+G   D+  I  K +   +     G+ +             Y+I FE   + 
Sbjct  184   QLKPGGVFIGTIPDAYWIVKKLKSESDDKLQIGNSI-------------YSIRFE-RRDT  229

Query  642   FPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQ--FV  469
             F  FG KY     + I    + LVHFP+  +LA E GL+ I  +     Y++   +  F 
Sbjct  230   FEKFGSKYWFHLEDAIDDCPEYLVHFPTFQKLAEEYGLELIYNKKFHQVYEEASQELDFN  289

Query  468   GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
              +L  +  N+I   G L    ++   ++  F F+K
Sbjct  290   QLLYRM--NVISEEGHLSADEWEAANIYLAFAFKK  322



>ref|XP_005713890.1| unnamed protein product [Chondrus crispus]
 emb|CDF34071.1| unnamed protein product [Chondrus crispus]
Length=474

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/281 (28%), Positives = 122/281 (43%), Gaps = 34/281 (12%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK  988
             +K  LI +   P  +V +L CGK  D  KW EA I  Y+  DVA   + E    +    +
Sbjct  183   LKSVLIALHTRPGYSVLDLCCGKGGDLNKWVEAGITSYVACDVAELSVKEAANRYNRLSQ  242

Query  987   VYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPG  808
                  ++ +  C            ++ D+V C   +   FESE++AR LL NV+  L PG
Sbjct  243   APFRPVLLVGDCFGVSLADFVPSQSRFDVVSCQFAVHYAFESEDRARMLLKNVTDRLNPG  302

Query  807   GYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPF--  634
             G+F+G T D++ +  K +                +  + I S  Y +  +       F  
Sbjct  303   GFFIGTTVDANVLVRKVRA---------------VDGDEISSSVYKVKLDERFATKRFAR  347

Query  633   ---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF--------YDD  487
                +G +Y      ++    + LVHFP+  +LA E  L+ +   N  DF        YDD
Sbjct  348   GNAYGIRYFFTLDQNVEDCPEFLVHFPTFKQLALEYDLEILMQCNFHDFYKEFTADNYDD  407

Query  486   YRPQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             YR  F  M      N++D  G + P  +D + L+T F F+K
Sbjct  408   YRNLFRTM------NVVDETGTMSPDEWDAIYLYTAFAFRK  442



>ref|XP_005837438.1| hypothetical protein GUITHDRAFT_46422, partial [Guillardia theta 
CCMP2712]
 gb|EKX50458.1| hypothetical protein GUITHDRAFT_46422, partial [Guillardia theta 
CCMP2712]
Length=258

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 114/238 (48%), Gaps = 25/238 (11%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK  988
             VK  LI   V P  ++ +L CGK  D  KW + +IGHY+G+D+A   + +  + +  Q+ 
Sbjct  32    VKAMLIASAVRPMYSILDLACGKGGDLPKWAKQEIGHYVGVDIAYKSITDAIQRYNGQQN  91

Query  987   VYTTELIEI----DPCTEDLKTHLQ--DKDNQADIVFCMHNLQLCFESEEKARKLLHNVS  826
                     I    + C  +    L+  +K  + D V C   +   + SE+ AR  L N +
Sbjct  92    RAGCNFPAIWCAGNFCKSNFFQELEKVEKGVRFDAVSCQFAIHYSWTSEQDARTALKNAA  151

Query  825   SLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESY-TIAFEVEE  649
               LKPGG F+G TTD++ +  K Q           G+      N  R  S+  I+F+V+ 
Sbjct  152   RRLKPGGLFVGTTTDANVLVKKLQ--------DAPGLN---FGNRYRQSSHDEISFDVKL  200

Query  648   EKFPF-------FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF  496
             + F         FG +Y+    + +    +CLVHFP+  ++A E GL+ +E  NL DF
Sbjct  201   DYFDKTFSDHSPFGIRYRFYLKDAVDDCEECLVHFPTFRKIAMEVGLELVEHINLHDF  258



>ref|XP_010253752.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X4 
[Nelumbo nucifera]
Length=375

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 147/320 (46%), Gaps = 52/320 (16%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI ++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIHLYARRGDFVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK +T    LI  D     L   L+D D   DI  C   L   + +E +AR
Sbjct  129   NGDADHHQRRKKFTFPARLICGDCFEVRLDKVLED-DAPFDICSCQFALHYSWSTETRAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K  + VE                   +  Y I
Sbjct  188   RALANVSALLRPGGIFIGTMPDANVI-VKKLREVEGL--------------AFGNSVYWI  232

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  E+KF F   FG KY     + +    +C+V F     LA E  L+ + ++N  
Sbjct  233   RFGEEYSEKKFRFSNPFGIKYNFHLEDAVDC-PECIVPFHVFKLLADEYDLELVFVKNFH  291

Query  501   DFYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F D+Y  +P+F      +G L D N +       L    +DV  L+  FV +K   PD 
Sbjct  292   EFVDEYFKKPEFTELMRRLGALGDGNKD----NSTLSQDEWDVAYLYLAFVLRKRGQPDR  347

Query  348   TPPLMTPFIVRRNNDDEASE  289
             T          RNND+  ++
Sbjct  348   T---------HRNNDNRGNK  358



>gb|ESA23124.1| hypothetical protein GLOINDRAFT_60236, partial [Rhizophagus irregularis 
DAOM 181602]
Length=287

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 142/288 (49%), Gaps = 22/288 (8%)
 Frame = -2

Query  1209  RPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATS  1030
             R  T  F     + +K  LI  +V+      ++ CGK  D  KW++A I   +G+D+A  
Sbjct  17    RESTIIFLRSFNNWIKSVLIGKYVTRDGYALDMGCGKGGDLLKWNKANIKSLVGLDIAEV  76

Query  1029  GMNEKKEAW-ESQRKVYTTELIEIDPCTEDLKTHLQD--KDNQADIVFCMHNLQLCFESE  859
              + + ++ W E + + +  E   +D  T ++ + +    K + A + FC+H     FE+E
Sbjct  77    SIEDARKRWSEMKGRRFDAEFHVLDCFTSNISSIIPSSTKFDIASMQFCLH---YSFETE  133

Query  858   EKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSE  679
             EKAR  L+NV++ L+ GG F+G   D++ I  K  K++     K          N I   
Sbjct  134   EKARITLNNVTTNLRSGGIFIGTVPDANWI-VKKLKSLPKEQLK--------FENSI---  181

Query  678   SYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
              Y+I FE + + FP FG KY     + I+   + LVHFP+  +LA++ GL+ I  +   D
Sbjct  182   -YSIRFE-QRDNFPLFGHKYWFYLKDAINDCPEYLVHFPTFQKLAQQYGLELIYKKRFHD  239

Query  498   FYDDYRPQFVGMLQDVNHNLIDPRG--RLLPRAYDVLGLFTTFVFQKP  361
              Y++++ +        +  +ID RG   +    ++  G++  F F+K 
Sbjct  240   LYNEFKEETHYRELLYSMRVIDKRGEDEMSDDEWEATGMYIGFAFRKK  287



>gb|EHJ64133.1| putative mrna (guanine-7-)methyltransferase [Danaus plexippus]
Length=395

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 121/243 (50%), Gaps = 22/243 (9%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW-ESQRK---VYTTELIEIDP  955
             V ++ CGK  D  KW +A+  H +  D+A   + + KE + E  R+   ++T E I  D 
Sbjct  97    VLDICCGKGGDLSKWQKARADHVVFADIAEVSVQQCKERYDEIHRRFGRLFTAEFIAADC  156

Query  954   CTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSS  775
               E L+   +D   + D+V C   L   FES ++AR++L N+S  LKPGGYF G   D+ 
Sbjct  157   SRETLRDKYKDPSIKYDVVSCQFGLHYSFESLKQARRMLLNISECLKPGGYFFGTIPDAY  216

Query  774   TIWAKYQKNVE-AYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFAND  598
              I ++ +K+ + ++ N+   +K              + F+ E++ FP FG KY       
Sbjct  217   EIVSRCKKSPDNSFENRICNIK--------------LMFDSEKDGFPLFGAKYDFHLEGV  262

Query  597   ISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN--HNLIDPRG  424
             +    + LV+F    +LA E GL+ +     +DFY ++  ++  +L  +    N   P+G
Sbjct  263   VDC-PEFLVYFDMFTKLALECGLELVYKAGFSDFYKEHLEKYKDLLPKIKCFENYPMPQG  321

Query  423   RLL  415
             + L
Sbjct  322   KEL  324



>gb|EXX66554.1| hypothetical protein RirG_122710 [Rhizophagus irregularis DAOM 
197198w]
Length=335

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 142/288 (49%), Gaps = 22/288 (8%)
 Frame = -2

Query  1209  RPPTESFHHRLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATS  1030
             R  T  F     + +K  LI  +V+      ++ CGK  D  KW++A I   +G+D+A  
Sbjct  65    RESTIIFLRSFNNWIKSVLIGKYVTRDGYALDMGCGKGGDLLKWNKANIKSLVGLDIAEV  124

Query  1029  GMNEKKEAW-ESQRKVYTTELIEIDPCTEDLKTHLQD--KDNQADIVFCMHNLQLCFESE  859
              + + ++ W E + + +  E   +D  T ++ + +    K + A + FC+H     FE+E
Sbjct  125   SIEDARKRWSEMKGRRFDAEFHVLDCFTSNISSIIPSSTKFDIASMQFCLH---YSFETE  181

Query  858   EKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSE  679
             EKAR  L+NV++ L+ GG F+G   D++ I  K  K++     K          N I   
Sbjct  182   EKARITLNNVTTNLRSGGIFIGTVPDANWI-VKKLKSLPKEQLK--------FENSI---  229

Query  678   SYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
              Y+I FE + + FP FG KY     + I+   + LVHFP+  +LA++ GL+ I  +   D
Sbjct  230   -YSIRFE-QRDNFPLFGHKYWFYLKDAINDCPEYLVHFPTFQKLAQQYGLELIYKKRFHD  287

Query  498   FYDDYRPQFVGMLQDVNHNLIDPRG--RLLPRAYDVLGLFTTFVFQKP  361
              Y++++ +        +  +ID RG   +    ++  G++  F F+K 
Sbjct  288   LYNEFKEETHYRELLYSMRVIDKRGEDEMSDDEWEATGMYIGFAFRKK  335



>ref|XP_002051506.1| GJ11848 [Drosophila virilis]
 gb|EDW63661.1| GJ11848 [Drosophila virilis]
Length=421

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 109/236 (46%), Gaps = 27/236 (11%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWE-----SQRKVY----TTEL  970
             V ++ CGK  D  KWD+AQI H I  D+A   + + +  ++     ++R  Y    T E 
Sbjct  133   VLDMCCGKGGDLLKWDKAQISHLICTDIAEVSVEQCQRRYQDILQRAERSKYAHKFTAEF  192

Query  969   IEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGI  790
                D     L+   +D   Q ++V C      CFES  +A  ++ N +  L+PGGYF+  
Sbjct  193   FACDSTMVRLRERYKDASLQLNLVSCQFAFHYCFESLMQADCMMRNAAECLQPGGYFIAT  252

Query  789   TTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIR--SESYTIAFEVEEEKFPFFGKKYQ  616
               D+  I  +          K +G      PN  R  ++ Y+I FE + E  P FG KYQ
Sbjct  253   IPDAYEIIRRL---------KAAG------PNARRFGNDVYSIEFECDTESLPLFGAKYQ  297

Query  615   MKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
                   +    + LVHFP+L++L R  GL  +      +++ +   Q   +LQ ++
Sbjct  298   FHMEGVVDC-PEFLVHFPTLVKLGRRHGLQLVRRSTFAEYFRETMSQGRQLLQRMS  352



>gb|EMS52353.1| mRNA cap guanine-N7 methyltransferase 1 [Triticum urartu]
Length=366

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 153/320 (48%), Gaps = 38/320 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE-----  1018
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +     
Sbjct  65    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  124

Query  1017  KKEAWESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
               ++ + +RK ++    LI  D     L  +L++ D   DI  C   +   + +E +AR+
Sbjct  125   NGDSDQQRRKKFSFPARLICADCYETRLDEYLRE-DAPFDICSCQFAMHYSWSTEARARQ  183

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L N+S+LL+PGG F+G   D++ I  + +++         GM+      CI     T  
Sbjct  184   ALANISALLRPGGTFIGTMPDANVIIKRLRES--------EGMEFGNSVYCI-----TFG  230

Query  663   FEVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFY  493
              E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +F 
Sbjct  231   EEYTEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHEFV  289

Query  492   DDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQKPDPDITPPLMTP  328
              DY  RP+F  +++ +   L D R     L    ++   L+  FV +K  P   PP    
Sbjct  290   HDYVQRPEFADLMRRLG-PLGDGRSGQSTLSQDEWEASYLYLAFVLRKRGP---PPSQR-  344

Query  327   FIVRRNNDDEASEYHSTKHI  268
                R NN +    + + + I
Sbjct  345   ---RANNPNRGKTFLAEEDI  361



>emb|CEG74798.1| Putative mRNA cap guanine-N7 methyltransferase [Rhizopus microsporus]
Length=318

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 141/274 (51%), Gaps = 17/274 (6%)
 Frame = -2

Query  1167  VKIALIKIFVS-PYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQR  991
             VK  LI+ +V+ P   V ++ CGK  D  KW +A+I H +  D+A   + + +E ++S R
Sbjct  53    VKSVLIQTYVNRPRQCVLDMGCGKGGDLLKWAKARIQHLVASDIAEISLQQMQERYKSLR  112

Query  990   -KVYTTELIEIDPCTEDLKTHLQD--KDNQADIVFCMHNLQLCFESEEKARKLLHNVSSL  820
              + +T E   +D  +E L+  LQ   + +   + FC+H     FE+E+KAR +L NV+S 
Sbjct  113   DRRFTAEFYPMDCYSELLEPKLQPHIQFDTVSMQFCLH---YSFETEQKARTMLKNVTSR  169

Query  819   LKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKF  640
             L+PGG+F+G   D++ I  + ++       KGS    N + N I+ E+     E ++  F
Sbjct  170   LRPGGHFIGTIPDANWIVKRLRQE-----PKGSFGFGNSIYN-IQFENIKDDDEKQKVGF  223

Query  639   PFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY--RPQFVG  466
               FG KY     + +    + LVH+ +  +LA E GL+    +N  DFY +    P +  
Sbjct  224   TKFGCKYMFHLVDAVDC-PEYLVHWSTFEKLANEYGLELKYKENFHDFYVNALKEPDYAR  282

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +L+ +   +   +  +    ++  G++  F F+K
Sbjct  283   LLERIG-VVGGDKAEMSMEEWETAGIYLAFAFEK  315



>ref|XP_006843480.1| hypothetical protein AMTR_s00053p00199490 [Amborella trichopoda]
 gb|ERN05155.1| hypothetical protein AMTR_s00053p00199490 [Amborella trichopoda]
Length=372

 Score =   103 bits (257),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 143/294 (49%), Gaps = 44/294 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V ++ CGK  D  KWD+AQIG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYARRGDAVLDMGCGKGGDLIKWDKAQIGYYVGIDMAEGSIEDCRTRY  127

Query  1002  ----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKL  841
                 +++RK +T    L+  D     L   L+D D   DI  C   L   +++E +AR+ 
Sbjct  128   NGEADARRKKFTFPARLLCGDCFEVPLDRVLED-DAPFDICSCQFALHYSWQTEARARRA  186

Query  840   LHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF  661
             L NV+SLL+PGG F+G   D++ +  K  +NVE                   +  Y+I+F
Sbjct  187   LENVASLLRPGGIFIGTMPDANVLIQKL-RNVEGL--------------TFGNSVYSISF  231

Query  660   EVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDF  496
                  +  F     FG +Y     + +    +C+V F     LA E GL+ + ++N  +F
Sbjct  232   NEAHSQKKFDSSKPFGIQYTFHLEDAVDC-PECIVPFRIFKSLADEYGLELLLVKNSHEF  290

Query  495   YDDY--RPQFVGMLQDV--------NHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
              D+Y  + +FV +++ +        NH+ I          ++V  L+  FVF+K
Sbjct  291   VDEYLKKLEFVDLMRRLGALGDGKNNHSTIS------EDEWEVAYLYLVFVFKK  338



>emb|CEG77672.1| Putative mRNA cap guanine-N7 methyltransferase [Rhizopus microsporus]
Length=318

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 140/274 (51%), Gaps = 17/274 (6%)
 Frame = -2

Query  1167  VKIALIKIFVS-PYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQR  991
             VK  LI+ +V+ P   V ++ CGK  D  KW +A+I H +  D+A   + + +E ++S R
Sbjct  53    VKSVLIQTYVNRPRQYVLDMGCGKGGDLLKWAKARIQHLVASDIAEVSLQQMQERYKSLR  112

Query  990   -KVYTTELIEIDPCTEDLKTHLQD--KDNQADIVFCMHNLQLCFESEEKARKLLHNVSSL  820
              + +T E   +D  +E L+  LQ   + +   + FC+H     FE+E+KAR +L NV+S 
Sbjct  113   DRRFTAEFYPMDCYSELLEPKLQPHIQFDTVSMQFCLH---YSFETEQKARTMLKNVTSR  169

Query  819   LKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKF  640
             L+PGG+F+G   D++ I  + ++       KGS    N + N I  E+     E ++  F
Sbjct  170   LRPGGHFIGTIPDANWIVKRLRQE-----PKGSFGFGNSIYN-IEFENIKDDDEKQKVGF  223

Query  639   PFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY--RPQFVG  466
               FG KY     + +    + LVH+ +  +LA E GL+    +N  DFY +    P +  
Sbjct  224   TKFGCKYMFHLVDAVDC-PEYLVHWSTFEKLANEYGLELKYKENFHDFYVNALKEPDYAR  282

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +L+ +   +   +  +    ++  G++  F F+K
Sbjct  283   LLERIG-VVGGDKAEMSMEEWETAGIYLAFAFEK  315



>gb|EMT00917.1| mRNA cap guanine-N7 methyltransferase 1 [Aegilops tauschii]
Length=371

 Score =   103 bits (256),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 142/291 (49%), Gaps = 34/291 (12%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE-----KKEAW  1003
             +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +       ++ 
Sbjct  75    IKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRYNGDSD  134

Query  1002  ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
             + +RK ++    LI  D     L  +L++ D   DI  C   +   + +E +AR+ L N+
Sbjct  135   QQRRKKFSFPARLICADCYETRLDEYLRE-DAPFDICSCQFAMHYSWSTEARARQALANI  193

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S+LL+PGG F+G   D++ I  + +++         GM+      CI     T   E  E
Sbjct  194   SALLRPGGTFIGTMPDANVIIKRLRES--------EGMEFGNSVYCI-----TFGEEYTE  240

Query  648   EKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY--  484
             +KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +F  DY  
Sbjct  241   KKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHEFVHDYVQ  299

Query  483   RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQKPDPDITPP  340
             RP+F  +++ +   L D R     L    ++   L+  FV +K  P   PP
Sbjct  300   RPEFADLMRRLG-PLGDGRSGQSTLSQDEWEASYLYLAFVLRKRGP---PP  346



>emb|CEI94856.1| Putative mRNA cap guanine-N7 methyltransferase [Rhizopus microsporus]
Length=318

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 140/274 (51%), Gaps = 17/274 (6%)
 Frame = -2

Query  1167  VKIALIKIFVS-PYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQR  991
             VK  LI+ +V+ P   V ++ CGK  D  KW +A+I H +  D+A   + + +E ++S R
Sbjct  53    VKSVLIQTYVNRPRQCVLDMGCGKGGDLLKWAKARIQHLVASDIAEVSLQQMQERYKSLR  112

Query  990   -KVYTTELIEIDPCTEDLKTHLQD--KDNQADIVFCMHNLQLCFESEEKARKLLHNVSSL  820
              + +T E   +D  +E L+  LQ   + +   + FC+H     FE+E+KAR +L NV+S 
Sbjct  113   DRRFTAEFYPMDCYSELLEPKLQPHIQFDTVSMQFCLH---YSFETEQKARTMLKNVTSR  169

Query  819   LKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKF  640
             L+PGG+F+G   D++ I  + ++       KGS    N + N I+ E+     E ++  F
Sbjct  170   LRPGGHFIGTIPDANWIVKRLRQE-----PKGSFGFGNSIYN-IQFENIKDDDEKQKVGF  223

Query  639   PFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY--RPQFVG  466
               FG KY     + +    + LVH+ +  +LA E GL+    +N  DFY      P +  
Sbjct  224   TKFGCKYMFHLVDAVDC-PEYLVHWSTFEKLANEYGLELKYKENFHDFYVRALKEPDYAR  282

Query  465   MLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +L+ +   +   +  +    ++  G++  F F+K
Sbjct  283   LLERIG-VVGGDKAEMSMEEWETAGIYLAFAFEK  315



>ref|XP_010253751.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X3 
[Nelumbo nucifera]
Length=376

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 147/321 (46%), Gaps = 53/321 (17%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI ++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIHLYARRGDFVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMH-NLQLCFESEEKA  850
                     +RK +T    LI  D     L   L+D D   DI  C    L   + +E +A
Sbjct  129   NGDADHHQRRKKFTFPARLICGDCFEVRLDKVLED-DAPFDICSCQQFALHYSWSTETRA  187

Query  849   RKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYT  670
             R+ L NVS+LL+PGG F+G   D++ I  K  + VE                   +  Y 
Sbjct  188   RRALANVSALLRPGGIFIGTMPDANVI-VKKLREVEGL--------------AFGNSVYW  232

Query  669   IAF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNL  505
             I F  E  E+KF F   FG KY     + +    +C+V F     LA E  L+ + ++N 
Sbjct  233   IRFGEEYSEKKFRFSNPFGIKYNFHLEDAVDC-PECIVPFHVFKLLADEYDLELVFVKNF  291

Query  504   TDFYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPD  352
              +F D+Y  +P+F      +G L D N +       L    +DV  L+  FV +K   PD
Sbjct  292   HEFVDEYFKKPEFTELMRRLGALGDGNKD----NSTLSQDEWDVAYLYLAFVLRKRGQPD  347

Query  351   ITPPLMTPFIVRRNNDDEASE  289
              T          RNND+  ++
Sbjct  348   RT---------HRNNDNRGNK  359



>ref|XP_003573408.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X1 
[Brachypodium distachyon]
Length=372

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/310 (28%), Positives = 149/310 (48%), Gaps = 43/310 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  71    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIRDCMTRY  130

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D C E        KD   DI  C   +   + +E +AR+
Sbjct  131   NGDTDQQRRKKFSFPARLICAD-CYETRLDEYLSKDAPFDICSCQFAMHYSWSTEARARQ  189

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L N+S+LL+PGG F+G   D++ I  + ++          GM+         +  Y I 
Sbjct  190   ALANISALLRPGGTFIGTMPDANVIIKRLRET--------DGME-------FGNSVYWIT  234

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  235   FGEEYTEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  293

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
             F ++Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K  P   PP  
Sbjct  294   FVNEYLQKPEFADLMRRLGA-LGDGRPGQSTLSQDEWEVSYLYLAFVLRKRGP---PPSQ  349

Query  333   TPFIVRRNND  304
                  RR+N+
Sbjct  350   -----RRSNN  354



>ref|XP_011097946.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Sesamum 
indicum]
Length=371

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 142/290 (49%), Gaps = 34/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYAKRGDAVLDLACGKGGDLIKWDKARIGYYVGIDIADGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++    LI  D C E     +  +D   DI  C   +   + +E +AR
Sbjct  129   NGDADHHQRRKKFSFPARLICGD-CFEVRLDKILAEDAPFDICSCQFAMHYSWSTEARAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  + +        +  G++     N +    Y I
Sbjct  188   RALANVSALLRPGGIFIGTMPDANVIIKRLR--------QAEGLE---FGNSV----YWI  232

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E EK  F     FG KY     + +    + +V F     LA E GL+ + ++N  
Sbjct  233   RFDEEFEKKKFKSSSPFGIKYTFHLEDAVDC-PEWIVPFHVFKALAEEHGLELVFVKNSH  291

Query  501   DFYDDY--RPQFVGMLQDVN--HNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
              F D+Y  +P+FV +++ +    +  + +  L P  ++V  L+  FV +K
Sbjct  292   AFVDEYLKKPEFVELMRRLGALGDGKEDQSTLSPDEWEVAYLYLAFVLRK  341



>ref|XP_010253750.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X2 
[Nelumbo nucifera]
Length=383

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 149/329 (45%), Gaps = 62/329 (19%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI ++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIHLYARRGDFVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTE---------DLKTHLQDKDNQADIVFCMHNLQL  874
                     +RK +T    LI  D C E          L   L+D D   DI  C   L  
Sbjct  129   NGDADHHQRRKKFTFPARLICGD-CFECRSRRKFLVRLDKVLED-DAPFDICSCQFALHY  186

Query  873   CFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPN  694
              + +E +AR+ L NVS+LL+PGG F+G   D++ I  K  + VE                
Sbjct  187   SWSTETRARRALANVSALLRPGGIFIGTMPDANVI-VKKLREVEGL--------------  231

Query  693   CIRSESYTIAF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGL  529
                +  Y I F  E  E+KF F   FG KY     + +    +C+V F     LA E  L
Sbjct  232   AFGNSVYWIRFGEEYSEKKFRFSNPFGIKYNFHLEDAVDC-PECIVPFHVFKLLADEYDL  290

Query  528   DYIEIQNLTDFYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFV  373
             + + ++N  +F D+Y  +P+F      +G L D N +       L    +DV  L+  FV
Sbjct  291   ELVFVKNFHEFVDEYFKKPEFTELMRRLGALGDGNKD----NSTLSQDEWDVAYLYLAFV  346

Query  372   FQK-PDPDITPPLMTPFIVRRNNDDEASE  289
              +K   PD T          RNND+  ++
Sbjct  347   LRKRGQPDRT---------HRNNDNRGNK  366



>ref|XP_004246767.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Solanum lycopersicum]
Length=373

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/301 (29%), Positives = 142/301 (47%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKK---  1012
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +   
Sbjct  69    KLNNWIKSVLIQLYTKRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  128

Query  1011  --EAWESQRK---VYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
               EA   QR+    +   L+  D C E     +   D   D+  C   +   + +E +AR
Sbjct  129   NGEADHHQRRKKFSFPARLLCGD-CYEVRLDRVLADDAPFDVCSCQFAMHYSWSTEARAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L N+S LL+PGG F+G   D++ I  KY+        +  G+          +  Y I
Sbjct  188   RALANISVLLRPGGIFIGTMPDANVIVKKYR--------EAEGL-------AFGNSVYWI  232

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  E+KF     FG KY+    + +    + +V FP    +A E   + + ++N  
Sbjct  233   RFDEEFSEKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFPVFKAMAEEYDFELVFVKNNH  291

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F D+Y  +P+F+      G L D N +    +  L P  ++V  L+  FV +K   PD 
Sbjct  292   EFVDEYMKKPEFIELMRRLGALGDGNQD----QSTLSPDEWEVAYLYLAFVLRKRGQPDQ  347

Query  348   T  346
             T
Sbjct  348   T  348



>ref|XP_002283163.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Vitis vinifera]
 emb|CBI20470.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   100 bits (250),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 142/301 (47%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYARRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK +T    LI  D C E     + + D   DI  C   +   + +E +AR
Sbjct  128   NGDADHHQRRKKFTFPARLICGD-CFEVPLDRVLEDDAPFDICSCQFAMHYSWSTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G+        I +  Y I
Sbjct  187   RALANVSALLRPGGIFIGTMPDANVIIKKLR--------EAEGL-------AIGNSVYWI  231

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ +  K  F     FG KY+    + +    + +V F     LA E  LD + ++N  
Sbjct  232   RFDEDFSKKKFKTSSPFGIKYKFHLEDAVDC-PEWIVPFHVFKSLAEEYDLDLVLVKNSH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F D+Y  +P+FV      G L D N +    +  L    ++V  L+  FV +K   PD 
Sbjct  291   EFVDEYLKKPEFVELMRRLGALGDGNQD----QTTLSQDEWEVAYLYLAFVLRKRGQPDR  346

Query  348   T  346
             T
Sbjct  347   T  347



>ref|XP_006659891.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Oryza 
brachyantha]
Length=373

 Score =   100 bits (250),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 142/290 (49%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  72    KLNNWIKSVLIQLYAHPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  131

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D     L  HL + D   DI  C   L   + +E +AR+
Sbjct  132   NGDTDQQRRKKFSFPARLICADCYEARLDEHLCE-DAPFDICSCQFALHYSWSTEARARQ  190

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + ++          GM+         +  Y I+
Sbjct  191   ALANVSALLRPGGIFIGTMPDANVIIKRLRET--------DGME-------FGNSVYWIS  235

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  236   FGEEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  294

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  295   FVHEYLQKPEFAELMRRLG-ALGDGRQDQSTLSRDEWEVAYLYLAFVLRK  343



>ref|XP_002066486.1| GK18308 [Drosophila willistoni]
 gb|EDW77472.1| GK18308 [Drosophila willistoni]
Length=418

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 107/234 (46%), Gaps = 23/234 (10%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRKV---------YTTEL  970
             V ++ CGK  D  KWD+A I H I  D+A   + + +  ++   K          +T E 
Sbjct  130   VLDMCCGKGGDLLKWDKASIAHLICTDIAEVSVEQCQRRYQDILKRAENSKYAHKFTAEF  189

Query  969   IEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGI  790
                D     L+   +D   Q ++V C      CFES  +A  ++ N +  L+PGGYF+  
Sbjct  190   FACDSTLVRLRERYKDASLQLNLVSCQFAFHYCFESLAQADCMVRNAAECLQPGGYFIAT  249

Query  789   TTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMK  610
               D+  I  + +         G G +         ++ Y+I FE + ++ P FG KYQ  
Sbjct  250   IPDAYEIMRRLKA-------AGPGQRK------FGNDVYSIEFENDADELPIFGAKYQFH  296

Query  609   FANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
                 +    + LVHFP+L++LAR+ GL  +      ++Y +  P    +LQ ++
Sbjct  297   LEGVVDC-PEFLVHFPTLVKLARKYGLQVLRRSTFAEYYKETLPHGRHLLQRMS  349



>gb|EMT24712.1| mRNA cap guanine-N7 methyltransferase 1 [Aegilops tauschii]
Length=371

 Score =   100 bits (248),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 87/325 (27%), Positives = 155/325 (48%), Gaps = 48/325 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE-----  1018
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +     
Sbjct  70    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKARVGYYVGVDIAEGSIKDCMTRY  129

Query  1017  KKEAWESQRKVYT--TELIEIDPCTEDLKTHLQD---KDNQADIVFCMHNLQLCFESEEK  853
               +A + +RK ++    LI    C +  +T L +   +D   DI  C   +   + +E +
Sbjct  130   NGDADQQRRKKFSFPARLI----CADCYETRLDEYLCEDAPFDICSCQFAMHYSWSTEAR  185

Query  852   ARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESY  673
             AR+ L N+S+LL+PGG F+G   D++ I  + ++          GM+         +  Y
Sbjct  186   ARQALANISALLRPGGTFIGTMPDANVIIKRLRET--------DGME-------FGNSVY  230

Query  672   TIAF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQN  508
              I F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N
Sbjct  231   WITFGEEYNEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKN  289

Query  507   LTDFYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQKPDPDITP  343
               +F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K  P   P
Sbjct  290   FHEFVHEYLQKPEFADLMRRLGA-LGDGRSVQSTLSQDEWEVSYLYLAFVLRKRGP---P  345

Query  342   PLMTPFIVRRNNDDEASEYHSTKHI  268
             P       R NN +    + + + I
Sbjct  346   PSQR----RANNANRGKTFLAEEDI  366



>ref|XP_010062933.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW70088.1| hypothetical protein EUGRSUZ_F03392 [Eucalyptus grandis]
Length=373

 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 88/295 (30%), Positives = 141/295 (48%), Gaps = 44/295 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+YIGID+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYARRGDAVLDLACGKGGDLIKWDKAKIGYYIGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK +T    LI  D C E     +   D   DI  C   +   + +E +AR
Sbjct  129   NGDADHHQRRKKFTFPARLICGD-CFEVQLDKVLAADAPFDICSCQFAMHYSWSTEARAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVE-AYHNKGSGMKPNIVPNCIRSESYT  670
             + L NVS+LL+PGG F+G   D++ I  K ++  E A+ N                  Y 
Sbjct  188   RALANVSALLRPGGIFIGTMPDANVIIKKLREADELAFGN----------------SVYW  231

Query  669   IAFEVE--EEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNL  505
             I F+ E  E+KF     FG KY+    + +    + +V F     LA E  LD + ++N 
Sbjct  232   IHFDEEFPEKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFHVFKALAEEYELDLVFVKNS  290

Query  504   TDFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
              +F  +Y  +P++V      G L D N +    +  L P  ++V  L+ +FV +K
Sbjct  291   HEFVHEYLKKPEYVELMRRLGALGDGNQD----QSTLSPDEWEVAYLYLSFVLRK  341



>ref|XP_002528402.1| mRNA (guanine-7-)methyltransferase, putative [Ricinus communis]
 gb|EEF33995.1| mRNA (guanine-7-)methyltransferase, putative [Ricinus communis]
Length=367

 Score =   100 bits (248),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 87/301 (29%), Positives = 144/301 (48%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  64    KLNNWIKSVLVQLYARRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  123

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++    LI  D     L   L D D   DI  C   L   + +E +AR
Sbjct  124   NGDADHHQRRKKFSFPARLICGDCYEVRLDKVLAD-DAPFDICSCQFALHYSWSTEARAR  182

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K ++            K  +  N +    Y I
Sbjct  183   RALANVSALLRPGGTFIGTMPDANVIVKKLRE-----------AKGPVFGNSV----YWI  227

Query  666   AFEVE--EEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E  E+KF +   +G KY+    + +    + +V F     LA E  L+ + ++N  
Sbjct  228   RFDEEYSEKKFKYSAPYGIKYKFHLEDAVDC-PEWIVPFNIFKSLAEEYDLELVFVKNAH  286

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F  +Y  +P+F+      G L D N +    +  L P  ++V  L+  FV +K   PD 
Sbjct  287   EFVHEYMKKPEFIDLMRRLGALGDGNQD----QSTLSPDEWEVAYLYLAFVLKKRGQPDR  342

Query  348   T  346
             T
Sbjct  343   T  343



>ref|NP_001061136.1| Os08g0180000 [Oryza sativa Japonica Group]
 sp|Q6Z9U7.1|MCES1_ORYSJ RecName: Full=mRNA cap guanine-N7 methyltransferase 1; AltName: 
Full=mRNA (guanine-N(7)-)-methyltransferase 1; AltName: Full=mRNA 
cap methyltransferase 1 [Oryza sativa Japonica Group]
 dbj|BAD17036.1| putative mRNA cap methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF23050.1| Os08g0180000 [Oryza sativa Japonica Group]
 gb|EEE68151.1| hypothetical protein OsJ_26261 [Oryza sativa Japonica Group]
Length=369

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 141/290 (49%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  68    KLNNWIKSVLIQLYAHPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  127

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D     L  HL + D   DI  C   L   + +E +AR+
Sbjct  128   NGDTDQQRRKKFSFPARLICADCYEARLDEHLYE-DAPFDICSCQFALHYSWSTEARARQ  186

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + ++          GM+         +  Y I+
Sbjct  187   ALANVSALLRPGGVFIGTMPDANVIIKRLRET--------DGME-------FGNGVYWIS  231

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ +  +N  +
Sbjct  232   FGEEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLTKNFHE  290

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  291   FVHEYLQKPEFAELMRRLG-ALGDGRQDQSTLSQDEWEVAYLYLAFVLRK  339



>gb|EAZ05808.1| hypothetical protein OsI_28045 [Oryza sativa Indica Group]
Length=369

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 141/290 (49%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  68    KLNNWIKSVLIQLYAHPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  127

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D     L  HL + D   DI  C   L   + +E +AR+
Sbjct  128   NGDTDQQRRKKFSFPARLICADCYEARLDEHLYE-DAPFDICSCQFALHYSWSTEARARQ  186

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + ++          GM+         +  Y I+
Sbjct  187   ALANVSALLRPGGVFIGTMPDANVIIKRLRET--------DGME-------FGNGVYWIS  231

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ +  +N  +
Sbjct  232   FGEEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLTKNFHE  290

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  291   FVHEYLQKPEFAELMRRLG-ALGDGRQDQSTLSQDEWEVAYLYLAFVLRK  339



>ref|XP_009412669.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=369

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 149/321 (46%), Gaps = 50/321 (16%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V ++ CGK  D  KWD+A+IG+Y+G+D+A   + + +  +
Sbjct  67    KLNNWIKSVLIQLYARPKDAVLDIACGKGGDLIKWDKARIGYYVGVDIAEGSIRDCQTRY  126

Query  1002  ------ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                   + +RK ++    LI  D     L  +L+D D   DI  C   L   + +E +AR
Sbjct  127   NGDLDQQQRRKKFSFPARLICADCYEVRLDKYLRD-DAPFDICSCQFALHYSWSTEARAR  185

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  + +        +  G++         +  Y I
Sbjct  186   QALANVSALLRPGGTFIGTMPDANVIIKRLR--------EAEGLE-------FGNSVYWI  230

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E     F     FG KY+    + +    + +V F     LA E  L+ I ++N  
Sbjct  231   CFDEEYSSKKFKPSSPFGVKYKFHLEDAVDC-PEWIVPFHVFKCLAEEYDLELIFVKNSH  289

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDIT  346
             +F +++  +P+FV      G L D N +    +  L    +DV  L+  FV +K      
Sbjct  290   EFVNEFLKKPEFVDLMRRLGALGDGNQD----QSTLSQDEWDVAYLYLAFVLRKRG----  341

Query  345   PPLMTPFIVRRNNDDEASEYH  283
                  P   RRN++    + H
Sbjct  342   ----QPSSSRRNSNINKGKMH  358



>ref|XP_010931870.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Elaeis guineensis]
Length=371

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 143/294 (49%), Gaps = 42/294 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + VK  LI+++     +V +L CGK  D  KWD+A+IG+Y+G+D+A   + + +  +
Sbjct  67    KLNNWVKSVLIQLYARRGDSVLDLACGKGGDLIKWDKAKIGYYVGVDIAEGSIKDCRTRY  126

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
              S      +RK ++    LI  D     L  +L+D D   DI  C   L   + +E +AR
Sbjct  127   NSDADQQQRRKKFSFPARLICADCYEARLDKYLRD-DAPYDICSCQFALHYSWSTEARAR  185

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L +VS+LL+PGG F+G   D++ I  + +        +  G++     N +    Y I
Sbjct  186   RALAHVSALLRPGGTFIGTMPDANVIIKRLR--------EAEGLE---FGNSV----YWI  230

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E  +  F     FG KY+    + +    + +V F     LA E  L+ + ++N  
Sbjct  231   CFDEEYAQKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFNLFKSLAEEYDLELVFVKNFH  289

Query  501   DFYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +F ++Y  +P+F      +G L D N +    +  L    +DV  L+  FV +K
Sbjct  290   EFVNEYLKKPEFAELMRRLGALGDGNQD----QSTLSQDEWDVAYLYLAFVLRK  339



>gb|KHN82523.1| mRNA cap guanine-N7 methyltransferase [Toxocara canis]
Length=597

 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/230 (30%), Positives = 107/230 (47%), Gaps = 18/230 (8%)
 Frame = -2

Query  1134  PYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE------KKEAWESQRKVYTTE  973
             P ATV +L CGK  D  KW    + H +  D+A+  M +      + ++ + +R+++T E
Sbjct  359   PQATVLDLCCGKGGDLLKWRIGNVAHLVATDIASVSMEQCESRYKEMKSRDDRRRMFTAE  418

Query  972   LIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLG  793
              I  D   E L      +D + D+  C  +    FESE +AR ++ N    ++PGGYF+G
Sbjct  419   FIVADATKERLADLYSKRDIEFDLCSCQFSFHYSFESERQARYMIRNAVERIRPGGYFIG  478

Query  792   ITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI-AFEVEEEKFPFFGKKYQ  616
                D+  I       +    N  SG+  N V   +R E   I A    + + P FG K+ 
Sbjct  479   TLPDAERI-------MYCIRNGDSGVYSNDV---VRLEYGDIEALNDSQHRPPIFGAKFH  528

Query  615   MKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVG  466
                   ++   + LVHFP+L RL  E G++ +  +   D  D Y  Q  G
Sbjct  529   FSLDTQVNC-PEYLVHFPALERLLEECGMELVYKKRFPDAVDYYLEQHDG  577



>ref|XP_005537778.1| mRNA (guanine-7-)methyltransferase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81742.1| mRNA (guanine-7-)methyltransferase [Cyanidioschyzon merolae strain 
10D]
Length=373

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 137/300 (46%), Gaps = 30/300 (10%)
 Frame = -2

Query  1179  LIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWE  1000
             L + +K  LI +   P   V +L CGK  D  K+  AQ+ H++G+D A   +    + + 
Sbjct  32    LNNWIKAVLIGLHSRPGCVVLDLACGKGGDLLKFARAQVSHWVGVDHARVSLEHAVQRYN  91

Query  999   S---QRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
                 +++ +    +  D    DL+ +L  +    D+V C   +   FESE++ R++LHNV
Sbjct  92    DLGPKQRSFPAHFLCGDVFGVDLEANLDLEWPAFDLVSCQFAVHYAFESEQRVRQMLHNV  151

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVE----------AYHNKGSGMKPNIVPNCIRSE  679
             +  LKPGG+F+G T D++ + +K +              ++ N    +  +     + + 
Sbjct  152   TCRLKPGGFFIGTTPDANVLVSKLRAASGLSFGNSIYRISFENSSQSIDADGTSADLGNL  211

Query  678   SYTIAFEVE-----EEKFP---FFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDY  523
              +  A  +E      ++FP    FG +Y      ++    + LVHFP+  R+A E  L+ 
Sbjct  212   EHDPAPTLETATSAAKRFPPSRPFGIRYHFTLDENVEDCPEYLVHFPTFERIAAEYDLEL  271

Query  522   IEIQNLTDFYDDYRPQ------FVGMLQDVNHNLIDPR-GRLLPRAYDVLGLFTTFVFQK  364
             +   N   F + +  Q      F  + Q +   ++DP  G + P  +D   L+  F F+K
Sbjct  272   LLRMNFHAFVNAFALQADAPARFRDLFQRM--QVLDPESGTISPEEWDAAYLYLVFAFRK  329



>dbj|BAJ98497.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 86/322 (27%), Positives = 153/322 (48%), Gaps = 42/322 (13%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNE-----  1018
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +     
Sbjct  69    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  128

Query  1017  KKEAWESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
               ++ + +RK ++    LI  D C E        +D   DI  C   +   + +E +AR+
Sbjct  129   NGDSDQQRRKKFSFPARLICAD-CYETRLDEYLCEDAPFDICSCQFAIHYSWSTEARARQ  187

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L N+S+LL+PGG F+G   D++ I  + ++          GM+         +  Y+I 
Sbjct  188   ALANISALLRPGGTFIGTMPDANVIIKRLRET--------EGME-------FGNSVYSIT  232

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  233   FGEEYTEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEHDLELVLMKNFHE  291

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
             F  +Y  RP+F+ +++ +   L D R     L    ++   L+  FV +K  P   PP  
Sbjct  292   FVHEYMQRPEFLDLMRRLGP-LGDGRSGQSTLSQDEWEASYLYLAFVLRKRGP---PPSQ  347

Query  333   TPFIVRRNNDDEASEYHSTKHI  268
                  R NN +    + + + I
Sbjct  348   R----RANNPNRGKTFLAEEDI  365



>gb|ACN40623.1| unknown [Picea sitchensis]
Length=371

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 141/291 (48%), Gaps = 36/291 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+G+D+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYTHRDDVVLDLACGKGGDLIKWDKARIGYYVGVDIADGSIEDCRTRY  127

Query  1002  ESQ------RKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
               +      RK ++    LI  D     L   LQD D   DI  C   L   + +EE+AR
Sbjct  128   NGETDQIHRRKRFSFPARLICADCYEVPLDKALQD-DAPFDICSCQFALHYSWSTEERAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVSSLL+PGG F+G   D++ I  K +        +  G+      N +    Y I
Sbjct  187   QALENVSSLLRPGGTFIGTMPDANVIVKKLR--------EAEGL---TFGNSV----YWI  231

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
             +F+ E  K  F     FG +Y+    + +    + LV F     LA+E GL+ +  +N  
Sbjct  232   SFDEEYTKKKFKSSRPFGIQYKFHLEDAVDC-PEWLVPFHIFKELAKEYGLELVFKKNSH  290

Query  501   DFYDDY--RPQFVGMLQDVNHNLIDPRG---RLLPRAYDVLGLFTTFVFQK  364
             +F ++Y  +P+F  +++ +   L D  G    L    ++   L+  FV +K
Sbjct  291   EFVNEYIKKPEFAELMRRLG-ALGDGSGDGRTLSEDEWEAAYLYLVFVMRK  340



>ref|XP_010234336.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X2 
[Brachypodium distachyon]
Length=369

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 135/274 (49%), Gaps = 32/274 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  71    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIRDCMTRY  130

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D C E        KD   DI  C   +   + +E +AR+
Sbjct  131   NGDTDQQRRKKFSFPARLICAD-CYETRLDEYLSKDAPFDICSCQFAMHYSWSTEARARQ  189

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L N+S+LL+PGG F+G   D++ I  + ++          GM+         +  Y I 
Sbjct  190   ALANISALLRPGGTFIGTMPDANVIIKRLRET--------DGME-------FGNSVYWIT  234

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  235   FGEEYTEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  293

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPRGRLLPRAY  403
             F ++Y  +P+F  +++ +   L D R   +P+ +
Sbjct  294   FVNEYLQKPEFADLMRRLG-ALGDGRPGQIPQVH  326



>ref|NP_001149962.1| mRNA [Zea mays]
 gb|ACG37354.1| mRNA [Zea mays]
Length=367

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 138/288 (48%), Gaps = 31/288 (11%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM-------  1024
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   +       
Sbjct  66    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  125

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N   +    +R  +   LI  D     L  +L + D   DI  C   L   + +E +AR+
Sbjct  126   NGDTDQQRRKRFSFPARLICTDCYEARLDEYLYE-DAPFDICSCQFALHYSWSTEARARQ  184

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + +++         G++      CI     +  
Sbjct  185   ALANVSALLRPGGIFIGTMPDANVIIKRLRES--------EGLEFGNSVYCI-----SFG  231

Query  663   FEVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFY  493
              E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +F 
Sbjct  232   NEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHEFV  290

Query  492   DDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
              +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  291   HEYLQKPEFAELMRRLG-ALGDGRQDQSTLSQDEWEVSYLYLAFVLRK  337



>ref|XP_004972710.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Setaria 
italica]
Length=369

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/293 (28%), Positives = 142/293 (48%), Gaps = 41/293 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  68    KLNNWIKSVLIQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  127

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D C E        +D   DI  C   L   + +E +AR+
Sbjct  128   NGDTDQQRRKKFSFPARLICTD-CYEARLDEYLSEDAPFDICSCQFALHYSWSTEARARQ  186

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + +++         G++         +  Y ++
Sbjct  187   ALANVSALLRPGGIFIGTMPDANVIIKRLRES--------EGLE-------FGNSVYWVS  231

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E GL+ + ++N  +
Sbjct  232   FGEEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYGLELVLMKNFHE  290

Query  498   FYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  + +F      +G L D  H+    +  L    ++V  L+  FV +K
Sbjct  291   FVHEYLQKAEFTELMRRLGALGDGRHD----QSTLSQDEWEVSYLYLAFVLRK  339



>ref|XP_001987970.1| GH10912 [Drosophila grimshawi]
 gb|EDW02837.1| GH10912 [Drosophila grimshawi]
Length=412

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 112/251 (45%), Gaps = 27/251 (11%)
 Frame = -2

Query  1161  IALIK--IFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWES--Q  994
             +ALIK    V     V ++ CGK  D  KWD+A I H I  D+A   + + +  ++   Q
Sbjct  107   MALIKNQKRVGDALRVLDMCCGKGGDLLKWDKALISHLICTDIADVSVEQCQRRYQDILQ  166

Query  993   RK-------VYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLH  835
             R         +T E    D     L+   +D   Q ++V C      CFES  +A  ++ 
Sbjct  167   RAEKSKYGHKFTAEFFACDSTMVRLRERYKDASLQLNLVSCQFAFHYCFESLSQADCMMR  226

Query  834   NVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE-  658
             N +  L+PGGYF+    D+  I  +          K +G       N    + Y+I FE 
Sbjct  227   NAAECLEPGGYFIATIPDAYEIMRRL---------KAAGPDARRFGN----DVYSIEFED  273

Query  657   -VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYR  481
              +  E  P FG KYQ      +    + LVHFP+L++L R+ GL  I      D+Y +  
Sbjct  274   DMMTEAPPLFGAKYQFHLEGVVDC-PEFLVHFPTLVKLGRKHGLQLIRRSTFADYYKETM  332

Query  480   PQFVGMLQDVN  448
             PQ   +LQ ++
Sbjct  333   PQGRQLLQRMS  343



>ref|XP_008454587.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454588.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454590.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454591.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454592.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454593.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454594.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454595.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
 ref|XP_008454596.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Cucumis melo]
Length=371

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 87/301 (29%), Positives = 144/301 (48%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLVQLYARRGDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++    LI  D C E    H+   D   DI  C   L   + +E +AR
Sbjct  128   NGDADHHQRRKKFSFPARLICGD-CYEARLDHVLADDAPFDICSCQFALHYSWSTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L N+S+LL+PGG  +G   D++ I  K +        +  G+   +  N +    Y I
Sbjct  187   RALANISALLRPGGILIGTMPDANVIVKKLR--------EAQGL---MFGNSV----YWI  231

Query  666   AFEVE--EEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E  E+KF     FG KY     + +    + +V F     LA E  L+ + ++N  
Sbjct  232   RFDEEYAEKKFSASSPFGIKYLFHLEDAVDC-PEWIVPFHVFKSLAEEYDLELVFVKNSH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F  +Y  +P+FV      G L D N +    +  L P  ++V  L+ +FV +K   PD 
Sbjct  291   EFVHEYLKKPEFVDLMRRLGALGDGNQD----QSTLSPDEWEVAYLYLSFVLRKRGQPDR  346

Query  348   T  346
             T
Sbjct  347   T  347



>ref|XP_004151971.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004160264.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Cucumis 
sativus]
Length=370

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 87/301 (29%), Positives = 144/301 (48%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  67    KLNNWIKSVLVQLYARRGDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRY  126

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++    LI  D C E    H+   D   DI  C   L   + +E +AR
Sbjct  127   NGDADHHQRRKKFSFPARLICGD-CYEARLDHVLADDAPFDICSCQFALHYSWSTEARAR  185

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L N+S+LL+PGG  +G   D++ I  K +        +  G+   +  N +    Y I
Sbjct  186   RALANISALLRPGGVLIGTMPDANVIVKKLR--------EAQGL---MFGNSV----YWI  230

Query  666   AFEVE--EEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E  E+KF     FG KY     + +    + +V F     LA E  L+ + ++N  
Sbjct  231   RFDEEYAEKKFNASSPFGIKYLFHLEDAVDC-PEWIVPFHVFKSLAEEYDLELVFVKNSH  289

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F  +Y  +P+FV      G L D N +    +  L P  ++V  L+ +FV +K   PD 
Sbjct  290   EFVHEYLKKPEFVDLMRRLGALGDGNQD----QSTLSPDEWEVAYLYLSFVLRKRGQPDR  345

Query  348   T  346
             T
Sbjct  346   T  346



>ref|XP_003699309.1| PREDICTED: mRNA cap guanine-N7 methyltransferase-like [Megachile 
rotundata]
Length=438

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 137/307 (45%), Gaps = 57/307 (19%)
 Frame = -2

Query  1164  KIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK-  988
             K+   K++ SP   V ++ CGK  D  KW++A++ H I  D+A   + + ++ ++   K 
Sbjct  133   KVKEHKVYGSPLK-VLDMCCGKGGDLFKWEKAKVSHVICADLAEISIEQCQQRYKDLLKS  191

Query  987   ---------VYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLH  835
                      ++T E I  D     L+T  +D   Q D V C      CFE+ ++A  ++ 
Sbjct  192   SANKRDPTPLFTAEFITADCTKVHLRTKFKDPSIQLDFVSCQFAFHYCFETLQQAECMMK  251

Query  834   NVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEV  655
             N S  LKPGGYF+G   ++  + +++QK                  N   ++ Y I F  
Sbjct  252   NASECLKPGGYFVGTIPNAYDLVSRWQK---------------CDGNSFGNDIYNIEFCC  296

Query  654   EEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFY------  493
             ++ K P FG KY  +  + ++   + LV+ P L +LA++ GL+ +  +   ++Y      
Sbjct  297   DKTKPPLFGAKYHFQLESLVNC-PEFLVYLPVLNKLAQKFGLELVMFKRFDEYYETMKNK  355

Query  492   -----------DDYRPQFVGML-----QDVNH------NLIDPR--GRLLPRAYDVLGLF  385
                        + Y PQ    L     +D  H      N+ D    G L    +D++ L+
Sbjct  356   GKFLLNKMQALETYPPQQGTKLLGKPDEDYQHVKQHARNVSDRHKIGTLSQSDWDIITLY  415

Query  384   TTFVFQK  364
               FVFQK
Sbjct  416   AVFVFQK  422



>ref|XP_001961496.1| GF14902 [Drosophila ananassae]
 gb|EDV30717.1| GF14902 [Drosophila ananassae]
Length=426

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 108/234 (46%), Gaps = 23/234 (10%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWES-QRKV--------YTTEL  970
             V ++ CGK  D  KW++A I H I  D+A   + + +  ++   R+         +T E 
Sbjct  138   VLDMCCGKGGDLLKWEKASISHLICTDIAEVSIEQCQRRYQDILRRAENSKFSNKFTAEF  197

Query  969   IEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGI  790
                D     L+   +D   Q ++V C      CFES  +A  ++ N +  LKPGG+F+  
Sbjct  198   FACDSTLVRLRERYKDPSLQLNLVSCQFAFHYCFESLAQADCMMRNAAECLKPGGFFIAT  257

Query  789   TTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMK  610
               D+  I  +          K +G +     N +    Y+I F+ E +  P FG KYQ  
Sbjct  258   IPDAYEIIRRL---------KAAGPETRRFGNDV----YSIEFDCETDPLPLFGAKYQFH  304

Query  609   FANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
                 +    + LVHFP+L++L R+ GL  I     +++Y +  P+   +LQ ++
Sbjct  305   LEGVVDC-PEFLVHFPTLVKLGRKYGLQLIRRSTFSEYYKETLPKGRQLLQRMS  357



>ref|XP_010234337.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X3 
[Brachypodium distachyon]
Length=322

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 128/259 (49%), Gaps = 31/259 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  71    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIRDCMTRY  130

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D C E        KD   DI  C   +   + +E +AR+
Sbjct  131   NGDTDQQRRKKFSFPARLICAD-CYETRLDEYLSKDAPFDICSCQFAMHYSWSTEARARQ  189

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L N+S+LL+PGG F+G   D++ I  + ++          GM+         +  Y I 
Sbjct  190   ALANISALLRPGGTFIGTMPDANVIIKRLRET--------DGME-------FGNSVYWIT  234

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  235   FGEEYTEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  293

Query  498   FYDDY--RPQFVGMLQDVN  448
             F ++Y  +P+F  +++ + 
Sbjct  294   FVNEYLQKPEFADLMRRLG  312



>ref|XP_002587527.1| hypothetical protein BRAFLDRAFT_156010 [Branchiostoma floridae]
 gb|EEN43538.1| hypothetical protein BRAFLDRAFT_156010 [Branchiostoma floridae]
Length=294

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/257 (29%), Positives = 114/257 (44%), Gaps = 33/257 (13%)
 Frame = -2

Query  1215  AHRPPTESFHHR-LIDIVKIALIKIFV------SPYATVC--ELYCGKVPDEEKWDEAQI  1063
             AHR  +  FH R   + +K  LI   +      SP   +C  +L  GK  D  KW +  I
Sbjct  14    AHRNQSRIFHLRNFNNWIKSMLIADTLRRLRADSPGGRLCVLDLGVGKGGDLLKWKKGGI  73

Query  1062  GHYIGIDVATSGMNEKKEAWESQR-------KVYTTELIEIDPCTEDLKTHLQDKDNQAD  904
              H +  D+A + + + +E + S         +V++ E I  D   EDL    +D D   D
Sbjct  74    DHLVCADLAETSVQQCEERYRSMAGREGRGPRVFSAEFIAADCAKEDLSRRYRDPDTTFD  133

Query  903   IVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKG  724
             +V C   L   FES  +A ++L N    L+PGGYF+G T D   +  + Q        +G
Sbjct  134   LVSCQFVLHYSFESHAQADRMLRNAGERLRPGGYFIGTTPDGYELVRRLQT------AEG  187

Query  723   SGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLA  544
                  +I         Y+I F  ++E FP FG +Y       +    + LV+FP L ++A
Sbjct  188   LSFGNSI---------YSITFR-QKENFPLFGCQYDFHLEGVVDC-PEFLVYFPLLEKMA  236

Query  543   REAGLDYIEIQNLTDFY  493
                GL  +  Q   +F+
Sbjct  237   ERYGLRLVYRQTFAEFF  253



>ref|XP_004235844.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Solanum 
lycopersicum]
Length=373

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 87/324 (27%), Positives = 146/324 (45%), Gaps = 50/324 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A++G+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYAKRGDAVLDLACGKGGDLIKWDKAKVGYYVGIDIADGSIEDCRTRY  128

Query  1002  -------ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                    + ++K      +    C E     +   D   D+  C   +   + +E +AR+
Sbjct  129   NGDADHHQRRKKFSFPARLMCGDCYEVRLDRILADDAPFDVCSCQFAMHYSWSTEARARR  188

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  K +        +  G+          +  Y I 
Sbjct  189   ALANVSALLRPGGIFIGTMPDANVIIKKLR--------EAEGL-------TFGNSVYWIR  233

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KF     FG KY+    + +    + +V F     LA E   + + ++N   
Sbjct  234   FDEEFSEKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFHIFKELAEEYDFELVFVKNNHI  292

Query  498   FYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDIT  346
             F D+Y  +P+F+      G L D N +    R  L P  ++V  L+ TFV +K   PD T
Sbjct  293   FIDEYMKKPEFIELMRRLGALGDGNQD----RSTLSPDEWEVAYLYLTFVLRKRGQPDQT  348

Query  345   PPLMTPFIVRRNNDDEASEYHSTK  274
                      +RN   +  + H TK
Sbjct  349   ---------QRNPRRDKGKMHLTK  363



>ref|XP_002089335.1| GE19056 [Drosophila yakuba]
 gb|EDW89047.1| GE19056 [Drosophila yakuba]
Length=427

 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 105/234 (45%), Gaps = 23/234 (10%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWES--QR-------KVYTTEL  970
             V ++ CGK  D  KW++A I H I  D+A   + + +  ++   QR         +T E 
Sbjct  139   VLDMCCGKGGDLLKWEKAAISHLICTDIAEVSVEQCQRRYQDILQRAEKSKFANKFTAEF  198

Query  969   IEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGI  790
                D     L+   +D   Q ++V C      CFES  +A  ++ N +  LKPGG+F+  
Sbjct  199   FACDSTLVRLRERYKDPSLQLNLVSCQFAFHYCFESMAQADCMMRNAAECLKPGGFFIAT  258

Query  789   TTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMK  610
               D+  I  +          + +G       N +    Y+I F+ E +  P FG KYQ  
Sbjct  259   MPDAYEIIRRL---------RAAGSDARRFGNDV----YSIEFDCETDPLPLFGAKYQFH  305

Query  609   FANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
                 +    + LVHFP+L++L R+ GL  +      D+Y +  P    +LQ ++
Sbjct  306   LEGVVDC-PEFLVHFPTLVKLGRKYGLQLLRRSTFADYYKESLPHGRHLLQRMS  358



>ref|XP_001968929.1| GG25137 [Drosophila erecta]
 gb|EDV57988.1| GG25137 [Drosophila erecta]
Length=427

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 105/234 (45%), Gaps = 23/234 (10%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWES--QR-------KVYTTEL  970
             V ++ CGK  D  KW++A I H I  D+A   + + +  ++   QR         +T E 
Sbjct  139   VLDMCCGKGGDLLKWEKAAISHLICTDIAEVSVEQCQRRYQDILQRAEKSKFANKFTAEF  198

Query  969   IEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGI  790
                D     L+   +D   Q ++V C      CFES  +A  ++ N +  LKPGG+F+  
Sbjct  199   FACDSTLVRLRERYKDPSLQLNLVSCQFAFHYCFESMAQADCMMRNAAECLKPGGFFIAT  258

Query  789   TTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMK  610
               D+  I  +          + +G       N +    Y+I F+ E +  P FG KYQ  
Sbjct  259   MPDAYEIIRRL---------RAAGPDARRFGNNV----YSIEFDCETDPLPLFGAKYQFH  305

Query  609   FANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
                 +    + LVHFP+L++L R+ GL  +      D+Y +  P    +LQ ++
Sbjct  306   LEGVVDC-PEFLVHFPTLVKLGRKYGLQLLRRSTFADYYKESLPHGRHLLQRMS  358



>tpg|DAA50954.1| TPA: hypothetical protein ZEAMMB73_770353 [Zea mays]
Length=367

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 80/290 (28%), Positives = 140/290 (48%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM-------  1024
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   +       
Sbjct  66    KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  125

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N   +    +R  +   LI  D     L  +L + D   DI  C   L   + +E +AR+
Sbjct  126   NGDTDQQRRKRFSFPARLICTDCYEARLDEYLYE-DAPFDICSCQFALHYSWSTEARARQ  184

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + +++         G++         +  Y I+
Sbjct  185   ALANVSALLRPGGIFIGTMPDANVIIKRLRES--------EGLE-------FGNSVYWIS  229

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  230   FGNEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  288

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  289   FVHEYLQKPEFAELMRRLG-ALGDGRQDQSTLSQDEWEVSYLYLAFVLRK  337



>gb|EFN84098.1| mRNA cap guanine-N7 methyltransferase [Harpegnathos saltator]
Length=356

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 78/294 (27%), Positives = 122/294 (41%), Gaps = 57/294 (19%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQRK----------VYTTE  973
             V ++ CGK  D  KW +A I H I  D+A   + + ++ +               +YT E
Sbjct  64    VLDMCCGKGGDLLKWKKANITHLICADIAEVSLEQCQQRYNDMTSRSSNDRGFAPIYTAE  123

Query  972   LIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLG  793
              I  D     L+   +D   Q D V C       FES  +A  +L N S  L+PGG+F+G
Sbjct  124   FITADCTKVRLREKYKDPSMQLDFVSCQFAFHYSFESLSQAECMLRNASETLRPGGFFVG  183

Query  792   ITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE-EKFPFFGKKYQ  616
                D+  + +++QK  +               N   ++ Y+I F  E+ E+ P FG KY 
Sbjct  184   TIPDAYDLVSRWQKCDD---------------NKFGNDVYSIDFLCEDKERPPLFGAKYN  228

Query  615   MKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGML--------  460
                   +    + LVH P+L +LA + GL+ +  +    FY+ ++ +   +L        
Sbjct  229   FHLEGVVDC-PEFLVHLPTLRKLALKNGLELVAFERFDTFYERFKDEGRSLLGNMQALET  287

Query  459   --------------QDVNH------NLIDPR--GRLLPRAYDVLGLFTTFVFQK  364
                           QD  H      NL D R  G L    +DV  L+  F F+K
Sbjct  288   YPPFHEVPLLGNSEQDYQHAVQYMQNLPDHRKIGTLSQSEWDVTSLYAVFAFRK  341



>ref|XP_002464010.1| hypothetical protein SORBIDRAFT_01g010530 [Sorghum bicolor]
 gb|EER91008.1| hypothetical protein SORBIDRAFT_01g010530 [Sorghum bicolor]
Length=368

 Score = 97.4 bits (241),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 81/290 (28%), Positives = 143/290 (49%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  67    KLNNWIKSVLIQLYARPGDCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  126

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D     L  +L + D   DI  C   L   + +E +AR+
Sbjct  127   NGDTDQQRRKKFSFPARLICTDCYEARLDEYLYE-DAPFDICSCQFALHYSWSTEARARQ  185

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + +++         G++         +  Y I+
Sbjct  186   ALANVSALLRPGGIFIGTMPDANVIIKRLRES--------EGLE-------FGNSVYWIS  230

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  231   FGEEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  289

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  290   FVHEYLQKPEFTELMRRLG-ALGDGRQDQSTLSQDEWEVSYLYLAFVLRK  338



>ref|XP_010253749.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X1 
[Nelumbo nucifera]
Length=384

 Score = 97.8 bits (242),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 99/330 (30%), Positives = 149/330 (45%), Gaps = 63/330 (19%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI ++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIHLYARRGDFVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTE---------DLKTHLQDKDNQADIVFCMH-NLQ  877
                     +RK +T    LI  D C E          L   L+D D   DI  C    L 
Sbjct  129   NGDADHHQRRKKFTFPARLICGD-CFECRSRRKFLVRLDKVLED-DAPFDICSCQQFALH  186

Query  876   LCFESEEKARKLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVP  697
               + +E +AR+ L NVS+LL+PGG F+G   D++ I  K  + VE               
Sbjct  187   YSWSTETRARRALANVSALLRPGGIFIGTMPDANVI-VKKLREVEGL-------------  232

Query  696   NCIRSESYTIAF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAG  532
                 +  Y I F  E  E+KF F   FG KY     + +    +C+V F     LA E  
Sbjct  233   -AFGNSVYWIRFGEEYSEKKFRFSNPFGIKYNFHLEDAVDC-PECIVPFHVFKLLADEYD  290

Query  531   LDYIEIQNLTDFYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTF  376
             L+ + ++N  +F D+Y  +P+F      +G L D N +       L    +DV  L+  F
Sbjct  291   LELVFVKNFHEFVDEYFKKPEFTELMRRLGALGDGNKD----NSTLSQDEWDVAYLYLAF  346

Query  375   VFQK-PDPDITPPLMTPFIVRRNNDDEASE  289
             V +K   PD T          RNND+  ++
Sbjct  347   VLRKRGQPDRT---------HRNNDNRGNK  367



>gb|EFA03004.1| hypothetical protein TcasGA2_TC010427 [Tribolium castaneum]
Length=323

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 107/231 (46%), Gaps = 26/231 (11%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVAT-------SGMNEKKEAWESQRK---VYTTE  973
             V ++ CGK  D  KW +  I H I  D+A+       S  N+ KE    +R    +Y+ E
Sbjct  32    VLDMCCGKGGDLLKWRKGNITHLICSDIASVSLDQCRSRYNDMKERSSRERNGGNIYSIE  91

Query  972   LIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLG  793
              I  D     L+    D   + D+V C       FES  +A  ++ N S  L+PGG+F+G
Sbjct  92    YIAGDCSRVRLREKYTDPSMKLDLVSCQFAFHYSFESLPQAECMIRNASECLQPGGFFIG  151

Query  792   ITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQM  613
                D++ + A+ ++                  N   ++ Y + F+ +  K P FG KY  
Sbjct  152   TIPDANDLIARARR---------------ADANTFGNDVYQVHFDCDVNKPPLFGAKYNF  196

Query  612   KFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGML  460
                  +    + LVHFP+LI+LAR+ GL +++ +   D+Y+  + +   +L
Sbjct  197   HLDGVVDC-PEFLVHFPTLIKLARKYGLKFVKKEKFYDYYEQMKNEGRQLL  246



>ref|XP_011095296.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X2 
[Sesamum indicum]
Length=335

 Score = 97.1 bits (240),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 141/309 (46%), Gaps = 38/309 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  31    KLNNWIKSVLIQLYTKKGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  90

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++    LI  D     L   L D D   D+  C   +   + +E +AR
Sbjct  91    NGDADHHQRRKKFSFPARLICGDCFEVRLDKVLAD-DAPFDVCSCQFAMHYSWSTEARAR  149

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D + I  K ++          GM          +  Y I
Sbjct  150   RALANVSALLRPGGIFIGTMPDGNVIVKKLREV--------DGM-------TFGNSVYWI  194

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E E   F     FG KY+    + +    + +V F     +A E  L+ I  +N  
Sbjct  195   RFDEEFENKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFHVFKSMAEEYDLELIFAKNAH  253

Query  501   DFYDDY--RPQFVGMLQDVN--HNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
              F D+Y  +P+F+ +++ +    +  D +  L P  +D   L+  FV +K       P  
Sbjct  254   VFVDEYLKKPEFIELMRRLGALGDGKDDQSTLSPDEWDAAYLYLAFVLRKR----GQPDQ  309

Query  333   TPFIVRRNN  307
             T   +RR+ 
Sbjct  310   TQVSIRRDK  318



>ref|XP_011095295.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X1 
[Sesamum indicum]
Length=373

 Score = 97.4 bits (241),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 141/309 (46%), Gaps = 38/309 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYTKKGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++    LI  D     L   L D D   D+  C   +   + +E +AR
Sbjct  129   NGDADHHQRRKKFSFPARLICGDCFEVRLDKVLAD-DAPFDVCSCQFAMHYSWSTEARAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D + I  K ++          GM          +  Y I
Sbjct  188   RALANVSALLRPGGIFIGTMPDGNVIVKKLREV--------DGM-------TFGNSVYWI  232

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E E   F     FG KY+    + +    + +V F     +A E  L+ I  +N  
Sbjct  233   RFDEEFENKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFHVFKSMAEEYDLELIFAKNAH  291

Query  501   DFYDDY--RPQFVGMLQDVN--HNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITPPLM  334
              F D+Y  +P+F+ +++ +    +  D +  L P  +D   L+  FV +K       P  
Sbjct  292   VFVDEYLKKPEFIELMRRLGALGDGKDDQSTLSPDEWDAAYLYLAFVLRKR----GQPDQ  347

Query  333   TPFIVRRNN  307
             T   +RR+ 
Sbjct  348   TQVSIRRDK  356



>ref|XP_002018845.1| GL26022 [Drosophila persimilis]
 gb|EDW37041.1| GL26022 [Drosophila persimilis]
Length=408

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 69/249 (28%), Positives = 112/249 (45%), Gaps = 25/249 (10%)
 Frame = -2

Query  1161  IALIK--IFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWE----  1000
             +ALIK    V     V ++ CGK  D  KW++A I H I  D+A   + + +  ++    
Sbjct  105   MALIKESKRVGDALRVLDMCCGKGGDLLKWEKAAITHIICTDIAEVSVEQCQRRYQDILE  164

Query  999   -SQRKVY----TTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLH  835
              +++  Y    T E    D     L+   +D   Q ++V C      CFES  +A  ++ 
Sbjct  165   RAEKSKYANKFTAEFFACDSTLVRLRERYKDVTLQLNLVSCQFAFHYCFESLGQADCMMR  224

Query  834   NVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEV  655
             N +  L+PGGYF+    D+  I  +          + +G       N    + Y I F+ 
Sbjct  225   NAAECLEPGGYFIATMPDAYEIMRR---------KREAGPDAQSFGN----DVYNIKFDC  271

Query  654   EEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQ  475
             E +  P FG KYQ      +    + LVHFP+L++L R+ GL  +      D+Y +  PQ
Sbjct  272   ETDPLPLFGAKYQFHLEGVVDC-PEFLVHFPTLVKLGRKYGLKLVRKTTFADYYKEALPQ  330

Query  474   FVGMLQDVN  448
                +LQ ++
Sbjct  331   GRNLLQRMS  339



>ref|XP_009419607.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=373

 Score = 97.4 bits (241),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 81/294 (28%), Positives = 141/294 (48%), Gaps = 42/294 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V ++ CGK  D  KWD+A+IG+Y+G+D+A   + + +  +
Sbjct  67    KLNNWIKSVLIQLYAHPKDAVLDIACGKGGDLIKWDKARIGYYVGVDIAEGSIKDCRTRY  126

Query  1002  ------ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                   + +RK ++    LI  D     L  +L D D   D+  C   L   + +E +AR
Sbjct  127   NGDSDQQQRRKKFSFPARLICADFYEVRLDKYLHD-DAPFDVCSCQFALHYSWSTEARAR  185

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  + +        +  G++         +  Y I
Sbjct  186   QALANVSALLQPGGTFIGTMPDANVIIKRLR--------EAEGLE-------FGNSVYWI  230

Query  666   AFEVEEEKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F+ E     F     FG KY+    + +    + +V F     LA+E  L+ + ++N  
Sbjct  231   CFDEEYSSKKFKSSSPFGIKYKFHLEDAVDC-PEWIVPFHVFKSLAQEYDLELVFVKNSH  289

Query  501   DFYDDY--RPQF------VGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +F ++Y  RP+F      +G L D N +    +  L    +DV  L+  FV +K
Sbjct  290   EFVNEYLRRPEFTDLMRRLGALGDGNQD----QSTLSQDEWDVAYLYLAFVLRK  339



>ref|XP_001357357.2| GA17612 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL34426.2| GA17612 [Drosophila pseudoobscura pseudoobscura]
Length=408

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/249 (28%), Positives = 112/249 (45%), Gaps = 25/249 (10%)
 Frame = -2

Query  1161  IALIK--IFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWE----  1000
             +ALIK    V     V ++ CGK  D  KW++A I H I  D+A   + + +  ++    
Sbjct  105   MALIKESKRVGDALRVLDMCCGKGGDLLKWEKAAITHIICTDIAEVSVEQCQRRYQDILE  164

Query  999   -SQRKVY----TTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLH  835
              +++  Y    T E    D     L+   +D   Q ++V C      CFES  +A  ++ 
Sbjct  165   RAEKSKYANKFTAEFFACDSTLVRLRERYKDVTLQLNLVSCQFAFHYCFESLGQADCMMR  224

Query  834   NVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEV  655
             N +  L+PGGYF+    D+  I  +          + +G       N    + Y I F+ 
Sbjct  225   NAAECLEPGGYFIATMPDAYEIMRR---------KREAGPDAQSFGN----DVYNIKFDC  271

Query  654   EEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQ  475
             E +  P FG KYQ      +    + LVHFP+L++L R+ GL  +      D+Y +  PQ
Sbjct  272   ETDPLPLFGAKYQFHLEGVVDC-PEFLVHFPTLVKLGRKYGLKLVRKTTFADYYKEALPQ  330

Query  474   FVGMLQDVN  448
                +LQ ++
Sbjct  331   GRNLLQRMS  339



>ref|XP_002987067.1| hypothetical protein SELMODRAFT_158424 [Selaginella moellendorffii]
 gb|EFJ11910.1| hypothetical protein SELMODRAFT_158424 [Selaginella moellendorffii]
Length=340

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/283 (28%), Positives = 128/283 (45%), Gaps = 29/283 (10%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI ++V    +V +L CGK  D  K+D+A IG Y+G+D+A   +++  + +
Sbjct  47    KLNNWIKSVLIHLYVHKGDSVLDLACGKGGDLIKYDKANIGRYVGVDIAAGSIDDAMKRY  106

Query  1002  ES--QRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              +  QR  +  EL   D    DL+  +Q      D+  C   L   + + E+A + L NV
Sbjct  107   NNRRQRLSFAAELFCGDCYEVDLERSIQ---GGFDVCSCQFALHYSWSTIERAERALDNV  163

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEE  649
             S +L PGG+F+G   DS+ I  K +           G++         +  Y I+F  E 
Sbjct  164   SRMLNPGGFFIGTMPDSNVIVQKLR--------AAQGLE-------FGNSVYNISFGEEH  208

Query  648   EKFPF-----FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
                 F     FG +Y  K  + +    + LV FP    LA   GLD +   N  DF   +
Sbjct  209   RTKRFSQATRFGIQYHFKLEDAVDC-PEWLVFFPYFQSLAANYGLDLVLKLNFHDFVHKH  267

Query  483   --RPQFVGMLQDVNHNLIDPRGRLL-PRAYDVLGLFTTFVFQK  364
                  F+ +++ +        G  L P  ++   L+  FVF+K
Sbjct  268   IKDDHFIDLMRKLGALGDGSNGDTLSPDEWEAAYLYLVFVFKK  310



>gb|KFK39384.1| hypothetical protein AALP_AA3G238000 [Arabis alpina]
Length=370

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/294 (28%), Positives = 144/294 (49%), Gaps = 42/294 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P  +V +L CGK  D  KWD+AQIG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYTRPDDSVLDLACGKGGDLIKWDKAQIGYYVGIDIAEGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++  + L+  D     L  +L++ D   DI  C   +   + +E +AR
Sbjct  128   NGDADHHQRRKKFSFPSRLLCGDCFEVALDKYLEE-DAPFDICSCQFAMHYSWTTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G++       I +  Y I
Sbjct  187   RALANVSALLRPGGVFIGTMPDANVIIKKLR--------EAEGLE-------IGNSVYWI  231

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  ++KF     FG +Y     + +    + +V F     LA E  L+ + ++N  
Sbjct  232   RFGKEYSQKKFKSSSPFGIEYVFHLEDAVDC-PEWIVPFNVFKSLAEEYDLELVFVKNSH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +F  +Y  +P++V      G L D NH+    +  L    ++   L+ +FV +K
Sbjct  291   EFVHEYMKKPEYVELMKRLGALGDGNHD----QSTLSADEWEAAYLYLSFVLRK  340



>emb|CDP05825.1| unnamed protein product [Coffea canephora]
Length=370

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 143/323 (44%), Gaps = 48/323 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A++G+Y+G+D+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYAKKGDAVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIEDCRTRY  128

Query  1002  -------ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                    + ++K      +    C E     +   D   DI  C   +   + +E +AR+
Sbjct  129   NGDADHHQRRKKFSFPARLMCGDCFEVRLDKVLSDDAPFDICSCQFAMHYSWSTEARARR  188

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  K +        +  G+          +  Y I 
Sbjct  189   ALANVSALLRPGGIFIGTMPDANVIIKKLR--------EAEGL-------AFGNSVYWIR  233

Query  663   FEVE--EEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F+ E  E+KF     FG KY+    + +    + +V F     LA E  L+ + ++N   
Sbjct  234   FDEEYSEKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFHVFKALAEEYDLELVFVKNSHV  292

Query  498   FYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDITP  343
             F D+Y  +P+F+      G L D N +       L P  ++V  L+  FV +K       
Sbjct  293   FVDEYLKKPEFIELMRRLGALGDGNQD----HSTLSPDEWEVAYLYLAFVLRKRG-----  343

Query  342   PLMTPFIVRRNNDDEASEYHSTK  274
                 P   R NN  +  + H  K
Sbjct  344   ---QPNQTRDNNRRDKGKMHVDK  363



>ref|XP_007021149.1| MRNA capping enzyme family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY12674.1| MRNA capping enzyme family protein isoform 2, partial [Theobroma 
cacao]
Length=349

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 86/301 (29%), Positives = 141/301 (47%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYARRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK +T    LI  D C E     +   D   DI  C   +   + +E +AR
Sbjct  128   NGDADHHQRRKKFTFPARLICGD-CYEVRLDRVLADDAPFDICSCQFAMHYSWSTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G+          +  Y I
Sbjct  187   RALANVSALLRPGGTFIGTMPDANVIIKKLR--------EAEGL-------AFGNSVYWI  231

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  ++KF     FG KY+    + +    + +V F     LA E  L+ + ++N  
Sbjct  232   RFDEEFSDKKFKSSSPFGIKYKFHLEDAVDC-PEWIVPFHLFKSLAEEYDLELVFVKNSH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F  +Y  +P++V      G L D N +    +  L P  ++V  L+  FV +K   PD 
Sbjct  291   EFVHEYLKKPEYVELMRRLGALGDGNQD----QSTLSPDEWEVAYLYLAFVLKKRGQPDR  346

Query  348   T  346
             T
Sbjct  347   T  347



>ref|XP_009110293.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Brassica 
rapa]
 ref|XP_009110300.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Brassica 
rapa]
 ref|XP_009110307.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Brassica 
rapa]
Length=374

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 142/294 (48%), Gaps = 42/294 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  70    KLNNWIKSVLIQLYARPDDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRY  129

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++  + L+  D C E     + ++D   DI  C   +   + +E +AR
Sbjct  130   NGDADHHQRRKKFSFPSRLLCGD-CFEVELDKILEEDAPFDICSCQFAMHYSWTTEARAR  188

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  GM+       I +  Y I
Sbjct  189   RALANVSALLRPGGVFIGTMPDANVIIKKLR--------QAEGME-------IGNSVYWI  233

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  ++KF     FG +Y     + +    + +V F     LA E  L+ + ++N  
Sbjct  234   RFGEEYSQKKFKSSSPFGIEYVFHLEDAVDC-PEWIVPFNIFKSLADEYDLELVFVKNSH  292

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +F  +Y  +P+FV      G L D N +    +  L    +D   L+ +FV +K
Sbjct  293   EFVHEYMKKPEFVELMRRLGALGDGNQD----QSTLSADEWDAAYLYLSFVLRK  342



>emb|CDY53618.1| BnaA01g25610D [Brassica napus]
Length=373

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 142/294 (48%), Gaps = 42/294 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYARPDDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++  + L+  D C E     + ++D   DI  C   +   + +E +AR
Sbjct  129   NGDADHHQRRKKFSFPSRLLCGD-CFEVELDKILEEDAPFDICSCQFAMHYSWTTEARAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  GM+       I +  Y I
Sbjct  188   RALANVSALLRPGGVFIGTMPDANVIIKKLR--------QAEGME-------IGNSVYWI  232

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  ++KF     FG +Y     + +    + +V F     LA E  L+ + ++N  
Sbjct  233   RFGEEYSQKKFKSSSPFGIEYVFHLEDAVDC-PEWIVPFNIFKSLADEYDLELVFVKNSH  291

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +F  +Y  +P+FV      G L D N +    +  L    +D   L+ +FV +K
Sbjct  292   EFVHEYMKKPEFVELMRRLGALGDGNQD----QSTLSADEWDAAYLYLSFVLRK  341



>ref|XP_009614611.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 isoform X1 
[Nicotiana tomentosiformis]
Length=373

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 145/324 (45%), Gaps = 50/324 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM-------  1024
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   +       
Sbjct  69    KLNNWIKSVLIQLYAKRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  128

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N + +  + ++K      +    C E     +   D   D+  C   +   + +E +AR+
Sbjct  129   NGEADHHQRRKKFSFPARLMCGDCFEVRLDRVLADDAPFDVCSCQFAMHYSWSTEARARR  188

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  K +        +  G+          +  Y I 
Sbjct  189   ALANVSALLRPGGIFIGTMPDANVIIKKLR--------EAEGL-------AFGNSVYWIR  233

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KF     FG KY+    + +    + +V F     LA E   + + ++N   
Sbjct  234   FDEEFSEKKFKSSNPFGIKYKFHLEDAVDC-PEWIVPFHVFKALAEEYDFELVFVKNNHV  292

Query  498   FYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDIT  346
             F ++Y  +P+FV      G L D N +    +  L P  ++V  L+  FV +K   PD T
Sbjct  293   FVEEYMKKPEFVELMRRLGALGDGNQD----QSTLSPDEWEVAYLYLAFVLRKRGQPDQT  348

Query  345   PPLMTPFIVRRNNDDEASEYHSTK  274
                      RRN   +  + H TK
Sbjct  349   ---------RRNPRRDKGKMHLTK  363



>gb|EPB83352.1| hypothetical protein HMPREF1544_09885 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=319

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/280 (29%), Positives = 131/280 (47%), Gaps = 31/280 (11%)
 Frame = -2

Query  1167  VKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQR-  991
             VK  LI  +V P   V ++ CGK  D  KW +A+I H +  D+A   + + ++ +E+ R 
Sbjct  58    VKSVLIHRYVRPRQNVFDMGCGKGGDLIKWAKARIQHLVAADIANVSLEQMRKRYETLRD  117

Query  990   KVYTTELIEIDPCTEDLKTHLQDKDNQADIV---FCMHNLQLCFESEEKARKLLHNVSSL  820
             + ++ E   +D C  +L     D++ + D V   FC+H     FE+E KAR +L NVSS 
Sbjct  118   RTFSAEFHAMD-CYSELIAPKLDRNMRFDTVSMQFCLH---YAFENEHKARIMLQNVSSQ  173

Query  819   LKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKF  640
             L+ GGYF+G   D++ I  + ++        G+ +  +I  + I+ E+ T      +  F
Sbjct  174   LRSGGYFIGTMPDANWIVKRVREEPVGSFGFGNSIY-SITFDHIKDENGT------KTGF  226

Query  639   PFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGML  460
               FG KY     + +    + LVH+ +   LA E GL     +N  DFY       V   
Sbjct  227   TPFGCKYMFHLVDAVDC-PEYLVHWRTFENLAAEYGLKLKFKENFHDFY-------VSAS  278

Query  459   QDVNH----NLIDPRGRLLPRA----YDVLGLFTTFVFQK  364
              +  H    N I   G   P      ++  G++  F F+K
Sbjct  279   NEEEHARLLNRIGVIGGQAPEMTDEEWEAAGIYLAFAFEK  318



>ref|XP_002002342.1| GI13226 [Drosophila mojavensis]
 gb|EDW11784.1| GI13226 [Drosophila mojavensis]
Length=420

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 110/234 (47%), Gaps = 23/234 (10%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWES--QRK-------VYTTEL  970
             V ++ CGK  D  KW++A I H I  D+A   + + ++ ++   QR         +T E 
Sbjct  132   VLDMCCGKGGDLLKWEKAFISHLICTDIAEVSVEQCQQRYQDILQRAESSKFAHKFTAEF  191

Query  969   IEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGI  790
                D     L+   +D   Q ++V C      CFES ++A  ++ N +  L+PGGYF+  
Sbjct  192   FACDSTMVRLRERYKDASLQLNLVSCQFAFHYCFESLQQADCMIRNAAECLQPGGYFIAT  251

Query  789   TTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQMK  610
               D+  I  + ++       +G G           ++ Y+I FE   +  P FG KY+  
Sbjct  252   FPDAYEIMKRLRE--AGPDARGFG-----------NDVYSIEFECNTKVLPLFGAKYRFH  298

Query  609   FANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGMLQDVN  448
                 +    + LVHFP+L++LAR  GL  +   +  +++ +  PQ   +LQ ++
Sbjct  299   LEGVVDC-PEFLVHFPTLVKLARRHGLQLVRRSSFAEYFKETLPQGRQLLQRMS  351



>ref|XP_002985502.1| hypothetical protein SELMODRAFT_424575 [Selaginella moellendorffii]
 gb|EFJ13376.1| hypothetical protein SELMODRAFT_424575 [Selaginella moellendorffii]
Length=359

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 131/283 (46%), Gaps = 29/283 (10%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI ++V    +V +L CGK  D  K+D+A IG Y+G+D+A   +++  + +
Sbjct  66    KLNNWIKSVLIHLYVHKGDSVLDLACGKGGDLIKYDKANIGRYVGVDIAAGSIDDAMKRY  125

Query  1002  ES--QRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNV  829
              +  QR  +  EL   D    DL+  +Q      D+  C   L   + + E+A + L NV
Sbjct  126   NNRRQRLSFAAELFCGDCYEVDLERSIQ---GGFDVCSCQFALHYSWSTIERAERALDNV  182

Query  828   SSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF--EV  655
             S +L PGG+F+G   DS+ I  K    + A  +   G           +  Y I+F  E 
Sbjct  183   SRMLNPGGFFIGTMPDSNVIVQK----LRAAQDLEFG-----------NSVYNISFGEEH  227

Query  654   EEEKFP---FFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
               ++FP    FG +Y  K  + +    + LV FP    LA   GLD +   N  DF   +
Sbjct  228   RTKRFPQATRFGIQYHFKLEDAVDC-PEWLVFFPYFQSLAANYGLDLVLKLNFHDFVHKH  286

Query  483   --RPQFVGMLQDVNHNLIDPRGRLL-PRAYDVLGLFTTFVFQK  364
                  F+ +++ +        G  L P  ++   L+  FVF+K
Sbjct  287   IKDDHFIDLMRKLGALGDGSNGDTLSPDEWEAAYLYLVFVFKK  329



>ref|XP_007021148.1| MRNA capping enzyme family protein isoform 1 [Theobroma cacao]
 gb|EOY12673.1| MRNA capping enzyme family protein isoform 1 [Theobroma cacao]
Length=372

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/301 (29%), Positives = 141/301 (47%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYARRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK +T    LI  D C E     +   D   DI  C   +   + +E +AR
Sbjct  128   NGDADHHQRRKKFTFPARLICGD-CYEVRLDRVLADDAPFDICSCQFAMHYSWSTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G+          +  Y I
Sbjct  187   RALANVSALLRPGGTFIGTMPDANVIIKKLR--------EAEGL-------AFGNSVYWI  231

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  ++KF     FG KY+    + +    + +V F     LA E  L+ + ++N  
Sbjct  232   RFDEEFSDKKFKSSSPFGIKYKFHLEDAVDC-PEWIVPFHLFKSLAEEYDLELVFVKNSH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F  +Y  +P++V      G L D N +    +  L P  ++V  L+  FV +K   PD 
Sbjct  291   EFVHEYLKKPEYVELMRRLGALGDGNQD----QSTLSPDEWEVAYLYLAFVLKKRGQPDR  346

Query  348   T  346
             T
Sbjct  347   T  347



>ref|XP_005107770.1| PREDICTED: mRNA cap guanine-N7 methyltransferase-like isoform 
X1 [Aplysia californica]
Length=389

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 107/218 (49%), Gaps = 22/218 (10%)
 Frame = -2

Query  1125  TVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWE--SQR---KVYTTELIEI  961
             +V +L  GK  D  KW + +I   +  D+A + + + +E +   SQR   K++  E I  
Sbjct  70    SVLDLASGKGGDLLKWKKGRISSLVCADIAATSVQQSEERYRQNSQREKYKLFDAEFIVA  129

Query  960   DPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTD  781
             D   E LK   +      D+V C  +   CFES ++A  ++ N S  L+PGGYF+G T +
Sbjct  130   DCTKERLKDKYKSTRQSFDLVSCQFSFHYCFESYQQAMMMIRNASECLRPGGYFIGTTPN  189

Query  780   SSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF-EVEEEKFPFFGKKYQMKFA  604
             S  +  + + +            PN   +   +E Y+I+F + E+  FP FG KY     
Sbjct  190   SYELVRRLRNS------------PN---STFGNEVYSISFAQQEKSNFPLFGAKYNFHLE  234

Query  603   NDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYD  490
               +    + LV+FP+L ++A + G+  ++     DF++
Sbjct  235   GVVDC-PEFLVYFPALEKMAAQFGMKLVKRIPFADFFE  271



>gb|EMS47623.1| mRNA cap guanine-N7 methyltransferase 1 [Triticum urartu]
Length=427

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 140/290 (48%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  L++++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  155   KLNNWIKSVLVQLYARPGDCVLDLACGKGGDLIKWDKARVGYYVGVDIAEGSIKDCMTRY  214

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    LI  D C E        +D   DI  C   +   + +E +AR+
Sbjct  215   NGDTDQQRRKKFSFPARLICAD-CYETRLDEYLCEDAPFDICSCQFAMHYSWSTEARARQ  273

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L N+S+LL+PGG F+G   D++ I  + ++          GM+         +  Y I 
Sbjct  274   ALANISALLRPGGTFIGTMPDANVIIKRLRET--------DGME-------FGNSVYWIT  318

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ + ++N  +
Sbjct  319   FGEEYNEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLMKNFHE  377

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  378   FVHEYLQKPEFADLMRRLGA-LGDGRSVQSTLSQDEWEVSYLYLAFVLRK  426



>ref|XP_008200424.1| PREDICTED: mRNA cap guanine-N7 methyltransferase [Tribolium castaneum]
Length=402

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 107/231 (46%), Gaps = 26/231 (11%)
 Frame = -2

Query  1122  VCELYCGKVPDEEKWDEAQIGHYIGIDVAT-------SGMNEKKEAWESQRK---VYTTE  973
             V ++ CGK  D  KW +  I H I  D+A+       S  N+ KE    +R    +Y+ E
Sbjct  111   VLDMCCGKGGDLLKWRKGNITHLICSDIASVSLDQCRSRYNDMKERSSRERNGGNIYSIE  170

Query  972   LIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLG  793
              I  D     L+    D   + D+V C       FES  +A  ++ N S  L+PGG+F+G
Sbjct  171   YIAGDCSRVRLREKYTDPSMKLDLVSCQFAFHYSFESLPQAECMIRNASECLQPGGFFIG  230

Query  792   ITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEKFPFFGKKYQM  613
                D++ + A+ ++                  N   ++ Y + F+ +  K P FG KY  
Sbjct  231   TIPDANDLIARARR---------------ADANTFGNDVYQVHFDCDVNKPPLFGAKYNF  275

Query  612   KFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGML  460
                  +    + LVHFP+LI+LAR+ GL +++ +   D+Y+  + +   +L
Sbjct  276   HLDGVVDC-PEFLVHFPTLIKLARKYGLKFVKKEKFYDYYEQMKNEGRQLL  325



>ref|XP_005107771.1| PREDICTED: mRNA cap guanine-N7 methyltransferase-like isoform 
X2 [Aplysia californica]
Length=394

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 107/218 (49%), Gaps = 22/218 (10%)
 Frame = -2

Query  1125  TVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWE--SQR---KVYTTELIEI  961
             +V +L  GK  D  KW + +I   +  D+A + + + +E +   SQR   K++  E I  
Sbjct  75    SVLDLASGKGGDLLKWKKGRISSLVCADIAATSVQQSEERYRQNSQREKYKLFDAEFIVA  134

Query  960   DPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLLHNVSSLLKPGGYFLGITTD  781
             D   E LK   +      D+V C  +   CFES ++A  ++ N S  L+PGGYF+G T +
Sbjct  135   DCTKERLKDKYKSTRQSFDLVSCQFSFHYCFESYQQAMMMIRNASECLRPGGYFIGTTPN  194

Query  780   SSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAF-EVEEEKFPFFGKKYQMKFA  604
             S  +  + + +            PN   +   +E Y+I+F + E+  FP FG KY     
Sbjct  195   SYELVRRLRNS------------PN---STFGNEVYSISFAQQEKSNFPLFGAKYNFHLE  239

Query  603   NDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYD  490
               +    + LV+FP+L ++A + G+  ++     DF++
Sbjct  240   GVVDC-PEFLVYFPALEKMAAQFGMKLVKRIPFADFFE  276



>ref|XP_009796829.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Nicotiana 
sylvestris]
Length=373

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 145/324 (45%), Gaps = 50/324 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGM-------  1024
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   +       
Sbjct  69    KLNNWIKSVLIQLYAKRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIADGSIEDCRTRY  128

Query  1023  NEKKEAWESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
             N + +  + ++K      +    C E     +   D   D+  C   +   + +E +AR+
Sbjct  129   NGEADHHQRRKKFSFPARLMCGDCFEVRLDRVLADDAPFDVCSCQFAMHYSWSTEARARR  188

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  K +        +  G+          +  Y I 
Sbjct  189   ALANVSALLRPGGIFVGTMPDANVIIKKLR--------EAEGL-------AFGNSVYWIR  233

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KF     FG KY+    + +    + +V F     LA E   + + ++N   
Sbjct  234   FDEEFSEKKFISSNPFGIKYKFHLEDAVDC-PEWIVPFHVFKALAEEYDFELVFVKNNHV  292

Query  498   FYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDIT  346
             F ++Y  +P+FV      G L D N +    +  L P  ++V  L+  FV +K   PD T
Sbjct  293   FVEEYMKKPEFVELMRRLGALGDGNQD----QSTLSPDEWEVAYLYLAFVLRKRGQPDQT  348

Query  345   PPLMTPFIVRRNNDDEASEYHSTK  274
                      RRN   +  + H TK
Sbjct  349   ---------RRNPRRDKGKMHLTK  363



>ref|XP_008365909.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1 [Malus domestica]
Length=371

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 87/301 (29%), Positives = 142/301 (47%), Gaps = 43/301 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYARKGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                      RK +T    LI  D     L   L D D   D+V C   L   + +E +AR
Sbjct  128   NGDADHHQHRKKFTFPAHLICGDCYEVRLDKVLAD-DAPFDVVSCQFALHYSWSTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G+   +  N +    Y I
Sbjct  187   RALANVSALLRPGGTFIGTMPDANVIIKKLR--------EAEGL---VFGNSV----YWI  231

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  +  E+KF     FG KY+    + +    + +V F     L  E  ++ + ++N  
Sbjct  232   RFDEDFSEKKFKSSSPFGIKYKFHLEDAVDC-PEWIVPFHVFKSLVEEYDMELVLVKNNH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK-PDPDI  349
             +F  +Y  +P+FV      G L D N +    +  L    ++V  L+  FV +K  +PD 
Sbjct  291   EFVHEYIKKPEFVELMRRLGALGDGNQD----QSTLSNDEWEVAHLYLAFVLRKRGEPDR  346

Query  348   T  346
             T
Sbjct  347   T  347



>ref|XP_004294320.1| PREDICTED: mRNA cap guanine-N7 methyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=370

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 95/331 (29%), Positives = 150/331 (45%), Gaps = 49/331 (15%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++      V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  68    KLNNWIKSVLIQLYARRGDAVLDLACGKGGDLIKWDKAKIGYYVGIDIAEGSIEDCRTRY  127

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK +T    LI  D     L   L D D   DI  C   L   + +E +AR
Sbjct  128   NGDADHHQRRKKFTFPARLICGDCYEVRLDKALAD-DAPFDICSCQFALHYSWSTEARAR  186

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G+      N +    Y I
Sbjct  187   RALANVSALLRPGGTFIGTMPDANVIIKKLR--------EAEGL---FFGNSV----YWI  231

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  E+KF     FG KY+    + +    + +V F     L  E  ++ I  +N  
Sbjct  232   RFDEEFSEKKFKSSSPFGIKYKFHLEDAVDC-PEWIVPFHVFKSLVEEYDMELIFAKNSH  290

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQKPDPDIT  346
             +F  +Y  RP++V      G L D N +    +  L    ++V  L+ +FV +K      
Sbjct  291   EFVHEYMKRPEYVELMRRLGALGDGNQD----QSTLSQDEWEVAYLYMSFVLRKR----G  342

Query  345   PPLMTPFIVRRNNDDEASEYHSTKHILQVSH  253
              P  T    RR   D+   + S + IL + H
Sbjct  343   QPDRTQANSRR---DKGKMHISKEDILNIEH  370



>ref|XP_002445157.1| hypothetical protein SORBIDRAFT_07g005000 [Sorghum bicolor]
 gb|EES14652.1| hypothetical protein SORBIDRAFT_07g005000 [Sorghum bicolor]
Length=368

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/290 (28%), Positives = 142/290 (49%), Gaps = 35/290 (12%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A++G+Y+G+D+A   + +    +
Sbjct  67    KLNNWIKSVLIQLYARPGHCVLDLACGKGGDLIKWDKAKVGYYVGVDIAEGSIKDCMTRY  126

Query  1002  -----ESQRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARK  844
                  + +RK ++    L+  D     L  +L + D   DI  C   L   + +E +AR+
Sbjct  127   NGDTDQQRRKKFSFPARLLCTDCYEARLDEYLYE-DAPFDICSCQFALHYSWSTEARARQ  185

Query  843   LLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIA  664
              L NVS+LL+PGG F+G   D++ I  + +++         G++         +  Y I+
Sbjct  186   ALANVSALLRPGGIFIGTMPDANVIIKRLRES--------EGLE-------FGNSVYWIS  230

Query  663   F--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTD  499
             F  E  E+KFP    FG KY+    + +    + +V F     LA E  L+ +  +N  +
Sbjct  231   FGEEYAEKKFPASRPFGIKYKFHLEDAVDC-PEWVVPFHLFKLLAEEYDLELVLTKNFHE  289

Query  498   FYDDY--RPQFVGMLQDVNHNLIDPR---GRLLPRAYDVLGLFTTFVFQK  364
             F  +Y  +P+F  +++ +   L D R     L    ++V  L+  FV +K
Sbjct  290   FVHEYLQKPEFTELIRRLG-ALGDGRQDQSTLSQDEWEVSYLYLAFVLRK  338



>ref|XP_002127709.1| PREDICTED: mRNA cap guanine-N7 methyltransferase [Ciona intestinalis]
 ref|XP_009857635.1| PREDICTED: mRNA cap guanine-N7 methyltransferase [Ciona intestinalis]
 ref|XP_009857638.1| PREDICTED: mRNA cap guanine-N7 methyltransferase [Ciona intestinalis]
Length=398

 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 120/242 (50%), Gaps = 25/242 (10%)
 Frame = -2

Query  1179  LIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW-  1003
             LI     AL  + V+ +  V +L CGK  D  KWD+A+  H +  D+A + +++ KE + 
Sbjct  77    LIRKYTDALYHVGVA-HPVVLDLGCGKGGDVLKWDKARPRHLVCTDLAETSVSQCKERYA  135

Query  1002  -----ESQRKVYTTELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKARKLL  838
                     R+ ++ E I  D  TE+LK  L+D +   DI  C   +   FESE+KA  ++
Sbjct  136   LLKRRNRNRQFFSAEFIVADSSTENLKEKLEDTNLMFDITSCQFVVHYTFESEDKAETMV  195

Query  837   HNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFE  658
              N  + LK GGYF G T +S  +    +K      + G     N+         Y + FE
Sbjct  196   KNACNNLKEGGYFFGTTVNSEKLINSVKK------SDGLSFGNNV---------YDVTFE  240

Query  657   VEEEKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFY-DDYR  481
              +EE FP F  KY  +  +D+    + L+   +L+RL ++  +  +E +  ++F+ ++ R
Sbjct  241   NKEE-FPEFACKYIFQL-HDVVNCPEFLLKKETLVRLCKKHNMRLVEWKTFSEFFEENSR  298

Query  480   PQ  475
             P+
Sbjct  299   PK  300



>emb|CDY43068.1| BnaCnng10740D [Brassica napus]
Length=373

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 82/294 (28%), Positives = 142/294 (48%), Gaps = 42/294 (14%)
 Frame = -2

Query  1182  RLIDIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW  1003
             +L + +K  LI+++  P   V +L CGK  D  KWD+A+IG+Y+GID+A   + + +  +
Sbjct  69    KLNNWIKSVLIQLYARPDDAVLDLACGKGGDLIKWDKARIGYYVGIDIAEGSIEDCRTRY  128

Query  1002  ES------QRKVYT--TELIEIDPCTEDLKTHLQDKDNQADIVFCMHNLQLCFESEEKAR  847
                     +RK ++  + L+  D C E     + ++D   DI  C   +   + +E +AR
Sbjct  129   NGDADHHQRRKKFSFPSRLLCGD-CFEVELDKILEEDAPFDICSCQFAMHYSWTTEARAR  187

Query  846   KLLHNVSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTI  667
             + L NVS+LL+PGG F+G   D++ I  K +        +  G++       I +  Y I
Sbjct  188   RALANVSALLRPGGVFIGTMPDANVIIKKLR--------QAEGLE-------IGNSVYWI  232

Query  666   AF--EVEEEKFPF---FGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLT  502
              F  E  ++KF     FG +Y     + +    + +V F     LA E  L+ + ++N  
Sbjct  233   RFGEEYSQKKFKSSSPFGIEYIFHLEDAVDC-PEWIVPFNIFKSLAEEYDLELVFVKNSH  291

Query  501   DFYDDY--RPQFV------GMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             +F  +Y  +P+FV      G L D N +    +  L    +D   L+ +FV +K
Sbjct  292   EFVHEYMKKPEFVELMRRLGALGDGNQD----QSTLSADEWDAAYLYLSFVLRK  341



>gb|EIE77819.1| hypothetical protein RO3G_02523 [Rhizopus delemar RA 99-880]
Length=376

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/282 (28%), Positives = 133/282 (47%), Gaps = 30/282 (11%)
 Frame = -2

Query  1173  DIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQ  994
             + VK  LI+  V P   V ++ CGK  D  KW +A+I H +  D+A   M + +  ++S 
Sbjct  112   NWVKSVLIQRHVRPRQCVLDMGCGKGGDLLKWAKAKIQHLVAADIAEVSMQQMQGRYQSL  171

Query  993   R-KVYTTELIEIDPCTEDLKTHLQD--KDNQADIVFCMHNLQLCFESEEKARKLLHNVSS  823
             R + +T E   +D  +E L+  LQ   K +   + FC+H     FE+E KAR +L NV+S
Sbjct  172   RDRRFTAEFYPMDCYSELLEPKLQPHIKFDTVSMQFCLH---YAFENETKARTMLKNVTS  228

Query  822   LLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEE-  646
              L+ GG+F+G   D++ I  + ++  +     G+ +             Y I FE   E 
Sbjct  229   RLRSGGHFIGTMPDANWIVKRLRQEEKGSFGFGNSI-------------YHIDFENIRED  275

Query  645   ------KFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
                    F  FG KY     + +    + LVH+ +  +LA E GL     +N  +FY + 
Sbjct  276   GNGKKVGFTPFGCKYMFHLEDAVDC-PEYLVHWNTFEKLASEYGLVLKFKENFHNFYANS  334

Query  483   R--PQFVGMLQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
                P++  +L+ +     D +  +    ++  G++  F F+K
Sbjct  335   LKVPEYSRLLERIGVVGGD-KAEMSLEEWEAAGIYLAFAFEK  375



>ref|XP_006678461.1| hypothetical protein BATDEDRAFT_24462 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80668.1| hypothetical protein BATDEDRAFT_24462 [Batrachochytrium dendrobatidis 
JAM81]
Length=381

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/273 (25%), Positives = 130/273 (48%), Gaps = 16/273 (6%)
 Frame = -2

Query  1167  VKIALIKIFVSPY---ATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAW-E  1000
             +K  LI +F   Y     + ++ CGK  D +KW   ++   +G+D+A   + + +  + +
Sbjct  118   IKSVLINLFAPSYPKGIKILDMCCGKGGDLQKWKRLRVNQVVGLDIADVSIEQARTRYNQ  177

Query  999   SQRKVYTTELIEIDPCTEDLKTHLQDKD-NQADIVFCMHNLQLCFESEEKARKLLHNVSS  823
                + Y      +D  +  +   L+ K  +   I F +H     FE+E++AR+ ++N+SS
Sbjct  178   GTSQHYPASFYAVDCFSSAVGDILKGKLFDLCSIQFALH---YSFETEKQARQAIYNISS  234

Query  822   LLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVEEEK  643
              L  GG  +G   ++  I+ +  + V     +G    P    N I    Y+I FE     
Sbjct  235   HLHSGGILIGTIPNADLIYKRLMEAVRIGETQGQTTGPYTFGNSI----YSITFESTTP-  289

Query  642   FPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDYRPQFVGM  463
                FG KYQ   A+ I    + L+++ +L +LA E  L+ I  +   +FY D   + + +
Sbjct  290   -TLFGHKYQFALADAIDDCPEYLINYSTLKKLAAEYQLEPIMWKPFHNFYQDECVKNIEL  348

Query  462   LQDVNHNLIDPRGRLLPRAYDVLGLFTTFVFQK  364
             L+ +   + + +G +    ++ +G+++ F FQK
Sbjct  349   LERM--RIFNHQGTISSDEWEAIGIYSVFAFQK  379



>emb|CCH40561.1| mRNA cap guanine-N7 methyltransferase [Wickerhamomyces ciferrii]
Length=483

 Score = 96.3 bits (238),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 113/248 (46%), Gaps = 26/248 (10%)
 Frame = -2

Query  1173  DIVKIALIKIFVSPYATVCELYCGKVPDEEKWDEAQIGHYIGIDVATSGMNEKKEAWESQ  994
             +++K  LI  +  P     +L CGK  D  KWD+A+I  YIGID++ + + E  + +++ 
Sbjct  214   NVIKYILIGNYAQPGWRTLDLGCGKGGDINKWDQAKISEYIGIDISNASIVEAIKRYKNN  273

Query  993   RKVYTTELIEIDPCTEDLKTHLQDKDN---QADIV---FCMHNLQLCFESEEKARKLLHN  832
                + +  I  D   + L   L D  +     DIV   FCMH     FE+E KAR LL N
Sbjct  274   EAGFQSTFITGDCFGQPLPYILNDHPHVQLDVDIVSMQFCMH---YAFETEMKARTLLEN  330

Query  831   VSSLLKPGGYFLGITTDSSTIWAKYQKNVEAYHNKGSGMKPNIVPNCIRSESYTIAFEVE  652
             VS  L+PGG F+G    S  I  +  K      + G+ +             Y++ F+ E
Sbjct  331   VSRSLRPGGIFIGTIPSSDFIKERISKMQPGEKSFGNSI-------------YSVTFDNE  377

Query  651   E----EKFPFFGKKYQMKFANDISAETQCLVHFPSLIRLAREAGLDYIEIQNLTDFYDDY  484
                  E  P FG++Y     + I    + +V F SL  LA E GL+    +   D Y + 
Sbjct  378   PPRNGEFRPAFGQRYTYFLKDAIDNVPEYVVPFESLRSLADEFGLELTYKKPFLDLYKEE  437

Query  483   RPQFVGML  460
              P +   L
Sbjct  438   IPTWFKKL  445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3863858971050