BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22967_g1_i2 len=2081 path=[2059:0-870 2930:871-879 2939:880-1021
3081:1022-1044 3104:1045-1151 3211:1152-1190 3250:1191-1285
3345:1286-1304 3364:1305-1651 3711:1652-1742 3802:1743-2080]

Length=2081
                                                                      Score     E

gb|ABB40579.2|  1-aminocyclopropane-1-carboxylate synthase             1001   0.0      Ipomoea nil [qian niu]
gb|AAR99392.1|  ACC synthase ACS3a                                      783   0.0      Nicotiana attenuata
gb|AAC83147.1|  1-aminocyclopropane-1-carboxylate synthase              778   0.0      Nicotiana glutinosa
ref|XP_009590054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    776   0.0      
ref|XP_009776307.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    776   0.0      
emb|CAA06288.1|  1-cyclopropane-1-carboxylate synthase                  776   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009626433.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    775   0.0      
gb|AAR99393.1|  ACC synthase ACS3b                                      772   0.0      Nicotiana attenuata
dbj|BAG30909.1|  ACC synthase                                           770   0.0      Capsicum chinense [bonnet pepper]
ref|XP_009791163.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    770   0.0      
ref|XP_009590053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    770   0.0      
ref|XP_006343930.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    768   0.0      
ref|XP_009771943.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    767   0.0      
gb|AAR99391.1|  ACC synthase ACS2                                       766   0.0      Nicotiana attenuata
emb|CAA67118.1|  ACC synthase                                           766   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001266271.1|  1-aminocyclopropane-1-carboxylate synthase-like    765   0.0      
ref|XP_009626021.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    764   0.0      
ref|XP_006343931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    763   0.0      
gb|AAF97615.1|U18057_1  1-amino-cyclopropane-1-carboxylate synthase     762   0.0      Solanum lycopersicum
gb|AAF97614.1|U18056_1  1-amino-cyclopropane-1-carboxylate synthase     761   0.0      Solanum lycopersicum
ref|NP_001233922.1|  1-aminocyclopropane-1-carboxylate synthase         760   0.0      
gb|AAC15777.1|  ACC synthase                                            759   0.0      Nicotiana glutinosa
ref|XP_009757887.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    759   0.0      
gb|ABW97851.1|  ACS5                                                    755   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001275367.1|  1-aminocyclopropane-1-carboxylate synthase         753   0.0      
emb|CDP12072.1|  unnamed protein product                                747   0.0      
gb|AAB70885.1|  1-aminocyclopropane-1-carboxylate synthase              740   0.0      Pelargonium x hortorum [bedding geranium]
ref|NP_001234164.1|  1-aminocyclopropane-1-carboxylate synthase         739   0.0      
dbj|BAA34923.1|  1-aminocyclopropane-1-carboxylate synthase             738   0.0      Solanum lycopersicum
gb|ACX71871.1|  ACC synthase 1                                          737   0.0      Lithospermum erythrorhizon
dbj|BAA25916.1|  1-aminocyclopropane-1-carboxylate synthase             737   0.0      Solanum lycopersicum
ref|XP_002278489.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    732   0.0      Vitis vinifera
ref|XP_011073274.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    730   0.0      
ref|XP_011080907.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    729   0.0      
ref|XP_009363394.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    725   0.0      
ref|XP_009343873.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    723   0.0      
ref|NP_001280870.1|  1-aminocyclopropane-1-carboxylate synthase         723   0.0      
dbj|BAB89350.1|  1-aminocyclopropane-1-carboxylate synthase             721   0.0      Diospyros kaki [Japanese persimmon]
gb|ACT54524.2|  1-aminocyclopropane-1-carboxylate synthase              719   0.0      Eriobotrya japonica [loquat]
gb|ABQ51840.1|  1-aminocyclopropane-1-carboxylate synthase              719   0.0      Pelargonium x hortorum [bedding geranium]
ref|XP_006360739.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    717   0.0      
ref|XP_010089045.1|  1-aminocyclopropane-1-carboxylate synthase         717   0.0      
gb|AAL66205.1|AF386523_1  1-aminocyclopropane 1-carboxylate synth...    713   0.0      Pyrus communis
gb|ABA01475.2|  1-aminocyclopropane-1-carboxylate synthase              711   0.0      Gossypium hirsutum [American cotton]
ref|XP_002509858.1|  acc synthase, putative                             709   0.0      Ricinus communis
gb|KHG06607.1|  1-aminocyclopropane-1-carboxylate synthase              709   0.0      
gb|KHG22476.1|  1-aminocyclopropane-1-carboxylate synthase              707   0.0      
gb|ABJ99502.1|  1-aminocyclopropane-1-carboxylate synthase              706   0.0      Gossypium hirsutum [American cotton]
gb|ABC75833.1|  1-aminocyclopropane-1-carboxylate synthase              705   0.0      Gossypium hirsutum [American cotton]
gb|ABM88785.1|  1-aminocyclopropane-1-carboxylate synthase              704   0.0      Camellia sinensis [black tea]
dbj|BAA94599.1|  1-aminocyclopropane-1-carboxylate synthase             704   0.0      Populus euphratica
ref|XP_002298013.1|  1-aminocyclopropane-1-carboxylate synthase f...    704   0.0      Populus trichocarpa [western balsam poplar]
gb|AFM93771.1|  ACC synthetase                                          704   0.0      
gb|AER35096.1|  1-aminocyclopropane-1-carboxylate synthase              701   0.0      
gb|AAQ14268.1|AF248737_1  1-aminocyclopropane-1-carboxylate synthase    700   0.0      Momordica charantia [balsam pear]
gb|ABW03086.1|  1-aminocyclopropane 1-carboxylate synthase 5            699   0.0      Prunus salicina [Japanese plum]
ref|XP_010676415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    699   0.0      
ref|XP_004298832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    699   0.0      
gb|AAC98809.1|  ACC synthase                                            698   0.0      Carica papaya [mamon]
ref|XP_008238953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    698   0.0      
ref|XP_004503673.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    698   0.0      
dbj|BAJ65574.1|  1-aminocyclopropane-1-carboxylate synthase             697   0.0      
gb|ACK43795.1|  1-aminocyclopropane-1-carboxylate synthase              697   0.0      Momordica charantia [balsam pear]
ref|XP_007210019.1|  hypothetical protein PRUPE_ppa016458mg             696   0.0      
gb|KHN16788.1|  1-aminocyclopropane-1-carboxylate synthase              696   0.0      
gb|AAM80888.1|  1-aminocyclopropane-1-carboxylate synthase              695   0.0      Betula pendula [white birch]
ref|XP_011029354.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    694   0.0      
ref|NP_001275831.1|  1-aminocyclopropane-1-carboxylate synthase-like    694   0.0      
ref|XP_002276774.2|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    694   0.0      Vitis vinifera
gb|AAQ14266.1|AF248735_1  1-aminocyclopropane-1-carboxylate synthase    694   0.0      Momordica charantia [balsam pear]
gb|KDP25384.1|  hypothetical protein JCGZ_20540                         693   0.0      
ref|XP_007160107.1|  hypothetical protein PHAVU_002G293000g             693   0.0      
gb|KHG05668.1|  1-aminocyclopropane-1-carboxylate synthase              692   0.0      
ref|NP_001280768.1|  1-aminocyclopropane-1-carboxylate synthase-like    692   0.0      
gb|KDP28564.1|  hypothetical protein JCGZ_14335                         692   0.0      
gb|KEH21137.1|  1-aminocyclopropane-1-carboxylate synthase              692   0.0      
gb|KDO76335.1|  hypothetical protein CISIN_1g011570mg                   691   0.0      
gb|ACT54523.3|  1-aminocyclopropane-1-carboxylate synthase              691   0.0      Eriobotrya japonica [loquat]
ref|XP_003538294.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    691   0.0      
ref|XP_008452008.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    691   0.0      
gb|KHM99945.1|  1-aminocyclopropane-1-carboxylate synthase              690   0.0      
ref|XP_007040349.1|  1-aminocyclopropane-1-carboxylate synthase i...    690   0.0      
gb|AAL35745.1|  1-aminocyclopropanecarboxylic acid synthase             690   0.0      Medicago truncatula
dbj|BAB18464.1|  1-aminocyclopropane-1-carboxylate synthase             690   0.0      Cucumis melo [Oriental melon]
ref|NP_001236858.1|  1-aminocyclopropane-1-carboxylate synthase         689   0.0      
ref|XP_002304518.2|  1-aminocyclopropane-1-carboxylate synthase f...    689   0.0      Populus trichocarpa [western balsam poplar]
gb|AAP14019.1|AF380836_1  putative ACC synthase 1                       689   0.0      Lactuca sativa [cultivated lettuce]
ref|NP_001236141.1|  1-aminocyclopropane-1-carboxylate synthase         689   0.0      
ref|XP_004160953.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    689   0.0      
gb|AFT92042.2|  1-aminocyclopropane-1-carboxylate synthase              689   0.0      
gb|ABO76785.1|  1-aminocyclopropane-1-carboxylate synthase              688   0.0      Citrullus colocynthis x Citrullus lanatus var. lanatus
emb|CAN69483.1|  hypothetical protein VITISV_035777                     688   0.0      Vitis vinifera
dbj|BAA93713.1|  1-aminocyclopropane-1-carboxylate synthase             688   0.0      Cucumis melo [Oriental melon]
ref|XP_011022618.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    687   0.0      
emb|CAA77688.1|  1-aminocyclopropane 1-carboxylate synthase             687   0.0      Vigna radiata var. radiata [golden gram]
ref|XP_004252649.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    686   0.0      
ref|NP_001267589.1|  1-aminocyclopropane-1-carboxylate synthase-like    687   0.0      
gb|KHG14845.1|  1-aminocyclopropane-1-carboxylate synthase              686   0.0      
gb|ACN78835.1|  1-aminocyclopropane-1-carboxylate synthase              686   0.0      Paeonia suffruticosa [moutan peony]
gb|ABC69166.2|  1-aminocyclopropane-1-carboxylate synthase              684   0.0      Paeonia suffruticosa [moutan peony]
gb|ABB70229.1|  1-aminocyclopropane-1-carboxylate synthase              681   0.0      Glycine max [soybeans]
ref|XP_006444953.1|  hypothetical protein CICLE_v10019970mg             681   0.0      
dbj|BAB89349.1|  1-aminocyclopropane-1-carboxylate synthase             680   0.0      Diospyros kaki [Japanese persimmon]
gb|EYU23427.1|  hypothetical protein MIMGU_mgv1a005590mg                679   0.0      
ref|XP_010053217.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    676   0.0      
gb|AAF22109.1|AF119411_1  1-aminocyclopropane-1-carboxylate synth...    676   0.0      Lupinus albus
emb|CAB60831.1|  ACC synthase                                           676   0.0      Citrus sinensis [apfelsine]
ref|XP_007051710.1|  1-aminocyclopropane-1-carboxylate synthase         675   0.0      
emb|CAN77934.1|  hypothetical protein VITISV_021265                     673   0.0      Vitis vinifera
ref|XP_002511916.1|  acc synthase, putative                             674   0.0      Ricinus communis
ref|XP_010261352.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    674   0.0      
ref|XP_010279043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    673   0.0      
ref|XP_004492797.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    673   0.0      
ref|XP_003622479.1|  1-aminocyclopropane-1-carboxylate synthase         672   0.0      
gb|ACD87813.1|  putative ACC synthase                                   671   0.0      Vicia faba [broad bean]
gb|AAD04199.1|  1-aminocyclopropane-1-carboxylate synthase              671   0.0      Pisum sativum [garden pea]
gb|ABM66813.1|  ACC synthase                                            671   0.0      Gossypium hirsutum [American cotton]
gb|AAA86471.1|  1-aminocyclopropane 1-carboxylate synthase              665   0.0      Pelargonium x hortorum [bedding geranium]
ref|NP_001275873.1|  1-aminocyclopropane-1-carboxylate synthase 1...    668   0.0      
gb|AAM21682.1|AF500119_1  1-aminocyclopropane-1-carboxylate synth...    669   0.0      Persea americana
ref|XP_004510689.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    668   0.0      
ref|XP_006598931.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    666   0.0      
gb|AAC49154.1|  1-aminocyclopropane 1-carboxylate synthase              662   0.0      Pelargonium x hortorum [bedding geranium]
gb|ABK97620.1|  1-aminocyclopropane-1-carboxylic acid synthase          666   0.0      Durio zibethinus [durian]
ref|XP_003552421.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    665   0.0      
dbj|BAF44097.1|  1-aminocyclopropane-1-carboxylate synthase             664   0.0      Pyrus x bretschneideri [bai li]
ref|XP_011023276.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    665   0.0      
gb|AAM21683.1|AF500120_1  1-aminocyclopropane-1-carboxylate synth...    664   0.0      Persea americana
dbj|BAA94600.1|  1-aminocyclopropane-1-carboxylate synthase             664   0.0      Populus x canadensis [Canadian poplar]
ref|XP_010053212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    664   0.0      
gb|AAB96658.1|  1-aminocyclopropane-1-carboxylate synthase              661   0.0      Rumex palustris
emb|CAA72191.1|  1-aminocyclopropane-1-carboxylate synthase             661   0.0      Carica papaya [mamon]
ref|XP_003534540.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    660   0.0      
ref|XP_010040891.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    659   0.0      
gb|KHN29314.1|  1-aminocyclopropane-1-carboxylate synthase CMW33        659   0.0      
ref|XP_003529924.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    663   0.0      
ref|XP_010053214.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    658   0.0      
gb|KCW77477.1|  hypothetical protein EUGRSUZ_D01815                     657   0.0      
gb|AES80302.2|  1-aminocyclopropane-1-carboxylate synthase              654   0.0      
ref|XP_010092578.1|  1-aminocyclopropane-1-carboxylate synthase 1       654   0.0      
emb|CAA79478.1|  1-aminocyclopropane-1-carboxylate synthase             654   0.0      Petunia x hybrida [garden petunia]
ref|XP_007219056.1|  hypothetical protein PRUPE_ppa004774mg             653   0.0      
ref|XP_009786813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    653   0.0      
ref|XP_008364813.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    653   0.0      
ref|XP_009366562.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    652   0.0      
gb|AAX99362.1|  1-aminocyclopropane-1-carboxylate synthase              652   0.0      Prunus persica
ref|XP_008779569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    651   0.0      
emb|CDP10864.1|  unnamed protein product                                649   0.0      
dbj|BAA96743.1|  1-aminocyclopropane-1-carboxylate synthase             650   0.0      Prunus persica
dbj|BAB47124.1|  ACC synthase                                           650   0.0      Cucurbita maxima [Boston marrow]
gb|ABW03085.1|  1-aminocyclopropane 1-carboxylate synthase 4            649   0.0      Prunus salicina [Japanese plum]
sp|Q07262.1|1A1C_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...    649   0.0      Nicotiana tabacum [American tobacco]
ref|XP_003624084.1|  1-aminocyclopropane-1-carboxylate synthase         650   0.0      
ref|XP_004306735.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    649   0.0      
ref|XP_008345341.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    648   0.0      
ref|XP_009591161.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    647   0.0      
ref|NP_001280199.1|  1-aminocyclopropane-1-carboxylate synthase 1       647   0.0      
gb|ABQ51839.1|  1-aminocyclopropane-1-carboxylate synthase              646   0.0      Pelargonium x hortorum [bedding geranium]
gb|AAC49153.1|  1-aminocyclopropane 1-carboxylate synthase              645   0.0      Pelargonium x hortorum [bedding geranium]
emb|CAJ34918.1|  1-aminocyclopropane-1-carboxylate synthase             645   0.0      Carica papaya [mamon]
ref|XP_008362641.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    645   0.0      
gb|ACX69843.1|  ACC synthase                                            644   0.0      
gb|AAR99390.1|  ACC synthase ACS1                                       644   0.0      Nicotiana attenuata
gb|ACV30003.1|  ACC synthase family protein                             643   0.0      Musa acuminata AAA Group [Cavendish banana]
gb|ACV33064.1|  1-aminocyclopropane-1-carboxylate synthase              643   0.0      Musa acuminata AAA Group [Cavendish banana]
ref|XP_007135134.1|  hypothetical protein PHAVU_010G103900g             642   0.0      
sp|Q9MB95.1|1A11_PRUMU  RecName: Full=1-aminocyclopropane-1-carbo...    643   0.0      Prunus mume [ume]
ref|XP_006345579.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    643   0.0      
gb|ACM48506.3|  1-aminocyclopropane-carboxylate synthase                642   0.0      Dimocarpus longan [longan]
gb|AAC31571.1|  1-aminocyclopropane-1-carboxylate synthase              642   0.0      Musa acuminata [banana]
gb|ABK95257.1|  unknown                                                 640   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010919415.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    642   0.0      
ref|XP_010422075.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    642   0.0      
dbj|BAF33503.1|  ACC synthase                                           642   0.0      Orobanche minor
ref|XP_006339629.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    641   0.0      
ref|XP_009397633.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    641   0.0      
ref|XP_009624194.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    641   0.0      
emb|CAE53271.1|  1-aminocyclopropane-1-carboxylate synthase             640   0.0      Musa acuminata [banana]
ref|XP_006287590.1|  hypothetical protein CARUB_v10000800mg             640   0.0      
gb|AAD22099.2|  1-aminocyclopropane-1-carboxylate synthase              639   0.0      Musa acuminata [banana]
gb|ACZ54911.3|  1-aminocyclopropane-1-carboxylic acid synthase          639   0.0      Narcissus tazetta var. chinensis
dbj|BAG30910.1|  ACC synthase                                           639   0.0      Capsicum chinense [bonnet pepper]
dbj|BAA93712.1|  1-aminocyclopropane-1-carboxylate synthase             639   0.0      Cucumis melo [Oriental melon]
ref|XP_009398061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    638   0.0      
ref|XP_010455533.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    639   0.0      
emb|CAD44267.2|  putative aminocyclopropane carboxylic acid synthase    637   0.0      Musa acuminata [banana]
gb|ABO76787.1|  1-aminocyclopropane-1-carboxylate synthase              637   0.0      Citrullus colocynthis x Citrullus lanatus var. lanatus
ref|XP_006396926.1|  hypothetical protein EUTSA_v10028605mg             637   0.0      
ref|NP_192867.1|  1-aminocyclopropane-1-carboxylate synthase 6          637   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386742.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    637   0.0      
gb|AAC83146.1|  1-aminocyclopropane-1-carboxylate synthase              637   0.0      Nicotiana glutinosa
ref|NP_001234280.1|  1-aminocyclopropane-1-carboxylate synthase 4       636   0.0      
dbj|BAA78333.1|  1-aminocyclopropane-1-carboxylic acid synthase         637   0.0      Pyrus pyrifolia [sha li]
gb|AAU09672.1|  ACC synthase                                            636   0.0      Musa acuminata AAA Group [Cavendish banana]
gb|AEY82446.1|  1-aminocyclopropane-1-carboxylate synthase              637   0.0      
ref|NP_001233875.1|  1-aminocyclopropane 1-carboxylate synthase         635   0.0      
gb|AAO91942.1|  1-aminocyclopropane-1-carboxylate synthase              635   0.0      Musa acuminata [banana]
sp|P23599.1|1A11_CUCMA  RecName: Full=1-aminocyclopropane-1-carbo...    636   0.0      Cucurbita maxima [Boston marrow]
ref|XP_002878386.1|  predicted protein                                  635   0.0      
ref|XP_010541198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    635   0.0      
dbj|BAA84945.1|  ACC synthase                                           635   0.0      Musa acuminata AAA Group [Cavendish banana]
gb|KFK35337.1|  hypothetical protein AALP_AA5G271900                    634   0.0      
ref|NP_001284464.1|  1-aminocyclopropane-1-carboxylate synthase 1       635   0.0      
emb|CAH56694.1|  1-aminocyclopropane-1-carboxylate synthase             634   0.0      Solanum lycopersicum
gb|KGN45694.1|  hypothetical protein Csa_6G006800                       634   0.0      
gb|AAD28181.1|AF109927_1  1-aminocyclopropane-1-carboxylate synthase    634   0.0      Musa acuminata [banana]
emb|CAA44397.1|  1-aminocyclopropane 1-carboxylate synthase             633   0.0      Solanum lycopersicum
sp|P18485.2|1A12_SOLLC  RecName: Full=1-aminocyclopropane-1-carbo...    633   0.0      Solanum lycopersicum
pdb|1IAX|A  Chain A, Crystal Structure Of Acc Synthase Complexed ...    631   0.0      
ref|NP_001234178.1|  1-aminocyclopropane-1-carboxylate synthase 2       633   0.0      
ref|NP_191710.1|  1-aminocyclopropane-1-carboxylate synthase            633   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAL66200.1|AF386518_1  1-aminocyclopropane 1-carboxylate synth...    633   0.0      Pyrus communis
emb|CAA41856.1|  1-aminocyclopropane 1-carboxylate synthase             632   0.0      Solanum lycopersicum
ref|XP_010055081.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    632   0.0      
emb|CAH56693.1|  1-aminocyclopropane-1-carboxylate synthase             631   0.0      Solanum lycopersicum
ref|XP_002872570.1|  1-aminocyclopropane-1-carboxylic acid (acc) ...    632   0.0      
dbj|BAA33374.1|  ACC synthase                                           632   0.0      Cucumis sativus [cucumbers]
ref|XP_004159772.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    631   0.0      
sp|P23279.1|1A11_CUCPE  RecName: Full=1-aminocyclopropane-1-carbo...    630   0.0      Cucurbita pepo
gb|AAA33111.1|  1-aminocyclopropane-1-carboxylate synthase              630   0.0      Cucurbita pepo
sp|Q00379.1|1A12_CUCPE  RecName: Full=1-aminocyclopropane-1-carbo...    630   0.0      Cucurbita pepo
emb|CDY13251.1|  BnaC09g24050D                                          630   0.0      
gb|KFK31896.1|  hypothetical protein AALP_AA6G173200                    630   0.0      
ref|XP_010435116.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    630   0.0      
emb|CAA57716.1|  1-aminocyclopropane-1-carboxylate synthase             624   0.0      Capsicum annuum
ref|XP_011092964.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    629   0.0      
ref|XP_010559100.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    628   0.0      
dbj|BAJ10416.1|  1-aminocyclopropane-1-carboxylate synthase             628   0.0      
gb|AAA33112.1|  1-aminocyclopropane-1-carboxylate synthase              627   0.0      Cucurbita pepo
ref|NP_001289261.1|  1-aminocyclopropane-1-carboxylate synthase 1       627   0.0      
dbj|BAK19923.1|  1-aminocyclopropane-1-carboxylate synthase             628   0.0      
dbj|BAJ10406.1|  1-aminocyclopropane-1-carboxylate synthase             627   0.0      
emb|CAA57724.1|  1-aminocyclopropane-1-carboxylate synthase             627   0.0      Brassica oleracea
dbj|BAK19925.1|  1-aminocyclopropane-1-carboxylate synthase             627   0.0      
dbj|BAJ10420.1|  1-aminocyclopropane-1-carboxylate synthase             627   0.0      
gb|AAA81580.1|  1-aminocyclopropane-1-carboxylate synthase              626   0.0      Solanum lycopersicum
ref|XP_010474747.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    626   0.0      
ref|XP_009108182.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    625   0.0      
ref|XP_010669851.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    625   0.0      
dbj|BAJ10410.1|  1-aminocyclopropane-1-carboxylate synthase             624   0.0      
dbj|BAK19924.1|  1-aminocyclopropane-1-carboxylate synthase             625   0.0      
emb|CAA75749.1|  1-aminocyclopropane-1-carboxylate synthase             624   0.0      Musa acuminata AAA Group [Cavendish banana]
ref|XP_010512497.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    624   0.0      
ref|XP_009624213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    624   0.0      
dbj|BAJ10414.1|  1-aminocyclopropane-1-carboxylate synthase             624   0.0      
gb|ABD16181.1|  1-aminocyclopropane-1-carboxylate synthase              621   0.0      Cicer arietinum [garbanzo]
ref|XP_010480237.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    623   0.0      
emb|CAB76930.1|  ACC synthase                                           619   0.0      Citrus sinensis [apfelsine]
ref|XP_007139782.1|  hypothetical protein PHAVU_008G058400g             622   0.0      
dbj|BAJ10405.1|  1-aminocyclopropane-1-carboxylate synthase             623   0.0      
emb|CDY15174.1|  BnaC05g00530D                                          622   0.0      
dbj|BAJ10412.1|  1-aminocyclopropane-1-carboxylate synthase             622   0.0      
ref|XP_010556574.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    621   0.0      
ref|XP_010457119.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    621   0.0      
dbj|BAJ10403.1|  1-aminocyclopropane-1-carboxylate synthase             621   0.0      
emb|CAA79477.1|  1-aminocyclopropane 1-carboxylate synthase             622   0.0      Dianthus caryophyllus [carnation]
emb|CAA51227.1|  1-aminocyclopropane-1-carboxylate synthase             620   0.0      Brassica juncea [brown mustard]
ref|XP_002892062.1|  1-amino-cyclopropane-1-carboxylate synthase 2      620   0.0      
gb|KHN35042.1|  1-aminocyclopropane-1-carboxylate synthase              617   0.0      
gb|AAB96880.1|  1-aminocyclopropane-1-carboxylate synthase              615   0.0      Solanum tuberosum [potatoes]
ref|XP_010469085.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    620   0.0      
ref|XP_006402473.1|  hypothetical protein EUTSA_v10005927mg             619   0.0      
emb|CBI40404.3|  unnamed protein product                                617   0.0      
ref|XP_010544767.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    618   0.0      
ref|XP_010413389.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    618   0.0      
gb|KFK42535.1|  hypothetical protein AALP_AA1G007100                    618   0.0      
gb|AAD33789.1|AF144746_1  1-aminocyclopropane-1-carboxylate synthase    613   0.0      Solanum melongena [aubergine]
ref|XP_006292599.1|  hypothetical protein CARUB_v10018840mg             617   0.0      
emb|CDY65356.1|  BnaC08g49010D                                          616   0.0      
emb|CDY11360.1|  BnaA09g39260D                                          616   0.0      
ref|XP_009116817.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    616   0.0      
gb|AEM65195.1|  ACC synthase                                            613   0.0      
dbj|BAK09604.1|  1-aminocyclopropane-1-carboxylate synthase             617   0.0      
ref|XP_002302608.2|  1-aminocyclopropane-1-carboxylate synthase f...    615   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006418427.1|  hypothetical protein EUTSA_v10007457mg             615   0.0      
gb|EYU32170.1|  hypothetical protein MIMGU_mgv1a025862mg                614   0.0      
ref|XP_010544766.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    613   0.0      
ref|NP_171655.1|  1-aminocyclopropane-1-carboxylate synthase 2          612   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAA97516.1|  1-aminocyclopropane-1-carboxylate synthase              612   0.0      Arabidopsis thaliana [mouse-ear cress]
sp|P27486.1|1A1C_DIACA  RecName: Full=1-aminocyclopropane-1-carbo...    612   0.0      
ref|XP_009119698.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    611   0.0      
gb|AAB67988.1|  ACC synthase                                            603   0.0      
gb|AAC63850.1|  ACC synthase                                            607   0.0      
ref|XP_010053213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    606   0.0      
gb|AAF61235.1|AF239987_1  ACC synthase ACS1                             602   0.0      
gb|AAM74939.1|AF518326_1  1-aminocyclopropane-1-carboxylate synth...    601   0.0      
dbj|BAJ95898.1|  predicted protein                                      604   0.0      
ref|XP_004976571.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    603   0.0      
gb|EMT04664.1|  1-aminocyclopropane-1-carboxylate synthase              603   0.0      
gb|ACN31344.1|  unknown                                                 602   0.0      
ref|XP_010053215.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    600   0.0      
ref|XP_008669001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    602   0.0      
ref|XP_006652680.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    601   0.0      
gb|AAR25559.1|  acc synthase                                            601   0.0      
ref|NP_001053637.1|  Os04g0578000                                       601   0.0      
emb|CAH66732.1|  H0404F02.8                                             600   0.0      
gb|AFO63004.1|  ACC synthase                                            600   0.0      
ref|XP_006345624.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    600   0.0      
ref|XP_006829176.1|  hypothetical protein AMTR_s00001p00270760          599   0.0      
gb|AAD53173.1|  1-aminocyclopropane-1-carboxylic acid synthase ACS1     596   0.0      
ref|NP_001146401.1|  1-aminocyclopropane-1-carboxylate synthase7        598   0.0      
gb|AAG12246.1|AF184077_1  ACC synthase                                  593   0.0      
gb|AAC41663.1|  1-aminocyclopropane-1-carboxylate synthase              595   0.0      
ref|XP_002448372.1|  hypothetical protein SORBIDRAFT_06g026160          596   0.0      
gb|AAB18416.1|  ACC synthase                                            595   0.0      
emb|CDP08761.1|  unnamed protein product                                593   0.0      
ref|XP_003580370.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    595   0.0      
gb|EMS62632.1|  1-aminocyclopropane-1-carboxylate synthase              594   0.0      
dbj|BAK19926.1|  1-aminocyclopropane-1-carboxylate synthase             594   0.0      
emb|CAA10063.1|  1-aminocyclopropane-1-carboxylate synthase             588   0.0      
emb|CAB86186.1|  1-aminocyclopropane-1-carboxylate synthase             588   0.0      
ref|XP_011091525.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    590   0.0      
gb|AAL35386.1|  ACC synthase                                            587   0.0      
gb|ADZ96243.1|  ACC synthase 1                                          591   0.0      
dbj|BAA28860.1|  1-aminocyclopropane-1-carboxylate synthase             583   0.0      
gb|AAA86470.1|  1-aminocyclopropane 1-carboxylate synthase              583   0.0      
dbj|BAK19930.1|  1-aminocyclopropane-1-carboxylate synthase             587   0.0      
dbj|BAK19929.1|  1-aminocyclopropane-1-carboxylate synthase             583   0.0      
sp|Q01912.1|1A1C_VIGRR  RecName: Full=1-aminocyclopropane-1-carbo...    578   0.0      
dbj|BAA37135.1|  ACC synthase                                           577   0.0      
dbj|BAF36561.1|  ACC synthase                                           578   0.0      
emb|CAA47174.1|  1-aminocyclopropane 1-carboxylate synthase             573   0.0      
gb|AAD51755.1|AF177769_1  1-aminocyclopropane-1-carboxylate synthase    575   0.0      
gb|AEI84819.1|  1-aminocyclopropane-1-carboxylate synthase 2            575   0.0      
ref|XP_007158530.1|  hypothetical protein PHAVU_002G159800g             573   0.0      
gb|ACO59910.1|  1-aminocyclopropane-1-carboxylate synthase              570   0.0      
dbj|BAK19927.1|  1-aminocyclopropane-1-carboxylate synthase             576   0.0      
gb|AAM80889.1|  1-aminocyclopropane-1-carboxylate synthase              570   0.0      
dbj|BAC66952.1|  ACC synthase                                           572   0.0      
gb|AAN07180.1|  1-aminocyclopropane-1-carboxylate synthase              568   0.0      
gb|ABB89907.1|  1-aminocyclopropane-1-carboxylate synthase              567   0.0      
gb|EPS62904.1|  1-aminocyclopropane-1-carboxylate synthase              568   0.0      
gb|ABQ51842.1|  1-aminocyclopropane-1-carboxylate synthase              568   0.0      
gb|ABM60749.1|  ACC synthase                                            569   0.0      
gb|ABM60750.1|  ACC synthase                                            568   0.0      
dbj|BAK19928.1|  1-aminocyclopropane-1-carboxylate synthase             566   0.0      
gb|AAC05376.1|  1-aminocyclopropane-1-carboxylate synthase 3            562   0.0      
dbj|BAB33423.1|  ACC synthase                                           564   0.0      
gb|ABM60747.1|  ACC synthase                                            562   0.0      
gb|ABR53740.1|  1-aminocyclopropane-1-carboxylate synthase 5            556   0.0      
ref|XP_007040350.1|  1-aminocyclopropane-1-carboxylate synthase i...    555   0.0      
gb|AAC70351.2|  ACC synthase 1                                          551   0.0      
gb|AAA84895.1|  1-aminocyclopropane-carboxylate synthase                551   0.0      
gb|AAF01279.1|  1-aminocyclopropane-1-carboxylate synthase              551   0.0      
gb|AAD53174.1|  1-aminocyclopropane-1-carboxylic acid synthase ACS2     551   0.0      
gb|AAC32251.1|  1-aminocyclopropane-1-carboxylate synthase              546   0.0      
gb|AAR38503.1|  1-aminocyclopropane-1-carboxylate synthase 2b           549   0.0      
ref|XP_010041705.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    546   0.0      
gb|AAL34980.1|  1-aminocyclopropane-1-carboxylate                       543   0.0      
ref|XP_003620879.1|  1-aminocyclopropane-1-carboxylate synthase         544   0.0      
dbj|BAE94691.1|  1-aminocyclopropane-1-carboxylic acid synthase 3b      543   0.0      
ref|XP_009352610.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    543   0.0      
gb|AFA25803.1|  ACC synthase                                            543   0.0      
gb|AAR12136.1|  1-aminocyclopropene-1-carboxylate synthase 3a           542   0.0      
gb|KDP33744.1|  hypothetical protein JCGZ_07315                         542   0.0      
gb|AGE15420.1|  1-aminocyclopropane-1-carboxylate synthase              541   0.0      
gb|AAB67989.1|  ACC synthase                                            541   0.0      
gb|AEP82201.1|  1-aminocyclopropane-1-carboxylic acid synthase 3a-2     541   0.0      
gb|AEP82200.1|  1-aminocyclopropane-1-carboxylic acid synthase 3a-1     541   0.0      
ref|XP_010919134.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    540   0.0      
dbj|BAA76388.1|  1-aminocyclopropane -1-carboxylate synthase            541   0.0      
ref|XP_008387653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    540   0.0      
gb|AAM74940.1|AF518327_1  1-aminocyclopropane-1-carboxylate synth...    536   0.0      
ref|XP_009109390.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    540   0.0      
gb|AAL66201.1|AF386519_1  1-aminocyclopropane 1-carboxylate synth...    539   0.0      
ref|XP_011091524.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    537   0.0      
ref|XP_004503531.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    539   0.0      
ref|XP_009629400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    539   0.0      
gb|ABB89908.1|  1-aminocyclopropane-1-carboxylate synthase              536   0.0      
gb|AAL78631.1|  ACC synthase                                            535   0.0      
ref|XP_004288284.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    540   0.0      
ref|XP_010925479.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    538   0.0      
ref|XP_008391508.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    538   0.0      
ref|XP_010090013.1|  1-aminocyclopropane-1-carboxylate synthase 7       538   0.0      
ref|XP_008367258.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    538   0.0      
emb|CAB01401.1|  1-aminocyclopropane-carboxylate synthase homologue     537   0.0      
gb|AAF22112.1|AF119414_1  1-aminocyclopropane-1-carboxylate synth...    537   0.0      
emb|CDY69462.1|  BnaAnng30490D                                          538   0.0      
gb|ABM60748.1|  ACC synthase                                            536   0.0      
gb|AAL37504.1|AF338652_1  ACC synthase                                  533   0.0      
ref|XP_009778720.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    536   0.0      
ref|XP_008242429.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    534   1e-180   
ref|XP_008387640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    534   1e-180   
ref|XP_007012906.1|  1-amino-cyclopropane-1-carboxylate synthase 7      537   1e-180   
ref|XP_002514161.1|  acc synthase, putative                             533   2e-180   
gb|AAF61236.1|AF239989_1  ACC synthase ACS25                            530   3e-180   
ref|XP_007201928.1|  hypothetical protein PRUPE_ppa022214mg             531   5e-180   
emb|CDX90035.1|  BnaA10g00470D                                          532   5e-180   
ref|XP_002310878.1|  1-aminocyclopropane-1-carboxylic acid syntha...    533   5e-180   
ref|XP_008344120.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    531   5e-180   
pdb|1M7Y|A  Chain A, Crystal Structure Of Apple Acc Synthase In C...    532   5e-180   
ref|XP_010915315.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    532   6e-180   
ref|XP_006285008.1|  hypothetical protein CARUB_v10006315mg             532   7e-180   
gb|KFK30387.1|  hypothetical protein AALP_AA7G254400                    533   8e-180   
pdb|1B8G|A  Chain A, 1-aminocyclopropane-1-carboxylate Synthase         531   8e-180   
ref|XP_008342238.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    533   9e-180   
ref|XP_006475545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    531   1e-179   
emb|CDX69326.1|  BnaC01g01270D                                          532   1e-179   
dbj|BAA76389.1|  1-aminocyclopropane-1-carboxylic acid synthase         532   1e-179   
ref|XP_007152930.1|  hypothetical protein PHAVU_004G172300g             531   2e-179   
ref|XP_003530192.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    531   2e-179   
dbj|BAA35057.1|  1-aminocyclopropane-1-carboxylate synthase             531   2e-179   
sp|P37821.2|1A1C_MALDO  RecName: Full=1-aminocyclopropane-1-carbo...    531   3e-179   
ref|XP_002308289.1|  1-aminocyclopropene-1-carboxylate synthase 3...    530   3e-179   
emb|CDP02644.1|  unnamed protein product                                531   3e-179   
gb|ABR53739.1|  1-aminocyclopropane-1-carboxylate synthase 4            527   4e-179   
ref|XP_009133375.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    531   4e-179   
gb|KFK29127.1|  hypothetical protein AALP_AA7G092400                    530   5e-179   
emb|CAA81749.1|  1-aminocyclopropane-1-carboxylate synthase             530   5e-179   
ref|XP_010262212.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    530   5e-179   
ref|XP_011031331.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    530   6e-179   
ref|XP_009362620.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    530   7e-179   
ref|XP_002320015.1|  1-aminocyclopropane-1-carboxylic acid syntha...    530   8e-179   
gb|ABA03056.1|  ACC synthase                                            530   8e-179   
emb|CDX75675.1|  BnaA01g00270D                                          529   1e-178   
ref|XP_006371987.1|  1-aminocyclopropene-1-carboxylate synthase 3...    529   1e-178   
gb|AGG19162.1|  ACC synthase                                            530   1e-178   
ref|XP_011004709.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   1e-178   
ref|XP_011078213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   1e-178   
ref|XP_004242974.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   1e-178   
dbj|BAF44094.1|  1-aminocyclopropane-1-carboxylate synthase             530   2e-178   
ref|XP_004288918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   2e-178   
gb|KEH21318.1|  1-aminocyclopropane-1-carboxylate synthase              528   2e-178   
ref|XP_006362080.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   4e-178   
ref|XP_009389451.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   5e-178   
ref|XP_010666827.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    527   5e-178   
ref|XP_006282592.1|  hypothetical protein CARUB_v10004734mg             528   6e-178   
gb|AAA03472.1|  1-aminocyclopropane-1-carboxylate (ACC) synthase        528   7e-178   
gb|AEO92026.1|  1-aminocyclopropane-1-carboxylic acid synthase          525   8e-178   
ref|XP_006466414.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   8e-178   
gb|ACH88383.1|  ACC synthase                                            523   8e-178   
ref|XP_011013607.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    526   8e-178   
ref|XP_006426151.1|  hypothetical protein CICLE_v10027248mg             528   8e-178   
ref|XP_010248312.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    528   1e-177   
ref|XP_010999918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    527   1e-177   
dbj|BAE94692.1|  1-aminocyclopropane-1-carboxylic acid synthase 3c      526   1e-177   
gb|AAR38501.1|  1-aminocyclopropane-1-carboxylate synthase 1b           527   1e-177   
ref|XP_011078426.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    526   1e-177   
ref|XP_006411853.1|  hypothetical protein EUTSA_v10027155mg             527   1e-177   
gb|KDO78833.1|  hypothetical protein CISIN_1g043923mg                   527   2e-177   
ref|NP_195491.1|  1-aminocyclopropane-1-carboxylate synthase 8          527   2e-177   
ref|XP_008793196.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    525   2e-177   
ref|XP_003530532.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    525   2e-177   
dbj|BAB89348.1|  1-aminocyclopropane-1-carboxylate synthase             526   3e-177   
ref|XP_010555438.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    526   3e-177   
ref|XP_004513132.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    525   3e-177   
ref|XP_011094001.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    525   3e-177   
ref|XP_006855760.1|  hypothetical protein AMTR_s00044p00180330          526   4e-177   
ref|XP_006573922.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    525   4e-177   
ref|XP_004509049.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    526   6e-177   
ref|XP_010267362.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    524   6e-177   
dbj|BAA31137.1|  1-aminocyclopropane-1-carboxylate synthase             525   9e-177   
ref|XP_008242430.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    524   1e-176   
gb|AEI84820.1|  1-aminocyclopropane-1-carboxylate synthase 3            524   1e-176   
gb|AAF22108.1|AF119410_1  1-aminocyclopropane-1-carboxylate synth...    524   1e-176   
ref|XP_010446626.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    525   1e-176   
ref|XP_010313742.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    523   2e-176   
prf||1808332A  aminocyclopropane carboxylate synthase                   523   2e-176
ref|XP_003635576.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    524   2e-176   
ref|NP_001289205.1|  1-aminocyclopropane-1-carboxylate synthase         524   2e-176   
ref|XP_006580895.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    523   2e-176   
ref|XP_002269780.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    524   2e-176   
ref|XP_006364401.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    523   3e-176   
ref|XP_010273757.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    524   3e-176   
ref|XP_004502555.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    523   3e-176   
emb|CAA81747.1|  Amino cyclopropane carboxylate acid synthase           523   3e-176   
gb|AAQ13597.1|  1-aminocyclopropane-1-carboxylate synthase              523   4e-176   
gb|AAP14020.1|AF380837_1  putative ACC synthase 2                       522   4e-176   
emb|CDY71142.1|  BnaCnng71530D                                          522   4e-176   
ref|XP_006353581.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    523   4e-176   
ref|XP_009621053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    523   4e-176   
ref|XP_002868965.1|  1-amino-cyclopropane-1-carboxylate synthase 8      523   6e-176   
gb|ABW03081.1|  1-aminocyclopropane 1-carboxylate synthase 1            523   6e-176   
ref|XP_006413217.1|  hypothetical protein EUTSA_v10027427mg             522   6e-176   
ref|XP_002869623.1|  1-amino-cyclopropane-1-carboxylate synthase 7      522   6e-176   
ref|XP_007160245.1|  hypothetical protein PHAVU_002G305000g             521   9e-176   
ref|XP_010448309.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    522   9e-176   
gb|ABW03082.1|  1-aminocyclopropane 1-carboxylate synthase 3            521   9e-176   
ref|XP_009797702.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    522   1e-175   
gb|AAG28795.1|  ACC synthase                                            522   1e-175   
emb|CAA81748.1|  1-aminocyclopropane-1-carboxylate synthase             522   1e-175   
ref|NP_001234160.1|  1-aminocyclopropane-1-carboxylate synthase 8       522   2e-175   
sp|Q00257.1|1A12_CUCMA  RecName: Full=1-aminocyclopropane-1-carbo...    522   2e-175   
gb|AAQ13435.1|  1-aminocyclopropane-1-carboxylate synthase              521   2e-175   
emb|CDX94359.1|  BnaC01g18250D                                          521   2e-175   
ref|XP_010433537.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    521   2e-175   
ref|XP_009393981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    521   2e-175   
ref|XP_008236043.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    521   2e-175   
ref|XP_010679692.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    521   3e-175   
ref|XP_010432032.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    521   3e-175   
ref|XP_007205128.1|  hypothetical protein PRUPE_ppa004987mg             521   4e-175   
ref|XP_006364400.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    520   4e-175   
gb|KEH35860.1|  1-aminocyclopropane-1-carboxylate synthase              521   4e-175   
ref|XP_011099419.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    521   4e-175   
ref|XP_010438788.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    520   5e-175   
emb|CAA60591.1|  1-aminocyclopropane-1-carboxylate synthase             521   5e-175   
ref|NP_194350.1|  1-aminocyclopropane-1-carboxylate synthase 7          519   8e-175   
ref|XP_009339376.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    520   1e-174   
ref|XP_006280412.1|  hypothetical protein CARUB_v10026345mg             519   1e-174   
gb|ACN25592.1|  unknown                                                 520   2e-174   



>gb|ABB40579.2| 1-aminocyclopropane-1-carboxylate synthase [Ipomoea nil]
Length=488

 Score =  1001 bits (2587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/488 (100%), Positives = 488/488 (100%), Gaps = 0/488 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC
Sbjct  1     MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP
Sbjct  61    FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF
Sbjct  121   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE
Sbjct  181   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA
Sbjct  241   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  300

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN
Sbjct  301   RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  360

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
             GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE
Sbjct  361   GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  420

Query  1444  TMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMN  1623
             TMRVALMRIRTSVLQWKGMEAAAAASAKKQKQCRRNLKVSLSFRRGLEDCMISSPHSPMN
Sbjct  421   TMRVALMRIRTSVLQWKGMEAAAAASAKKQKQCRRNLKVSLSFRRGLEDCMISSPHSPMN  480

Query  1624  SPLVQATN  1647
             SPLVQATN
Sbjct  481   SPLVQATN  488



>gb|AAR99392.1| ACC synthase ACS3a [Nicotiana attenuata]
Length=484

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/480 (77%), Positives = 420/480 (88%), Gaps = 5/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLTNNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE+F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTTEGAEDFRDIAIFQDYHGLPEFRQAVARFMEKVRGDKVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE LAFCL +PG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKVT+ AL
Sbjct  129   GATGAHETLAFCLANPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKVTKKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             ESAY+KAQE NI +KGLLINNPSNPLGT+LD DTL DIV F+N KNIHL+CDEIYAATVF
Sbjct  189   ESAYEKAQESNINIKGLLINNPSNPLGTILDSDTLKDIVTFINSKNIHLICDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP+FIS+++I++E V CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPKFISVSEIVEEHVGCNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHLIA+MLSD+ F+E FI ESSERL KRHE FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLIASMLSDETFIEKFIAESSERLGKRHEMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKELTFESELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RIR  VLQ KG+ + +A   +     R  L++SLSFRR ++D M S  HSPMNSPLV+ 
Sbjct  429   RRIRNFVLQTKGLNSKSAVKKQCS---RSKLQISLSFRR-MDDFMNSPVHSPMNSPLVRT  484



>gb|AAC83147.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana glutinosa]
Length=484

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/485 (77%), Positives = 420/485 (87%), Gaps = 5/485 (1%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             + S  Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLCFD
Sbjct  4     ISSNNQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLINNPNGVIQMGLAENQLCFD  63

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             LI+ WV+NNPKASICT +GAE FKDIAI+QDYHGLPEFR AVARFME VRGD V FDP+R
Sbjct  64    LIQEWVVNNPKASICTIEGAENFKDIAIFQDYHGLPEFRQAVARFMENVRGDRVTFDPNR  123

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVMSGGATGAHE LAFCL +PG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKV
Sbjct  124   IVMSGGATGAHETLAFCLANPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKV  183

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             T+ ALE+AY+KAQE NI +KGLLINNPSNPLGT+LD DTL DIV+F+N KNIHL+CDEIY
Sbjct  184   TKKALETAYEKAQESNINIKGLLINNPSNPLGTLLDSDTLRDIVKFINSKNIHLICDEIY  243

Query  910   AATVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCAR  1086
             AATVF QP+FIS+++I++E V CN D IHIVYSLSKD+GFPGFRVGI+YSYND VV+ AR
Sbjct  244   AATVFDQPKFISVSEIVEEHVGCNKDLIHIVYSLSKDMGFPGFRVGIVYSYNDTVVNIAR  303

Query  1087  KMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNG  1266
             KMSSFGLVSTQTQHLIA+MLSD+ FVE FI ESSERL KRH  FT+GLAQVGI TLKSN 
Sbjct  304   KMSSFGLVSTQTQHLIASMLSDEIFVEKFIAESSERLGKRHGMFTKGLAQVGISTLKSNA  363

Query  1267  GLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDET  1446
             GLF WM+LR LLKEPTF +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDET
Sbjct  364   GLFFWMDLRRLLKEPTFDSELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDET  423

Query  1447  MRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNS  1626
             MR+AL RIR  VLQ KG+   AA   +     R  L++SLSFRR ++D M S  HSPMNS
Sbjct  424   MRIALRRIRNFVLQTKGLNNKAAVKKQCS---RSKLQISLSFRR-MDDFMNSPVHSPMNS  479

Query  1627  PLVQA  1641
             PLV+ 
Sbjct  480   PLVRT  484



>ref|XP_009590054.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/480 (77%), Positives = 417/480 (87%), Gaps = 5/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE LAFCL +PG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKVT+ AL
Sbjct  129   GATGAHETLAFCLANPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKVTKKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E+AY+KAQE NI +KGLLINNPSNPLGT+LD DTL DIV F+N KNIHL+CDEIYAATVF
Sbjct  189   EAAYEKAQESNINIKGLLINNPSNPLGTLLDSDTLRDIVTFINSKNIHLICDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP+FIS+++I++E V CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPKFISVSEIVEEHVGCNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHLIA+MLSD+ F+E FI ESSER+ KRH  FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLIASMLSDEIFIEKFIAESSERVGKRHGMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKEPT  +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR AL
Sbjct  369   MDLRRLLKEPTLESELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRTAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RIR  VLQ KG+   AA   +     R  L++SLSFRR ++D M S  HSPMNSPLV+ 
Sbjct  429   RRIRNFVLQTKGLNNKAAVKKQCS---RSKLQISLSFRR-MDDFMNSPVHSPMNSPLVRT  484



>ref|XP_009776307.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/480 (77%), Positives = 418/480 (87%), Gaps = 5/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENSAYFDGWKAY+ +PFH  +NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSAYFDGWKAYEIDPFHLTNNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTIEGAEDFKDIAIFQDYHGLPEFRQAVARFMEKVRGDKVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE LAFCL +PG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKVT+ AL
Sbjct  129   GATGAHETLAFCLANPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKVTKKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             ESAY+KAQE NI +KGLLINNPSNPLGT+LD DTL DIV F+N KNIHL+CDEIYAATVF
Sbjct  189   ESAYEKAQESNINIKGLLINNPSNPLGTLLDSDTLRDIVTFINSKNIHLICDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP+FIS+++I++E V CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPKFISVSEIVEEHVGCNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHLIA+MLSD+ FVE FI ESSERL KRH  FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLIASMLSDEIFVEKFIAESSERLGKRHGMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKESTFESELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RIR  VLQ KG+ + +A   +     R  L++SLSFRR ++D M S  HSPMNSPLV+ 
Sbjct  429   RRIRNFVLQTKGLNSKSAVKKQCS---RSKLQISLSFRR-MDDFMNSPVHSPMNSPLVRT  484



>emb|CAA06288.1| 1-cyclopropane-1-carboxylate synthase [Nicotiana tabacum]
 emb|CAB65314.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana tabacum]
 gb|ABW97849.1| ACS2 [Nicotiana tabacum]
Length=484

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/480 (77%), Positives = 416/480 (87%), Gaps = 5/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE LAFCL +PG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKVT+ AL
Sbjct  129   GATGAHETLAFCLANPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKVTKKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E+AY+KAQE NI +KGLLINNPSNPLGT+LD DTL DIV F+N KNIHL+CDEIYAATVF
Sbjct  189   EAAYEKAQESNINIKGLLINNPSNPLGTLLDSDTLRDIVTFINSKNIHLICDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP+F S+++I++E V CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPKFFSVSEIVEEHVGCNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHLIA+MLSD+ F+E FI ESSERL KRH  FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLIASMLSDEIFIEKFIAESSERLGKRHGMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKEPT  +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR AL
Sbjct  369   MDLRRLLKEPTLESELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRTAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RIR  VLQ KG+   AA   +     R  L++SLSFRR ++D M S  HSPMNSPLV+ 
Sbjct  429   RRIRNFVLQTKGLNNKAAVKKQCS---RSKLQISLSFRR-MDDFMNSPVHSPMNSPLVRT  484



>ref|XP_009626433.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=486

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/482 (78%), Positives = 423/482 (88%), Gaps = 12/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSKIAT+DGHGENSAYFDGWKAY+N+PFH   NP GVIQMGLAENQLCFDLI+ WV+N
Sbjct  9     KLLSKIATSDGHGENSAYFDGWKAYENDPFHLTQNPNGVIQMGLAENQLCFDLIQEWVVN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP ASICT +GA++FKDIAI+QDYHGLPEFR AV+RFMEKVRGD V FD DRIVMSGGAT
Sbjct  69    NPNASICTAEGAQDFKDIAIFQDYHGLPEFRKAVSRFMEKVRGDRVIFDSDRIVMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALESA
Sbjct  129   GAHETLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALESA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE NIRVKGLLINNPSNPLGTVLDR+TL DI+RF+NDKNIHLVCDEIYAATVFSQP
Sbjct  189   YEKAQESNIRVKGLLINNPSNPLGTVLDRETLKDILRFINDKNIHLVCDEIYAATVFSQP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             +FISI++++QEV  CN + +H+VYSLSKDLGFPGFRVGIIYSYND VV+CARKMSSFGLV
Sbjct  249   DFISISEVMQEVNGCNENLVHVVYSLSKDLGFPGFRVGIIYSYNDVVVNCARKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             STQTQ LIA+MLSD+ FVENFI +SS RL +RH  FT+GLAQVGI TLKSNGGLF WM+L
Sbjct  309   STQTQFLIASMLSDEIFVENFIAKSSVRLSQRHGLFTKGLAQVGISTLKSNGGLFFWMDL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF AEL+LW +IINE+KLNVSPG SFHC E GWFRVCFANMDDETMRVAL RI
Sbjct  369   RRLLKESTFEAELDLWHIIINEVKLNVSPGVSFHCSEPGWFRVCFANMDDETMRVALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMIS----SPHSPMNSPLV  1635
             R  VLQ KG+          +KQCRR+ L++SLSFRR L+D M S    SPHSPM+SP+V
Sbjct  429   RHFVLQRKGL-----IEVATKKQCRRSKLEISLSFRR-LDDFMNSPFKNSPHSPMSSPMV  482

Query  1636  QA  1641
             QA
Sbjct  483   QA  484



>gb|AAR99393.1| ACC synthase ACS3b [Nicotiana attenuata]
Length=485

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/487 (77%), Positives = 424/487 (87%), Gaps = 8/487 (2%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             + S  Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLCFD
Sbjct  4     ISSNNQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFD  63

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             LI+ WV+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME+VRGD V FDP+R
Sbjct  64    LIQEWVVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFMERVRGDKVXFDPNR  123

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVMSGGATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKV
Sbjct  124   IVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKV  183

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             TR ALESAY+KAQE NI++KGLLINNPSNPLGT+LDRDTL DIV FVN KNIHLVCDEIY
Sbjct  184   TREALESAYEKAQESNIKIKGLLINNPSNPLGTLLDRDTLKDIVSFVNSKNIHLVCDEIY  243

Query  910   AATVFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             AATVF++P FISI++I++E    CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ A
Sbjct  244   AATVFNKPNFISISEILEENLGLCNQDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIA  303

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGLVSTQTQHLIA+MLSD+ FVE FI+ESSERL  R   F++GLAQVGI TLKSN
Sbjct  304   RKMSSFGLVSTQTQHLIASMLSDEIFVEKFIVESSERLGIRQGMFSKGLAQVGISTLKSN  363

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
              GLF WM+LR LLKE TF AELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDE
Sbjct  364   AGLFFWMDLRRLLKESTFEAELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDE  423

Query  1444  TMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSP-HSPM  1620
             TMR+A+ RIR  VLQ KG+      +A K++  R  L++SLSFRR L+D   +SP HSPM
Sbjct  424   TMRIAIRRIRNFVLQTKGI--TNKVAAFKKQCSRSKLQISLSFRR-LDD--FNSPVHSPM  478

Query  1621  NSPLVQA  1641
             NSPLV+ 
Sbjct  479   NSPLVRT  485



>dbj|BAG30909.1| ACC synthase [Capsicum chinense]
Length=485

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/480 (77%), Positives = 414/480 (86%), Gaps = 4/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENSAYFDGWKAY N+PFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSAYFDGWKAYANDPFHLTDNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE+F++IAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTAEGAEDFQEIAIFQDYHGLPEFRQAVARFMEKVRGDKVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSNDFKVTR AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNDFKVTRKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQE NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EEAYEKAQESNIKIKGLLINNPSNPLGTLLDKDTLRDIVTFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS+++++ E + CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV  ARKMSSF
Sbjct  249   DQPRFISVSEVVDEMIGCNQDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVDIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHL+A+MLSD+ F+E FI ESSERL KR   FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLLASMLSDEIFIEKFIAESSERLGKRQGMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKEPTF AELELW++II+E+KLNVSPG SFHC E GWFRVCFANMDDETMR AL
Sbjct  369   MDLRRLLKEPTFDAELELWRIIIHEVKLNVSPGVSFHCSEPGWFRVCFANMDDETMRTAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RIR  VLQ KG+      +  K++  R  L++SLSFRR L+D M S  +SPMNSPLV+ 
Sbjct  429   RRIRNFVLQTKGLN--NKVAVLKKQCSRSKLQISLSFRR-LDDFMNSPANSPMNSPLVRT  485



>ref|XP_009791163.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=486

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/482 (78%), Positives = 424/482 (88%), Gaps = 12/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSKIAT+DGHGENSAYFDGWKAY+N+PFH   NP GVIQMGLAENQLCFDLI+ WV+N
Sbjct  9     KLLSKIATSDGHGENSAYFDGWKAYENDPFHLIKNPNGVIQMGLAENQLCFDLIQEWVVN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +GA++FKDIAI+QDYHGLPEFR AV+RFMEKVRGD V FDPD IVMSGGAT
Sbjct  69    NPKASICTAEGAQDFKDIAIFQDYHGLPEFRKAVSRFMEKVRGDKVTFDPDHIVMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FK+T+ ALESA
Sbjct  129   GAHETLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKITKEALESA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE NIR+KGLLINNPSNPLGTVLDR+TL DI+ F+NDKNIHLVCDEIYAATVFSQP
Sbjct  189   YEKAQESNIRIKGLLINNPSNPLGTVLDRETLKDILSFINDKNIHLVCDEIYAATVFSQP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             +FISI++++QEV  CN + +HIVYSLSKDLGFPGFRVGIIYSYN+ VV+CARKMSSFGLV
Sbjct  249   DFISISEVMQEVNGCNENLVHIVYSLSKDLGFPGFRVGIIYSYNNVVVNCARKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             STQTQ LIA+MLSD+ FVENFI +SS RL +RH  FT+GLAQVGI TLKSNGGLF WM+L
Sbjct  309   STQTQFLIASMLSDEIFVENFIAKSSVRLSQRHGLFTKGLAQVGICTLKSNGGLFFWMDL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF AEL+LW +IINE+KLNVSPG SFHC E GWFRVCFANMDDETMRVAL RI
Sbjct  369   RRLLKESTFEAELDLWHIIINEVKLNVSPGVSFHCSEPGWFRVCFANMDDETMRVALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCM----ISSPHSPMNSPLV  1635
             R  VLQ KG+          +KQCRR+ L++SLSFRR L+D M    ++SPHSPM+SP+V
Sbjct  429   RHFVLQRKGL-----IEVATKKQCRRSKLEISLSFRR-LDDFMNSPFMNSPHSPMSSPMV  482

Query  1636  QA  1641
             QA
Sbjct  483   QA  484



>ref|XP_009590053.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/481 (77%), Positives = 420/481 (87%), Gaps = 6/481 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME+VRGD V FDP+R+VMSG
Sbjct  69    VVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFMERVRGDKVTFDPNRVVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+P+VC+SSNDFKVTR AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPIVCDSSNDFKVTRKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E+AY+KAQE NI++KGLLINNPSNPLGT+LDRDTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EAAYEKAQESNIKIKGLLINNPSNPLGTLLDRDTLKDIVSFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             ++P FISI++I++E    CN D +HIVYSLSKDLGFPGFRVGI+YSYND +V+ ARKMSS
Sbjct  249   NKPNFISISEILEENVGLCNQDLVHIVYSLSKDLGFPGFRVGIVYSYNDTIVNIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQHLIA+MLSD+ FVE FI ESSERL KR   F++GLAQVGI TLKSN GLF 
Sbjct  309   FGLVSTQTQHLIASMLSDEIFVEKFIAESSERLGKRQGMFSKGLAQVGISTLKSNAGLFF  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLKE TF AELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+A
Sbjct  369   WMDLRRLLKESTFEAELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIA  428

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQ  1638
             L RIR  VLQ KG+      +A K++  R  L++SLSFRR L+D   S  HSPMNSPLV+
Sbjct  429   LRRIRNFVLQTKGI--TNKVAAFKKQCSRSKLQISLSFRR-LDD-FNSPAHSPMNSPLVR  484

Query  1639  A  1641
              
Sbjct  485   T  485



>ref|XP_006343930.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/480 (76%), Positives = 412/480 (86%), Gaps = 4/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENS YFDGWKAY N+PFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSPYFDGWKAYANDPFHLTDNPNGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVA+FMEKVRGD V FDPDRIVMSG
Sbjct  69    VVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVAKFMEKVRGDKVTFDPDRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES NDFKVT+ AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESCNDFKVTKKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ+ NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EEAYEKAQQSNIKIKGLLINNPSNPLGTLLDKDTLQDIVTFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS+++I++E ++CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPRFISVSEIVEEMIECNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHL+A+MLSD+ F+E FI ESSERL +R   FT+GLA+VGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLLASMLSDEVFIEKFIAESSERLGERQGMFTKGLAEVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF  ELELW+MIINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKEATFDGELELWRMIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RI   VLQ KG+   AA + +     RR L++SLSFRR   + M S  HSPMNSPLV+ 
Sbjct  429   KRISYFVLQPKGLNNKAAVNKQCS---RRKLQISLSFRRLDHEFMNSPAHSPMNSPLVRT  485



>ref|XP_009771943.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=484

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/488 (76%), Positives = 421/488 (86%), Gaps = 6/488 (1%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S  Q+ Q+LSKIATNDGHGENSAYFDGWKAY+N+PFH  +NP GVIQMGLAENQLC
Sbjct  1     MVFISGNQKQQLLSKIATNDGHGENSAYFDGWKAYENDPFHLSNNPNGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ WV+NNPKASICT +GAE+FKDIAI+QDYHGLPEFR AVARFME+VRGD V FDP
Sbjct  61    FDLIQEWVVNNPKASICTTEGAEDFKDIAIFQDYHGLPEFRQAVARFMERVRGDKVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +RIVMSGGATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDF
Sbjct  121   NRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             KVTR ALESAY+KAQE NI++KGLLINNPSNPLGT+LDRDTL DIV FVN KNIHLVCDE
Sbjct  181   KVTRKALESAYEKAQESNIKIKGLLINNPSNPLGTLLDRDTLKDIVSFVNSKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             IYAATVF++P FISI++I++E    CN D +HIVYSLSKDLGFPGFRVGI+YSYN+ VV+
Sbjct  241   IYAATVFNKPNFISISEILEENVGLCNQDLVHIVYSLSKDLGFPGFRVGIVYSYNNTVVN  300

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
              ARKMSSFGLVSTQTQHLIA+MLSD+ FVE FI ESSERL  R   F++GLAQVGI TLK
Sbjct  301   IARKMSSFGLVSTQTQHLIASMLSDEIFVEKFIAESSERLGIRQGMFSKGLAQVGISTLK  360

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SN GLF WM+LR LLK+ TF AELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMD
Sbjct  361   SNAGLFFWMDLRRLLKDSTFEAELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMD  420

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSP  1617
             DETMR+A+ RIR  VLQ KG+      +A K++  R  L++SLSFRR L+D   S  HSP
Sbjct  421   DETMRIAIRRIRNFVLQTKGI--TNKVAAFKKQCSRSKLQISLSFRR-LDD-FNSPAHSP  476

Query  1618  MNSPLVQA  1641
             MNSPLV+ 
Sbjct  477   MNSPLVRT  484



>gb|AAR99391.1| ACC synthase ACS2 [Nicotiana attenuata]
Length=483

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/481 (76%), Positives = 425/481 (88%), Gaps = 10/481 (2%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             + ++LSK+ATN+GHGENSAYFDGWKAY+ +PFH   N  GVIQMGLAENQLCFDLI+ WV
Sbjct  8     ENELLSKVATNNGHGENSAYFDGWKAYEIDPFHLTQNFDGVIQMGLAENQLCFDLIQEWV  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             +NNPKASICT +G+E+FKDIAIYQDYHGLPEFR+AVARFMEKVRGD + F+ +RIVMSGG
Sbjct  68    VNNPKASICTAEGSEDFKDIAIYQDYHGLPEFRSAVARFMEKVRGDRITFEAERIVMSGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE+LAFCL DP EAFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVTRTALE
Sbjct  128   ATGAHELLAFCLADPAEAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTRTALE  187

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
             +AY+KAQE NI VKGLL+NNPSNPLGT+LDR+TL D VRF+N+KNIHLVCDEIYAAT+F+
Sbjct  188   TAYQKAQESNITVKGLLLNNPSNPLGTILDRETLKDTVRFINEKNIHLVCDEIYAATIFN  247

Query  928   QPEFISIAQII--QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
             +P+FISI+++I  ++V+C+ D IHIVYSLSKDLGFPGFRVGIIYSYND V +CARKMSSF
Sbjct  248   KPDFISISEVILDEDVECDRDLIHIVYSLSKDLGFPGFRVGIIYSYNDVVTNCARKMSSF  307

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQ LI+ MLSD++FV  FI ESSERL KRH+ FT+GLAQVGI TLKSN GLF+W
Sbjct  308   GLVSTQTQFLISNMLSDEKFVTKFIGESSERLAKRHDMFTKGLAQVGINTLKSNAGLFIW  367

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMRVAL
Sbjct  368   MDLRRLLKELTFESELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRVAL  427

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMISSPHSPMNSPLVQ  1638
              RI   V+Q KG+E        K+ QCRR+ L++SLSFR+ L+D  I+SPHSPM+SPLVQ
Sbjct  428   RRINNFVIQRKGIE-----GGVKKLQCRRSKLEISLSFRK-LDD-FINSPHSPMSSPLVQ  480

Query  1639  A  1641
             A
Sbjct  481   A  481



>emb|CAA67118.1| ACC synthase [Nicotiana tabacum]
Length=483

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/479 (76%), Positives = 422/479 (88%), Gaps = 10/479 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+ATN+GHGENSAYFDGWKAY+ +PFHP  N  GVIQMGLAENQLCFDLI+ WV+ 
Sbjct  10    ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVK  69

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G+++FKDIAIYQDYHGLPEFR+AVARFM KVRGD + F+P+RIVMSGGAT
Sbjct  70    NPKASICTAEGSQDFKDIAIYQDYHGLPEFRSAVARFMGKVRGDRITFEPERIVMSGGAT  129

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE+LAFCL DPGEAFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALE+A
Sbjct  130   GAHELLAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALEAA  189

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE NI VKGLL+NNPSNPLGT+LDR+TL D VRF+N+KNIHLVCDEIYAAT+F++P
Sbjct  190   YQKAQESNITVKGLLLNNPSNPLGTILDRETLKDTVRFINEKNIHLVCDEIYAATIFNKP  249

Query  934   EFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             +FISI+++I E  V+C+ D IHIVYSLSKDLGFPGFRVGIIYSYND V +CARKMSSFGL
Sbjct  250   DFISISEVIMEEDVECDRDLIHIVYSLSKDLGFPGFRVGIIYSYNDVVTNCARKMSSFGL  309

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ LI+ MLSD+ FV  FI ESSERL+KRH  FTRGLAQVGI TLKSN GLF+WM+
Sbjct  310   VSTQTQFLISNMLSDENFVTKFIGESSERLQKRHGMFTRGLAQVGINTLKSNAGLFIWMD  369

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR LLKE TF AELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL R
Sbjct  370   LRRLLKELTFEAELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIALRR  429

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
             I   V+Q KG+E        K+ QCRR+ L++SLSFR+ L+D M +SPHSPM+SPLVQA
Sbjct  430   INNFVIQRKGIE-----GGVKKLQCRRSKLEISLSFRK-LDDFM-NSPHSPMSSPLVQA  481



>ref|NP_001266271.1| 1-aminocyclopropane-1-carboxylate synthase-like [Solanum lycopersicum]
 gb|AAB17279.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/481 (76%), Positives = 414/481 (86%), Gaps = 8/481 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENS YFDGWKAY NNPFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHPTDNPTGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             ++NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    MVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES NDFKVT  AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESCNDFKVTTKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ+ NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EEAYEKAQQSNIKIKGLLINNPSNPLGTLLDKDTLRDIVTFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS++++++E ++CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ +RKMSSF
Sbjct  249   DQPRFISVSEMVEEMIECNTDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNISRKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQH++A+MLSD+ FVE FI ESSERL KR   FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHMLASMLSDEIFVEKFIAESSERLGKRQGMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF  ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSP-HSPMNSPLVQ  1638
              RIR  VLQ KG+   AA   +     R  L++SLSFRR L+D   +SP HSPMNSPLV+
Sbjct  429   RRIRNFVLQTKGLNNIAAIKKQCS---RSKLQISLSFRR-LDD--FNSPAHSPMNSPLVR  482

Query  1639  A  1641
              
Sbjct  483   T  483



>ref|XP_009626021.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/479 (76%), Positives = 422/479 (88%), Gaps = 10/479 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+ATN+GHGENSAYFDGWKAY+ +PFHP  N  GVIQMGLAENQLCFDLI+ WV+ 
Sbjct  10    ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVK  69

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G+++FKDIAIYQDYHGLPEFR+AVARFM KVRGD + F+P+RIVMSGGAT
Sbjct  70    NPKASICTAEGSQDFKDIAIYQDYHGLPEFRSAVARFMGKVRGDRITFEPERIVMSGGAT  129

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE+LAFCL DPGEAFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALE+A
Sbjct  130   GAHELLAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALEAA  189

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE NI VKGLL+NNPSNPLGT+LDR+TL D VRF+N+KNIHLVCDEIYAAT+F++P
Sbjct  190   YQKAQESNITVKGLLLNNPSNPLGTILDRETLKDTVRFINEKNIHLVCDEIYAATIFNKP  249

Query  934   EFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             +FISI+++I E  V+C+ D IHIVYSLSKDLGFPGFRVGIIYSYND V +CARKMSSFGL
Sbjct  250   DFISISEVIMEEDVECDRDLIHIVYSLSKDLGFPGFRVGIIYSYNDVVTNCARKMSSFGL  309

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ LI+ MLSD+ FV  FI ESSERL+KRH  FTRGLAQVGI TLKSN GLF+WM+
Sbjct  310   VSTQTQFLISNMLSDENFVTKFIGESSERLQKRHGMFTRGLAQVGINTLKSNAGLFIWMD  369

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR LLKE TF AELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL R
Sbjct  370   LRRLLKELTFEAELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIALRR  429

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
             I   V+Q KG+E        K+ QCRR+ L+++LSFR+ L+D M +SPHSPM+SPLVQA
Sbjct  430   INNFVIQRKGIE-----GGVKKLQCRRSKLEINLSFRK-LDDFM-NSPHSPMSSPLVQA  481



>ref|XP_006343931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=484

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/481 (76%), Positives = 413/481 (86%), Gaps = 8/481 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENS YFDGWKAY N+PFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  10    QKQQLLSKIATNDGHGENSPYFDGWKAYANDPFHLTDNPNGVIQMGLAENQLCFDLIQEW  69

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDPDRIVMSG
Sbjct  70    VVNNPKASICTAEGAENFQDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPDRIVMSG  129

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES NDFKVT+ AL
Sbjct  130   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESCNDFKVTKKAL  189

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ+ NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  190   EEAYEKAQQSNIKIKGLLINNPSNPLGTLLDKDTLRDIVTFINSKNIHLVCDEIYAATVF  249

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS+++I++E ++CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  250   DQPRFISVSEIVEEMIECNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  309

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHL+A+MLSD+ F+E FI ESSERL +R   FT+GLAQVGI TLKSN GLF W
Sbjct  310   GLVSTQTQHLLASMLSDEIFIERFIAESSERLGQRQGMFTKGLAQVGISTLKSNAGLFFW  369

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF  ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETM+ AL
Sbjct  370   MDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMKTAL  429

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSP-HSPMNSPLVQ  1638
              RIR  VLQ KG+   AA   +     R  L++SLSFRR L+D   +SP HSPMNSPLV+
Sbjct  430   RRIRNFVLQTKGLNNIAAIKKQCS---RSKLQISLSFRR-LDD--FNSPAHSPMNSPLVR  483

Query  1639  A  1641
              
Sbjct  484   T  484



>gb|AAF97615.1|U18057_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=483

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/481 (76%), Positives = 413/481 (86%), Gaps = 8/481 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENS YFDGWKAY NNPFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHLTDNPTGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             ++NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    MVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES NDFKVT  AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESCNDFKVTTKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ+ NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EEAYEKAQQSNIKIKGLLINNPSNPLGTLLDKDTLRDIVTFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS++++++E ++CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ +RKMSSF
Sbjct  249   DQPRFISVSEMVEEMIECNTDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNISRKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQH++A+MLSD+ FVE FI ESSERL KR   FT+GLAQVGI TLKSN GLF W
Sbjct  309   GLVSTQTQHMLASMLSDEIFVEKFIAESSERLGKRQGMFTKGLAQVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF  ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKEATFDGELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSP-HSPMNSPLVQ  1638
              RIR  VLQ KG+   AA   +     R  L++SLSFRR L+D   +SP HSPMNSPLV+
Sbjct  429   RRIRNFVLQTKGLNNIAAIKKQCS---RSKLQISLSFRR-LDD--FNSPAHSPMNSPLVR  482

Query  1639  A  1641
              
Sbjct  483   T  483



>gb|AAF97614.1|U18056_1 1-amino-cyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/480 (76%), Positives = 411/480 (86%), Gaps = 4/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENS YFDGWKAY NNPFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHLTDNPTGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES NDFKVT  AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESCNDFKVTTKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ+ NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EEAYEKAQQSNIKIKGLLINNPSNPLGTLLDKDTLRDIVTFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS+++I+++ ++CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPRFISVSEIVEDMIECNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHL+A+MLSD+ F++ FI ESSERL +R   FT+GLA+VGI TLKSN GLF W
Sbjct  309   GLVSTQTQHLLASMLSDEVFIDKFIAESSERLGERQGMFTKGLAEVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKEATFDSELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RI   VLQ KG+   AA   +     RR L++SLSFRR   + M S  HSPMNSPLV+ 
Sbjct  429   KRISYFVLQPKGLNNIAAIKKQCS---RRKLQISLSFRRLDHEFMNSPAHSPMNSPLVRT  485



>ref|NP_001233922.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAB17278.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/480 (75%), Positives = 410/480 (85%), Gaps = 4/480 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q+ Q+LSKIATNDGHGENS YFDGWKAY NNPFH   NP GVIQMGLAENQLCFDLI+ W
Sbjct  9     QKQQLLSKIATNDGHGENSPYFDGWKAYANNPFHLTDNPTGVIQMGLAENQLCFDLIQEW  68

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GAE F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDP+RIVMSG
Sbjct  69    VVNNPKASICTVEGAENFQDIAIFQDYHGLPEFRQAVARFMEKVRGDRVTFDPNRIVMSG  128

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES NDFKVT  AL
Sbjct  129   GATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESCNDFKVTTKAL  188

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ+ NI++KGLLINNPSNPLGT+LD+DTL DIV F+N KNIHLVCDEIYAATVF
Sbjct  189   EEAYEKAQQSNIKIKGLLINNPSNPLGTLLDKDTLRDIVTFINSKNIHLVCDEIYAATVF  248

Query  925   SQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
              QP FIS+++I+++ ++CN D IHIVYSLSKDLGFPGFRVGI+YSYND VV+ ARKMSSF
Sbjct  249   DQPRFISVSEIVEDMIECNKDLIHIVYSLSKDLGFPGFRVGIVYSYNDTVVNIARKMSSF  308

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVS QTQHL+A+MLSD+ F++ FI ESSERL +R   FT+GLA+VGI TLKSN GLF W
Sbjct  309   GLVSAQTQHLLASMLSDEVFIDKFIAESSERLGERQGMFTKGLAEVGISTLKSNAGLFFW  368

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKE TF +ELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL
Sbjct  369   MDLRRLLKEATFDSELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIAL  428

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
              RI   VLQ KG+   AA   +     RR L++SLSFRR   + M S  HSPMNSPLV+ 
Sbjct  429   KRISYFVLQPKGLNNIAAIKKQCS---RRKLQISLSFRRLDHEFMNSPAHSPMNSPLVRT  485



>gb|AAC15777.1| ACC synthase [Nicotiana glutinosa]
Length=482

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/477 (77%), Positives = 419/477 (88%), Gaps = 6/477 (1%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSKIAT+DGHGENSAYFDGWKAY+N+PFH   NP GVIQMGLAENQLCFDLI+ WV+N
Sbjct  9     KLLSKIATSDGHGENSAYFDGWKAYENDPFHLTQNPNGVIQMGLAENQLCFDLIQEWVVN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +GA++F DIAI+QDYHGL EFR AV+RFMEKVRGD V FDPD IVMSGGAT
Sbjct  69    NPKASICTAEGAQDFNDIAIFQDYHGLREFRKAVSRFMEKVRGDKVTFDPDHIVMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCES N+FK+T+ ALESA
Sbjct  129   GAHETLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESFNNFKITKEALESA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE NIRVKGLLINNPSNPLGT+LDR+TL DI+RF+NDKNIHLVCDEIYAATVFSQP
Sbjct  189   YEKAQESNIRVKGLLINNPSNPLGTILDRETLKDILRFINDKNIHLVCDEIYAATVFSQP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             +FISI++++QEV  CN + +H+VYSLSKDLGFPGFRVGIIYSYND VVSCARKMSSFGLV
Sbjct  249   DFISISEVMQEVNGCNENLVHVVYSLSKDLGFPGFRVGIIYSYNDVVVSCARKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             STQTQ LIA+MLSD+ FVENFI +SS RL +RH  FT+GLAQVGI +LKSN GLF WM+L
Sbjct  309   STQTQFLIASMLSDEIFVENFIAKSSVRLSQRHGFFTKGLAQVGISSLKSNSGLFFWMDL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF AEL+LW +IINE+KLNVSPG SFHC E GWFRVCFANMDDETMRVAL RI
Sbjct  369   RRLLKESTFEAELDLWHIIINEVKLNVSPGVSFHCSEPGWFRVCFANMDDETMRVALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
             +  VLQ KG+      + KKQ + RR  ++SLSFRR L+D M +SPHSPM+SP+VQA
Sbjct  429   KHFVLQRKGL---IEVATKKQCRRRRKREISLSFRR-LDDFM-NSPHSPMSSPMVQA  480



>ref|XP_009757887.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
sylvestris]
Length=483

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/479 (75%), Positives = 421/479 (88%), Gaps = 10/479 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+ATNDGHGENSAYFDGWKAY+ +PFHP  N  GVIQMGLAENQLCFDLI+ WV+N
Sbjct  10    ELLSKVATNDGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVN  69

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G+E+FKDIAIYQDYHGLPEFR AVARFMEKVRGD ++ + +RIVMSGGAT
Sbjct  70    NPKASICTGEGSEDFKDIAIYQDYHGLPEFRIAVARFMEKVRGDRIRIEAERIVMSGGAT  129

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE+LAFCL DPGEAFLVPTPYYPGFDRDLRWRTGVQL+PVVC+SSNDFKVTRTALE+A
Sbjct  130   GAHELLAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVQLFPVVCDSSNDFKVTRTALETA  189

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE  I +KGLL+NNPSNPLGT+LD++TL D VRF+N+KNIHLVCDEIYAAT+F++P
Sbjct  190   YQKAQESKITIKGLLLNNPSNPLGTILDKETLKDTVRFINEKNIHLVCDEIYAATIFNKP  249

Query  934   EFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             +FISI+++I E  V+C+ D IHIVYSLSKDLGFPGFRVGIIYSYN+ V +CARKMSSFGL
Sbjct  250   DFISISEVIMEEDVECDRDLIHIVYSLSKDLGFPGFRVGIIYSYNNVVTNCARKMSSFGL  309

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ LI+ MLSD++F+  FI +SS RLRKRH  F +GL QVGI TLKSN GLF+WM+
Sbjct  310   VSTQTQFLISNMLSDEKFITKFITKSSGRLRKRHYMFIKGLEQVGINTLKSNAGLFIWMD  369

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR LLKEPTF +EL+LW++IINE+KLN+SPGCSFHC E GWFRVCFANMDDETMR+AL R
Sbjct  370   LRRLLKEPTFESELQLWRIIINEVKLNISPGCSFHCSEPGWFRVCFANMDDETMRIALRR  429

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
             I   V+Q KG+E        K+ QCRR+ L++SLSFR+ L+D M +SPHSPM+SPLVQA
Sbjct  430   INNFVIQRKGIE-----GGVKKLQCRRSKLEISLSFRK-LDDFM-NSPHSPMSSPLVQA  481



>gb|ABW97851.1| ACS5 [Nicotiana tabacum]
Length=474

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/479 (76%), Positives = 419/479 (87%), Gaps = 10/479 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+ATN+GHGENSAYFDGWKAY+ +PFHP  N  GVIQMGLAENQLCFDLI+ WV+ 
Sbjct  1     ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNSDGVIQMGLAENQLCFDLIQEWVVK  60

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G+++FKDIAIYQDYHGLPEFR+AVARFM KVRGD + F+P+RIVMSGGAT
Sbjct  61    NPKASICTAEGSQDFKDIAIYQDYHGLPEFRSAVARFMGKVRGDRITFEPERIVMSGGAT  120

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE+LAFCL DPGEAFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALE+A
Sbjct  121   GAHELLAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALEAA  180

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KAQE NI VKGLL+NNPSNPLGT+LDR+TL D VRF+N+KNIHLVCDEIYAAT+F++P
Sbjct  181   YQKAQESNITVKGLLLNNPSNPLGTILDRETLKDTVRFINEKNIHLVCDEIYAATIFNKP  240

Query  934   EFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             +FISI+++I E  V+C+ D IHIVYSLSKDLGFPGFRVGIIYSYND V +CARKMSSFGL
Sbjct  241   DFISISEVIMEEDVECDRDLIHIVYSLSKDLGFPGFRVGIIYSYNDVVTNCARKMSSFGL  300

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ LI+ MLSD+ FV  FI ESSERL+KRH  FTRG AQVG  TLKSN  LF+WM+
Sbjct  301   VSTQTQFLISNMLSDENFVTKFIGESSERLQKRHGMFTRGPAQVGNNTLKSNPALFIWMD  360

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR LLKE TF AELELW++IINE+KLNVSPGCSFHC E GWFRVCFANMDDETMR+AL R
Sbjct  361   LRRLLKELTFEAELELWRIIINEVKLNVSPGCSFHCSEPGWFRVCFANMDDETMRIALRR  420

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMISSPHSPMNSPLVQA  1641
             I   V+Q KG+E        K+ QCRR+ L++SLSFR+ L+D M +SPHSPM+SPLVQA
Sbjct  421   INNFVIQRKGIE-----GGVKKLQCRRSKLEISLSFRK-LDDFM-NSPHSPMSSPLVQA  472



>ref|NP_001275367.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum tuberosum]
 dbj|BAB16433.1| ACC synthase [Solanum tuberosum]
Length=486

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/491 (74%), Positives = 418/491 (85%), Gaps = 8/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L S     ++LSKIATNDGHGENSAYFDGWKAY+N+PFHP  NP GVIQMGLAENQLC
Sbjct  1     MGLVSENYNKKLLSKIATNDGHGENSAYFDGWKAYENDPFHPTQNPHGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W++NNPKASICT +G ++F+DIAI+QDYHGLPEFR AVARFMEKVRGD V FDP
Sbjct  61    FDLIQEWIVNNPKASICTYEGVQDFQDIAIFQDYHGLPEFRKAVARFMEKVRGDRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +RIVMSGGATGAHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+F
Sbjct  121   ERIVMSGGATGAHESLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             KVT+ ALE AYKKAQE NI+VKGLLINNPSNPLGT+LD++TL DI+RF+NDKNIHLVCDE
Sbjct  181   KVTKEALEEAYKKAQESNIKVKGLLINNPSNPLGTILDKETLKDILRFINDKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAAT FSQP FISI++++ E V CN D +HIVYSLSKDLGFPGFRVGIIYSYND VV+ 
Sbjct  241   IYAATAFSQPSFISISEVMSEVVGCNDDLVHIVYSLSKDLGFPGFRVGIIYSYNDVVVNI  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVSTQTQ LIA+MLSD  FVENFI +S+ +L +RH+ FT+GL QVGI TLKS
Sbjct  301   ARKMSSFGLVSTQTQRLIASMLSDTIFVENFIAKSAMKLSQRHDLFTKGLGQVGITTLKS  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             N GLF+WM+LR  L++ TF  EL+LW +IIN++KLNVSPGCSFHC E GWFRVCFANMDD
Sbjct  361   NAGLFIWMDLRRFLEKSTFDDELKLWHIIINKVKLNVSPGCSFHCSEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSV-LQ-WKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHS  1614
              TM+VAL RIR  V LQ  KG+E A      +    R  L++SLSFRR L+D M +SPHS
Sbjct  421   ATMQVALKRIRHFVYLQPSKGVEVATKKQYCRT---RSKLEISLSFRR-LDDFM-NSPHS  475

Query  1615  PMNSPLVQATN  1647
             PM+SP+VQA N
Sbjct  476   PMSSPMVQARN  486



>emb|CDP12072.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/492 (73%), Positives = 412/492 (84%), Gaps = 9/492 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M+     +Q Q+LSK+ATNDGHGENS YFDGWKAYD++P+HP  NP GVIQMGLAENQLC
Sbjct  1     MEFSLKNEQQQLLSKMATNDGHGENSPYFDGWKAYDSDPYHPTRNPNGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ WVLNNP+ASICT +GA +F ++AIYQDYHGLPEFR AVARFMEKVRG+ VKFDP
Sbjct  61    FDLIEEWVLNNPEASICTAEGANKFMEVAIYQDYHGLPEFRNAVARFMEKVRGERVKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +RIVMSGGATGAHE LAFCL DP +AFLVPTPYYPGFDRDLRWRTG+QL P+VC SSNDF
Sbjct  121   NRIVMSGGATGAHETLAFCLADPEDAFLVPTPYYPGFDRDLRWRTGIQLLPIVCHSSNDF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             KVT+ ++E+AY+KAQE NIRVKG L+NNPSNPLGTVLDR+TL DIV F+NDKNIHL+CDE
Sbjct  181   KVTKESMEAAYQKAQEANIRVKGFLLNNPSNPLGTVLDRETLIDIVTFINDKNIHLICDE  240

Query  904   IYAATVFSQPEFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IY+ATVFSQPEFISI++II+ +VQCN D IH+VYSLSKDLGFPGFRVGI+YSYNDAVVSC
Sbjct  241   IYSATVFSQPEFISISEIIEHDVQCNRDLIHLVYSLSKDLGFPGFRVGILYSYNDAVVSC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVSTQTQHLIA+MLSD+ F +  I  SSERL  RH  FTRGLAQVGI TLKS
Sbjct  301   ARKMSSFGLVSTQTQHLIASMLSDETFTDKIISTSSERLAARHGLFTRGLAQVGIGTLKS  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             + GL+ WM+LR LL+E TF AE+ELW++II+E+KLNVSPG SFHC E GWFRVCFANMDD
Sbjct  361   SAGLYFWMDLRRLLRESTFEAEMELWRIIIHEVKLNVSPGLSFHCSEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSVL-QWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS---SP  1608
             E++RVAL RI   VL Q K  E     S          L++SLSFRR  E  M S   SP
Sbjct  421   ESVRVALRRIHKFVLVQGKATEPTTPKSRCGSS----KLQLSLSFRRLDERVMGSHMMSP  476

Query  1609  HSPMNSPLVQAT  1644
             HSPM SPLV+AT
Sbjct  477   HSPMASPLVRAT  488



>gb|AAB70885.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
 gb|ABQ51844.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=489

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/493 (73%), Positives = 417/493 (85%), Gaps = 11/493 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             +++ S   Q  +LSK+AT DGHGENS YFDGWKAYDNNPFH   NPQGVIQMGLAENQL 
Sbjct  2     VNMSSTTNQRTLLSKMATGDGHGENSPYFDGWKAYDNNPFHLTQNPQGVIQMGLAENQLS  61

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             F+LI+ WVLNNP+ASICT QG +EFKD AI+QDYHGLPEFR AVA FM KVRG+ V F+P
Sbjct  62    FELIEQWVLNNPQASICTAQGLQEFKDTAIFQDYHGLPEFRYAVANFMGKVRGNRVTFNP  121

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE++AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVCES N+F
Sbjct  122   DRIVMSGGATGAHEMIAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLIPVVCESENNF  181

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++TR+ALE AY++AQEDNIRVKGLLI NPSNPLGT+LDR+TL  +V F+N+KNIHLVCDE
Sbjct  182   RITRSALEEAYERAQEDNIRVKGLLITNPSNPLGTILDRETLVSLVSFINEKNIHLVCDE  241

Query  904   IYAATVFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             IYAATVFSQP F+SIA++I++  V CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVV+
Sbjct  242   IYAATVFSQPAFVSIAEVIEQENVSCNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVN  301

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
             CARKMSSFGLVSTQTQHLIA+MLSD EFV+ FI+ES++RL +R+ +FTRGLAQV I  LK
Sbjct  302   CARKMSSFGLVSTQTQHLIASMLSDDEFVDTFIVESAKRLARRYTTFTRGLAQVNIGCLK  361

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SNGGLF+WM+LR LLKE TF AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMD
Sbjct  362   SNGGLFIWMDLRRLLKEKTFEAEMALWRVIINEVKLNVSPGASFHCSEPGWFRVCFANMD  421

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRN--LKVSLSFRRGLEDCMIS--S  1605
             D TM+VAL RI T  LQ K     AA     ++QC +N   ++SLSFRR  +D  +S  S
Sbjct  422   DLTMQVALRRIITFALQNK----EAAVLPAIKRQCWQNNLGRLSLSFRR-FDDFTMSPMS  476

Query  1606  PHSPMNSPLVQAT  1644
             PHSP+ SPLV+AT
Sbjct  477   PHSPIQSPLVRAT  489



>ref|NP_001234164.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAK72433.1|AF179249_1 1-aminocyclopropane-1-carboxylate synthase 6 [Solanum lycopersicum]
 gb|AAQ17610.1|AF167428_1 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/480 (74%), Positives = 408/480 (85%), Gaps = 8/480 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ++SKIATNDGHGENSAYFDGWKAY+N+PFHP  NP GVIQMGLAENQLCFDLI+ W++NN
Sbjct  3     LISKIATNDGHGENSAYFDGWKAYENDPFHPTQNPNGVIQMGLAENQLCFDLIQEWIVNN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT +G ++F+D AI+QDYHGLPEFR AVARFMEKVRGD V+FDP+RIVMSGGATG
Sbjct  63    PKASICTYEGVQDFQDTAIFQDYHGLPEFRKAVARFMEKVRGDRVRFDPERIVMSGGATG  122

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALE AY
Sbjct  123   AHESLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALEEAY  182

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KAQE NI+VKGLLINNPSNPLGT+LD++TL DI+RF+NDKNIHLVCDEIYAAT FSQP 
Sbjct  183   SKAQESNIKVKGLLINNPSNPLGTILDKETLKDILRFINDKNIHLVCDEIYAATAFSQPS  242

Query  937   FISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISI+++  E V CN D +HIVYSLSKDLGFPGFRVGIIYSYNDAVV+ ARKMSSFGLVS
Sbjct  243   FISISEVKSEVVGCNDDLVHIVYSLSKDLGFPGFRVGIIYSYNDAVVNIARKMSSFGLVS  302

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             TQTQ LIA+ML D  FVE+FI +SS RL +RH  FT+GL QVGI TLKSN GLF+WM+LR
Sbjct  303   TQTQRLIASMLLDTIFVEDFIAKSSMRLLQRHGLFTKGLGQVGITTLKSNAGLFIWMDLR  362

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
               L+  TF  EL+LW +II+++KLNVSPGCSFHC E GWFRVCFANMDD TM++AL RIR
Sbjct  363   RFLENSTFDDELKLWHIIIDKVKLNVSPGCSFHCSEPGWFRVCFANMDDATMKIALRRIR  422

Query  1474  TSVLQW--KGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQATN  1647
               V     KG+E A      +    R  L++SLSFRR L+D M +SPHSPM+SP+VQA N
Sbjct  423   HFVYLQPNKGVEVATKKQYCRT---RSKLEISLSFRR-LDDFM-NSPHSPMSSPMVQARN  477



>dbj|BAA34923.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/480 (74%), Positives = 408/480 (85%), Gaps = 8/480 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ++SKIATNDGHGENSAYFDGWKAY+N+PFHP  NP GVIQMGLAENQLCFDLI+ W++NN
Sbjct  3     LISKIATNDGHGENSAYFDGWKAYENDPFHPTQNPNGVIQMGLAENQLCFDLIQEWIVNN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT +G ++F+D AI+QDYHGLPEFR AVARFMEKVRGD V+FDP+RIVMSGGATG
Sbjct  63    PKASICTYEGVQDFQDTAIFQDYHGLPEFRKAVARFMEKVRGDRVRFDPERIVMSGGATG  122

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALE AY
Sbjct  123   AHESLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALEEAY  182

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KAQE NI+VKGLLINNPSNPLGT+LD++TL DI+RF+NDKNIHLVCDEIYAAT FSQP 
Sbjct  183   SKAQESNIKVKGLLINNPSNPLGTILDKETLKDILRFINDKNIHLVCDEIYAATAFSQPS  242

Query  937   FISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISI+++  E V CN D +HIVYSLSKDLGFPGFRVGIIYSYNDAVV+ ARKMSSFGLVS
Sbjct  243   FISISEVKSEVVGCNDDLVHIVYSLSKDLGFPGFRVGIIYSYNDAVVNIARKMSSFGLVS  302

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             TQTQ LIA+ML D  FVE+FI +SS RL ++H  FT+GL QVGI TLKSN GLF+WM+LR
Sbjct  303   TQTQRLIASMLLDTIFVEDFIAKSSMRLLQKHGLFTKGLGQVGITTLKSNAGLFIWMDLR  362

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
               L+  TF  EL+LW +II+++KLNVSPGCSFHC E GWFRVCFANMDD TM++AL RIR
Sbjct  363   RFLENSTFDDELKLWHIIIDKVKLNVSPGCSFHCSEPGWFRVCFANMDDATMKIALRRIR  422

Query  1474  TSVLQW--KGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQATN  1647
               V     KG+E A      +    R  L++SLSFRR L+D M +SPHSPM+SP+VQA N
Sbjct  423   HFVYLQPNKGVEVATKKQYCRT---RSKLEISLSFRR-LDDFM-NSPHSPMSSPMVQARN  477



>gb|ACX71871.1| ACC synthase 1 [Lithospermum erythrorhizon]
Length=480

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/485 (73%), Positives = 406/485 (84%), Gaps = 15/485 (3%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             ++Q Q+LS+IATNDGHGENS YFDGWKAYD++P+HP +NP GVIQMGLAENQL FDLI+ 
Sbjct  5     KKQHQLLSRIATNDGHGENSPYFDGWKAYDSDPYHPTNNPNGVIQMGLAENQLSFDLIQE  64

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WV+ NP ASICT +G  +FKDIAI+QDYHGLP+FR AVARFMEKVRGD V FDPDRIVMS
Sbjct  65    WVVKNPTASICTAEGVSDFKDIAIFQDYHGLPKFRQAVARFMEKVRGDKVSFDPDRIVMS  124

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGA E LA+CL DPGEAFLVPTPYYP FDRDLRWRTGVQL P+VCESSNDFK+TR A
Sbjct  125   GGATGAQETLAYCLADPGEAFLVPTPYYPAFDRDLRWRTGVQLLPIVCESSNDFKLTREA  184

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             +E+AY KAQE NIRVKGLL+NNPSNPLGTV+DR+TL +   F+ +KNIHLVCDEIYAATV
Sbjct  185   METAYDKAQESNIRVKGLLLNNPSNPLGTVMDRETLQEAANFITEKNIHLVCDEIYAATV  244

Query  922   FSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             FSQP FISIA+I+QE  ++ NP+ +HIVYSLSKDLGFPGFRVGI+YSYND+VV+CARKMS
Sbjct  245   FSQPGFISIAEIVQESSMKINPELVHIVYSLSKDLGFPGFRVGILYSYNDSVVNCARKMS  304

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ LIA MLSD+ FVE FI ESSERL KR+  FTRGL+QVGI +L SN GL+
Sbjct  305   SFGLVSTQTQQLIATMLSDEIFVEKFIAESSERLSKRYNYFTRGLSQVGIGSLNSNAGLY  364

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLKE T   E+ELW++IINE+KLNVS G SFHC E GWFRVCFANM+DET+RV
Sbjct  365   FWMDLRRLLKEQTTDGEMELWRVIINEVKLNVSSGSSFHCSEPGWFRVCFANMNDETVRV  424

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRR--NLKVSLSFRRGLEDCM--ISSPHSPMN  1623
             AL RIR  VLQ K            +KQCRR   L++SLSFRR  +  M  + SPHSPM+
Sbjct  425   ALRRIRNFVLQDKS---------AAKKQCRRRSKLEISLSFRRRDDIIMGNVMSPHSPMS  475

Query  1624  SPLVQ  1638
             SPLVQ
Sbjct  476   SPLVQ  480



>dbj|BAA25916.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/480 (74%), Positives = 408/480 (85%), Gaps = 8/480 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ++SKIATNDGHGENSAYFDGWKAY+N+PFHP  NP GVIQMGLAENQLCFDLI+ W++NN
Sbjct  3     LISKIATNDGHGENSAYFDGWKAYENDPFHPTQNPNGVIQMGLAENQLCFDLIQEWIVNN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT +G ++F+D AI+QDYHGLPEFR AVARFMEKVRGD V+FDP+RIVMSGGATG
Sbjct  63    PKASICTYEGVQDFQDTAIFQDYHGLPEFRKAVARFMEKVRGDRVRFDPERIVMSGGATG  122

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+PVVCESSN+FKVT+ ALE AY
Sbjct  123   AHESLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFPVVCESSNNFKVTKEALEEAY  182

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KAQE NI+VKGLLINNPSNPLGT+LD++TL DI+RF+NDKNIHLVCDEIYAAT FSQP 
Sbjct  183   SKAQESNIKVKGLLINNPSNPLGTILDKETLKDILRFINDKNIHLVCDEIYAATAFSQPS  242

Query  937   FISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISI+++  E V CN D +HIVYSLSKDLGFPGFRVGIIYSYNDAVV+ ARKMSSFGLVS
Sbjct  243   FISISEVKSEVVGCNDDLVHIVYSLSKDLGFPGFRVGIIYSYNDAVVNIARKMSSFGLVS  302

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             TQTQ LIA+ML D  FVE+FI +SS RL +R+  FT+GL QVGI TLKSN GLF+WM+LR
Sbjct  303   TQTQRLIASMLLDTIFVEDFIAKSSMRLLQRYGLFTKGLGQVGITTLKSNAGLFIWMDLR  362

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
               L+  TF  EL+LW +II+++KLNVSPGCSFHC E GWFRVCFANMDD TM++AL RIR
Sbjct  363   RFLENSTFDDELKLWHIIIDKVKLNVSPGCSFHCSEPGWFRVCFANMDDATMKIALRRIR  422

Query  1474  TSVLQW--KGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLVQATN  1647
               V     KG+E A      +    R  L++SLSFRR L+D M +SPHSPM+SP+VQA N
Sbjct  423   HFVYLQPNKGVEVATKKQYCRT---RSKLEISLSFRR-LDDFM-NSPHSPMSSPMVQARN  477



>ref|XP_002278489.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Vitis 
vinifera]
 emb|CBI34388.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/482 (72%), Positives = 409/482 (85%), Gaps = 7/482 (1%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M  Q Q+LSKIAT++GHGENS YFDGWKAYD++P+HP  NP GVIQMGLAENQL FD+I+
Sbjct  4     MSNQPQLLSKIATDNGHGENSPYFDGWKAYDSDPYHPIENPGGVIQMGLAENQLSFDIIE  63

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
              W+L NPKASICT +G  EF+D+AI+QDYHGL EFR AVA+FM KVRGD V FDPDRIVM
Sbjct  64    EWLLKNPKASICTVEGMSEFRDVAIFQDYHGLKEFRNAVAKFMGKVRGDRVVFDPDRIVM  123

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGAHE++ FCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVCESSNDFK+TR 
Sbjct  124   SGGATGAHELVTFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLLPVVCESSNDFKITRE  183

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE+AY+KAQEDN +VKGLLI NPSNPLGTVLDR+TL  +V FVN+KNIHL+ DEIYAAT
Sbjct  184   ALEAAYEKAQEDNTKVKGLLITNPSNPLGTVLDRETLKSLVSFVNEKNIHLISDEIYAAT  243

Query  919   VFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             VFS P FIS+++II E++CNPD IHIVYSLSKD+GFPGFRVGI+YSYND VV+  RKMSS
Sbjct  244   VFSSPGFISVSEIIDEMECNPDLIHIVYSLSKDMGFPGFRVGIVYSYNDDVVNIGRKMSS  303

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQHLIA+MLSD EFVE+FI ++SE+L  R+++F+RGL+QVGI  LKSN GLF 
Sbjct  304   FGLVSSQTQHLIASMLSDDEFVESFITKNSEKLATRYKTFSRGLSQVGIGCLKSNAGLFF  363

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLKEPT  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMDDETM VA
Sbjct  364   WMDLRRLLKEPTVEAEMALWRLIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDETMEVA  423

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLV  1635
             L RIR  VL+ K  E      + K+++ + NLKV LSF RGL++  + SPHSP+  SPLV
Sbjct  424   LRRIRNFVLKAKEKE-----VSAKRQRWQNNLKVRLSF-RGLDEPHLMSPHSPIPQSPLV  477

Query  1636  QA  1641
             +A
Sbjct  478   RA  479



>ref|XP_011073274.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Sesamum 
indicum]
Length=481

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/483 (74%), Positives = 403/483 (83%), Gaps = 10/483 (2%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             +R +  +LSKIATNDGHGENSAYFDGWKAYD +P+HP  NP GVIQMGLAENQL FDL++
Sbjct  5     LRNEENLLSKIATNDGHGENSAYFDGWKAYDADPYHPTKNPNGVIQMGLAENQLAFDLVQ  64

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
              WV NNPKASICT +G ++FKDIAIYQDYHGLPEFR AVARFM +VRG+ V+FDPDRIVM
Sbjct  65    EWVRNNPKASICTAEGVDDFKDIAIYQDYHGLPEFRNAVARFMGRVRGNRVRFDPDRIVM  124

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGA E LAFCL DPG+AFLVPTPYYPG DRDL WRTGV+L  VVCESSNDFK+TR 
Sbjct  125   SGGATGAQETLAFCLADPGDAFLVPTPYYPGNDRDLTWRTGVRLLHVVCESSNDFKITRH  184

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALESAY KAQE NIRVKGLL+NNPSNPLGTVLDR+ L D + F NDKNIHL+CDEIY+AT
Sbjct  185   ALESAYNKAQEANIRVKGLLLNNPSNPLGTVLDREALTDSLAFTNDKNIHLICDEIYSAT  244

Query  919   VFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             VFSQP+FISIA+I QE V C  D IHIVYSLSKDLGFPGFRVG++YSYND VV+CARKMS
Sbjct  245   VFSQPDFISIAEIAQENVNCRRDMIHIVYSLSKDLGFPGFRVGVVYSYNDTVVNCARKMS  304

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ LIA MLSD  FV+ F+ ES +RL  RH   +RGLAQVGI +L SN GL+
Sbjct  305   SFGLVSTQTQRLIALMLSDDVFVDKFLSESVKRLGTRHGFLSRGLAQVGIGSLNSNAGLY  364

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLKEPTF AE+ELW++IINE+KLNVSPG SFHC E GWFRVCFANMDDETMRV
Sbjct  365   CWMDLRRLLKEPTFEAEMELWRVIINEVKLNVSPGASFHCSEPGWFRVCFANMDDETMRV  424

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMISSPHSPMNSPL  1632
             AL RI   V Q KG E      A  ++QCRR+ L++SLSFRR   D ++S  HSPM+SP+
Sbjct  425   ALGRIHKFVAQKKGGE------ASSRRQCRRSKLEISLSFRR--LDEIMSPHHSPMSSPM  476

Query  1633  VQA  1641
             V+A
Sbjct  477   VRA  479



>ref|XP_011080907.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Sesamum 
indicum]
Length=485

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/484 (73%), Positives = 402/484 (83%), Gaps = 11/484 (2%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             Q Q+LS+IATNDGHGENSA+FDGWKAYD++P+HP  NP GVIQMGLAENQL FDL++ WV
Sbjct  5     QVQLLSQIATNDGHGENSAFFDGWKAYDSDPYHPTRNPSGVIQMGLAENQLSFDLVQEWV  64

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
              NNPKASICT +G+  FKDIAIYQDYHGLPEFR AVARFMEKVRG+ V+FDPDRIVMSGG
Sbjct  65    RNNPKASICTAEGSNGFKDIAIYQDYHGLPEFRNAVARFMEKVRGNRVRFDPDRIVMSGG  124

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGA E LAFCL D G+AFLVPTPYYPG DRDL WRTG+QL PVVCESSNDFK+TR ALE
Sbjct  125   ATGAQETLAFCLADAGDAFLVPTPYYPGNDRDLTWRTGIQLLPVVCESSNDFKITRRALE  184

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
             +AYK AQE NI+VKGLL+NNPSNPLGTV+DR+TL D + F N+KNIHL+CDEIY+ATVFS
Sbjct  185   TAYKNAQESNIKVKGLLLNNPSNPLGTVIDRETLTDSLLFTNEKNIHLICDEIYSATVFS  244

Query  928   QPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
             QP F SIA+I+QE   CN + IHIVYSLSKDLGFPGFRVGI+YSYND VV+CARKMSSFG
Sbjct  245   QPGFTSIAEIVQENTDCNRNLIHIVYSLSKDLGFPGFRVGIVYSYNDIVVNCARKMSSFG  304

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVSTQTQHLIA MLSD  FV+ FI ESS+RL  RH   + GLAQVGI +LKSN GL+ WM
Sbjct  305   LVSTQTQHLIATMLSDDVFVDRFIAESSKRLEIRHGILSAGLAQVGIGSLKSNAGLYCWM  364

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR LLKEPTF AELELW++IIN++KLNVSPG SFHC E GWFRVCFANMD ETM VAL 
Sbjct  365   DLRRLLKEPTFEAELELWQVIINDVKLNVSPGASFHCSEPGWFRVCFANMDGETMMVALN  424

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGLEDCMIS----SPHSPMNSP  1629
             RI   V Q KG +         +KQCR + L++SLSFRR  E  M +    SPHSPM+SP
Sbjct  425   RIHKFVTQKKGSD-----QESGRKQCRSSKLEISLSFRRLDEMKMAAPHKMSPHSPMSSP  479

Query  1630  LVQA  1641
             LV+A
Sbjct  480   LVRA  483



>ref|XP_009363394.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=487

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/489 (72%), Positives = 404/489 (83%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQ+CFDLI
Sbjct  4     TLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM KVRG+ V F+ DRIV
Sbjct  64    QEWILNNPEASICTEAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVTFEADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHEMIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ  NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQIANIRVKGLLITNPSNPLGTVLDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP FISIA+II+E + CN + +HIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEENIGCNRNLVHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE FI +S++RL+ RH  FT GLAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFIAQSAKRLKTRHMRFTMGLAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW+ II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRG----LEDCMISSPHSPM  1620
             VAL RIRT VLQ    +  A    K  +  +RNL++S   RR     +  CM+ SPH+P+
Sbjct  424   VALTRIRTFVLQ----DKEAIEPRKSNRSWQRNLRLSFQSRRTDDNMMSPCMM-SPHTPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>ref|XP_009343873.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Pyrus 
x bretschneideri]
Length=487

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/489 (72%), Positives = 403/489 (82%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQ+CFDLI
Sbjct  4     TLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM KVRG+ V F+ DRIV
Sbjct  64    QEWILNNPEASICTEAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVTFEADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHEMIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ  NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQIANIRVKGLLITNPSNPLGTVLDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP FISIA+II+E + CN + IHIVYSLSKD+GFPGFRVGI+YSYND VV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEENIGCNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDTVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE FI +S++RL+ RH  FT GLAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFIAQSAKRLKTRHMRFTMGLAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW+ II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRG----LEDCMISSPHSPM  1620
             +AL RIRT VLQ    +  A    K  +  +RNL++S   RR     +  CM+ SPH+P+
Sbjct  424   IALTRIRTFVLQ----DKEAIVPRKSNRSWQRNLRLSFQSRRTDDNMMSPCMM-SPHTPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>ref|NP_001280870.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
 dbj|BAA92351.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
Length=487

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/489 (72%), Positives = 404/489 (83%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQ+CFDLI
Sbjct  4     TLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM KVRG+ V FD DRIV
Sbjct  64    QEWILNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVTFDADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHEMIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLISLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP FISIA+II+E + CN + IHIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEENIGCNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFV+ FI +S++RL+ RH  FT GLAQV    LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVKRFIAQSAKRLKTRHMRFTMGLAQVSTNCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW+ II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             VAL RIRT VLQ K     A    K  +    NL++S   RR ++D M+S    SPH+P+
Sbjct  424   VALTRIRTFVLQNK----EAIVPRKSNRLWHSNLRLSFQSRR-MDDTMMSPCMMSPHTPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>dbj|BAB89350.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki]
Length=486

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/491 (71%), Positives = 402/491 (82%), Gaps = 12/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S   Q  +LSKIAT+ GHGENS+YFDGWKAYD++P+HP  NP GVIQMGLAENQLC
Sbjct  1     MGFVSSNNQQHLLSKIATDGGHGENSSYFDGWKAYDSDPYHPTGNPDGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ WV+NNPKASICT +GA +F D AI+QDYHGLPEFR  VA FM KVRGD V+FDP
Sbjct  61    FDLIEEWVVNNPKASICTAEGAGDFMDTAIFQDYHGLPEFREGVANFMAKVRGDRVRFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE+L FCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PV CESSN F
Sbjct  121   DRIVMSGGATGAHEMLVFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVPCESSNHF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T  ALE+A+++A++ NIRVKGLLI NPSNPLGT+L + T+ DI+ F+   NIHLV DE
Sbjct  181   KITGEALEAAFRRAKDANIRVKGLLITNPSNPLGTILGKSTMRDILSFITRNNIHLVLDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQ----CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAV  1071
             IYAATVFSQP F SIA+I+++ +     N D IHIVYSLSKDLGFPGFRVGI+YSYNDAV
Sbjct  241   IYAATVFSQPRFTSIAEIVEKERGSNSINTDLIHIVYSLSKDLGFPGFRVGIVYSYNDAV  300

Query  1072  VSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIET  1251
              SCARKMSSFGLVSTQTQHL+AAMLSD +FV  FI ES +RL KRHE FT+GLAQVGI +
Sbjct  301   TSCARKMSSFGLVSTQTQHLLAAMLSDNDFVGKFIAESGKRLAKRHEDFTKGLAQVGIGS  360

Query  1252  LKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFAN  1431
             L+SN GLF WM+LR LLKEPT  AEL LWK+I++E+KLNVSPG SFHC E GWFRVCFAN
Sbjct  361   LESNAGLFFWMDLRRLLKEPTPEAELALWKVIVHEVKLNVSPGVSFHCSEPGWFRVCFAN  420

Query  1432  MDDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSP  1608
             MDD+TMRVAL RIR+ V + K ME         ++QC R NL+++LSFRR  +D  + SP
Sbjct  421   MDDDTMRVALRRIRSFVAKRKAME------GPAKRQCWRSNLRINLSFRRK-DDIAMMSP  473

Query  1609  HSPMNSPLVQA  1641
             HSP+ SPLV+A
Sbjct  474   HSPLTSPLVRA  484



>gb|ACT54524.2| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
 gb|ACZ63266.1| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
Length=487

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/489 (72%), Positives = 404/489 (83%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQ+CFDLI
Sbjct  4     TLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENQMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+LNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM KVRG+ V FD DRIV
Sbjct  64    QEWILNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVTFDADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FK TR
Sbjct  124   MSGGATGAHEMIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKFTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVF+Q  FISIA+II+E + CN + IHIVYSLSKD+GFPGFRVGIIYSYNDAVV+CARKM
Sbjct  244   TVFNQSSFISIAEIIEENIGCNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFV+ FI +S++RL+ RH  FT GLAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVKRFIAQSAKRLKTRHMRFTMGLAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLK+ TF AE+ LW+ II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKDQTFEAEMVLWRTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             VAL RIRT VLQ    +  A    K  +  + NL++S   RR ++D M+S    SPH+P+
Sbjct  424   VALTRIRTFVLQ----DKEAIVPRKSNRLWQSNLRLSFQSRR-MDDNMMSPCMMSPHTPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>gb|ABQ51840.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=490

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/494 (71%), Positives = 410/494 (83%), Gaps = 12/494 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             +++ S   Q  +LSK+AT DGHGENS YFDGWKAYDNNPFH   NPQGVIQMGLAENQL 
Sbjct  2     VNMSSTTNQRTLLSKMATGDGHGENSPYFDGWKAYDNNPFHLTQNPQGVIQMGLAENQLS  61

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             F+LI+ WVLNNP+ASICT QG +EFKD AI+QDYHGL       A FM KVRG+ V F+P
Sbjct  62    FELIEQWVLNNPQASICTAQGLQEFKDTAIFQDYHGLQSSDMLFANFMGKVRGNRVTFNP  121

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVV-CESSND  720
             DRIVMSGGATGAHE++AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVV CES N+
Sbjct  122   DRIVMSGGATGAHEMIAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLIPVVVCESENN  181

Query  721   FKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCD  900
             F++TR+ALE AY++AQED IRVKGLLI NPSNPLGT+LDR+TL  +V F+N+KNIHLVCD
Sbjct  182   FRITRSALEEAYERAQEDKIRVKGLLITNPSNPLGTILDRETLVSLVSFINEKNIHLVCD  241

Query  901   EIYAATVFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             EIYAATVFSQP F+SIA++I++  V CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVV
Sbjct  242   EIYAATVFSQPAFVSIAEVIEQENVSCNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVV  301

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQHLIA+MLSD EFV+ FI+ES++RL +R+ +FTRGLAQV I  L
Sbjct  302   NCARKMSSFGLVSTQTQHLIASMLSDDEFVDTFIVESAKRLARRYTTFTRGLAQVNIGCL  361

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
             KSNGGLF+WM+LR LLKE TF AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANM
Sbjct  362   KSNGGLFIWMDLRRLLKEKTFEAEMALWRVIINEVKLNVSPGASFHCSEPGWFRVCFANM  421

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRN--LKVSLSFRRGLEDCMIS--  1602
             DD TM+VAL RI T  LQ K     AA     ++QC +N   ++SLSFRR  +D  +S  
Sbjct  422   DDLTMQVALRRIITFALQNK----EAAVLPAIKRQCWQNNLGRLSLSFRR-FDDFTMSPM  476

Query  1603  SPHSPMNSPLVQAT  1644
             SPHSP+ SPLV+AT
Sbjct  477   SPHSPIQSPLVRAT  490



>ref|XP_006360739.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
tuberosum]
Length=485

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/431 (76%), Positives = 379/431 (88%), Gaps = 2/431 (0%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+ATN+GHGENSAYFDGWKAY+ +PFHP  NP GVIQMGLAENQLCFDLI+ WV+N
Sbjct  10    ELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTQNPNGVIQMGLAENQLCFDLIQEWVVN  69

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             N K+SICT  G EEFK+IAIYQDYHGLPEFR AVARFMEKVRGD +KFD +RIVMSGGAT
Sbjct  70    NQKSSICTAGGCEEFKEIAIYQDYHGLPEFRRAVARFMEKVRGDKIKFDEERIVMSGGAT  129

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE+LAFCL DPGEAFLVPTPYYPGFDRDL WRTGVQL+P++CESSN+FKVT+ ALE A
Sbjct  130   GAHELLAFCLADPGEAFLVPTPYYPGFDRDLSWRTGVQLFPIICESSNNFKVTKKALEDA  189

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y KAQE NI +KGLL+NNPSNPLGT+LD +TL D +RF+NDKNIHLVCDEIYAATVF++P
Sbjct  190   YNKAQESNITIKGLLLNNPSNPLGTILDMETLKDTIRFINDKNIHLVCDEIYAATVFNEP  249

Query  934   EFISIAQII--QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             +FISI+++I  + VQCN D IHIVYSLSKDLGFPGFRVGIIYSYND V  CARKMSSFGL
Sbjct  250   KFISISEVIISENVQCNLDLIHIVYSLSKDLGFPGFRVGIIYSYNDVVTKCARKMSSFGL  309

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ+LI+ ML D  F+E F++ES ERL KRH  FT+GL  +GI TL+SN GLF WM+
Sbjct  310   VSTQTQYLISNMLLDDTFIEKFVVESRERLEKRHGVFTKGLENIGINTLESNAGLFCWMD  369

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR+LLKE TF +E+ELW+MIIN++KLNVSPGCSFHC E GWFRVCFANMDD+TMR+AL R
Sbjct  370   LRSLLKENTFESEIELWRMIINDVKLNVSPGCSFHCCEPGWFRVCFANMDDDTMRIALRR  429

Query  1468  IRTSVLQWKGM  1500
             I   ++Q+KG+
Sbjct  430   IEIFMVQYKGI  440



>ref|XP_010089045.1| 1-aminocyclopropane-1-carboxylate synthase [Morus notabilis]
 gb|EXB37292.1| 1-aminocyclopropane-1-carboxylate synthase [Morus notabilis]
Length=486

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/482 (72%), Positives = 403/482 (84%), Gaps = 12/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIAT DGHGENS YFDGWKAYDN+PFHP +N  GVIQMGLAENQLCFDL+++W+L+
Sbjct  9     QLLSKIATGDGHGENSPYFDGWKAYDNDPFHPTNNSNGVIQMGLAENQLCFDLVQDWILD  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICTP+G +EF+DIAI+QDYHGLPEFR AVA+FM KVR D V FDPDRIVMSGGAT
Sbjct  69    NPRASICTPEGVDEFRDIAIFQDYHGLPEFREAVAKFMGKVRRDRVTFDPDRIVMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE++ FCL DPGEAFLVP PYYPGFDRDL+WRTG+QL PV CES+N FKVTR ALE A
Sbjct  129   GAHEMVTFCLADPGEAFLVPVPYYPGFDRDLKWRTGIQLIPVHCESANGFKVTRDALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+K + +NIRVKGLLI NPSNPLGT+LDR+TL  IVRF+N+K+IHLVCDEIYAATVFSQP
Sbjct  189   YEKTESENIRVKGLLITNPSNPLGTILDRETLRSIVRFINEKSIHLVCDEIYAATVFSQP  248

Query  934   EFISIAQII---QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
              F+SI++II     ++CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKMSSFG
Sbjct  249   AFVSISEIIAGDDGIKCNTDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKMSSFG  308

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQHLIAAMLSD  FV+ F+ ESS RL  RH+ FTRGLAQVGI  LKSN GLF+WM
Sbjct  309   LVSSQTQHLIAAMLSDDVFVKRFLAESSRRLGIRHKVFTRGLAQVGISCLKSNAGLFLWM  368

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +L  LLKE T  AE+ LWK+II+E+KLNVSPG SFHC E GWFRVC ANMDD TM VAL 
Sbjct  369   DLHRLLKEQTLEAEMALWKVIIHEVKLNVSPGSSFHCPEPGWFRVCIANMDDHTMEVALK  428

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRR--NLKVSLSFRRGLEDCMISSPHSPM-NSPLV  1635
             RIR+ VLQ K            +K+C +  NL++S S RR  +D +++SPHSP+ +SPLV
Sbjct  429   RIRSFVLQKK-----EPVVVPNKKKCWQDHNLRLSFSARR-FDDFLMASPHSPIPHSPLV  482

Query  1636  QA  1641
             QA
Sbjct  483   QA  484



>gb|AAL66205.1|AF386523_1 1-aminocyclopropane 1-carboxylate synthase 5 [Pyrus communis]
Length=487

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/489 (71%), Positives = 399/489 (82%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSK+AT DGHGENS YFDGWKAYD++PFHP  NP GVIQMGL EN++CFDLI
Sbjct  4     TLSNQQQLLSKMATGDGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLRENEMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVLNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AV  FM +VRG+ V FD DRIV
Sbjct  64    QEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVTNFMGRVRGNRVTFDADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+F+VTR
Sbjct  124   MSGGATGAHETIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFEVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTVLDRDTL   V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLRSSVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP FISIA+II+E + CN + IHIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEENIGCNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE FI +S++RL+ RH  FT  LAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFIAQSAKRLKTRHMRFTMELAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ELW+ II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMELWRTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             VAL RIRT VLQ    +  A    K  +  +  L  +   RR ++D M+S    SPH+P+
Sbjct  424   VALTRIRTFVLQ----DKEAIVPRKSNRLWKATLGSAFQSRR-MDDNMMSPCMMSPHTPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>gb|ABA01475.2| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
 gb|AER35094.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/479 (71%), Positives = 406/479 (85%), Gaps = 14/479 (3%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGE+S YFDGWKAY+ NPFHP   P GVIQMGLAENQLCF+ IK WV+ +P
Sbjct  4     ISKIATGNGHGEDSPYFDGWKAYETNPFHPIDRPDGVIQMGLAENQLCFNFIKKWVMEHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+C+ +G  +F++ A++QDYHG+PEFR AVA+FM KVRGD VKFDPDRIVMSGGATGA
Sbjct  64    EASLCSAEGVNKFEETALFQDYHGMPEFREAVAKFMGKVRGDRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PVVCESSN+FK+TR ALE+AY+
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVELVPVVCESSNNFKITRAALEAAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KA+E N+RVKGLLI NPSNPLGT+LDRDTL  IV+F+N+KNIHL+ DEIYAATVF +PEF
Sbjct  184   KAKEANLRVKGLLITNPSNPLGTILDRDTLKGIVKFINEKNIHLIGDEIYAATVFMEPEF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +SI++II+EV+CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVVSCARKMSSFGLVS+Q
Sbjct  244   VSISEIIEEVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVSCARKMSSFGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHLIA MLSD +FV++FI+ES E+L KRH+ FT  L+QVGI +LKSN GLF+WM+LR L
Sbjct  304   TQHLIATMLSDDDFVDSFIVESKEQLFKRHKYFTLSLSQVGIGSLKSNAGLFIWMDLRKL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE TF AE++LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD TM VAL+RI T 
Sbjct  364   LKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCDEPGWFRVCFANMDDNTMEVALLRITTF  423

Query  1480  VLQWKGMEaaaaasakkqkqCRR-NLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQA  1641
             + +          +   +K CRR +LK+SLS RR  +D M   + SPHSP+  SPLV+A
Sbjct  424   MHK-------HNEAMVPRKLCRRASLKLSLSRRR--DDFMSQNMMSPHSPIPQSPLVRA  473



>ref|XP_002509858.1| acc synthase, putative [Ricinus communis]
 gb|EEF51245.1| acc synthase, putative [Ricinus communis]
 gb|AGB96761.1| 1-aminocyclopropane-1-carboxylate synthase [Ricinus communis]
Length=480

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/480 (73%), Positives = 401/480 (84%), Gaps = 9/480 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIA  DGHGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQL FD+++ W+ N
Sbjct  8     QLLSKIAIGDGHGENSPYFDGWKAYDSDPFHPIDNPNGVIQMGLAENQLSFDVVQEWLKN  67

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICTP+GA+EFK++AI+QDYHGLPEFR AVA FM KVRGD V FDPDRIVMSGGAT
Sbjct  68    NPKASICTPEGADEFKNVAIFQDYHGLPEFRNAVANFMAKVRGDRVTFDPDRIVMSGGAT  127

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE++AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PV C+SSN FKVTR ALE+A
Sbjct  128   GAHEMIAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLIPVDCDSSNQFKVTREALENA  187

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ AQ DNI VKGLLI NPSNPLGT+LDR+TL  IV F+N+KNIHL+CDEIYAATVFSQP
Sbjct  188   YEMAQYDNINVKGLLITNPSNPLGTILDRETLRSIVGFINEKNIHLICDEIYAATVFSQP  247

Query  934   EFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             EF+SIA+II+E +C+ D IHIVYSLSKDLGFPGFRVGI+YSYNDAVV CARKMSSFGLVS
Sbjct  248   EFVSIAEIIEEEECDLDLIHIVYSLSKDLGFPGFRVGIVYSYNDAVVKCARKMSSFGLVS  307

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK-SNGGLFVWMNL  1290
             +QTQHLIA+MLSD EFVE FI+ES +RL  R+  FT+GLAQVGI  LK SN GLF+WM+L
Sbjct  308   SQTQHLIASMLSDDEFVERFIMESKKRLAARYSVFTKGLAQVGIRCLKTSNAGLFLWMDL  367

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLK+ +   E+ LW++IIN++KLNVSPG SFHC EAGWFRVCFANMDD+TM VAL RI
Sbjct  368   RRLLKDQSVEGEMALWRVIINDVKLNVSPGSSFHCTEAGWFRVCFANMDDKTMEVALSRI  427

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQATN  1647
             RT VLQ K      A    K+   + +LK+S S R  + D  I SP SP+  SPLV+A N
Sbjct  428   RTFVLQNK-----EAMKPMKKLLWQSSLKLSFSSR--IYDDFIMSPRSPIPQSPLVRARN  480



>gb|KHG06607.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=478

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/477 (72%), Positives = 401/477 (84%), Gaps = 7/477 (1%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGENS YFDGWKAY+ NPFHP   P+GVIQMGLAENQLCF+LIKNW++ +P
Sbjct  4     MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPEGVIQMGLAENQLCFNLIKNWLIKHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+CTPQG  +FK+ A++QDYHG+PEFR AVA+FM KVRGD VKFDPDRIVMSGGATGA
Sbjct  64    EASLCTPQGVNKFKETALFQDYHGMPEFRQAVAKFMGKVRGDRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDL+WRTGV+L PV CES N+FK+TR ALE+AY 
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLKWRTGVELVPVNCESYNNFKITRNALEAAYV  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQE N+RVKGLLI NPSNPLGT+LDRDTL  +VRF+NDKNIHL+ DEIYAATVF +PEF
Sbjct  184   KAQEANLRVKGLLITNPSNPLGTILDRDTLKSMVRFINDKNIHLIGDEIYAATVFMEPEF  243

Query  940   ISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             +SI++II+E  V+CN D IHIVYSLSKD+GFPGFRVGI+YSYND+VVSCARKMSSFGLVS
Sbjct  244   VSISEIIEEEDVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDSVVSCARKMSSFGLVS  303

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHLIA+MLSD EFV+NFI E+ E L KRH+ FT  L+QVGI  LK N GLF+WM+LR
Sbjct  304   SQTQHLIASMLSDGEFVDNFITENKELLFKRHKYFTWSLSQVGIGCLKGNSGLFIWMDLR  363

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLKE TFAAE+ELW++IINE+KLNVSPG SFHC+E GWFRVCFANMDD TM+VAL+RIR
Sbjct  364   KLLKEKTFAAEMELWRVIINEVKLNVSPGSSFHCEEPGWFRVCFANMDDHTMKVALLRIR  423

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             T VL+       A    K  +     L +S S  R +E   I SPHSP+  SPLV+A
Sbjct  424   TFVLK----NNEAMVPLKLCRPSSLKLSLSRSLSRRMEAPGIMSPHSPLPQSPLVRA  476



>gb|KHG22476.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=475

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/479 (70%), Positives = 404/479 (84%), Gaps = 14/479 (3%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGE+S YFDGWKAY+ NPFHP   P GVIQMGLAENQLCF+ IK WV+ +P
Sbjct  4     ISKIATGNGHGEDSPYFDGWKAYETNPFHPIDRPDGVIQMGLAENQLCFNFIKKWVMEHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+C+ +G  +FK+ A++QDYHG+PEFR AVA+FM KVRG  VKFDPDRIVMSGGATGA
Sbjct  64    EASLCSAEGVNKFKETALFQDYHGMPEFREAVAKFMGKVRGGRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PVVCESSN+FK+TR ALE+AY+
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLVPVVCESSNNFKITRAALEAAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KA+E N+RVKGLLI NPSNPLGT+LD+DTL  IV+F+N+KNIHL+ DEIYAATVF +PEF
Sbjct  184   KAKEANLRVKGLLITNPSNPLGTILDQDTLKGIVKFINEKNIHLIGDEIYAATVFMEPEF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +SI++II+EV+CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVVSCARKMSSFGLVS+Q
Sbjct  244   VSISEIIEEVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVSCARKMSSFGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHLIA MLSD +FV+ FI+ES E+L KRH+ FT  L+QVGI +LKSN GLF+WM+LR L
Sbjct  304   TQHLIAKMLSDDDFVDRFIVESKEQLLKRHKYFTLSLSQVGIGSLKSNAGLFIWMDLRKL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE TF AE++LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD TM VAL+RI T 
Sbjct  364   LKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCDEPGWFRVCFANMDDNTMEVALLRITTF  423

Query  1480  VLQWKGMEaaaaasakkqkqCRR-NLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQA  1641
             + +          +   +K CRR +LK+SLS  R ++D M   + SPHSP+  SPLV+A
Sbjct  424   MHK-------HNEAMVPRKLCRRASLKLSLS--RRMDDFMSQNMMSPHSPIPQSPLVRA  473



>gb|ABJ99502.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/479 (71%), Positives = 403/479 (84%), Gaps = 14/479 (3%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGE+S YFDGWKAY+ NPFHP   P GVIQMGLAENQLCF+ IK WV+ +P
Sbjct  4     ISKIATGNGHGEDSPYFDGWKAYETNPFHPIDRPDGVIQMGLAENQLCFNFIKKWVMEHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+C+ +G  +FK+ A++QDYHG+PEFR AVA+FM KVRG  VKFDPDRIVMSGGATGA
Sbjct  64    EASLCSAEGVNKFKETALFQDYHGMPEFREAVAKFMGKVRGGRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDL WRTGV+L PVVCESSN+FK+TR ALE+AY+
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLSWRTGVELVPVVCESSNNFKITRAALEAAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KA+E N+RVKGLLI NPSNPLGT+LD+DTL  IV+F+N+KNIHL+ DEIYAATVF +PEF
Sbjct  184   KAKEANLRVKGLLITNPSNPLGTILDQDTLKGIVKFINEKNIHLIGDEIYAATVFMEPEF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +SI++II+EV+CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVVSCARKMSSFGLVS+Q
Sbjct  244   VSISEIIEEVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVSCARKMSSFGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHLIA MLSD +FV+ FI+ES E+L KRH+ FT  L+QVGI +LKSN GLF+WM+LR L
Sbjct  304   TQHLIAKMLSDDDFVDRFIVESKEQLLKRHKYFTLSLSQVGIGSLKSNAGLFIWMDLRKL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE TF AE++LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD TM VAL+RI T 
Sbjct  364   LKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCDEPGWFRVCFANMDDNTMEVALLRITTF  423

Query  1480  VLQWKGMEaaaaasakkqkqCRR-NLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQA  1641
             + +          +   +K CRR +LK+SLS RR  +D M   I SPHSP+  SPLV+A
Sbjct  424   MHK-------HNEAMVPRKLCRRASLKLSLSRRR--DDFMSPNIMSPHSPIPQSPLVRA  473



>gb|ABC75833.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=475

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/479 (70%), Positives = 403/479 (84%), Gaps = 14/479 (3%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGE+S YFDGWKAY+ NPFHP   P GVIQMGLAENQLCF+ IK WV+ +P
Sbjct  4     ISKIATGNGHGEDSPYFDGWKAYETNPFHPIDRPDGVIQMGLAENQLCFNFIKKWVMEHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+C+ +G  +FK+ A++QDYHG+PEFR AVA+FM KVRG  VKFDPDRIVMSGGATGA
Sbjct  64    EASLCSAEGVNKFKETALFQDYHGMPEFREAVAKFMGKVRGGRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDL WRTGV+L PVVCESSN+FK+TR ALE+AY+
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLSWRTGVELVPVVCESSNNFKITRAALEAAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KA+E N+RVKGLLI NPSNPLGT+LD+DTL  IV+F+N+KNIHL+ DEIYAATVF +PEF
Sbjct  184   KAKEANLRVKGLLITNPSNPLGTILDQDTLKGIVKFINEKNIHLIGDEIYAATVFMEPEF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +SI++II+EV+CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVVSCARKMSSFGLVS+Q
Sbjct  244   VSISEIIEEVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVSCARKMSSFGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHLIA MLSD +FV+ FI+ES E+L KRH+ FT  L+QVGI +LKSN GLF+WM+LR L
Sbjct  304   TQHLIAKMLSDDDFVDRFIVESKEQLLKRHKYFTLSLSQVGIGSLKSNAGLFIWMDLRKL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE TF AE++LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD TM VAL+RI T 
Sbjct  364   LKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCDEPGWFRVCFANMDDNTMEVALLRITTF  423

Query  1480  VLQWKGMEaaaaasakkqkqCRR-NLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQA  1641
             + +          +   +K CRR +LK+SLS RR  +D M   + SPHSP+  SPLV+A
Sbjct  424   MHK-------HNEAMVPRKLCRRASLKLSLSRRR--DDFMSPNMMSPHSPIPQSPLVRA  473



>gb|ABM88785.1| 1-aminocyclopropane-1-carboxylate synthase [Camellia sinensis]
Length=477

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/483 (70%), Positives = 401/483 (83%), Gaps = 18/483 (4%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK ATN+ HGENS YFDGWKAYDN+PFHP  NP G+ +  L +N+LCFDLIK W
Sbjct  7     KTNSILSKFATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGLSRWVLQKNELCFDLIKEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+NNPKASICT +GA E K+IAIYQDYHGLPEFR  VA+FM KVRGD V FDPDRIVMSG
Sbjct  67    VVNNPKASICTAEGANELKNIAIYQDYHGLPEFRKGVAKFMGKVRGDRVTFDPDRIVMSG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE+LAFCL +PGEAFLVPTPYY GFDRDL+WRTGV+L PVVCESSN+FKVT++AL
Sbjct  127   GATGAHEMLAFCLANPGEAFLVPTPYYAGFDRDLKWRTGVELVPVVCESSNNFKVTKSAL  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E+A+K A+E NI++KGLLI NPSNPLGTVLDR+TL  IV F+N+KNIHLV DEIYAATVF
Sbjct  187   EAAFKGAKEANIKIKGLLITNPSNPLGTVLDRETLRIIVSFINEKNIHLVADEIYAATVF  246

Query  925   SQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
             + P+F+SIA+I++E+ CN + IHIVYSL KD+GFPGFRVGI+YSYNDAV SCAR+MSSFG
Sbjct  247   NTPQFVSIAEILEEIDCNRNLIHIVYSLPKDMGFPGFRVGIVYSYNDAVTSCARRMSSFG  306

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVSTQTQH+IA+ML D  FVE FI +S+ERL KRHE FT+GLAQVGI +LKSN GLF WM
Sbjct  307   LVSTQTQHMIASMLLDDIFVEKFIAKSAERLAKRHELFTKGLAQVGIGSLKSNAGLFFWM  366

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR LL++ TF +E+ LW++I++++KLNVSPG SFHC E GWFRVCFANMDDETMRVAL 
Sbjct  367   DLRRLLEDSTFESEMALWRVIVHDVKLNVSPGSSFHCSEPGWFRVCFANMDDETMRVALR  426

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPMNSPL  1632
             RIR+ V               K++  + NLK+SLSFRR L+D  ++    SPHSP++SPL
Sbjct  427   RIRSFV-------------TAKRQCWQSNLKLSLSFRR-LDDIGMAPHMMSPHSPISSPL  472

Query  1633  VQA  1641
             V+A
Sbjct  473   VRA  475



>dbj|BAA94599.1| 1-aminocyclopropane-1-carboxylate synthase [Populus euphratica]
Length=481

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 401/486 (83%), Gaps = 18/486 (4%)
 Frame = +1

Query  211   TQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVL  390
             + +LS+IA++DGHGE+S YFDGWKAYD++P HP  NP GVIQMGLAENQLCFDLI++W+ 
Sbjct  7     SHLLSRIASSDGHGEDSPYFDGWKAYDSDPHHPTDNPNGVIQMGLAENQLCFDLIQDWLK  66

Query  391   NNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGA  570
              NPKASIC+P+G  EF++IAI+QDYHGLPEFR AVA FMEKVRG+ V FDPDRIVMSGGA
Sbjct  67    KNPKASICSPEGLNEFREIAIFQDYHGLPEFRNAVANFMEKVRGNRVTFDPDRIVMSGGA  126

Query  571   TGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALES  750
             TGAHE +AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PV  +SSN+F VTR ALE+
Sbjct  127   TGAHETIAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLIPVDSDSSNNFMVTREALEN  186

Query  751   AYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQ  930
             AY+KAQ DNI+VKGLLI NPSNPLGT+LDR+TL  IVRF+N+KNIHLVCDEIYAATVFSQ
Sbjct  187   AYEKAQLDNIKVKGLLITNPSNPLGTILDRETLRSIVRFINEKNIHLVCDEIYAATVFSQ  246

Query  931   PEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             P+FIS+ +I+QE ++CN D +HIVYSLSKD+GFPG RVGIIYSYNDAVVSCARKMSSFGL
Sbjct  247   PDFISVRRILQEDIECNLDLVHIVYSLSKDMGFPGLRVGIIYSYNDAVVSCARKMSSFGL  306

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK-SNGGLFVWM  1284
             VSTQTQ+LIA+MLSD EFVE FI ES  RL  R+  FTRGL QVGIE LK SN GLF+WM
Sbjct  307   VSTQTQYLIASMLSDNEFVEMFIRESKRRLAARYRVFTRGLDQVGIECLKTSNAGLFLWM  366

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +L  LLK+ TF AE+ELW++II+E+KLNVSPGCSFHC + GWFRVCFANMDDETM+VAL 
Sbjct  367   DLSRLLKQQTFKAEMELWRVIIHEVKLNVSPGCSFHCLKPGWFRVCFANMDDETMQVALS  426

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRR----GLEDCMISSPHSPM-NSP  1629
             RI+T V                 K+ R+NL+   S +      + D  I+SPHSP+  SP
Sbjct  427   RIKTFV-----------NKEADTKKSRKNLRWQGSLKLLNSPRIYDDFINSPHSPIPQSP  475

Query  1630  LVQATN  1647
             LV+A N
Sbjct  476   LVRARN  481



>ref|XP_002298013.1| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE82818.1| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=481

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/489 (70%), Positives = 403/489 (82%), Gaps = 18/489 (4%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +  + +LS+IA+++GHGE+S YFDGWKAYD +P HP  NP GVIQMGLAENQLCFDLI++
Sbjct  4     KLNSHLLSRIASSNGHGEDSPYFDGWKAYDTDPHHPTDNPNGVIQMGLAENQLCFDLIQD  63

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W+  NPKASIC+P+G  EF++IAI+QDYHGLPEFR AVA FMEKVRG+ V FDPDRIVMS
Sbjct  64    WLKKNPKASICSPEGLNEFREIAIFQDYHGLPEFRNAVANFMEKVRGNRVAFDPDRIVMS  123

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PV  +SSN+F VT+ A
Sbjct  124   GGATGAHETIAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLIPVDSDSSNNFMVTKEA  183

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY+ AQ DNI+VKGLLI NPSNPLGT+LDR+TL  IVRF+N+KNIHLVCDEIYAATV
Sbjct  184   LENAYEMAQLDNIKVKGLLITNPSNPLGTILDRETLRSIVRFINEKNIHLVCDEIYAATV  243

Query  922   FSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             FSQP+FIS+A+I+QE ++CN D +HIVYSLSKD+GFPG RVGIIYSYNDAVVSCARKMSS
Sbjct  244   FSQPDFISVAEILQEDIECNLDLVHIVYSLSKDMGFPGLRVGIIYSYNDAVVSCARKMSS  303

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK-SNGGLF  1275
             FGLVSTQTQ+LIA+MLSD EFVE FI ES  RL  R+  FTRGL QVGIE LK SN GLF
Sbjct  304   FGLVSTQTQYLIASMLSDNEFVEMFIRESKSRLAARYRVFTRGLDQVGIECLKTSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             +WM+L  LLKE TF AE+ELW++II+E+KLNVSPGCSFHC + GWFRVCFANMDDETM+V
Sbjct  364   LWMDLSRLLKEQTFEAEMELWRVIIHEVKLNVSPGCSFHCLKPGWFRVCFANMDDETMQV  423

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRR----GLEDCMISSPHSPM-  1620
             AL RI+T V +  G + +           ++NL+   S +      + D  I+SPHSP+ 
Sbjct  424   ALSRIKTFVNKEAGTKKS-----------KKNLRWQGSLKLLNSPRIYDDFINSPHSPIP  472

Query  1621  NSPLVQATN  1647
              SPLV+A N
Sbjct  473   QSPLVRARN  481



>gb|AFM93771.1| ACC synthetase [Boehmeria nivea]
Length=489

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/483 (71%), Positives = 393/483 (81%), Gaps = 6/483 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             QQ Q+LSKIAT +GHGENS YFDGWKAYD++PFH  +NP GVIQMGLAENQL FDL+K+W
Sbjct  7     QQKQLLSKIATGNGHGENSPYFDGWKAYDSDPFHSANNPNGVIQMGLAENQLSFDLVKDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +L NP+ASICTP+G  EF+ IA+YQDYHGLPEFR A+A+FME VRG+ V FDPDRIVMSG
Sbjct  67    ILKNPEASICTPEGVNEFRGIALYQDYHGLPEFREAIAKFMESVRGNRVGFDPDRIVMSG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE++ FCL DPGEAF VP PYYPGFDRDLRWRTG++L PV CESSN FKVTR AL
Sbjct  127   GATGAHEMIGFCLADPGEAFPVPVPYYPGFDRDLRWRTGIELLPVACESSNGFKVTRQAL  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY+KAQ++NI+VKGLLI NPSNPLGTVLDRDTL  IV F+ND NIHLVCDEIYAATVF
Sbjct  187   EEAYEKAQKENIKVKGLLITNPSNPLGTVLDRDTLRSIVSFINDTNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
              QP F+S+A+II E  V+C+ D IHIVYSLSKDLGFPGFRVGI+YSYND VVSCAR+MSS
Sbjct  247   GQPGFVSVAEIIAEDGVECDLDLIHIVYSLSKDLGFPGFRVGIVYSYNDDVVSCARRMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ L+A+MLSD  FV  F+ ES+  L  RH +FTRGLAQVGI  LKSN GLF+
Sbjct  307   FGLVSTQTQRLVASMLSDGAFVRRFLAESARLLAARHGAFTRGLAQVGITCLKSNAGLFM  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+L  LLKE +F AE+ LW++IINE+KLNVSPG SFHC E GWFRVC ANMDD TM VA
Sbjct  367   WMDLHRLLKEQSFEAEMALWRVIINEVKLNVSPGVSFHCPEPGWFRVCIANMDDHTMEVA  426

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSL-SFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR+ V+  K  E     + KK  Q   +L++S  + R G  D  + SPHSPM  SPL
Sbjct  427   LKRIRSFVM--KNKEVVVVPNKKKCWQDHSHLRLSFPAMRGGRFDDFLMSPHSPMPQSPL  484

Query  1633  VQA  1641
             VQA
Sbjct  485   VQA  487



>gb|AER35096.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium hirsutum]
Length=456

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/425 (76%), Positives = 374/425 (88%), Gaps = 2/425 (0%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGENS YFDGWKAY+ NPFHP   P+GVIQMGLAENQLCF+LIKNW++ +P
Sbjct  4     MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPEGVIQMGLAENQLCFNLIKNWLIKHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+CTPQG  +FK+ A++QDYHG+PEFR AVA+FM KVRGD VKFDPDRIVMSGGATGA
Sbjct  64    EASLCTPQGVNKFKETALFQDYHGMPEFRQAVAKFMGKVRGDRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDL+WRTGV+L PV CES N+FK+TR ALE+AY 
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLKWRTGVELVPVNCESCNNFKITRNALEAAYV  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             K QE N+RVKGLLI NPSNPLGTVLDRDTL  +VRF+NDKNIHL+ DEIYA+TVF +PEF
Sbjct  184   KVQEANLRVKGLLITNPSNPLGTVLDRDTLKSMVRFINDKNIHLIGDEIYASTVFMEPEF  243

Query  940   ISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             +SI++II+E  V+CN D IHIVYSLSKD+GFPGFRVGI+YSYND+VVSCARKMSSFGLVS
Sbjct  244   VSISEIIEEEDVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDSVVSCARKMSSFGLVS  303

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHLIA+MLSD EFV NFI ES E L  RH+ FT  L+QVGI  LK N GLF+WM+LR
Sbjct  304   SQTQHLIASMLSDDEFVNNFITESKELLFNRHKYFTWSLSQVGIGCLKGNAGLFIWMDLR  363

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLKE TFAAE+ELW++I NE+KLNVSPG SFHCQE GWFRVCFANMDD TM+VAL+RIR
Sbjct  364   KLLKEETFAAEMELWRVITNEVKLNVSPGSSFHCQEPGWFRVCFANMDDYTMKVALLRIR  423

Query  1474  TSVLQ  1488
             T +L+
Sbjct  424   TFMLK  428



>gb|AAQ14268.1|AF248737_1 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/491 (68%), Positives = 410/491 (84%), Gaps = 12/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L+S     ++LSK+AT +GHGE+S YFDGWKAYD++PFHP  NP+GVIQMGLAENQL 
Sbjct  1     MVLQSSNNAKKLLSKLATGNGHGEDSPYFDGWKAYDSDPFHPTLNPRGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             F  ++ W+ NNP+ASICT +G +EFKD+AI+QDYHGLPEFR AVA FM KVRGD VKFDP
Sbjct  61    FGFVEKWMRNNPQASICTAEGIDEFKDVAIFQDYHGLPEFRNAVANFMGKVRGDRVKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DR+VMSGGATGAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV+CESSN+F
Sbjct  121   DRVVMSGGATGAHETVAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICESSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++TR ALE+AY++AQ+ + ++KGLLI NPSNPLGTV DR+TL   V F+NDKNIHLVCDE
Sbjct  181   RLTREALETAYEEAQKSDTKIKGLLITNPSNPLGTVYDRETLETAVAFINDKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAATVF++P F+SI+++I+ +  C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVVSC
Sbjct  241   IYAATVFAEPGFVSISEVIENDPSCDRNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVSC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVS+QTQH+IA+MLSD EFVE+F++ S+E+L  RH SFT+GLAQVGI  L+ 
Sbjct  301   ARKMSSFGLVSSQTQHMIASMLSDDEFVESFLVGSAEKLAARHRSFTKGLAQVGIGYLQG  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             +GGLF+WM+LR+LLKE T  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD
Sbjct  361   SGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRR--NLKVSLSFRRGLEDCMISSPHS  1614
             +TM +++ RIRT VLQ K      A   KK K C R  +L++ LS RR LED M  SPHS
Sbjct  421   KTMDISITRIRTFVLQNK-----EATKIKKHKFCWRQSSLELRLSSRR-LEDIM--SPHS  472

Query  1615  PM-NSPLVQAT  1644
             P+  SP+++AT
Sbjct  473   PLPQSPMLRAT  483



>gb|ABW03086.1| 1-aminocyclopropane 1-carboxylate synthase 5 [Prunus salicina]
Length=483

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/483 (70%), Positives = 392/483 (81%), Gaps = 6/483 (1%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSK+AT +GH ENS YFDGWKAYD+NPFHP  NP GVIQMGLAENQ+CFDLI
Sbjct  4     TVSNQQQLLSKMATGNGHSENSPYFDGWKAYDSNPFHPTKNPNGVIQMGLAENQVCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVL NP+ASIC   G  EFKDIAI+QDYHGLPEFR AVA FM K RG+ V FDPDRIV
Sbjct  64    EEWVLKNPEASICPAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKARGNQVTFDPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DP +AFLVP PYYPGFDRDL WRTGVQL PV CESSN FKVTR
Sbjct  124   MSGGATGAHEMIAFCLADPRDAFLVPVPYYPGFDRDLGWRTGVQLIPVACESSNSFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+DNIRVKGLLI NPSNPLGTVLDR+TL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKDNIRVKGLLITNPSNPLGTVLDRETLRSLVAFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP FISIA+II+ +++C+ + +HIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEDDIECDRNLVHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVS QTQHLIA+MLSD +FV+ FI +S++RL+ RH  FT GLAQVG   LKSNGGL
Sbjct  304   SSFGLVSAQTQHLIASMLSDNDFVDRFIAQSAKRLKARHMRFTMGLAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             F+WM+L  LLKE TF AE+ LW  II+E+KLNVSPG SFHC E GWFRVCFANMDD TM 
Sbjct  364   FLWMDLHKLLKEQTFEAEMALWHTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDMTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPL  1632
             +AL RIRT VLQ    +  A A  K  +  + +L++S   RR  +D M+S       SPL
Sbjct  424   IALTRIRTFVLQ----DKEAVAPRKNNRFWQSSLRLSFQSRRK-DDIMMSPCMMSPQSPL  478

Query  1633  VQA  1641
             V+A
Sbjct  479   VRA  481



>ref|XP_010676415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/482 (71%), Positives = 398/482 (83%), Gaps = 8/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LS+IA  +GHGE SAYF GWKAY+N+PFHP +NP GVIQMGLAENQL FD++K+WV+ 
Sbjct  4     ELLSRIAAGNGHGEESAYFHGWKAYENDPFHPVNNPSGVIQMGLAENQLSFDMVKDWVVK  63

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP ASICT +G + FKDIAI+QDYHGLP FR AVARFMEKVRG  V FDPDRIVMSGGAT
Sbjct  64    NPAASICTVEGVDHFKDIAIFQDYHGLPAFRNAVARFMEKVRGFKVTFDPDRIVMSGGAT  123

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE++AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L+PV C SSN+FKVTR ALE A
Sbjct  124   GAHELMAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVELFPVECHSSNNFKVTREALEEA  183

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             YKKA+E  I +KGLLI NPSNPLGTVLDR+TL  I+ F N+KNIHLVCDEIY ATVF  P
Sbjct  184   YKKAEEAKITIKGLLITNPSNPLGTVLDRETLTSILTFTNEKNIHLVCDEIYGATVFGYP  243

Query  934   EFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             EF+SI++II E   N D IHIVYSLSKDLGFPGFRVGI+YSYND VV+CARKMSSFGLVS
Sbjct  244   EFVSISEIILEHNYNSDLIHIVYSLSKDLGFPGFRVGIVYSYNDKVVNCARKMSSFGLVS  303

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             TQTQ LIA+MLSD++FVENF+ ESS+RL  RH  FT GL+QVGI+ LKSN GLFVWM+LR
Sbjct  304   TQTQRLIASMLSDEDFVENFLGESSKRLETRHNEFTWGLSQVGIQCLKSNAGLFVWMDLR  363

Query  1294  NLL-KEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
              L+ ++PT   EL LW++IINE+K+NVSPG SFHC EAGWFRVC ANMDD+TM++AL RI
Sbjct  364   QLIDQDPTVEGELALWRVIINEVKINVSPGSSFHCHEAGWFRVCIANMDDDTMQIALRRI  423

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM----ISSPHSPM-NSPLV  1635
             R+   Q K  +A    ++ K+K  + NL++ LS RR LED M    I SPHSP+  SPLV
Sbjct  424   RSFAAQ-KVAKAKPVVTSTKRKCWQTNLQLRLSSRR-LEDLMGVSQIGSPHSPLPTSPLV  481

Query  1636  QA  1641
             +A
Sbjct  482   RA  483



>ref|XP_004298832.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/489 (71%), Positives = 400/489 (82%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT  G  EN+ YFDGWKA+D++P+HP  NPQGVIQMGLAENQL FDLI
Sbjct  4     TLSNQQQLLSKIATGTGDSENTPYFDGWKAFDSDPYHPTTNPQGVIQMGLAENQLSFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVL NP+ASICT QGA+EFKD AI+QDYHGLPEFR AVA FM KVRG+ V F+PDRIV
Sbjct  64    QEWVLKNPEASICTAQGAKEFKDTAIFQDYHGLPEFRNAVANFMGKVRGNRVTFNPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++AFCL DPGEAF+VP PYYP FDRDLRWRTGVQL PV CESSN+FK+TR
Sbjct  124   MSGGATGANEMIAFCLADPGEAFMVPVPYYPAFDRDLRWRTGVQLLPVACESSNNFKITR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE AY+KAQ+ NIRVKGLLI NPSNPLGT+LDR+TL  +V F+N+KNIHLVCDEIYAA
Sbjct  184   AALEDAYEKAQKANIRVKGLLITNPSNPLGTILDRETLKSLVTFINEKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARK  1089
             TVF+QP FISIA+I++E  V CN D +HIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARK
Sbjct  244   TVFTQPRFISIAEILEEEDVVCNRDLVHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARK  303

Query  1090  MSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGG  1269
             MSSFGLVSTQTQ LIA+MLSD EFV+ FI+ES++RL  RH   T GL + G   LKSNGG
Sbjct  304   MSSFGLVSTQTQRLIASMLSDNEFVDRFIVESAKRLEARHTRLTEGLEEQGTTCLKSNGG  363

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             LFVWM+L   LKE TF AE+ LW+ II E+KLNVSPG SFHC + GWFRVCFANMDD+TM
Sbjct  364   LFVWMDLHKHLKEQTFEAEMALWRTIIYEVKLNVSPGVSFHCPQPGWFRVCFANMDDQTM  423

Query  1450  RVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF---RRGLEDCMISSPHSPM  1620
              VAL RIR  VLQ K    AA  + KK+K C ++ K+SLSF   RR  E  M  SPHSP+
Sbjct  424   DVALERIRNFVLQDK---EAAVVAMKKKKNCWQSKKLSLSFNNYRRFDEVNM--SPHSPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>gb|AAC98809.1| ACC synthase [Carica papaya]
Length=487

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/489 (70%), Positives = 400/489 (82%), Gaps = 15/489 (3%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M +  ++LSKIAT++GHGE+S YFDGWKAYD++PFHP  NP+GVIQMGLAENQLCF+LI 
Sbjct  4     MLRNQELLSKIATSNGHGEDSPYFDGWKAYDSDPFHPTQNPEGVIQMGLAENQLCFNLIH  63

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
              W+L NP+ASICT QGA EF+DIAI+QDYHGL EFR AVA+FM KVR +   FDPDRIVM
Sbjct  64    EWLLKNPEASICTAQGAAEFRDIAIFQDYHGLAEFREAVAKFMGKVRRNRASFDPDRIVM  123

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGAHE++AFCL DPG+AFLVPTPYYPGFDRDLRWRTGV+L PVVCESSND+++T  
Sbjct  124   SGGATGAHEMIAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVKLIPVVCESSNDYQITIE  183

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE+AY+ AQE +I+VKGLLI NPSNPLGT++ +DTL  +V F N KNIHLVCDEIYAAT
Sbjct  184   ALEAAYETAQEADIKVKGLLIPNPSNPLGTIITKDTLEALVTFTNHKNIHLVCDEIYAAT  243

Query  919   VFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             VFSQPEF SIA+II+E  + CN D IHI+YSLSKD+GFPGFRVGI+YSYNDAVVSCARKM
Sbjct  244   VFSQPEFTSIAEIIEEDKICCNRDLIHIIYSLSKDMGFPGFRVGIVYSYNDAVVSCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVS+QTQ+LIA+ML+D EFV+ FI+ES +RL  RH  FT+ LAQVGI  LKSN GL
Sbjct  304   SSFGLVSSQTQYLIASMLADDEFVDQFIVESRKRLAMRHSFFTQRLAQVGINCLKSNAGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMVLWRVIINEIKLNVSPGSSFHCSEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM-----ISSPHSP  1617
             +AL RI+T +LQ K       A   K+K C +   + LSF    ED M       SPHSP
Sbjct  424   IALSRIKTFMLQHK------EAMVPKKKLCWQT-SLRLSFSSRYEDIMETPGSFMSPHSP  476

Query  1618  M-NSPLVQA  1641
             +  SPLV+A
Sbjct  477   IPQSPLVRA  485



>ref|XP_008238953.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Prunus 
mume]
Length=483

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/483 (71%), Positives = 394/483 (82%), Gaps = 6/483 (1%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSK+AT +GHGENS YFDGWKAYD+NPFHP  NP GVIQMGLAEN+LCFDLI
Sbjct  4     TVSNQQQLLSKMATGNGHGENSPYFDGWKAYDSNPFHPTKNPNGVIQMGLAENELCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVLNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM K RG+ V FDPDRIV
Sbjct  64    EEWVLNNPEASICTVAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKARGNQVTFDPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV CESSN FKVTR
Sbjct  124   MSGGATGAHEMIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACESSNSFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+DNIRVKGLLI NPSNPLGTVLDR+TL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKDNIRVKGLLITNPSNPLGTVLDRETLRSLVAFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEF-ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP F      I ++++C+ + +HIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEEDIECDRNLVHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD +FV+ FI +S++RL+ RH  FT GLAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNDFVDRFIAQSAKRLKARHMRFTMGLAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+L  LLKE TF AE+ LW  II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLHKLLKEQTFEAEMALWHTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPL  1632
             +AL RIRT VLQ    +  A A  KK +  + NL++S   RR ++D M+S       SPL
Sbjct  424   IALTRIRTFVLQ----DKEAVAPRKKNRFWQSNLRLSFQSRR-MDDIMMSPCMMSPQSPL  478

Query  1633  VQA  1641
             V+A
Sbjct  479   VRA  481



>ref|XP_004503673.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Cicer 
arietinum]
Length=487

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/492 (69%), Positives = 408/492 (83%), Gaps = 11/492 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L SM  Q Q+LSKIAT DGHGE+S+YFDGWKAYD +PFH   NP GVIQMGLAENQL 
Sbjct  1     MGLMSM-DQPQLLSKIATGDGHGESSSYFDGWKAYDKDPFHLTKNPHGVIQMGLAENQLT  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DL++NW+++NP+ASICT +G   FK +A +QDYHGLPEFR AVA+FM + RG+ V FDP
Sbjct  60    ADLVQNWIMSNPEASICTLEGVHNFKHMANFQDYHGLPEFRNAVAKFMSRTRGNRVTFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE+ AFCL DPG+AFLVPTPYYPGFDRDLRWRTGV+L PV+CESSN+F
Sbjct  120   DRIVMSGGATGAHEVTAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVKLVPVICESSNNF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+TR ALE AY+KA+EDNIR+KGLLI NPSNPLGTV+DR TL  +V F+N K IHL+ DE
Sbjct  180   KLTRQALEEAYEKAKEDNIRIKGLLITNPSNPLGTVMDRTTLRTVVNFINQKRIHLISDE  239

Query  904   IYAATVFSQPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             IYAATVFS P FIS+A+II++   ++C+ D IHI+YSLSKD+GFPGFRVGIIYSYND+VV
Sbjct  240   IYAATVFSHPSFISVAEIIEQDTDIECDRDLIHIIYSLSKDMGFPGFRVGIIYSYNDSVV  299

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQ+L+  MLSD EFVE F+ ES++RL +R+  FT GL +VGI+ L
Sbjct  300   NCARKMSSFGLVSTQTQYLMTKMLSDDEFVERFLGESAKRLAQRYRIFTGGLVKVGIKCL  359

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
             +SNGGLFVWM+LR+LLK+PTF +ELELW++II+E+K+NVSPGCSFHC EAGWFRVC+ANM
Sbjct  360   QSNGGLFVWMDLRDLLKKPTFESELELWRVIIHEVKINVSPGCSFHCSEAGWFRVCYANM  419

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPH  1611
             DD  +++AL RIR+ VLQ K  E     S K  K C   NL++SL  RR  +D M+ SPH
Sbjct  420   DDRALQIALQRIRSFVLQ-KNKE--VMVSDKNSKPCWHSNLRLSLKSRR-FDDIMM-SPH  474

Query  1612  SPM-NSPLVQAT  1644
             SP+  SPLV+AT
Sbjct  475   SPIPQSPLVKAT  486



>dbj|BAJ65574.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus pyrifolia var. 
culta]
Length=487

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/489 (71%), Positives = 396/489 (81%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAEN++CFDLI
Sbjct  4     TLGNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVLNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM KVRG+ V FD DRIV
Sbjct  64    QEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVTFDADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHETMAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEF-ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP F      I ++++CN + IHIVYSLSKD+GFPGFRVGI+YSYND VV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEEDIECNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDDVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE FI +S++RL+ RH  FT  LAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFIAQSAKRLKARHMRFTMELAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW  II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFDAEMVLWHKIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             +AL RIR  V Q+K       A  K  +  + NL++S   RR ++D M+S    SPHSP+
Sbjct  424   IALSRIRNFVAQFK----EPIAPRKNNRYWKSNLRLSFQSRR-MDDIMMSPCMMSPHSPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>gb|ACK43795.1| 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/492 (68%), Positives = 409/492 (83%), Gaps = 12/492 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L+S     ++L+K+AT +GHGE+S YFDGWKAYD++PFHP  NP+GVIQMGLAENQL 
Sbjct  1     MVLQSSNNAKKLLAKLATGNGHGEDSPYFDGWKAYDSDPFHPTLNPRGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             F  ++ W+ NNP+ASICT +G +EFKD+AI+QDYHGLPEFR AVA FM KVRGD VKFDP
Sbjct  61    FGFVEKWMRNNPQASICTAEGIDEFKDVAIFQDYHGLPEFRNAVANFMGKVRGDRVKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DR+VMSGGATGAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV+CESSN+F
Sbjct  121   DRVVMSGGATGAHETVAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICESSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++TR ALE+AY++AQ+ + ++KGLLI NPSNPLGTV DR+TL   V F+NDKNIHLVCDE
Sbjct  181   RLTREALETAYEEAQKSDTKIKGLLITNPSNPLGTVYDRETLETAVAFINDKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAATVF++P F+SI+++I+ +  C+ + IH+VYSLSKD+GFPG RVGIIYSYNDAVVSC
Sbjct  241   IYAATVFAEPGFVSISEVIENDPSCDRNLIHVVYSLSKDMGFPGLRVGIIYSYNDAVVSC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVS+QTQH+IA+MLSD EFVE+F++ S+E+L  RH SFT+GLAQVGI  L+ 
Sbjct  301   ARKMSSFGLVSSQTQHMIASMLSDDEFVESFLVGSAEKLAARHRSFTKGLAQVGIGYLQG  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             +GGLF+WM+LR+LLKE T  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD
Sbjct  361   SGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRR--NLKVSLSFRRGLEDCMISSPHS  1614
             +TM +++ RIRT VLQ K      A   KK K C R  +L++ LS RR LED M  SPHS
Sbjct  421   KTMDISITRIRTFVLQNK-----EATKIKKHKFCWRQSSLELRLSSRR-LEDIM--SPHS  472

Query  1615  PM-NSPLVQATN  1647
             P+  SP+++AT 
Sbjct  473   PLPQSPMLRATT  484



>ref|XP_007210019.1| hypothetical protein PRUPE_ppa016458mg [Prunus persica]
 gb|EMJ11218.1| hypothetical protein PRUPE_ppa016458mg [Prunus persica]
Length=483

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/483 (70%), Positives = 391/483 (81%), Gaps = 6/483 (1%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSK+AT +GHGENS YFDGWKAYD+NPFHP  NP GVIQMGLAENQLCFDLI
Sbjct  4     TVSNQQQLLSKMATGNGHGENSPYFDGWKAYDSNPFHPTKNPNGVIQMGLAENQLCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVL NP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM K RG+ V FDPDRIV
Sbjct  64    EEWVLKNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKTRGNQVTFDPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE++AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV CESSN FKVTR
Sbjct  124   MSGGATGAHEMIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACESSNSFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+DNIRVKGLLI NPSNPLGTVLDR+TL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKDNIRVKGLLITNPSNPLGTVLDRETLRSLVAFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEF-ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP F      I ++++C+ + +HIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEEDIECDRNLVHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD +FV+ FI +S++RL+ RH   T GLAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNDFVDRFIAQSAKRLKARHMRLTMGLAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+L  LLKE TF AE+ LW  II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLHKLLKEQTFEAEMALWHTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPL  1632
             +AL RIRT VLQ    +  A A  K  +  + NL++S   RR +ED M+S       SPL
Sbjct  424   IALTRIRTFVLQ----DNEAVAPRKNNRFWQSNLRLSFQSRR-MEDIMMSPCIMSPQSPL  478

Query  1633  VQA  1641
             V+A
Sbjct  479   VRA  481



>gb|KHN16788.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=484

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/484 (68%), Positives = 404/484 (83%), Gaps = 13/484 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             QTQ+LSK+A  DGHGE S YFDGWKAYD NPFHPK NP GVIQMGLAENQL  DL+++W+
Sbjct  8     QTQLLSKMAIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWI  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM + RG+ V FDPDRIVMSGG
Sbjct  68    LNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE+  FCL DPG+AFLVP PYYPGFDRDLRWRTG++L PV+C+SSN+FK+T+ ALE
Sbjct  128   ATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALE  187

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY+KA+EDNIRVKG+LI NPSNPLGTV+DR+TL  +V F+N+K IHLV DEIY+ATVFS
Sbjct  188   DAYEKAKEDNIRVKGMLITNPSNPLGTVMDRNTLRTVVSFINEKRIHLVSDEIYSATVFS  247

Query  928   QPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             +P FISIA+I++E   ++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSS
Sbjct  248   RPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQHL+A+ML+D EFVE F+ ES++RL +RH  FT GLA+VGI+ L+SN GLFV
Sbjct  308   FGLVSTQTQHLLASMLNDDEFVERFLEESAKRLAQRHRVFTSGLAKVGIKCLQSNAGLFV  367

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK+PT  +E+ELW++II+E+K+NVSPG SFHC E GWFRVC+ANMDD  +++A
Sbjct  368   WMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIA  427

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIRT VLQ K +          +K C   NL++SL  RR  +D M+ SPHSP+  SPL
Sbjct  428   LQRIRTFVLQNKEV------MVPNKKHCWHSNLRLSLKTRR-FDDIMM-SPHSPIPQSPL  479

Query  1633  VQAT  1644
             V+AT
Sbjct  480   VKAT  483



>gb|AAM80888.1| 1-aminocyclopropane-1-carboxylate synthase [Betula pendula]
Length=485

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/482 (70%), Positives = 392/482 (81%), Gaps = 10/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
              +LSKIAT +GHGENS YFDGWKA+++NPFHP  NPQGVIQMGLAENQLCFDL++ W+L 
Sbjct  10    HLLSKIATGNGHGENSPYFDGWKAFESNPFHPTKNPQGVIQMGLAENQLCFDLVQEWILK  69

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICTP+G  +F +IA++QDYHGLPEFR AVA+FM KVRG+ V+FDPDRIVMSGGAT
Sbjct  70    NPQASICTPEGVYDFSEIAVFQDYHGLPEFRNAVAKFMAKVRGNRVRFDPDRIVMSGGAT  129

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE +AFCL DPGEAFLVPTPYYPGFDRDLRWRTGVQL PV CES N+FKVTR ALE+A
Sbjct  130   GAHETIAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVQLLPVTCESPNNFKVTRKALEAA  189

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ AQE NIRVKGLLI NPSNPLGT+LD+ TL ++V F+N+K+IHL+CDEIYAATVFSQP
Sbjct  190   YESAQEKNIRVKGLLITNPSNPLGTILDKQTLRELVSFINEKSIHLICDEIYAATVFSQP  249

Query  934   EFISIAQIIQ---EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
             +F+SI+++I+   E+ CN D IHIVYSLSKD+GFPGFRVGIIYSYNDAVV C RKMSSFG
Sbjct  250   DFVSISEVIEEEKEIACNRDLIHIVYSLSKDMGFPGFRVGIIYSYNDAVVQCCRKMSSFG  309

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQHL+A+MLSD  FV+ FI ESS+RL KR++ FT  LAQVGI  LKSN GLF+WM
Sbjct  310   LVSSQTQHLLASMLSDDVFVDRFIAESSKRLEKRYQDFTFPLAQVGINCLKSNAGLFLWM  369

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR+LLK  T  AE+ELWK+II+E+KLNVSPG SFHC E GWFRVC A       RVAL 
Sbjct  370   DLRHLLKNQTPEAEMELWKVIIDEVKLNVSPGDSFHCSEPGWFRVCLAQKGQSRRRVALT  429

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             RIRT V Q K ++               NL++S S  R   D M+ SPHSPM  SPLV+A
Sbjct  430   RIRTFVHQNKEVKNRLKRKCW-----NSNLRLSFSSLRVDHDNMM-SPHSPMAQSPLVRA  483

Query  1642  TN  1647
              N
Sbjct  484   MN  485



>ref|XP_011029354.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Populus 
euphratica]
Length=481

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/495 (69%), Positives = 400/495 (81%), Gaps = 34/495 (7%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +  + +LS+IA+++GHGE+S YFDGWKAYD +P HP  NP GVIQMGLAENQLCFDLI++
Sbjct  4     KLNSHLLSRIASSNGHGEDSPYFDGWKAYDTDPHHPTDNPNGVIQMGLAENQLCFDLIQD  63

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W+  NPKASIC+P+G  EF++ AI+QDYHGLPEFR AVA FMEKVRG+ V FDPDRIVMS
Sbjct  64    WLKKNPKASICSPEGLNEFRETAIFQDYHGLPEFRNAVANFMEKVRGNRVTFDPDRIVMS  123

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE LAFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PV  +SSN+F VTR A
Sbjct  124   GGATGAHETLAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLIPVHSDSSNNFMVTREA  183

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY++A+ DNI+VKGLLI NPSNPLGT+LDR+TL  IVRF+N+KNIHLVCDEIYAATV
Sbjct  184   LENAYERARLDNIKVKGLLITNPSNPLGTILDRETLRSIVRFINEKNIHLVCDEIYAATV  243

Query  922   FSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             FSQP+FISIA+I+QE ++CN D +HIVYSLSKD+GFPG RVGIIYSYND+VVSCARKMSS
Sbjct  244   FSQPDFISIAEILQEDIECNLDLVHIVYSLSKDMGFPGLRVGIIYSYNDSVVSCARKMSS  303

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK-SNGGLF  1275
             FGLVSTQTQ+LIA+MLSD EFVE FI ES  RL  R+  FTRGL QVGIE LK SN GLF
Sbjct  304   FGLVSTQTQYLIASMLSDSEFVEMFIRESKSRLAARYRVFTRGLHQVGIECLKTSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             +WM+L  LLKE T  AE+ELW++II+E+KLNVSPGCSFHC   GWFRVCFANMDD+TM+V
Sbjct  364   LWMDLSRLLKEQTLEAEMELWRVIIHEVKLNVSPGCSFHCLNPGWFRVCFANMDDDTMQV  423

Query  1456  ALMRIRTSV------------LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMI  1599
             AL RI+T V            L+W+G                 +LK+  S R  + D  I
Sbjct  424   ALSRIKTFVNKEVDTKKPKKNLRWQG-----------------SLKLLNSPR--IYDDFI  464

Query  1600  SSPHSPM-NSPLVQA  1641
             +SPHSP+  SPLV+A
Sbjct  465   NSPHSPIPQSPLVRA  479



>ref|NP_001275831.1| 1-aminocyclopropane-1-carboxylate synthase-like [Citrus sinensis]
 ref|XP_006439472.1| hypothetical protein CICLE_v10019920mg [Citrus clementina]
 emb|CAB60721.1| ACC synthase [Citrus sinensis]
 emb|CAB60722.1| ACC synthase [Citrus sinensis]
 gb|ESR52712.1| hypothetical protein CICLE_v10019920mg [Citrus clementina]
Length=483

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/484 (69%), Positives = 403/484 (83%), Gaps = 8/484 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIA  +GHGE+S YFDGWKA++++P+HP  NP GVIQMGLAEN LC +L+
Sbjct  4     ALSNQVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             ++W++NNPKASIC+ +G  EFK IAI+QDYHGLPEFR AVA+FM KVRG+ + FDPDRIV
Sbjct  64    EDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFMGKVRGNRITFDPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVC+SSNDFKVT 
Sbjct  124   MSGGATGAHETVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDSSNDFKVTM  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQE NIR+KG+LI NPSNPLGT LDR+TL DIV F+N+KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQESNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHLVCDEIYAA  243

Query  916   TVFS-QPEFISIAQII-QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARK  1089
             TVF+ +P F+SIA+II Q++ CN + IHIVYSLSKD+GFPGFRVGIIYSYND VVSCARK
Sbjct  244   TVFTKEPSFVSIAEIIDQDIACNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDQVVSCARK  303

Query  1090  MSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGG  1269
             MSSFGLVS+QTQHLIA MLSD +FVE FI ES++R+ +RH++FT GL+QVGI  LKSN G
Sbjct  304   MSSFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKAFTWGLSQVGIGCLKSNAG  363

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             LF+WM+L +LLKE T+ AE+ LW++IINE+KLNVSPG SFHC   GWFRVCFANMDD TM
Sbjct  364   LFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCPNPGWFRVCFANMDDRTM  423

Query  1450  RVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSP  1629
              +AL RI + +L  K +EA      K     +R+L++S+S RR ++D M S   SP  SP
Sbjct  424   EIALSRITSFML--KNVEAKVPNKKKLCW--QRSLRLSMSSRR-MDDFMASPCMSP-QSP  477

Query  1630  LVQA  1641
             LVQA
Sbjct  478   LVQA  481



>ref|XP_002276774.2| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Vitis vinifera]
Length=474

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/475 (69%), Positives = 390/475 (82%), Gaps = 6/475 (1%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             LSKIATND HGENS YFDGWKAYD NPFHP  NP GVIQMGLAENQL F+L++ W+L NP
Sbjct  3     LSKIATNDMHGENSLYFDGWKAYDENPFHPTKNPNGVIQMGLAENQLSFNLMEEWILKNP  62

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             KASICTP+G  +FKD+AI+QDYHGL +FR AVA+FM K RG  VKFDPDRIVMSGGATGA
Sbjct  63    KASICTPEGISQFKDVAIFQDYHGLTQFRNAVAKFMAKARGGRVKFDPDRIVMSGGATGA  122

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
              E++ FCL DPGEAFLVP+PYYP FDRDLRWRT V++ PV C S+N+F++TR ALE+AY+
Sbjct  123   DEMIMFCLADPGEAFLVPSPYYPAFDRDLRWRTQVKIRPVECTSANNFQITREALEAAYQ  182

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQE+NI+VKGL+I NPSNPLGT L R+TL  +V F+N+KNIHLV DEIYAATVFS P F
Sbjct  183   KAQEENIKVKGLIITNPSNPLGTTLSRETLTSLVSFINEKNIHLVADEIYAATVFSSPRF  242

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +S+++I+ EV+CNP+ IHIVYSLSKDLG PGFRVGI+YSYNDAVVSC RKMSSFGLVS+Q
Sbjct  243   VSVSEIMDEVECNPNLIHIVYSLSKDLGLPGFRVGIVYSYNDAVVSCGRKMSSFGLVSSQ  302

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHL+A+MLSD EFV+NF++ESS RL KRH++FT GL  V I  LKSN GLFVWM+LR+L
Sbjct  303   TQHLLASMLSDDEFVDNFLMESSRRLAKRHKTFTEGLVNVNINCLKSNAGLFVWMDLRHL  362

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKEPT   E+ LW++II ++KLNVSPG SF C E GWFRVCFANMD++T+ VAL RIRT 
Sbjct  363   LKEPTLEGEIALWRVIIKDVKLNVSPGSSFQCSEPGWFRVCFANMDEDTVEVALKRIRTF  422

Query  1480  VLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             V   KG E A A +  K+    +N  + LSF   + D  + SPHSPM +SPLV+A
Sbjct  423   V--GKGQEEAEAPTKAKRW---KNSTLRLSFSSRIYDEAVMSPHSPMPHSPLVRA  472



>gb|AAQ14266.1|AF248735_1 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=484

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/491 (68%), Positives = 408/491 (83%), Gaps = 12/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L+S     ++LSK+AT +GHGE+S YFDGWKAYD++PFHP  NP+GVI+MG AENQL 
Sbjct  1     MVLQSSNNAKKLLSKLATGNGHGEDSPYFDGWKAYDSDPFHPTLNPRGVIEMGQAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             F  ++ W+ NNP+ASICT +G +EFKD+ I+QDYHGLPEFR AVA FM KVRGD VKFDP
Sbjct  61    FGFVEKWMRNNPQASICTAEGIDEFKDVDIFQDYHGLPEFRNAVANFMGKVRGDRVKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DR+VMSGGATGAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV+CESSN+F
Sbjct  121   DRVVMSGGATGAHETVAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICESSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++TR ALE+AY++AQ+ + ++KGLLI NPSNPLGTV DR+TL   V F+NDKNIHLVCDE
Sbjct  181   RLTREALETAYEEAQKSDTKIKGLLITNPSNPLGTVYDRETLETAVAFINDKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAATVF++P F+SI+++I+ +  C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVVSC
Sbjct  241   IYAATVFAEPGFVSISEVIENDPSCDRNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVSC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVS+QTQH+IA+MLSD EFVE+F++ S+E+L  RH SFT+GLAQVGI  L+ 
Sbjct  301   ARKMSSFGLVSSQTQHMIASMLSDDEFVESFLVGSAEKLAARHRSFTKGLAQVGIGYLQG  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             +GGLF+WM+LR+LLKE T  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD
Sbjct  361   SGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRR--NLKVSLSFRRGLEDCMISSPHS  1614
             +TM +++ RIRT VLQ K      A   KK K C R  +L++ LS RR LED M  SPHS
Sbjct  421   KTMDISITRIRTFVLQNK-----EATKIKKHKFCWRQSSLELRLSSRR-LEDIM--SPHS  472

Query  1615  PM-NSPLVQAT  1644
             P+  SP+++AT
Sbjct  473   PLPQSPMLRAT  483



>gb|KDP25384.1| hypothetical protein JCGZ_20540 [Jatropha curcas]
Length=484

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/483 (71%), Positives = 391/483 (81%), Gaps = 13/483 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIAT +GHGE+S YFDGWKAYD++P+H   NP GVIQMGLAENQLCFDL++ W+ N
Sbjct  8     QLLSKIATGNGHGEDSPYFDGWKAYDSDPYHRTKNPNGVIQMGLAENQLCFDLVQEWIKN  67

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICTP+GAEEFKDIAI+QDYHGL EFRTAVA+FM K RGD V FDPDRIVMSGGAT
Sbjct  68    NPKASICTPEGAEEFKDIAIFQDYHGLSEFRTAVAKFMAKGRGDKVTFDPDRIVMSGGAT  127

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE++ FCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PV CESSN+F+VTR ALE A
Sbjct  128   GAHEMVTFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLIPVDCESSNNFEVTREALEYA  187

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ AQ DNIRVKGLLI NPSNPLGT+LDR+TL  IV F+N+KNIHLVCDEIYAATVF+QP
Sbjct  188   YEMAQIDNIRVKGLLITNPSNPLGTILDRETLRSIVSFINEKNIHLVCDEIYAATVFTQP  247

Query  934   EFIS-----IAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             EFIS          +  +CN D IHIVYSLSKD+GFPGFRVGIIYSYND VV+CARKMSS
Sbjct  248   EFISIAEIIQETEEEGEECNLDLIHIVYSLSKDMGFPGFRVGIIYSYNDVVVNCARKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK-SNGGLF  1275
             FGLVSTQTQHL+A+MLSD+EFVE FI ++ +RL KR+  F+ GLAQ GI+ LK SN GLF
Sbjct  308   FGLVSTQTQHLLASMLSDEEFVERFITQNKKRLAKRYTDFSLGLAQAGIKCLKTSNAGLF  367

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             VWM+LR LLK+ T   E  LW++IIN++KLNVSPG SFHC E GWFRVCFANMD+ TM V
Sbjct  368   VWMDLRRLLKDQTVEGETALWRIIINDVKLNVSPGSSFHCTEPGWFRVCFANMDNHTMDV  427

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLV  1635
             AL RIRT VLQ K       A   K+K C +   + LSF   + D  I SPHS   SP+V
Sbjct  428   ALSRIRTFVLQNK------EAMKPKKKLCWQG-SLKLSFSSRIYDDFIMSPHSRPQSPMV  480

Query  1636  QAT  1644
             +AT
Sbjct  481   RAT  483



>ref|XP_007160107.1| hypothetical protein PHAVU_002G293000g [Phaseolus vulgaris]
 gb|ESW32101.1| hypothetical protein PHAVU_002G293000g [Phaseolus vulgaris]
Length=484

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/493 (68%), Positives = 409/493 (83%), Gaps = 14/493 (3%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M LK+M  +TQ+LSK+A  DGHGE+S YFDGWKAYD NPFHP  NP GVIQMGLAENQL 
Sbjct  1     MGLKAM-DKTQLLSKMAMGDGHGESSPYFDGWKAYDENPFHPTDNPNGVIQMGLAENQLT  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DL+++W+LNNP+ASICTP+G  +F+ IA +QDYHGL EFR AVA+FM + RG+ +KFDP
Sbjct  60    SDLVEDWILNNPEASICTPEGIIDFRAIANFQDYHGLAEFRNAVAKFMGRTRGNRIKFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE+ AFCL DPGEAFLVP PYYPGFDRDLRWRTGVQL PV+C+SSN+F
Sbjct  120   DRIVMSGGATGAHEVTAFCLADPGEAFLVPIPYYPGFDRDLRWRTGVQLVPVMCDSSNNF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
              +T+ ALE AY+KA+E+NIRVKGLLI NPSNPLGT++DR TL  +V F+N+K IHLVCDE
Sbjct  180   MLTKEALEDAYEKARENNIRVKGLLITNPSNPLGTIMDRKTLRTVVSFINEKRIHLVCDE  239

Query  904   IYAATVFSQPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             IYAATVFS P FISIA+I++E   ++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV
Sbjct  240   IYAATVFSHPGFISIAEILEEETDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVV  299

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQ+L+A+ML+D EFVE F+ ES++RL +R   FT GLA+VGI+ L
Sbjct  300   NCARKMSSFGLVSTQTQYLLASMLNDDEFVERFLAESAKRLSQRFMVFTGGLAKVGIKCL  359

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
             +SN GLFVWM+LR+LLK PT  +E+ELWK+II+E+K+NVSPG SFHC E GWFRVC+ANM
Sbjct  360   QSNAGLFVWMDLRHLLKTPTLDSEMELWKVIIHEVKINVSPGSSFHCTEPGWFRVCYANM  419

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPH  1611
             DD  +++AL RIRT VLQ K +         K+K C   NL++SL  RR  +D M+ SPH
Sbjct  420   DDMAVQIALQRIRTFVLQNKEV------VVSKKKLCWHSNLRLSLKTRR-FDDIMM-SPH  471

Query  1612  SPM-NSPLVQATN  1647
             SP+  SP+V+ATN
Sbjct  472   SPLPQSPMVKATN  484



>gb|KHG05668.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=480

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 393/475 (83%), Gaps = 1/475 (0%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGENS YFDGWKAY+ NPFHP   P GVIQMGLAENQLCF+ IK W++ +P
Sbjct  4     MSKIATGNGHGENSPYFDGWKAYETNPFHPIDRPDGVIQMGLAENQLCFEFIKKWLMEHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+CT +G   FK+ A++QDYHG+PEFR A+A+FM KVRGD VKFDPDRIVMSGGATGA
Sbjct  64    EASLCTAEGVNRFKETALFQDYHGMPEFRQAIAKFMGKVRGDRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEA LVPTPYYPGFDRDLRWRTGV+L PV+CESS++F++TRTA+E+AY+
Sbjct  124   HEMVAFCLADPGEALLVPTPYYPGFDRDLRWRTGVELVPVICESSHNFQITRTAMEAAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQE N++VKGL+I NPSNPLGT++DR+TL  IV+F+N+KNIHL+ DEIYAATVF  PEF
Sbjct  184   KAQEANLKVKGLVITNPSNPLGTIMDRETLKSIVQFINEKNIHLIGDEIYAATVFKDPEF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +SI+++IQEV+CN D IHIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKMSS+GLVS+Q
Sbjct  244   VSISEVIQEVECNHDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKMSSYGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHLIA ML+D +F+ NFI+ES E+L KRH+ FT  L+QVGI +LKSNGGLF+WM+LR L
Sbjct  304   TQHLIATMLNDDDFIHNFIMESKEQLFKRHKYFTWSLSQVGIGSLKSNGGLFIWMDLRKL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE TF AE++LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD TM VAL RIR+ 
Sbjct  364   LKEKTFDAEMDLWRVIINEVKLNVSPGSSFHCHEPGWFRVCFANMDDNTMEVALSRIRSF  423

Query  1480  VLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             +L+            +   +   +  +S      +    I SPHSP+  SPLV+A
Sbjct  424   ILKNNESIVPRKLCRRSSLKLSLSRSLSRRMDDFMSPAGIMSPHSPLPQSPLVRA  478



>ref|NP_001280768.1| 1-aminocyclopropane-1-carboxylate synthase-like [Malus domestica]
 dbj|BAA92350.1| 1-aminocyclopropane-1-carboxylate synthase [Malus domestica]
Length=487

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/489 (70%), Positives = 393/489 (80%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT++GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAEN++CFDLI
Sbjct  4     TLSNQQQLLSKIATSNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVLNNP+ASICT  G  EFKDIAI+QDYHGLP FR AVA FM KVRG+ V FD DRIV
Sbjct  64    QEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPVFRNAVANFMGKVRGNRVTFDADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHETIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLMPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEF-ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP F      I + ++CN + IHIVYSLSKD+GFPGFRVGI+YSYND VV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEENIECNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDDVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE FI +S++RL+ RH  FT  L QVG   L SNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFIAQSAKRLKARHMRFTMELDQVGTSCLNSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW  II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMVLWHTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             +AL RIR  V Q+K       A  K  +  + NL++S   RR ++D M+S    SPHSP+
Sbjct  424   IALTRIRNFVAQYK----EPIAPRKNNRYWQSNLRLSFQSRR-MDDIMMSPCMMSPHSPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>gb|KDP28564.1| hypothetical protein JCGZ_14335 [Jatropha curcas]
Length=485

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/481 (67%), Positives = 394/481 (82%), Gaps = 4/481 (1%)
 Frame = +1

Query  211   TQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVL  390
             +Q+LS+IATN+GHGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQLCFDL+++W+ 
Sbjct  4     SQLLSRIATNEGHGENSPYFDGWKAYDGNPFHPVDNPEGVIQMGLAENQLCFDLVRDWIK  63

Query  391   NNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGA  570
              NP+ASICT +G   FKDIA +QDYHGLPEFR A+A+FM +VRG  V FDP+RIVM GGA
Sbjct  64    QNPEASICTAEGVAMFKDIANFQDYHGLPEFRQAIAKFMGRVRGSRVTFDPNRIVMGGGA  123

Query  571   TGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALES  750
             TGA E+L FCL +PG+AFL P+PYYP FDRDL WRTG+Q+ PV C SSN+FKVT+ ALE+
Sbjct  124   TGASELLMFCLANPGDAFLAPSPYYPAFDRDLSWRTGIQIIPVDCYSSNNFKVTKQALEA  183

Query  751   AYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQ  930
             AY KAQE  I +KGL++ NPSNPLGT+LDR+TL D+V F+N +NIHLV DEIY+AT+F+ 
Sbjct  184   AYDKAQEAGINIKGLILANPSNPLGTILDRETLKDLVTFINARNIHLVIDEIYSATIFNS  243

Query  931   PEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             P F+SIA+IIQE+ CN D +HI+YSLSKD+GFPGFRVGI+YSYNDAVVSC RKMSSFGLV
Sbjct  244   PSFVSIAEIIQEMDCNHDLVHILYSLSKDMGFPGFRVGIVYSYNDAVVSCGRKMSSFGLV  303

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+MLSD+ FVE F+ ESS+RL+KRH  FT+GL QVGI  LKSN GLFVWM+L
Sbjct  304   SSQTQHLLASMLSDECFVEKFLSESSKRLKKRHSMFTKGLEQVGIGCLKSNAGLFVWMDL  363

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LLKE TF  E+ LW++IINE+KLNVSPG SFHC+E GW+RVCFANMDDET+  AL RI
Sbjct  364   RHLLKEKTFDGEMALWRVIINEVKLNVSPGSSFHCKEPGWYRVCFANMDDETVEAALKRI  423

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQ  1638
             R  V++ K        +    K+ ++NL++S S RR  E  M   I SPHSPM +SPLV+
Sbjct  424   REFVVRGKEENQELPTNTNSNKRWQKNLRLSFSARRCEEAVMSPHIMSPHSPMPHSPLVR  483

Query  1639  A  1641
             A
Sbjct  484   A  484



>gb|KEH21137.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=487

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/491 (67%), Positives = 400/491 (81%), Gaps = 9/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L SM  Q Q+LSKIAT DGHGE S+YFDGWKAYD NPFHP  NPQGVIQMGLAENQL 
Sbjct  1     MGLVSM-DQPQLLSKIATGDGHGETSSYFDGWKAYDKNPFHPTKNPQGVIQMGLAENQLT  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DL++NW+++NP+ASICT +G   FK++A +QDYHGLPEFR AVA+FM + RG+ V FDP
Sbjct  60    ADLVQNWIMSNPEASICTLEGVHNFKEMANFQDYHGLPEFRNAVAKFMSRTRGNRVTFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE  AFCL DPG+AFLVPTPYYPGFDRDLRWRTGV+L PV+CES+N+F
Sbjct  120   DRIVMSGGATGAHEATAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVKLVPVICESANNF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T+ ALE AY+KA EDNIR+KGLLI NPSNPLGTV+DR+TL  +V F+N+K IHL+ DE
Sbjct  180   KLTKQALEEAYEKATEDNIRIKGLLITNPSNPLGTVMDRNTLRTVVNFINEKRIHLISDE  239

Query  904   IYAATVFSQPEFISIAQIIQ---EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             IYAATVFS P FISIA+I++   +++C+ + +HIVYSLSKD+GFPGFRVGIIYSYND VV
Sbjct  240   IYAATVFSHPSFISIAEILEHDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDTVV  299

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQ+L+A MLSD EFV+ F+ ES++RL +R+  FT GL +VGI  L
Sbjct  300   NCARKMSSFGLVSTQTQYLMAKMLSDDEFVKKFLTESAKRLAQRYRIFTSGLTKVGINCL  359

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
             +SNGGLFVWM+LR LLKE TF +ELELW++II+E+K+NVSPG SFHC E GWFRVC+ANM
Sbjct  360   QSNGGLFVWMDLRGLLKEATFESELELWRVIIHEVKINVSPGVSFHCSEPGWFRVCYANM  419

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHS  1614
             DD  +++AL RIR+ V+Q    +    +    +     NL++SL  RR   D ++ SPHS
Sbjct  420   DDRDVQIALQRIRSFVVQ--NNKEVMVSEKNTKPCWHSNLRLSLKTRRF--DDIVMSPHS  475

Query  1615  PM-NSPLVQAT  1644
             P   SPLV+AT
Sbjct  476   PFPQSPLVKAT  486



>gb|KDO76335.1| hypothetical protein CISIN_1g011570mg [Citrus sinensis]
Length=483

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/484 (69%), Positives = 402/484 (83%), Gaps = 8/484 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIA  +GHGE+S YFDGWKA++++P+HP  NP GVIQMGLAEN LC +L+
Sbjct  4     ALSNQVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             ++W++NNPKASIC+ +G  EFK IAI+QDYHGLPEFR AVA+FM KVRG+ + FDPDRIV
Sbjct  64    EDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFMGKVRGNRITFDPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVC+SSNDFKVT 
Sbjct  124   MSGGATGAHETVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDSSNDFKVTM  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQE NIR+KG+LI NPSNPLGT LDR+TL DIV F+N+KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQESNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHLVCDEIYAA  243

Query  916   TVFS-QPEFISIAQII-QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARK  1089
             TVF+ +  F+SIA+II Q++ CN + IHIVYSLSKD+GFPGFRVGIIYSYND VVSCARK
Sbjct  244   TVFTKESSFVSIAEIIDQDIACNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDQVVSCARK  303

Query  1090  MSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGG  1269
             MSSFGLVS+QTQHLIA MLSD +FVE FI ES++R+ +RH++FT GL+QVGI  LKSN G
Sbjct  304   MSSFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKAFTWGLSQVGIGCLKSNAG  363

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             LF+WM+L +LLKE T+ AE+ LW++IINE+KLNVSPG SFHC   GWFRVCFANMDD TM
Sbjct  364   LFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFHCPNPGWFRVCFANMDDRTM  423

Query  1450  RVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSP  1629
              +AL RI + +L  K +EA      K     +R+L++S+S RR ++D M S   SP  SP
Sbjct  424   EIALSRITSFML--KNVEAKVPNKKKLCW--QRSLRLSMSSRR-MDDFMASPCMSP-QSP  477

Query  1630  LVQA  1641
             LVQA
Sbjct  478   LVQA  481



>gb|ACT54523.3| 1-aminocyclopropane-1-carboxylate synthase [Eriobotrya japonica]
Length=487

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/489 (70%), Positives = 392/489 (80%), Gaps = 11/489 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAEN++CFDLI
Sbjct  4     TLSNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVL NP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM KVRG+ V FD DRIV
Sbjct  64    QEWVLTNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVTFDADRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHETIAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTV+DRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVIDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEFIS-IAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP F S    I + ++CN + IHIVYSLSKD+GFPGFRVGI+YSYND VV+CARKM
Sbjct  244   TVFSQPSFTSIAEIIEENIECNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDDVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE FI +S+ERL+ RH  FT  LAQV    L  NGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFIAQSAERLKARHMRFTMELAQVRTSCLNGNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW+ II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFEAEMVLWQTIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             +AL RIR  + Q+K       A  K  +  + NL++S   RR ++D M+     SPHSP+
Sbjct  424   IALTRIRNFMAQYK----EPIAPRKNNRYWQSNLRLSFQSRR-MDDVMMPPCMMSPHSPI  478

Query  1621  -NSPLVQAT  1644
               SPLV+AT
Sbjct  479   PQSPLVRAT  487



>ref|XP_003538294.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Glycine 
max]
Length=480

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/491 (67%), Positives = 400/491 (81%), Gaps = 16/491 (3%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M+L S+  + Q+LSKIAT DGHGENS YFDGWKAY+++PFHP  NP GVIQMGLAENQL 
Sbjct  1     MELMSV-NEPQLLSKIATGDGHGENSPYFDGWKAYEDDPFHPIKNPNGVIQMGLAENQLA  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DL++NW+ N P+ASICTP+G  +FK IA +QDYHGLP+FR AVA+FM + RG+ V FDP
Sbjct  60    SDLVQNWLTNKPRASICTPEGVRDFKAIANFQDYHGLPKFRKAVAKFMARTRGNRVTFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE+ AFCL DPGEAFLVPTPYY GFDRDLRWRTGV+L PV CESSNDF
Sbjct  120   DRIVMSGGATGAHEVTAFCLADPGEAFLVPTPYYAGFDRDLRWRTGVELVPVKCESSNDF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+TR AL+ AY+K +E+NIR+KGLLI NPSNPLGT++DR+TL  +V F+N+K+IHLV DE
Sbjct  180   KLTRKALQEAYEKGKENNIRIKGLLITNPSNPLGTIMDRETLRTVVSFINEKHIHLVSDE  239

Query  904   IYAATVFSQPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             IYA TVF  P F SIA++I+E   ++C+ D IHIVYSLSKD+GFPGFRVGIIYSYNDAVV
Sbjct  240   IYAGTVFCHPGFTSIAEVIEEDTDIECDRDLIHIVYSLSKDMGFPGFRVGIIYSYNDAVV  299

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQ+L+A+MLSD EFVE F+ ES++RL KR+  F RGLAQVGI+ L
Sbjct  300   NCARKMSSFGLVSTQTQYLLASMLSDDEFVERFLEESAKRLAKRYGVFCRGLAQVGIKCL  359

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
              SN GLF+WM+LR LLK+PTF AE+ELWK+II ++K+N+SPG SFHC E GWFRVC+ANM
Sbjct  360   ASNAGLFLWMDLRRLLKKPTFEAEMELWKVIIEQVKINISPGSSFHCSEPGWFRVCYANM  419

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHS  1614
             DD T+ V+L R+RT V Q          +  K+   +RNL++S SFR+   D  + SPHS
Sbjct  420   DDRTVEVSLARMRTFVNQ---------NTEAKKSCSQRNLRLSFSFRK--MDEYLVSPHS  468

Query  1615  PM-NSPLVQAT  1644
             P   SPLV+A+
Sbjct  469   PFPQSPLVKAS  479



>ref|XP_008452008.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Cucumis 
melo]
Length=490

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/481 (68%), Positives = 401/481 (83%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+A  +GHGE+S+YFDGWKAYD++PFHP  NP+GVIQMGLAENQL F+ ++ W+ N
Sbjct  14    KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM KVRG+ VKFDPDR+VMSGGAT
Sbjct  74    NPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVKFDPDRVVMSGGAT  133

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV CESSN+FK+TR ALE+A
Sbjct  134   GAHETMAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVKCESSNNFKLTREALETA  193

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y++A++ NIR+KGLLI NPSNPLGTV DR TL   V F+N+KNIHLVCDEIYAATVFS+P
Sbjct  194   YEEAEKSNIRIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHLVCDEIYAATVFSEP  253

Query  934   EFISIAQII---QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
              FISI+++I    +V+C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSSFG
Sbjct  254   GFISISEVIDNMNDVECDRNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVACARKMSSFG  313

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQ+LIA+MLSD  FV+NF+  S+E+L  RH +FT+GLAQVGI  LK +GGLF+WM
Sbjct  314   LVSSQTQYLIASMLSDDVFVDNFLAGSAEKLAVRHRNFTKGLAQVGIGYLKGSGGLFLWM  373

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR+LLKE T  AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDD TM +++ 
Sbjct  374   DLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDSTMDISIT  433

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             RIR  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP+  SP+++A
Sbjct  434   RIRNFVLQNK--EVTTKVKKQKFCWRQSSLELRLSSRR-LEDIM--SPHSPLPQSPMLRA  488

Query  1642  T  1644
             T
Sbjct  489   T  489



>gb|KHM99945.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=481

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/484 (68%), Positives = 403/484 (83%), Gaps = 13/484 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             QTQ+LSK+   DGHGE S YFDGWKAYD NPFHPK NP GVIQMGLAENQL  DL+++W+
Sbjct  5     QTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWI  64

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM + RG+ V FDPDRIVMSGG
Sbjct  65    LNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGG  124

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE+  FCL DPG+AFLVP PYYPGFDRDLRWRTG++L PV+C+SSN+FK+T+ ALE
Sbjct  125   ATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALE  184

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY+KA+EDNIRVKGLLI NPSNPLGTV+DR+TL  ++ F+N+K IHLV DEIY+ATVFS
Sbjct  185   DAYEKAKEDNIRVKGLLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVFS  244

Query  928   QPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
              P FISIA+I++E   ++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSS
Sbjct  245   HPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKMSS  304

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A+ML+D EFVE+F++ES++RL +RH  FT GLA+VGI+ L+SN GLFV
Sbjct  305   FGLVSTQTQYLLASMLNDDEFVESFLVESAKRLAQRHRVFTGGLAKVGIKCLQSNAGLFV  364

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK+PT  +E+ELW++II+E+K+NVSPG SFHC E GWFRVC+ANMDD  +++A
Sbjct  365   WMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIA  424

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR  VLQ K +          +K C   NL++SL  RR  +D M+ SPHSP+  SPL
Sbjct  425   LQRIRNFVLQNKEI------MVPNKKHCWHSNLRLSLKTRR-FDDIMM-SPHSPIPQSPL  476

Query  1633  VQAT  1644
             V+AT
Sbjct  477   VKAT  480



>ref|XP_007040349.1| 1-aminocyclopropane-1-carboxylate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY24850.1| 1-aminocyclopropane-1-carboxylate synthase isoform 1 [Theobroma 
cacao]
Length=478

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/479 (69%), Positives = 397/479 (83%), Gaps = 11/479 (2%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGENS YFDGWKAY+ NPFHP   P GVIQMGLAENQLCFD  + W++ +P
Sbjct  4     MSKIATGNGHGENSPYFDGWKAYETNPFHPTERPNGVIQMGLAENQLCFDFFQKWLMKHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +AS+C+P+G  +FK+ A++QDYHG+PEFR AVA+FM KVRGD VKFDPDRIVMSGGATGA
Sbjct  64    EASLCSPEGVRKFKETALFQDYHGMPEFRKAVAKFMGKVRGDRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++ FCL DPGEAFLVPTPYYPGFDRDLRWRT V+L PV CESSN+FK+TRTALE+AY+
Sbjct  124   HEMVTFCLADPGEAFLVPTPYYPGFDRDLRWRTRVELVPVDCESSNNFKITRTALEAAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQ  N+RVKGLLI NPSNPLGT+LDR+TL  IV F+N+KNIHL+ DEIY+ATVF +PEF
Sbjct  184   KAQAANLRVKGLLITNPSNPLGTILDRETLKSIVSFINEKNIHLIGDEIYSATVFMEPEF  243

Query  940   I-SIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             +     I ++++CN D IHIVYSLSKD+G PGFRVGI+YSYNDAVVSCARKMSSFGLVS+
Sbjct  244   VSISEIIEEDIECNRDLIHIVYSLSKDMGLPGFRVGIVYSYNDAVVSCARKMSSFGLVSS  303

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQHLIA+MLSD +FVE+FI+ES ERL KRH+ FT  L+QVGI +L+SN GLF+WM+LR 
Sbjct  304   QTQHLIASMLSDDDFVESFIVESKERLFKRHKYFTWSLSQVGIGSLQSNAGLFIWMDLRK  363

Query  1297  LLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRT  1476
             LLKE TF AE++LW++II E+KLNVSPG SFHCQE GWFRVCFANMDD T+ VALMRIRT
Sbjct  364   LLKEKTFKAEMDLWQVIIKEVKLNVSPGSSFHCQEPGWFRVCFANMDDNTVEVALMRIRT  423

Query  1477  SVLQWKGMEaaaaasakkqkqCRR-NLKVSLSFRRG--LEDCMISSPHSPM-NSPLVQA  1641
              +L+         A   + K CRR +LK+SLS R+   +    I SPHSP+  SPLV+A
Sbjct  424   FMLK------NNEAMVPRSKLCRRSSLKLSLSRRKDDFITSPGIMSPHSPLPTSPLVRA  476



>gb|AAL35745.1| 1-aminocyclopropanecarboxylic acid synthase [Medicago truncatula]
Length=487

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/491 (67%), Positives = 399/491 (81%), Gaps = 9/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L SM  Q Q+LSKIAT DGHGE S+YFDGWKAYD NPFHP  NPQGVIQMGLAENQL 
Sbjct  1     MGLVSM-DQPQLLSKIATGDGHGETSSYFDGWKAYDKNPFHPTKNPQGVIQMGLAENQLT  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DL++NW+++NP+ASICT +G   FK++A +QDYHGLPEFR AVA+FM + RG+ V FDP
Sbjct  60    ADLVQNWIMSNPEASICTLEGVHNFKEMANFQDYHGLPEFRNAVAKFMSRTRGNRVTFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE  AFCL DPG+AFLVPTPYYPGFDRDLRWRTGV+L PV+CES+N+F
Sbjct  120   DRIVMSGGATGAHEATAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVKLVPVICESANNF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T+ ALE AY+KA EDNIR+KGLLI NPSNPLGTV+DR+TL  +V F+N+K IHL+ DE
Sbjct  180   KLTKQALEEAYEKATEDNIRIKGLLITNPSNPLGTVMDRNTLRTVVNFINEKRIHLISDE  239

Query  904   IYAATVFSQPEFISIAQIIQ---EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             IYAATVFS P FISIA+I++   +++C+ + +HIVYSLSKD+GFPGFRVGIIYSYND VV
Sbjct  240   IYAATVFSHPSFISIAEILEHDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDTVV  299

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQ+L+A MLSD EFV+ F+ ES++RL +R+  FT GL +VGI  L
Sbjct  300   NCARKMSSFGLVSTQTQYLMAKMLSDDEFVKKFLTESAKRLAQRYRIFTSGLTKVGINCL  359

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
             +SNGGLFVWM+LR LLKE T  +ELELW++II+E+K+NVSPG SFHC E GWFRVC+ANM
Sbjct  360   QSNGGLFVWMDLRGLLKEATLESELELWRVIIHEVKINVSPGVSFHCSEPGWFRVCYANM  419

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHS  1614
             DD  +++AL RIR+ V+Q    +    +    +     NL++SL  RR   D ++ SPHS
Sbjct  420   DDRDVQIALQRIRSFVVQ--NNKEVMVSEKNTKPCWHSNLRLSLKTRRF--DDIVMSPHS  475

Query  1615  PM-NSPLVQAT  1644
             P   SPLV+AT
Sbjct  476   PFPQSPLVKAT  486



>dbj|BAB18464.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=490

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 401/481 (83%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+A  +GHGE+S+YFDGWKAYD++PFHP  NP+GVIQMGLAENQL F+ ++ W+ N
Sbjct  14    KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM KVRG+ VKFDPDR+VMSGGAT
Sbjct  74    NPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVKFDPDRVVMSGGAT  133

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV CESSN+FK+TR ALE+A
Sbjct  134   GAHETMAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVKCESSNNFKLTREALETA  193

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y++A++ NIR+KGLLI NPSNPLGTV DR TL   V F+N+KNIHLVCDEIYAATVF++P
Sbjct  194   YEEAEKSNIRIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHLVCDEIYAATVFAEP  253

Query  934   EFISIAQII---QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
              FISI+++I    +V+C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSSFG
Sbjct  254   GFISISEVIDNMNDVECDRNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVACARKMSSFG  313

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQ+LIA+MLSD  FV+NF+  S+E+L  RH +FT+GLAQVGI  LK +GGLF+WM
Sbjct  314   LVSSQTQYLIASMLSDDVFVDNFLAGSAEKLAVRHRNFTKGLAQVGIGYLKGSGGLFLWM  373

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR+LLKE T  AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDD TM +++ 
Sbjct  374   DLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDSTMDISIT  433

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             RIR  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP+  SP+++A
Sbjct  434   RIRNFVLQNK--EVTTKVKKQKFCWRQSSLELRLSSRR-LEDIM--SPHSPLPQSPMLRA  488

Query  1642  T  1644
             T
Sbjct  489   T  489



>ref|NP_001236858.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
 sp|P31531.1|1A1C_SOYBN RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Glycine max]
 emb|CAA47474.1| 1-aminocyclopropane 1-carboxylate synthase [Glycine max]
 prf||2019442A aminocyclopropane carboxylate synthase
Length=484

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/484 (68%), Positives = 402/484 (83%), Gaps = 13/484 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             QTQ+LSK+   DGHGE S YFDGWKAYD NPFHPK NP GVIQMGLAENQL  DL+++W+
Sbjct  8     QTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWI  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM + RG+ V FDPDRIVMSGG
Sbjct  68    LNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE+  FCL DPG+AFLVP PYYPGFDRDLRWRTG++L PV+C+SSN+FK+T+ ALE
Sbjct  128   ATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALE  187

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY+KA+EDNIRVKGLLI NPSNPLGTV+DR+TL  ++ F+N+K IHLV DEIY+ATVFS
Sbjct  188   DAYEKAKEDNIRVKGLLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVFS  247

Query  928   QPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
              P FISIA+I++E   ++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV CARKMSS
Sbjct  248   HPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVHCARKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A+ML+D EFVE+F++ES++RL +RH  FT GLA+VGI+ L+SN GLFV
Sbjct  308   FGLVSTQTQYLLASMLNDDEFVESFLVESAKRLAQRHRVFTGGLAKVGIKCLQSNAGLFV  367

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK+PT  +E+ELW++II+E+K+NVSPG SFHC E GWFRVC+ANMDD  +++A
Sbjct  368   WMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIA  427

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR  VLQ K +          +K C   NL++SL  RR  +D M+ SPHSP+  SPL
Sbjct  428   LQRIRNFVLQNKEI------MVPNKKHCWHSNLRLSLKTRR-FDDIMM-SPHSPIPQSPL  479

Query  1633  VQAT  1644
             V+AT
Sbjct  480   VKAT  483



>ref|XP_002304518.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
 gb|EEE79497.2| 1-aminocyclopropane-1-carboxylate synthase family protein [Populus 
trichocarpa]
Length=480

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/495 (68%), Positives = 396/495 (80%), Gaps = 35/495 (7%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +    +LS IA+++GHGE+S YF+GWKAYD+NP HP  NP GVIQMGLAENQLCFDLI++
Sbjct  4     KLNNHLLSSIASSNGHGEDSPYFEGWKAYDSNPHHPTENPNGVIQMGLAENQLCFDLIQD  63

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W+ NNPKASICTP+G  EF+++AI+QDYHGLPEFR AVA+FMEKVRG+ V FDPDRIVM+
Sbjct  64    WLKNNPKASICTPEGVNEFREVAIFQDYHGLPEFRNAVAKFMEKVRGNKVTFDPDRIVMN  123

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PV  ESSN+FKVTR A
Sbjct  124   GGATGAHETIAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLIPVDSESSNNFKVTREA  183

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY+ A+  NI+VKGLLI NPSNPLGT+LDR+TL  +V F+N+KNIHLVCDEIYAATV
Sbjct  184   LENAYEMAKLGNIKVKGLLITNPSNPLGTMLDRETLRSVVSFINEKNIHLVCDEIYAATV  243

Query  922   FSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             FSQP+FISIA+I+QE ++CN D +HIVYSLSKD+GFPG RVGIIYSYNDAVVSCARKMSS
Sbjct  244   FSQPDFISIAEILQEDIECNLDLVHIVYSLSKDMGFPGLRVGIIYSYNDAVVSCARKMSS  303

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL-KSNGGLF  1275
             FGLVS+QTQH+IA+MLSD EFV  FI +S  RL  RH  FT GLAQV I+ L  SN GLF
Sbjct  304   FGLVSSQTQHMIASMLSDDEFVGKFIRKSKRRLAARHRIFTYGLAQVSIKCLTTSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             +WM+L  LL+E TF AE+ LW++II+E+KLNVSPGCSFHC E GWFRVCFANMDD+TM+V
Sbjct  364   LWMDLSGLLEEKTFEAEMALWRVIIHEVKLNVSPGCSFHCTEPGWFRVCFANMDDQTMQV  423

Query  1456  ALMRIRTSV------------LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMI  1599
             AL RIRT V            L+W+G                    + L+  R  +D  I
Sbjct  424   ALSRIRTFVNKDVDTKKPKKTLRWQG-------------------SLKLNSPRIYDD-FI  463

Query  1600  SSPHSPM-NSPLVQA  1641
             +SPHSP+  SPLV+A
Sbjct  464   NSPHSPIPQSPLVRA  478



>gb|AAP14019.1|AF380836_1 putative ACC synthase 1 [Lactuca sativa]
Length=484

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/484 (68%), Positives = 393/484 (81%), Gaps = 7/484 (1%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++    + LSKIATNDGHGENS YFDGWKAYD NP+HP++NP GVI MGLAENQLCFDLI
Sbjct  4     ALNNSQKFLSKIATNDGHGENSPYFDGWKAYDTNPYHPQNNPTGVIHMGLAENQLCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  +P+ASICTP+G  +F++IAI+QDYHGLP+FR A+A FM +VRG  V+FDP+RIV
Sbjct  64    QEWIEKHPEASICTPEGGFDFREIAIFQDYHGLPKFRMAIANFMSRVRGSRVRFDPNRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL +PGEAFLVPTPYYPGFDRDLRWRTGV+L PVVC S N+FKV+ 
Sbjct  124   MSGGATGAHETVAFCLANPGEAFLVPTPYYPGFDRDLRWRTGVELLPVVCGSWNNFKVSL  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE AY+KA+E NI+VKGLLI NPSNPLGT  D++TL  +V FVNDKNIHL+CDEIYA 
Sbjct  184   AALEEAYEKAKESNIKVKGLLITNPSNPLGTFFDKETLKTLVTFVNDKNIHLICDEIYAG  243

Query  916   TVFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARK  1089
             TV    EFISIA+I++E    CN D IHIVYSLSKD+GFPGFRVGIIYSYND VVS ARK
Sbjct  244   TVTKDNEFISIAEILEESPTICNHDLIHIVYSLSKDMGFPGFRVGIIYSYNDTVVSIARK  303

Query  1090  MSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGG  1269
             MSSFGLVSTQTQH+IA+MLSD +FVENFI ES  RL  RH+ FTR LAQVGI +LKSN G
Sbjct  304   MSSFGLVSTQTQHMIASMLSDDDFVENFINESRNRLANRHDLFTRELAQVGISSLKSNAG  363

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             LF WM+LR  LK+ TF +E+  W++IINE+KLNVSPG SFHC E GWFRVCFANMDDET+
Sbjct  364   LFFWMDLRRFLKDATFESEMTFWRIIINEIKLNVSPGSSFHCSEPGWFRVCFANMDDETV  423

Query  1450  RVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSP  1629
              +A+ RI++ VL+ K  E     +  K++  + NL + LS RR LED M S  +SP+NSP
Sbjct  424   TIAVRRIKSFVLKNKLFE---IKTKSKKQCWQNNLHLKLSSRR-LEDIM-SPQYSPLNSP  478

Query  1630  LVQA  1641
             LV+A
Sbjct  479   LVRA  482



>ref|NP_001236141.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
 gb|ABB70230.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
Length=484

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/484 (68%), Positives = 401/484 (83%), Gaps = 13/484 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             QTQ+LSK+A  DGHGE S YFDGWKAYD NPFHPK NP GVIQMGLAENQL  DL+++W+
Sbjct  8     QTQLLSKMAIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWI  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM + RG+ V FDPDRIVMSGG
Sbjct  68    LNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE+  FCL DPG+AFLVP PYYPGFDRDLRWRTG++L PV+C+SSN+FK+T+ ALE
Sbjct  128   ATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALE  187

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY KA+EDNIRVKG+LI NPSNPLGTV+DR+TL  +V F+N+K IHLV  EIY+ATVFS
Sbjct  188   DAYVKAKEDNIRVKGMLITNPSNPLGTVMDRNTLRTVVSFINEKRIHLVSHEIYSATVFS  247

Query  928   QPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             +P FISIA+I++E   ++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSS
Sbjct  248   RPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQHL+A+ML+D EFVE F+ ES++RL +RH  FT GLA+VGI+ L+SN GLFV
Sbjct  308   FGLVSTQTQHLLASMLNDDEFVERFLEESAKRLAQRHRVFTSGLAKVGIKCLQSNAGLFV  367

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK+PT  +E+ELW++II+E+K+NVSPG SFHC E GWFRVC+ANMDD  +++A
Sbjct  368   WMDLRQLLKKPTLDSEMELWRVIIHEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIA  427

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIRT VLQ K +          +K C   NL++SL   R  +D M+ SPHSP+  SPL
Sbjct  428   LQRIRTFVLQNKEV------MVPNKKHCWHSNLRLSLKTXR-FDDIMM-SPHSPIPQSPL  479

Query  1633  VQAT  1644
             V+AT
Sbjct  480   VKAT  483



>ref|XP_004160953.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Cucumis 
sativus]
 gb|KGN53353.1| hypothetical protein Csa_4G049610 [Cucumis sativus]
Length=489

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/480 (68%), Positives = 401/480 (84%), Gaps = 8/480 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+A  +GHGE+S+YFDGWKAYD++PFHP  NP+GVIQMGLAENQL F+ ++ W+ N
Sbjct  14    KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM KVRG+ VKFDPDR+VMSGGAT
Sbjct  74    NPRASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVKFDPDRVVMSGGAT  133

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV+CESSN+FK+TR ALE+A
Sbjct  134   GAHETMAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICESSNNFKLTREALETA  193

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y++AQ+ NI++KGLLI NPSNPLGTV DR TL   V F+N+KNIHLVCDEIYAATVF++P
Sbjct  194   YEEAQKSNIKIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHLVCDEIYAATVFAEP  253

Query  934   EFISIAQII--QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
              FISI+++I   +++C+ + +H+VYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSSFGL
Sbjct  254   GFISISEVIDNSDIECDRNLVHVVYSLSKDMGFPGFRVGIIYSYNDAVVACARKMSSFGL  313

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VS+QTQ+LIA+ML D  FV+NF+  S+E+L  RH +FT+GLAQVGI  LK +GGLF+WM+
Sbjct  314   VSSQTQYLIASMLLDDVFVDNFLAGSAEKLAARHRNFTKGLAQVGIGYLKGSGGLFLWMD  373

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR+LLKE T  AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDD TM +++ R
Sbjct  374   LRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDNTMDISITR  433

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQAT  1644
             IR  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP+  SP+++AT
Sbjct  434   IRNFVLQNK--EVTTKVKKQKFCWRQSSLELRLSSRR-LEDIM--SPHSPLPQSPMLRAT  488



>gb|AFT92042.2| 1-aminocyclopropane-1-carboxylate synthase [Paeonia lactiflora]
Length=492

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/493 (68%), Positives = 391/493 (79%), Gaps = 8/493 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S  QQ Q+LSK+AT +GHGE+S YFDGWKAYD+NPFH  +NP GVIQMGL EN L 
Sbjct  1     MGFMSTDQQKQLLSKMATGNGHGEDSPYFDGWKAYDSNPFHLNNNPNGVIQMGLVENLLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FD+I+ WVLNNPKASICTP+G  EF+D AI+QDYHG PEFR A+A+FM KV G  V FDP
Sbjct  61    FDVIQEWVLNNPKASICTPEGINEFRDTAIFQDYHGFPEFRNAIAKFMGKVGGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHEILAFCL DPG+AFLVPTPYYPG+DRDLRWRTG QL PV C+SSN+F
Sbjct  121   DRIVMSGGATGAHEILAFCLADPGDAFLVPTPYYPGYDRDLRWRTGAQLLPVQCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
              VT +ALE AY+KAQ+ NI+VKGL+INNPSNPLGTVL+ +TL  IV F+N+KNIHLVCDE
Sbjct  181   MVTISALELAYQKAQDANIKVKGLIINNPSNPLGTVLNGETLKTIVNFINEKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAATVF QP FISIA+II ++   N + IHIVYSLSKD+GFPGFRVGI+YSYNDAVVSC
Sbjct  241   IYAATVFCQPRFISIAEIINDMDGVNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVSC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVSTQTQHLIA+MLSD+ F E +I+ES+++L +R   FTRGLAQVGI  LKS
Sbjct  301   ARKMSSFGLVSTQTQHLIASMLSDEHFTERYIVESAKKLAERQRRFTRGLAQVGINFLKS  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             N GLF+WM+L +LLKE T   EL LW++IINE+KLNVSPG SFHC E GWFRVCFANMDD
Sbjct  361   NAGLFLWMDLSSLLKEKTVEEELTLWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVS-----LSFRRGLEDCMISS  1605
              TM VAL RIRT  L+ K  +      + +    R + K       L   R +  CM  S
Sbjct  421   ATMEVALRRIRTFALKAKEADVPRKKQSWQNNNLRFSFKSGKYDDVLLSPRMMSPCM-RS  479

Query  1606  PHSPM-NSPLVQA  1641
             PHSP+  SPLV+A
Sbjct  480   PHSPIPQSPLVRA  492



>gb|ABO76785.1| 1-aminocyclopropane-1-carboxylate synthase [Citrullus colocynthis 
x Citrullus lanatus var. lanatus]
Length=486

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/490 (67%), Positives = 402/490 (82%), Gaps = 8/490 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M L S     ++LSK+A  +GHGE+S YFDGWKAYD++PFHP  NP+GVIQMGLAENQL 
Sbjct  1     MVLVSPNNAKKLLSKLAKGNGHGEDSPYFDGWKAYDSDPFHPTMNPRGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             F+ ++ W+ NNP+ASICT +G  EFKD+AI+QDYHGLPEFR AVA FM KVRG+ VKFDP
Sbjct  61    FEFVEKWMKNNPQASICTLEGVYEFKDVAIFQDYHGLPEFRKAVANFMGKVRGNRVKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DR+VMSGGATGAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV+CESSN+F
Sbjct  121   DRVVMSGGATGAHETVAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICESSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+TR ALE+AY++A++ NI++KGLLI NPSNPLGTV DR TL   V F+N+KNIHLVCDE
Sbjct  181   KLTREALETAYEEAEKSNIKIKGLLITNPSNPLGTVYDRQTLETAVAFINEKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQII--QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             IYAATVF++P FISI+++I   ++ C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVV+
Sbjct  241   IYAATVFAEPGFISISEVIDNDDIDCDRNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVA  300

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
             CARKMSSFGLVS+QTQHLIA+MLSD  FV++F+  S+E+L  RH +FT+GLAQVGI  LK
Sbjct  301   CARKMSSFGLVSSQTQHLIASMLSDDAFVDSFLAGSAEKLAARHRNFTKGLAQVGIGYLK  360

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
              +GGLF+WM+LR+LLKE T  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMD
Sbjct  361   GSGGLFLWMDLRHLLKEKTLEAEMALWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANMD  420

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSP  1617
             D TM +++ RIR  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP
Sbjct  421   DNTMDISITRIRNFVLQNK--EVTTKIKKQKFCWRQSSLELRLSSRR-LEDIM--SPHSP  475

Query  1618  M-NSPLVQAT  1644
             +  SP+++AT
Sbjct  476   LPQSPMLRAT  485



>emb|CAN69483.1| hypothetical protein VITISV_035777 [Vitis vinifera]
Length=481

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/482 (68%), Positives = 389/482 (81%), Gaps = 13/482 (3%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             LSKIATND HGENS YFDGWKAYD NPFHP  NP GVIQMGLAENQL F+L++ W+L NP
Sbjct  3     LSKIATNDMHGENSLYFDGWKAYDENPFHPTKNPNGVIQMGLAENQLSFNLMEEWILKNP  62

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             KASICTP+G  +FKD+AI+QDYHGL +FR AVA+FM K RG  VKFDPDRIVMSGGATGA
Sbjct  63    KASICTPEGISQFKDVAIFQDYHGLTQFRNAVAKFMXKARGGRVKFDPDRIVMSGGATGA  122

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
              E++ FCL DPGEAFLVP+PYYP FDRDLRWRT V++ PV C S N+F++TR ALE+AY+
Sbjct  123   DEMIMFCLADPGEAFLVPSPYYPAFDRDLRWRTQVKIRPVECTSXNNFQITREALEAAYQ  182

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQE+NI+VKGL+I NPSNPLGT L R+TL  +V F+N+KNIHLV DEIYAATVFS P F
Sbjct  183   KAQEENIKVKGLIITNPSNPLGTTLSRETLTSLVSFINEKNIHLVADEIYAATVFSSPRF  242

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +S+++I+ EV+CNP+ IHIVYSLSKDLG PGFRVGI+YSYNDAVVSC RKMSSFGLVS+Q
Sbjct  243   VSVSEIMDEVECNPNLIHIVYSLSKDLGLPGFRVGIVYSYNDAVVSCGRKMSSFGLVSSQ  302

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHL+A+MLSD EFV+NF++ESS RL KRH++FT GL  V I  LKSN GLFVWM+LR+L
Sbjct  303   TQHLLASMLSDDEFVDNFLMESSRRLAKRHKTFTEGLVNVNINCLKSNAGLFVWMDLRHL  362

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKEPT   E+ LW++II ++KLNVSPG SF C E GWFRVCFANMD++T+ VAL RIRT 
Sbjct  363   LKEPTLEGEIALWRVIIKDVKLNVSPGSSFQCSEPGWFRVCFANMDEDTVEVALKRIRTF  422

Query  1480  VLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLED-------CMISSPHSPM-NSPLV  1635
             V   KG E A A +  K+    +N  + LSF   + D        M  SPHSPM +SPLV
Sbjct  423   V--GKGQEEAEAPTKAKRW---KNSTLRLSFSSRIYDEAVMTPLTMSMSPHSPMPHSPLV  477

Query  1636  QA  1641
             +A
Sbjct  478   RA  479



>dbj|BAA93713.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=490

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 400/481 (83%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+A  +GHGE+S+YFDGWKAYD++PFHP  NP+GVIQMGLAENQL F+ ++ W+ N
Sbjct  14    KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM KVRG+ VKFDPDR+VMSGGAT
Sbjct  74    NPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVKFDPDRVVMSGGAT  133

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV CESSN+FK+TR ALE+A
Sbjct  134   GAHETMAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVKCESSNNFKLTREALETA  193

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y++A++ NIR+KGLLI NPSNPLGTV DR TL   V F+N+KNIHLVCDEIYAATVFS+P
Sbjct  194   YEEAEKSNIRIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHLVCDEIYAATVFSEP  253

Query  934   EFISIAQII---QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
              FISI+++I    +V+C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSSFG
Sbjct  254   GFISISEVIDNMNDVECDRNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVACARKMSSFG  313

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQ+LIA+ML D  FV+NF+  S+E+L  RH +FT+GLAQVGI  LK +GGLF+WM
Sbjct  314   LVSSQTQYLIASMLLDDVFVDNFLAGSAEKLAVRHRNFTKGLAQVGIGYLKGSGGLFLWM  373

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR+LLKE T  AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDD TM +++ 
Sbjct  374   DLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDSTMDISIT  433

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             RIR  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP+  SP+++A
Sbjct  434   RIRNFVLQNK--EVTTKVKKQKFCWRQSSLELRLSSRR-LEDVM--SPHSPLPQSPMLRA  488

Query  1642  T  1644
             T
Sbjct  489   T  489



>ref|XP_011022618.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Populus 
euphratica]
Length=480

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/490 (68%), Positives = 395/490 (81%), Gaps = 35/490 (7%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS+IA+ +GHGE+S YF+GWKAYD+NP H   NP GVIQMGLAENQLCFDLI++W+ NN
Sbjct  9     LLSRIASGNGHGEDSPYFEGWKAYDSNPHHLTENPNGVIQMGLAENQLCFDLIQDWLKNN  68

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICTP+G  EF+++A++QDYHGLPEFR AVA+FMEKVRG+ V FDPDRIVM+GGATG
Sbjct  69    PKASICTPEGVNEFREVALFQDYHGLPEFRNAVAKFMEKVRGNKVTFDPDRIVMNGGATG  128

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE +AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PV  ESSN+FKVTR ALE+AY
Sbjct  129   AHETIAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLIPVDSESSNNFKVTREALENAY  188

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             + A+ DNI+VKGLLI NPSNPLGT+LDR+TL  IV F+N+KNIHLVCDEIYAATVFSQP+
Sbjct  189   EMAKLDNIKVKGLLITNPSNPLGTMLDRETLRSIVSFINEKNIHLVCDEIYAATVFSQPD  248

Query  937   FISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+I+QE ++CN D +HIVYSLSKD+GFPG RVGIIYSYNDAVVSCARKMSSFGLVS
Sbjct  249   FISIAEILQEDIECNLDLVHIVYSLSKDMGFPGLRVGIIYSYNDAVVSCARKMSSFGLVS  308

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL-KSNGGLFVWMNL  1290
             +QTQH+IA+MLSD EFV  FI +S  RL  RH  FT GLAQV I+ L  SN GLF+WM+L
Sbjct  309   SQTQHMIASMLSDDEFVGKFIRKSKRRLAARHRVFTYGLAQVSIKCLTTSNAGLFLWMDL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
               LL+E TF AE+ LW++II+E+KLNVSPGCSFHC E GWFRVCFANMDD+TM+VAL RI
Sbjct  369   SGLLEEKTFEAEMALWRVIIHEVKLNVSPGCSFHCPEPGWFRVCFANMDDQTMQVALSRI  428

Query  1471  RTSV------------LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHS  1614
             RT V            L+W+G                    + L+  R  +D  I+SPHS
Sbjct  429   RTFVNKDVDTKKPKKTLRWQG-------------------SLKLNSPRIYDD-FINSPHS  468

Query  1615  PM-NSPLVQA  1641
             P+  SPLV+A
Sbjct  469   PIPQSPLVRA  478



>emb|CAA77688.1| 1-aminocyclopropane 1-carboxylate synthase [Vigna radiata var. 
radiata]
Length=484

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/493 (67%), Positives = 403/493 (82%), Gaps = 14/493 (3%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M  K+M  QT +LSK+A  DGHGE+S YFDGWKAYD NPFHP  NP GV+QMGLAENQL 
Sbjct  1     MGFKAM-DQTPLLSKMAIGDGHGESSPYFDGWKAYDQNPFHPTDNPNGVMQMGLAENQLT  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DL+++W+LNNP+ASICTP+G  +F+ IA +QDYHGL EFR AVA+FM + RG+ + FDP
Sbjct  60    SDLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLAEFRNAVAKFMARTRGNRITFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHE+ AFCL DPGEAFLVP PYYPGFDRDLRWRTGV+L PV+C+SSN+F
Sbjct  120   DRIVMSGGATGAHEVTAFCLADPGEAFLVPIPYYPGFDRDLRWRTGVKLVPVMCDSSNNF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
              +T+ ALE AY+KA+EDNIRVKGLLI NPSNPLGT++DR TL  +V F+N+K IHLVCDE
Sbjct  180   VLTKEALEDAYEKAREDNIRVKGLLITNPSNPLGTIMDRKTLRTVVSFINEKRIHLVCDE  239

Query  904   IYAATVFSQPEFISIAQIIQ---EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVV  1074
             IYAATVFSQP FISIA+I++   +++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV
Sbjct  240   IYAATVFSQPGFISIAEILEDETDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVV  299

Query  1075  SCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETL  1254
             +CARKMSSFGLVSTQTQ+L+A+ML+D EFVE F+ ES++RL +R   FT GLA+VGI+ L
Sbjct  300   NCARKMSSFGLVSTQTQYLLASMLNDDEFVERFLAESAKRLAQRFRVFTGGLAKVGIKCL  359

Query  1255  KSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANM  1434
             +SN GLFVWM+LR LLK+PTF +E ELWK+II+E+K+NVSPG SFHC E GWFRVC+ANM
Sbjct  360   QSNAGLFVWMDLRQLLKKPTFDSETELWKVIIHEVKINVSPGYSFHCTEPGWFRVCYANM  419

Query  1435  DDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPH  1611
             DD  +++AL RIR  VLQ K +          +K C   NL++SL  RR   D +  SPH
Sbjct  420   DDMAVQIALQRIRNFVLQNKEV------VVSNKKHCWHSNLRLSLKTRRF--DDITMSPH  471

Query  1612  SPM-NSPLVQATN  1647
             SP+  SP+V+ATN
Sbjct  472   SPLPQSPMVKATN  484



>ref|XP_004252649.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Solanum 
lycopersicum]
Length=473

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/441 (72%), Positives = 372/441 (84%), Gaps = 2/441 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S     ++LSK+ATN+GHGENSAYFDGWKAY+ +PFHP  NP GVIQMGLAENQLC
Sbjct  1     MGFISNINNIELLSKVATNNGHGENSAYFDGWKAYEIDPFHPTKNPNGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ WV+NN K+SICT  G EEFK+IAIYQDYHGLPEFR  VA FM KVRGD +KFD 
Sbjct  61    FDLIQEWVVNNQKSSICTAGGCEEFKEIAIYQDYHGLPEFRRGVASFMSKVRGDKIKFDE  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +RIVMSGGATGAHE+LAFCL DPGEAFLVPTPYYPGFDRDL WRTGVQL+P++CES N+F
Sbjct  121   ERIVMSGGATGAHELLAFCLADPGEAFLVPTPYYPGFDRDLSWRTGVQLFPIICESCNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             KVT+ ALE AY KAQ+ NI +KGLL+NNPSNPLGT+LD + L D +RF+NDKNIHL+CDE
Sbjct  181   KVTKKALEDAYNKAQQSNITIKGLLLNNPSNPLGTILDMEALKDTIRFINDKNIHLICDE  240

Query  904   IYAATVFSQPEF--ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             IYAATVF+ P+F  IS   I ++VQCN D IHIVYSLSKDLGFPGFRVGIIYSYND V  
Sbjct  241   IYAATVFNVPKFISISEIIISEDVQCNLDLIHIVYSLSKDLGFPGFRVGIIYSYNDVVTK  300

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
             CARKMSSFGLVSTQTQ+LI+ ML D  F+E F++ES ERL KRH  FT+GL  +GI TL+
Sbjct  301   CARKMSSFGLVSTQTQYLISNMLLDDTFIEKFVVESRERLEKRHGVFTKGLENIGINTLE  360

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SN GLF WM+LR+LL++ TF +E++LW+MIIN++KLNVSPGCSFHC E GWFRVCFANMD
Sbjct  361   SNAGLFCWMDLRSLLEKNTFESEIKLWRMIINDVKLNVSPGCSFHCCEPGWFRVCFANMD  420

Query  1438  DETMRVALMRIRTSVLQWKGM  1500
             D+TMR+AL RI   V+Q+KG+
Sbjct  421   DDTMRIALRRIEIFVVQYKGI  441



>ref|NP_001267589.1| 1-aminocyclopropane-1-carboxylate synthase-like [Cucumis sativus]
 dbj|BAA33375.1| ACC synthase [Cucumis sativus]
 dbj|BAA93715.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=489

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/480 (68%), Positives = 400/480 (83%), Gaps = 8/480 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSK+A  +GHGE+S+YFDGWKAYD++PFHP  NP+GVIQMGLAENQL F+ ++ W+ N
Sbjct  14    KVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAENQLSFEFVEKWMKN  73

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASIC+ +G +EFKDIAI+QDYHGLPEFR AVA FM KVRG+ VKFDPDR+VMSGGAT
Sbjct  74    NPRASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVKFDPDRVVMSGGAT  133

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PV+CESSN+FK+TR ALE+A
Sbjct  134   GAHETMAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICESSNNFKLTREALETA  193

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y++AQ+ NI++KGLLI NPSNPLGTV DR TL   V F+N+KNIHLVCDEIYAATVF++P
Sbjct  194   YEEAQKSNIKIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHLVCDEIYAATVFAEP  253

Query  934   EFISIAQII--QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
              FISI+++I   +++C+ + +H+VYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSSFGL
Sbjct  254   GFISISEVIDNSDIECDRNLVHVVYSLSKDMGFPGFRVGIIYSYNDAVVACARKMSSFGL  313

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VS+QTQ+LIA+ML D  FV+NF+  S+E+L  RH +FT+GLAQVGI  LK +GGLF+WM+
Sbjct  314   VSSQTQYLIASMLLDDVFVDNFLAGSAEKLAARHRNFTKGLAQVGIGYLKGSGGLFLWMD  373

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR+LLKE T  AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDD TM +++ R
Sbjct  374   LRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDNTMDISITR  433

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQAT  1644
             IR  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP+  SP+ +AT
Sbjct  434   IRNFVLQNK--EVTTKVKKQKFCWRQSSLELRLSSRR-LEDIM--SPHSPLPQSPMHRAT  488



>gb|KHG14845.1| 1-aminocyclopropane-1-carboxylate synthase [Gossypium arboreum]
Length=477

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/423 (73%), Positives = 369/423 (87%), Gaps = 0/423 (0%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             +SKIAT +GHGENSAYFDGWKAY+ NPFHP   P GVIQMGLAENQLCFD I+ W++ +P
Sbjct  4     ISKIATGNGHGENSAYFDGWKAYETNPFHPTDRPDGVIQMGLAENQLCFDFIEKWLMEHP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             +ASICT +G  +FK+ A++QDYHG PEFR AVA+FM KVRGD VKFDPDRIVMSGGATGA
Sbjct  64    EASICTAEGVSKFKETALFQDYHGFPEFRQAVAKFMGKVRGDRVKFDPDRIVMSGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             HE++AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PVVC+S+NDFK+T  +L+SAY 
Sbjct  124   HEMVAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVELVPVVCDSANDFKITIDSLQSAYH  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQE NI++KGLLI NPSNPLGT +D+DTL +I+ FVN+K IHL+ DEIYAATVF++PEF
Sbjct  184   KAQEANIKIKGLLITNPSNPLGTFMDKDTLKNIINFVNEKKIHLIGDEIYAATVFTEPEF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             +SI+++I+EV+CN D IHIVYSLSKD+GFPGFRVGI+YSYND V SCARKMSSFGLVS+Q
Sbjct  244   VSISEVIEEVECNRDLIHIVYSLSKDMGFPGFRVGIVYSYNDTVTSCARKMSSFGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQHLIA MLS+ EF++NF+ ES ERL KRH+ FT  L+Q+GI +LKSN GLF+WM+LR L
Sbjct  304   TQHLIATMLSNDEFIDNFVAESRERLFKRHKYFTWTLSQIGICSLKSNAGLFIWMDLRKL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE TF AE++LW++II+E+KLNVSPG SFHC E GWFRVCFANMDD TM +AL RIR  
Sbjct  364   LKEKTFEAEMDLWRVIIDEVKLNVSPGSSFHCHEPGWFRVCFANMDDYTMEIALSRIRNF  423

Query  1480  VLQ  1488
             +++
Sbjct  424   MVK  426



>gb|ACN78835.1| 1-aminocyclopropane-1-carboxylate synthase [Paeonia suffruticosa]
Length=492

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/494 (68%), Positives = 394/494 (80%), Gaps = 10/494 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S  QQ Q+LSK+AT +GHGE+S YFDGWKAYD+NPFH  +NP GVIQMGLAEN L 
Sbjct  1     MGFMSTDQQKQLLSKMATGNGHGEDSPYFDGWKAYDSNPFHLNNNPNGVIQMGLAENLLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FD+I+ WVLNNPKASICTP+G  EF+D AI+QDYHG PEFR AVA+FM KV G  V FDP
Sbjct  61    FDVIQEWVLNNPKASICTPEGINEFRDTAIFQDYHGFPEFRNAVAKFMGKVGGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHEILAFCL DPG+AFLVPTPYYPG+DRDLRWRTG QL PV C+SSN+F
Sbjct  121   DRIVMSGGATGAHEILAFCLADPGDAFLVPTPYYPGYDRDLRWRTGAQLLPVQCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
              VT +ALE AY+KAQ  NI+VKGL+INNPSNPLGTVL+ +TL  IV F+N+KNIHLVCDE
Sbjct  181   TVTISALELAYEKAQAANIKVKGLIINNPSNPLGTVLNGETLKTIVNFINEKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAATVFSQP FISIA+I+ ++   N + IH+VYSLSKD+GFPGFRVGI+YSYNDAVV+C
Sbjct  241   IYAATVFSQPRFISIAEIVNDMDGVNRNLIHVVYSLSKDMGFPGFRVGIVYSYNDAVVNC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVSTQTQHLIA+MLSD+ F+E +I+ES+ +L +R   FTRGL+QVGI  LKS
Sbjct  301   ARKMSSFGLVSTQTQHLIASMLSDEHFIERYIVESANKLAERQRLFTRGLSQVGINFLKS  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             N GLF+WM+L +LLKE T  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFAN+DD
Sbjct  361   NAGLFLWMDLSSLLKEKTVEAEITLWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANIDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLK------VSLSFRRGLEDCMIS  1602
              TM +AL RI T  L+ K  +      + +    R + K      V LS  R +  CM  
Sbjct  421   ATMDIALRRILTFALKAKEADVPRKKQSWQNNNLRLSFKSGKYDDVKLS-PRMMSPCM-R  478

Query  1603  SPHSPM-NSPLVQA  1641
             SPHSP+  SPLV+A
Sbjct  479   SPHSPIPQSPLVRA  492



>gb|ABC69166.2| 1-aminocyclopropane-1-carboxylate synthase [Paeonia suffruticosa]
Length=492

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/494 (68%), Positives = 393/494 (80%), Gaps = 10/494 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S  QQ Q+LSK+AT +GHGE+S YFDGWKAYD+NPFH  +NP GVIQMGLAEN L 
Sbjct  1     MGFMSTDQQKQLLSKMATGNGHGEDSPYFDGWKAYDSNPFHLNNNPNGVIQMGLAENLLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FD+I+ WVLNNPKASICTP+G  EF+D AI+QDYHG PEFR AVA+FM KV G  V FDP
Sbjct  61    FDVIQEWVLNNPKASICTPEGINEFRDTAIFQDYHGFPEFRNAVAKFMGKVGGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGAHEILAFCL DPG+AFLVPTPYYPG+DRDLRWRTG QL PV C+SSN+F
Sbjct  121   DRIVMSGGATGAHEILAFCLADPGDAFLVPTPYYPGYDRDLRWRTGAQLLPVQCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
              VT +ALE AY+KAQ  NI+VKGL+INNPSNPLGTVL+ +TL  IV F+N+KNIHLVCDE
Sbjct  181   TVTISALELAYEKAQAANIKVKGLIINNPSNPLGTVLNGETLKTIVNFINEKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAATVFS P FISIA+I+ ++   N + IH+VYSLSKD+GFPGFRVGI+YSYNDAVV+C
Sbjct  241   IYAATVFSHPRFISIAEIVNDMNGVNRNLIHVVYSLSKDMGFPGFRVGIVYSYNDAVVNC  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVSTQTQHLIA+MLSD+ F+E +I+ES+ +L +R   FTRGL+QVGI  LKS
Sbjct  301   ARKMSSFGLVSTQTQHLIASMLSDEHFIERYIVESANKLAERQRLFTRGLSQVGINFLKS  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             N GLF+WM+L +LLKE T  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFAN+DD
Sbjct  361   NAGLFLWMDLSSLLKEKTVEAEITLWRVIINEVKLNVSPGSSFHCSEPGWFRVCFANIDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLK------VSLSFRRGLEDCMIS  1602
              TM +AL RI T  L+ K  +      + +    R + K      V LS  R +  CM  
Sbjct  421   ATMDIALRRILTFALKAKEADVPRKKQSWQNNNLRLSFKSGKYDDVKLS-PRMMSPCM-R  478

Query  1603  SPHSPM-NSPLVQA  1641
             SPHSP+  SPLV+A
Sbjct  479   SPHSPIPQSPLVRA  492



>gb|ABB70229.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine max]
Length=476

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/475 (68%), Positives = 395/475 (83%), Gaps = 12/475 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             QTQ+LSK+   DGHGE S YFDGWKAYD NPFHPK NP GVIQMGLAENQL  DL+++W+
Sbjct  7     QTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWI  66

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             LNNP+ASICTP+G  +F+ IA +QDYHGLPEFR AVA+FM + RG+ V FDPDRIVMSGG
Sbjct  67    LNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGG  126

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE+  FCL DPG+AFLVP PYYPGFDRDLRWRTG++L PV+C+SSN+FK+T+ ALE
Sbjct  127   ATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALE  186

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY+KA+EDNIRVKGLLI NPSNPLGTV+DR+TL  ++ F+N+K IHLV DEIY+ATVFS
Sbjct  187   DAYEKAKEDNIRVKGLLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVFS  246

Query  928   QPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
              P FISIA+I++E   ++C+ + +HIVYSLSKD+GFPGFRVGIIYSYNDAVV CARKMSS
Sbjct  247   HPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVHCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A+ML+D EFVE+F++ES++RL +RH  FT GLA+VGI+ L+SN GLFV
Sbjct  307   FGLVSTQTQYLLASMLNDDEFVESFLVESAKRLAQRHRVFTGGLAKVGIKCLQSNAGLFV  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK+PT  +E+ELW++II+E+K+NVSPG SFHC E GWFRVC+ANMDD  +++A
Sbjct  367   WMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIA  426

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSPM  1620
             L RIR  VLQ K +          +K C   NL++SL  RR  +D M+ SPHSP+
Sbjct  427   LQRIRNFVLQNKEI------MVPNKKHCWHSNLRLSLKTRR-FDDIMM-SPHSPI  473



>ref|XP_006444953.1| hypothetical protein CICLE_v10019970mg [Citrus clementina]
 ref|XP_006491186.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Citrus sinensis]
 gb|ESR58193.1| hypothetical protein CICLE_v10019970mg [Citrus clementina]
 gb|KDO86308.1| hypothetical protein CISIN_1g011801mg [Citrus sinensis]
Length=477

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/479 (67%), Positives = 390/479 (81%), Gaps = 10/479 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSKIATN+GHGE+SAYFDGWKA+D NPFHP  NP GVIQ+GLAENQLCFDLIK+W+  N
Sbjct  3     ILSKIATNNGHGEDSAYFDGWKAFDRNPFHPTQNPGGVIQLGLAENQLCFDLIKDWITKN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P ASICT +G E FKDIAI+QDYHGLPEFR AVA+FM K RG  V FDPDRIVM GGATG
Sbjct  63    PYASICTAEGVEVFKDIAIFQDYHGLPEFRQAVAKFMGKGRGGRVTFDPDRIVMGGGATG  122

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E++ FCL +PG+AFLVP+PYY  FDRDL WRTGVQ+ PV C+ SN+FK+TR ALE+AY
Sbjct  123   ANELIMFCLANPGDAFLVPSPYYAAFDRDLSWRTGVQIVPVHCDISNNFKITREALEAAY  182

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             ++AQE +I +KGL+I NPSNPLGT LDRDTL  +V F+NDKNIHLVCDEIYAATVFS P+
Sbjct  183   ERAQEASINIKGLIITNPSNPLGTTLDRDTLKSLVSFINDKNIHLVCDEIYAATVFSSPK  242

Query  937   FISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             F S+A++IQE+ CN D IHI+YSLSKD+G PGFRVGI+YS+ND VV+C RKMSSFGLVS+
Sbjct  243   FTSVAEVIQEMDCNRDLIHIIYSLSKDMGLPGFRVGIVYSFNDTVVNCGRKMSSFGLVSS  302

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQ+L+A+MLSD EFV+NF++E+S+RL KRH +FT+GL QVGI  LKSN GLF WM+LR+
Sbjct  303   QTQYLLASMLSDDEFVDNFLVETSKRLAKRHHNFTKGLEQVGINCLKSNAGLFFWMDLRH  362

Query  1297  LLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRT  1476
             LLKE T   E+ LW+ I+N++KLNVSPG SF C E GWFRVCFANMDD+T++VAL RI  
Sbjct  363   LLKEKTLEGEIALWRTIVNDVKLNVSPGSSFQCTEPGWFRVCFANMDDDTLQVALNRIAA  422

Query  1477  SVLQWKGMEaaaaasakkqkqCRRNLKVSLSFR---RGLEDCMISSPHSPM-NSPLVQA  1641
              V Q K  E         +K+ ++NL+VS S R   +G+    + SPHSP+  SPLV+A
Sbjct  423   FVQQDKESE------KPTKKRWQQNLRVSFSSRIYEQGVMSPHMMSPHSPIPQSPLVRA  475



>dbj|BAB89349.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki]
Length=488

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/473 (70%), Positives = 386/473 (82%), Gaps = 6/473 (1%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             ++LSKIATND HGENS YF GWKAYD+NPFH   NP GVIQMGLAENQL FDLI++W+  
Sbjct  13    RLLSKIATNDEHGENSLYFHGWKAYDDNPFHLTQNPNGVIQMGLAENQLSFDLIEDWMKK  72

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             N +ASICT +G   FK+IA +QDYHGLPEFR AVA+FM KVRG   +FDP RIVM GGAT
Sbjct  73    NQRASICTTEGVHMFKEIANFQDYHGLPEFRNAVAKFMGKVRGGRAEFDPKRIVMGGGAT  132

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E+L FCL DPG+AFLVP+PYYP FDRDLRWRTGV+L PV C+SS+ F++TR ALE A
Sbjct  133   GANELLMFCLADPGDAFLVPSPYYPAFDRDLRWRTGVKLLPVECKSSDSFRITREALEEA  192

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA E NIRVKGL+I NPSNPLGT++DR+TL  +V FVNDKNIH VCDEIYAATVF QP
Sbjct  193   YEKASESNIRVKGLIIGNPSNPLGTIMDRNTLKSLVSFVNDKNIHFVCDEIYAATVFKQP  252

Query  934   EFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             EFIS+++IIQE+ CN D IH+VYSLSKD+G PGFRVGI+YSYND VV+CARKMSSFGLVS
Sbjct  253   EFISVSEIIQEMDCNLDLIHVVYSLSKDMGMPGFRVGIVYSYNDEVVTCARKMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+A+MLSD EFVE FI ESS RL  RH +FT GL +V I+ L+ N GLF WM+LR
Sbjct  313   SQTQHLLASMLSDDEFVERFIGESSRRLENRHRTFTEGLKEVEIKCLEGNAGLFCWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLKE TF AE ELWK+IIN++KLNVSPG SFHC E GWFRVCFANMDDET++VAL RIR
Sbjct  373   PLLKEATFEAETELWKVIINQVKLNVSPGSSFHCSEPGWFRVCFANMDDETVQVALQRIR  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM  1620
             T V + KG  A  AA  KK+KQ +RNL++S S  R  ED  +S    SPHSPM
Sbjct  433   TFVDEKKG--AGKAAPEKKKKQWQRNLRLSFSSGRIYEDGCLSPHVLSPHSPM  483



>gb|EYU23427.1| hypothetical protein MIMGU_mgv1a005590mg [Erythranthe guttata]
Length=478

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/464 (70%), Positives = 377/464 (81%), Gaps = 11/464 (2%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             LSKIATNDGHGENSA+FDGWKAYD++P+HP  NP GVIQMGLAENQL FDL++ WV  NP
Sbjct  5     LSKIATNDGHGENSAFFDGWKAYDSDPYHPTKNPNGVIQMGLAENQLSFDLVQEWVKKNP  64

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
             KASICT +G ++FK+IAI+QDYHGLPEFR AVARFME+VRG+ V+FDP+RIVMSGGATGA
Sbjct  65    KASICTNEGVDDFKEIAIFQDYHGLPEFRNAVARFMERVRGNRVRFDPNRIVMSGGATGA  124

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
              E LAFCL D G+A LVPTPYYPG DRDL WRTG+QL PVVCESS  FK+TR ALE+AYK
Sbjct  125   QETLAFCLADSGDALLVPTPYYPGNDRDLTWRTGIQLLPVVCESSTGFKITREALETAYK  184

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KAQ+ NI+VKGLL+NNPSNPLGT +D+ TL + + F N+K IHL+CDEIY+ATVF QP F
Sbjct  185   KAQDSNIKVKGLLLNNPSNPLGTTIDKQTLTESLTFTNEKQIHLICDEIYSATVFDQPGF  244

Query  940   ISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
              SIA+I +E     NP+ IHIVYSLSKDLGFPGFRVGIIYSYND V +CARKMSSFGLVS
Sbjct  245   TSIAEIFEENPKSYNPNLIHIVYSLSKDLGFPGFRVGIIYSYNDTVTNCARKMSSFGLVS  304

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             TQTQHLIA+MLSD EFV+ FI ES++RL KRHE  TRGLAQVGI +LKSN GLF WM+LR
Sbjct  305   TQTQHLIASMLSDDEFVDRFIPESAKRLAKRHEILTRGLAQVGIGSLKSNAGLFCWMDLR  364

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLKE TF AE ELW+MII ++K+NVSPG  FHC E GWFRVCFANMDDE +RVA+ RI 
Sbjct  365   RLLKEATFEAEAELWRMIIEDVKINVSPGAPFHCSEPGWFRVCFANMDDEAVRVAINRIH  424

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISS  1605
               V+  +  +             R  L+VSLSFRR L++ M+ S
Sbjct  425   EFVMIVQTKKQRYIR--------RGKLEVSLSFRR-LDEIMMGS  459



>ref|XP_010053217.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
 gb|KCW77478.1| hypothetical protein EUGRSUZ_D01817 [Eucalyptus grandis]
Length=486

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/481 (67%), Positives = 395/481 (82%), Gaps = 13/481 (3%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS+ ATNDGH ENS YFDGWKAYD++PFHP  NP GVIQMGLAE+QLCF+L++ W+ NN
Sbjct  11    LLSQKATNDGHAENSPYFDGWKAYDSDPFHPTQNPSGVIQMGLAEHQLCFNLVQKWLENN  70

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G ++F+DIAI+QDYHGLPEFR AVA+FM +VRGD V+FDPDRIVMSGGATG
Sbjct  71    PEASICTKEGVDKFRDIAIFQDYHGLPEFRNAVAKFMGRVRGDKVRFDPDRIVMSGGATG  130

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE++ FCL DPG+A LVPTPYYPGFDRDL WRTGV+L PVVC SSN+FKVTR ALE AY
Sbjct  131   AHELITFCLADPGDALLVPTPYYPGFDRDLCWRTGVRLLPVVCHSSNNFKVTRKALEEAY  190

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KA E NI VKGLLI NPSNPLGT+LDRDTL + + F+N+KNIHLVCDEIYAATVF QP+
Sbjct  191   AKAVEANITVKGLLITNPSNPLGTILDRDTLREAMSFINEKNIHLVCDEIYAATVFRQPD  250

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E Q  N D +HI+YSLSKD+GFPGFRVGI+YSYNDAVV C+RKMSSFGLVS
Sbjct  251   FISIAEIIEEDQEYNRDLVHIIYSLSKDMGFPGFRVGIVYSYNDAVVECSRKMSSFGLVS  310

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+LIA+MLSD +F+E F+LES+ RL  RH+ FT GL QVGI+ L SN GLF+WM+L+
Sbjct  311   SQTQYLIASMLSDDQFIEKFLLESAGRLATRHKDFTDGLRQVGIKCLNSNAGLFLWMDLK  370

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
               L+E T  AE  LW++IIN++KLNVSPG SFHC E GWFR+C ANM++ETM+VAL RI+
Sbjct  371   GFLRESTVEAETALWRVIINDVKLNVSPGSSFHCSEPGWFRICIANMNEETMKVALARIQ  430

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM-NSPLVQ  1638
                   K ++       +K+K  + +L++ LSFRR ++D + S    SPHSP+  SPLV+
Sbjct  431   ------KFVQRNGDKLNRKEKCWQSDLRLRLSFRR-MDDVLRSPCSMSPHSPIPQSPLVR  483

Query  1639  A  1641
             A
Sbjct  484   A  484



>gb|AAF22109.1|AF119411_1 1-aminocyclopropane-1-carboxylate synthase 1 [Lupinus albus]
Length=487

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/495 (66%), Positives = 392/495 (79%), Gaps = 16/495 (3%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             MDL S  +  Q+LSKIATND HGENS YFDGWKAYDNNPFHP  NP GVIQMGLAENQLC
Sbjct  1     MDLGS--KTNQLLSKIATNDKHGENSPYFDGWKAYDNNPFHPSKNPNGVIQMGLAENQLC  58

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W+ NNPKASICT +G  +F+DIA +QDYHGLPEFR A+A FM KVRG  V+FDP
Sbjct  59    FDLIEEWIKNNPKASICTLEGVHKFRDIANFQDYHGLPEFRNALANFMSKVRGGNVRFDP  118

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +RIVMSGGATGA+E++ FCL DPG+AFLVPTPYYP F RDL WRTG+QL PV C+SSN+F
Sbjct  119   NRIVMSGGATGANEVIMFCLADPGDAFLVPTPYYPAFLRDLCWRTGLQLIPVECDSSNNF  178

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+TR ALE AY KA+EDNI VKGL+I NPSNPLGT LDR+TL  ++ F+N+ NIHLVCDE
Sbjct  179   KITREALEKAYNKAKEDNINVKGLIITNPSNPLGTTLDRETLKSLITFINENNIHLVCDE  238

Query  904   IYAATVFSQPEFISIAQIIQEVQ--CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             IYAATVFS P ++S++++IQE+   C  D IHI+YSLSKD+GFPGFRVGI+YS+ND VV+
Sbjct  239   IYAATVFSSPSYVSVSELIQEMDQPCKKDLIHIIYSLSKDMGFPGFRVGIVYSFNDEVVN  298

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
             C RKMSSFGLVS+QTQH++A+MLSD  FV+ F+ ES +RL KRH  F++ L +V I    
Sbjct  299   CGRKMSSFGLVSSQTQHMLASMLSDDSFVDKFLAESKKRLAKRHNIFSKVLEEVNITKFP  358

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SN GLF WMNL++LLKE TF AE+ LW MIINE+KLNVSPG SF+C E GWFRVCFANMD
Sbjct  359   SNAGLFCWMNLKSLLKEQTFEAEMMLWHMIINEVKLNVSPGSSFNCSEPGWFRVCFANMD  418

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSL-SFRRGLEDCMIS----  1602
             DET+ VAL RIRT +    G E        + K  +RNL++S  S RR + + ++S    
Sbjct  419   DETVEVALTRIRTFI----GKE--TKKPEMQVKSWQRNLQLSFSSIRRFVHETIMSPHMM  472

Query  1603  SPHSPM-NSPLVQAT  1644
             SPHSP+  SPLV+AT
Sbjct  473   SPHSPIPQSPLVKAT  487



>emb|CAB60831.1| ACC synthase [Citrus sinensis]
Length=477

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/479 (67%), Positives = 387/479 (81%), Gaps = 10/479 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSKIATN+GHGE+SAYFDGWKA+D NPFHP  NP GVIQ+GLAENQLCFDLIK+W+  N
Sbjct  3     ILSKIATNNGHGEDSAYFDGWKAFDRNPFHPTQNPGGVIQLGLAENQLCFDLIKDWITKN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P ASICT +G E FKDIAI+QDYHGLPEFR AVA+FM K RG  V FDPDRIVM GGATG
Sbjct  63    PYASICTAEGVEVFKDIAIFQDYHGLPEFRQAVAKFMGKGRGGRVTFDPDRIVMGGGATG  122

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E++ FCL +PG+AFLVP+PYY  FDRDL WRTGVQ+ PV C+ SN+FK+TR ALE+AY
Sbjct  123   ANELIMFCLANPGDAFLVPSPYYAAFDRDLSWRTGVQIVPVHCDISNNFKITREALEAAY  182

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             ++AQE +I +KGL+I NPSNPLGT LDRDTL  +V F+NDKNIHLVCDEIYAAT  S P+
Sbjct  183   ERAQEASINIKGLIITNPSNPLGTTLDRDTLKSLVSFINDKNIHLVCDEIYAATALSSPK  242

Query  937   FISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             F S+A++IQE+ CN D IHI+YSLSKD+G PGFRVGI+YS+ND  V+C RKMSSFGLVS+
Sbjct  243   FTSVAEVIQEMDCNRDLIHIIYSLSKDMGLPGFRVGIVYSFNDTAVNCGRKMSSFGLVSS  302

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQ+L+A+MLSD EFV+NF++E+S+RL KRH +FT+GL QVGI  LKSN GLF WM+LR+
Sbjct  303   QTQYLLASMLSDDEFVDNFLVETSKRLAKRHHNFTKGLEQVGINCLKSNAGLFFWMDLRH  362

Query  1297  LLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRT  1476
             LLKE T   E+ LW+ I+N++KLNVSPG SF C E GWFRVCFANMDD+T++VAL RI  
Sbjct  363   LLKEKTLEGEIALWRTIVNDVKLNVSPGSSFQCTEPGWFRVCFANMDDDTLQVALNRIAA  422

Query  1477  SVLQWKGMEaaaaasakkqkqCRRNLKVSLSFR---RGLEDCMISSPHSPM-NSPLVQA  1641
              V Q K  E         +K+ ++NL+VS S R   +G+    + SPHSP+  SPLV+A
Sbjct  423   FVQQDKESE------KPTKKRWQQNLRVSFSSRIYEQGVMSPHMMSPHSPIPQSPLVRA  475



>ref|XP_007051710.1| 1-aminocyclopropane-1-carboxylate synthase [Theobroma cacao]
 gb|EOX95867.1| 1-aminocyclopropane-1-carboxylate synthase [Theobroma cacao]
Length=483

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/435 (71%), Positives = 365/435 (84%), Gaps = 0/435 (0%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             ++  R++ Q+LS++ATND HGENS YFDGWKAYD NPFHP  NP GVIQMGLAENQLCFD
Sbjct  1     MERTRKKGQLLSRMATNDRHGENSPYFDGWKAYDENPFHPSQNPDGVIQMGLAENQLCFD  60

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             LIK W+L NP ASICT +G ++ K+IAIYQDYHGL EFR AVA+FME+V G+ V FDP+R
Sbjct  61    LIKKWILENPDASICTAEGVDKLKNIAIYQDYHGLKEFREAVAKFMERVGGNRVTFDPNR  120

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVM GGATGA+E + FCL DPG+AFLVP PYYP F RDLRWRTG+++ PV C+SSN+F++
Sbjct  121   IVMGGGATGANETVMFCLADPGDAFLVPAPYYPAFARDLRWRTGLEIVPVDCKSSNNFRI  180

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             TR ALE AY+KAQ  NI VKG+++ NPSNPLGTVLDR+T+  +V FVN+K IHLVCDEIY
Sbjct  181   TRAALEEAYEKAQSSNINVKGVILANPSNPLGTVLDRETMRSLVSFVNEKGIHLVCDEIY  240

Query  910   AATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARK  1089
             AATVFS P FISIA+IIQ++ CN D IHIVYSLSKD+GFPGFRVGI+YS+ND VV+CARK
Sbjct  241   AATVFSSPRFISIAEIIQDMDCNRDLIHIVYSLSKDMGFPGFRVGIVYSFNDVVVNCARK  300

Query  1090  MSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGG  1269
             MSSFGLVS+QTQ+L+A+MLSD+EFV NF+ ESS+RL +RH  FT+GL QVGI  LKSN G
Sbjct  301   MSSFGLVSSQTQYLLASMLSDEEFVGNFLRESSKRLARRHSVFTKGLEQVGISCLKSNAG  360

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             LF WMN+R LLKE T   ELELW+ II+E+KLNVSPG SF C E GWFRVCFANMDDET+
Sbjct  361   LFFWMNMRPLLKEQTAQGELELWRAIISEVKLNVSPGSSFQCSEPGWFRVCFANMDDETV  420

Query  1450  RVALMRIRTSVLQWK  1494
              VAL RIR  VLQ K
Sbjct  421   EVALERIRAFVLQGK  435



>emb|CAN77934.1| hypothetical protein VITISV_021265 [Vitis vinifera]
Length=456

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/454 (71%), Positives = 377/454 (83%), Gaps = 18/454 (4%)
 Frame = +1

Query  229   IATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNPKAS  408
             IAT++GHGENS YFDGWKAYD++P+HP  NP GVIQMGLAENQL FD+I+ W+L NPKAS
Sbjct  1     IATDNGHGENSPYFDGWKAYDSDPYHPIENPGGVIQMGLAENQLSFDIIEEWLLKNPKAS  60

Query  409   ICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGAHEI  588
             ICT +G  EF+D+AI+QDYHGL EFR AVA+FM KVRGD V FDPDRIVMSGGATGAHE+
Sbjct  61    ICTVEGMSEFRDVAIFQDYHGLKEFRNAVAKFMGKVRGDRVVFDPDRIVMSGGATGAHEL  120

Query  589   LAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYKKAQ  768
             + FCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVCESSNDFK+TR ALE+AY+KAQ
Sbjct  121   VTFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLLPVVCESSNDFKITREALEAAYEKAQ  180

Query  769   EDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEFISI  948
             EDN +VKGLLI NPSNPL            V FVN+K IHL+ DEIYAATVFS P FIS+
Sbjct  181   EDNXKVKGLLITNPSNPL------------VXFVNEKXIHLISDEIYAATVFSSPGFISV  228

Query  949   AQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQTQH  1128
             ++II E++CN D IHIVYSLSKD+GFPGFRVGI+YSYND VV+  RKMSSFGLVS+QTQH
Sbjct  229   SEIIDEMECNXDLIHIVYSLSKDMGFPGFRVGIVYSYNDDVVNIGRKMSSFGLVSSQTQH  288

Query  1129  LIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNLLKE  1308
             LIA+MLSD EFVE+FI ++SE+L  R+++F+RGL+QVGI  LKSN GLF WM+LR LLKE
Sbjct  289   LIASMLSDDEFVESFITKNSEKLATRYKTFSRGLSQVGIGCLKSNAGLFFWMDLRRLLKE  348

Query  1309  PTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTSVLQ  1488
             PT  AE+ LW++IINE+KLNVSPG SFHC E GWFRVCFANMDDETM VAL RIR  VL+
Sbjct  349   PTVEAEMALWRLIINEVKLNVSPGSSFHCSEPGWFRVCFANMDDETMEVALRRIRNFVLK  408

Query  1489  WKGMEaaaaasakkqkqCRRNLKVSLSFRRGLED  1590
              K  E      + K+++ + NLKV LSF RGL++
Sbjct  409   AKEKE-----VSAKRQRWQNNLKVRLSF-RGLDE  436



>ref|XP_002511916.1| acc synthase, putative [Ricinus communis]
 gb|EEF50585.1| acc synthase, putative [Ricinus communis]
Length=482

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/482 (67%), Positives = 393/482 (82%), Gaps = 7/482 (1%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             + Q+LS+IATN+GHGENSAYFDGWKAYD NPFHP  NP GVIQMGLAENQL FDLI++W+
Sbjct  3     RDQLLSRIATNEGHGENSAYFDGWKAYDRNPFHPIDNPDGVIQMGLAENQLSFDLIRDWI  62

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
               NP+ASIC  +GA +FKD+A +QDYHGLPEFR A+A+FM KVRG+ V FDPDRIVM GG
Sbjct  63    KRNPEASICNLEGASKFKDVANFQDYHGLPEFRQAIAKFMGKVRGNRVTFDPDRIVMGGG  122

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGA+E + FCL DPG+AFLVP+PYYP FDRDL WRTGV++ P+ C S+N+F++T+ ALE
Sbjct  123   ATGANETIMFCLADPGDAFLVPSPYYPAFDRDLTWRTGVKIIPIDCYSTNNFQITKEALE  182

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY  A++  I +KGL++ NPSNPLGT+L+R TL D+V F+N++NIHLV DEIYAAT+FS
Sbjct  183   VAYATAKKSGINIKGLILANPSNPLGTILNRKTLKDLVSFINERNIHLVIDEIYAATIFS  242

Query  928   QPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
              P F+SI++II+E+ CN D IHIVYSLSKD+G PGFRVGIIYSYNDAVV CARKMSSFGL
Sbjct  243   SPNFVSISEIIREMDCNRDLIHIVYSLSKDMGLPGFRVGIIYSYNDAVVCCARKMSSFGL  302

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VS+QTQ+L+AAMLSD+ FV++F+ ESS RL+KRH  FT+GL QVGI  LKSN GLFVWM+
Sbjct  303   VSSQTQYLLAAMLSDEVFVDDFLAESSRRLKKRHSLFTKGLEQVGITCLKSNAGLFVWMD  362

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             L +LL+E TF  E+ LW++IINE+KLNVSPG SFHC+E GWFRVCFANMDDET+  AL R
Sbjct  363   LHHLLEEQTFDGEMALWRVIINEVKLNVSPGSSFHCKEPGWFRVCFANMDDETVATALKR  422

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPM-NSPLV  1635
             IR  V   KG E     S K  K+ ++NL++S S RR  E  M   I SPHSP+ +SPLV
Sbjct  423   IRAFV--GKGKE-EQEKSTKTSKRWQKNLRLSFSGRRFEEGVMSPRIMSPHSPIAHSPLV  479

Query  1636  QA  1641
             +A
Sbjct  480   RA  481



>ref|XP_010261352.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nelumbo 
nucifera]
Length=492

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/483 (68%), Positives = 385/483 (80%), Gaps = 10/483 (2%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +QQ  +LSKIA +DGH E+S YFDGWKAYD +P+HP  NP GVIQMGLAENQLCFDLI++
Sbjct  9     QQQHHLLSKIANSDGHSEDSLYFDGWKAYDKDPYHPTQNPNGVIQMGLAENQLCFDLIED  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W   +P+ASICT +G + FKDIA +QDYHGL  FR AVA FM KVRG  V FDPDRIVMS
Sbjct  69    WTKRHPEASICTAEGIKGFKDIATFQDYHGLLTFRKAVANFMGKVRGGRVTFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGA E+LAFCL DPG+AFLVP+PYYP FDRDLRWRTGVQL+PV+CESSN+FK+T  A
Sbjct  129   GGATGAQELLAFCLADPGDAFLVPSPYYPAFDRDLRWRTGVQLFPVICESSNNFKITMAA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE AY+KAQE N+RVKGLLI NPSNPLGTVLDRDTL  +VRF+N KNIHLVCDEIYAATV
Sbjct  189   LEDAYRKAQEANVRVKGLLITNPSNPLGTVLDRDTLKSLVRFINQKNIHLVCDEIYAATV  248

Query  922   FSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             F+ P FISI++II E  + CN D IH+VYSLSKD+G PGFRVGI+YSYNDAVV+C RKMS
Sbjct  249   FNHPNFISISEIINEEDISCNRDLIHLVYSLSKDMGLPGFRVGIVYSYNDAVVNCGRKMS  308

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQ+L+A+MLSD EFVE  I ES +RL  RH+ FT  L +VGI  LKSN GLF
Sbjct  309   SFGLVSSQTQYLLASMLSDNEFVERLIEESGKRLATRHKVFTAKLLEVGITCLKSNAGLF  368

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLKE T  AE+ LW++II+E+KLNVSPG SFHC E GWFRVCFANMD ETM V
Sbjct  369   CWMDLRPLLKESTVEAEMALWRVIIDEVKLNVSPGSSFHCTEPGWFRVCFANMDSETMEV  428

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRG--LEDCMIS----SPHSP  1617
             AL RI++ V + K  EAA    A K K  R NL++S +  R    E+ ++S    SPHSP
Sbjct  429   ALQRIQSFVRKPK--EAAEVPVAVKAKPLRNNLRLSFTRTRSRRFEEFVMSPHLISPHSP  486

Query  1618  MNS  1626
             + S
Sbjct  487   LVS  489



>ref|XP_010279043.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nelumbo 
nucifera]
Length=482

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/479 (69%), Positives = 380/479 (79%), Gaps = 9/479 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             QQ  +LSKIATNDGH E S YFDGWKAYD +PFHP  NP GVIQMGLAENQLCFDLI++W
Sbjct  5     QQYNVLSKIATNDGHSEESPYFDGWKAYDRDPFHPTQNPNGVIQMGLAENQLCFDLIEDW  64

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  +P+ASICT QG   FKD AI+QDYHGL  FR AVA FM +VRG  + FDP+RIVMSG
Sbjct  65    INRHPEASICTTQGVNGFKDTAIFQDYHGLLSFRKAVANFMGRVRGGRITFDPERIVMSG  124

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA E+LAFCL DPG+AFLVP+PYYP FDRDLRWRTGVQL PV+C SSN F +TR AL
Sbjct  125   GATGAQEMLAFCLADPGDAFLVPSPYYPAFDRDLRWRTGVQLVPVICNSSNKFNITRGAL  184

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AYKKAQE NI+VKGL++ NPSNPLGT+LDRDTL  +V F+N KNIHLV DEIYA TVF
Sbjct  185   EEAYKKAQEANIKVKGLVVTNPSNPLGTILDRDTLKTLVSFINQKNIHLVSDEIYAGTVF  244

Query  925   SQP-EFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             S P  FISI++II+E  +CN D IHIVYSLSKD+G PGFRVGI+YSYNDAV++ +RKMSS
Sbjct  245   SHPTNFISISEIIEEDTECNRDLIHIVYSLSKDMGLPGFRVGIVYSYNDAVMNSSRKMSS  304

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQHLIA++LSD EFVE+FI ES+ RL  RH+ FT  LAQVGI+ LKSN GLF 
Sbjct  305   FGLVSTQTQHLIASILSDNEFVESFIQESAIRLATRHKIFTTKLAQVGIDCLKSNAGLFF  364

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLKEPT  AE+ELW++IIN++KLNVSPG SFHC E GWFRVCFANMD E M VA
Sbjct  365   WMDLRGLLKEPTAEAEMELWRVIINDVKLNVSPGSSFHCTEPGWFRVCFANMDSEIMEVA  424

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPMNS  1626
             L RI+  VL  K     A    K +   + NL++SLS RR  E  M   + SPHSP+ S
Sbjct  425   LRRIQNFVLHPK----EANVPVKNKSWLKNNLRLSLSSRRYEEVVMSPHLISPHSPLVS  479



>ref|XP_004492797.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Cicer arietinum]
Length=483

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/482 (66%), Positives = 388/482 (80%), Gaps = 12/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATN+ HGENS YFDGWKAY++NPFHP  NPQGVIQMGLAENQLCFDLI+ W+ N
Sbjct  9     QLLSKIATNNKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCFDLIEEWIRN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICTP+G  +F+ IA +QDYHGLPEFR AVA FM KVRG  V+FDPDRI+MSGGAT
Sbjct  69    NPKASICTPEGVNQFRHIANFQDYHGLPEFRNAVANFMSKVRGGRVRFDPDRILMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL DPG+AFLVP+PYYP F RDL WRTG+QL PV C+SSN+FK+TR ALE A
Sbjct  129   GANELIMFCLADPGDAFLVPSPYYPAFVRDLCWRTGMQLIPVQCDSSNNFKITREALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+ + I VKGL+I NPSNPLGT ++++ L  IV F+N+KNIHLVCDEIYA TVF+ P
Sbjct  189   YEKAKSEKINVKGLIITNPSNPLGTTIEKERLKSIVNFINEKNIHLVCDEIYAGTVFTTP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              F S+++++QE++ C  D IHI+YSLSKD+G PGFRVG++YSYND VV+C RKMSSFGLV
Sbjct  249   NFTSVSEVLQEIEHCKKDLIHIIYSLSKDMGLPGFRVGLVYSYNDEVVNCGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH +A+MLSD  FVENF+ ESS RL++R E FT+GL +V I  L SN GLF WMNL
Sbjct  309   SSQTQHFLASMLSDNMFVENFLAESSRRLKERREFFTKGLEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             ++LLKE TF  E+ LW++IINE+KLNVSPG SF+C E GW+RVCFANMDDET+ +ALMRI
Sbjct  369   KSLLKEKTFEGEMMLWRLIINEVKLNVSPGSSFNCSEPGWYRVCFANMDDETVEIALMRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQ  1638
             R  V + KG          + K+   NL++S S RR  E+ M   + SPHSPM +SPLV+
Sbjct  429   RAFVGRQKG-------KTVEIKRWNSNLRLSFSSRRFEENVMSPHMMSPHSPMPHSPLVR  481

Query  1639  AT  1644
             AT
Sbjct  482   AT  483



>ref|XP_003622479.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
 gb|KEH18801.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=480

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/484 (65%), Positives = 388/484 (80%), Gaps = 13/484 (3%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +  Q+LSKIATND HGENS YFDGWKAY+ NPFHP+ NPQGVIQMGLAENQLCFDLI+ W
Sbjct  6     ESYQLLSKIATNDQHGENSPYFDGWKAYEKNPFHPRKNPQGVIQMGLAENQLCFDLIEEW  65

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             + NNPKASICTP+G  +F+DIA +QDYHGLPEF +A+A+FM KVRG  V+FDP+RI+MSG
Sbjct  66    IKNNPKASICTPEGVCKFRDIANFQDYHGLPEFTSAMAKFMSKVRGGRVRFDPNRILMSG  125

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E++ FCL DPG+AFLVPTPYYPGF RDL WRT VQL PV C+SSN+FK+TR AL
Sbjct  126   GATGANELIMFCLADPGDAFLVPTPYYPGFVRDLCWRTKVQLIPVHCDSSNNFKITREAL  185

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AYKKAQE+NI VKGL+I NPSNPLGT LD++TL  ++ F+N+K IHLVCDEIYAATVF
Sbjct  186   EVAYKKAQENNINVKGLIITNPSNPLGTTLDKETLKSLITFINEKTIHLVCDEIYAATVF  245

Query  925   SQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
             + P ++S+++++QE++CN D IH++YSLSKDLGFPGFRVGI+YSYND VV+C RKMSSFG
Sbjct  246   TSPSYVSVSEVVQEMKCNLDLIHVIYSLSKDLGFPGFRVGIVYSYNDQVVNCGRKMSSFG  305

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQ+++A+MLSD++FV+ F+LESS RL KRH+ FT+GL +V I    SN GLF WM
Sbjct  306   LVSSQTQYMLASMLSDEKFVDKFLLESSRRLLKRHDKFTKGLEEVEISRFPSNAGLFCWM  365

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             NL+ LLKE T   EL+LW +IINE+KLNVSPG SF+C E GWFRVCFAN+DDET+ +AL 
Sbjct  366   NLKKLLKEETIEEELKLWHVIINEVKLNVSPGSSFNCSEVGWFRVCFANIDDETVEIALQ  425

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM----NSPL  1632
             RIR  V    G E       K     R    +SLSF     D  + SPH+ +    +SPL
Sbjct  426   RIRAFV----GKETKKKIEVK-----RWQPNLSLSFTSTRFDENVLSPHNHIIISPHSPL  476

Query  1633  VQAT  1644
             V+AT
Sbjct  477   VRAT  480



>gb|ACD87813.1| putative ACC synthase [Vicia faba]
Length=487

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/482 (66%), Positives = 391/482 (81%), Gaps = 8/482 (2%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             Q Q+LSKIA  DGHGE S+YFDGWKAYD +PFHP  NP GVIQMGLAENQL  DL++NW+
Sbjct  8     QPQLLSKIAIGDGHGETSSYFDGWKAYDKDPFHPSKNPHGVIQMGLAENQLTADLVQNWI  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             ++NP+ASICT +G   FK +A +QDYHGLPEFR AVA+FM + RG+ V FDPDRIVMSGG
Sbjct  68    MDNPEASICTLEGVHNFKRMANFQDYHGLPEFRNAVAKFMSRTRGNRVTFDPDRIVMSGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE  AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L PV+CESSN+FK+T+ ALE
Sbjct  128   ATGAHEATAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLVPVICESSNNFKLTKQALE  187

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY+KA++DNI +KGLLI NPSNPLGTV+D +TL  ++ F+N+K IHL+ DEIYAATVFS
Sbjct  188   EAYEKAKQDNITIKGLLITNPSNPLGTVMDGNTLRTVIGFINEKRIHLISDEIYAATVFS  247

Query  928   QPEFISIAQIIQ---EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
              P FISIA+II+   +++C+ + +HIVYSLSKD+GFPGFRVGIIYSYND VV C+RKMSS
Sbjct  248   HPSFISIAEIIEHDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDTVVDCSRKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A MLSD EFVE F+ ES++RL +R+  FT GL +VGI+ L+SNGGLFV
Sbjct  308   FGLVSTQTQYLMAKMLSDDEFVEKFLAESAKRLAQRYRVFTSGLIKVGIKCLQSNGGLFV  367

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK  TF +ELELW++II+E+K+NVSPG SFHC E GWFRVC+AN DD  +++A
Sbjct  368   WMDLRGLLKNATFESELELWRVIIHEVKINVSPGVSFHCSEPGWFRVCYANKDDRDVQIA  427

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLV  1635
             L RIR+ V Q    + A  +    +     NL++SL  RR  +D M+ SPHSP+  SPLV
Sbjct  428   LQRIRSFVTQ--NNKEAMVSDKNSKPCWHSNLRLSLKSRR-FDDIMM-SPHSPIPQSPLV  483

Query  1636  QA  1641
             +A
Sbjct  484   KA  485



>gb|AAD04199.1| 1-aminocyclopropane-1-carboxylate synthase [Pisum sativum]
Length=487

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/483 (66%), Positives = 391/483 (81%), Gaps = 8/483 (2%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             Q Q+LSKIA  DGHGE S+YFDGWKAYD +PFHP  NP GVIQMGLAENQL  D+++NW+
Sbjct  8     QPQLLSKIAMGDGHGEASSYFDGWKAYDKDPFHPSKNPHGVIQMGLAENQLTADMVQNWI  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
             ++NP+ASICT +G   FK +A +QDYHGLPEFR AVA+FM + RG+ V FDP+RIVMSGG
Sbjct  68    MSNPEASICTLEGVHNFKQMANFQDYHGLPEFRNAVAKFMSRTRGNRVTFDPERIVMSGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGAHE  AFCL D GEA LVPTPYYPGFDRDLRWRTGV+L PV+CESSN+FK+T+ ALE
Sbjct  128   ATGAHEATAFCLADRGEALLVPTPYYPGFDRDLRWRTGVKLVPVICESSNNFKLTKQALE  187

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
              AY+KA+EDNIR KGLLI NPSNPLGTV+DR+TL  ++ F+N+K IHL+ DEIYAATVFS
Sbjct  188   EAYEKAKEDNIRFKGLLITNPSNPLGTVMDRNTLRTVITFINEKRIHLISDEIYAATVFS  247

Query  928   QPEFISIAQIIQ---EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
              P FISIA+II+   +++C+ + +HIVYSLSKD+GFPGFRVGIIYSYND VV C RKMSS
Sbjct  248   HPSFISIAEIIEHDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDTVVDCTRKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+LIA MLSD +FVE F+ ES++RL +R+  FT GL +VGI+ L+SNGGLFV
Sbjct  308   FGLVSTQTQYLIAKMLSDDDFVEKFLPESAKRLAQRYRVFTGGLIKVGIKCLQSNGGLFV  367

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK  TF +E+ELW++II+E+K+NVSPG SFHC E GWFRVC+ANMDD  +++A
Sbjct  368   WMDLRGLLKNATFESEIELWRVIIHEVKINVSPGVSFHCSEPGWFRVCYANMDDRDVQIA  427

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLV  1635
             L RIR+ V Q    + A  +    +     NL++SL  RR  +D M+ SPHSP+  SPLV
Sbjct  428   LQRIRSFVTQ--NNKEAMGSDKNSKPYWHSNLRLSLKPRR-FDDIMM-SPHSPIPQSPLV  483

Query  1636  QAT  1644
             +AT
Sbjct  484   KAT  486



>gb|ABM66813.1| ACC synthase [Gossypium hirsutum]
Length=493

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/489 (66%), Positives = 391/489 (80%), Gaps = 11/489 (2%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             R+  Q+LS+IATND HGENS YFDGWKAYD++PFHP HNP GVIQMGLAEN L FDLI+ 
Sbjct  5     RKNRQLLSRIATNDRHGENSPYFDGWKAYDSSPFHPIHNPDGVIQMGLAENPLSFDLIEK  64

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W+  NP ASICT +G ++FK IAIYQDYHGL EFR AVA+FM +V G  V FDP+RIVMS
Sbjct  65    WIRENPDASICTAEGLDKFKHIAIYQDYHGLREFREAVAKFMGRVGGSRVTFDPNRIVMS  124

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGA+E + FCL DPG+AFLVP+PYY GF RDLRWRTGV++ PV C+SSN+F++TR A
Sbjct  125   GGATGANETVIFCLADPGDAFLVPSPYYAGFARDLRWRTGVEIVPVHCKSSNNFRITRAA  184

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE AY+KAQ  NI +KG++I NPSNPLGTVLD++TL  IV FV DKNIHLV DE YAATV
Sbjct  185   LEEAYEKAQRSNINIKGVIITNPSNPLGTVLDKETLRSIVSFVTDKNIHLVSDEXYAATV  244

Query  922   FSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
             FS P FIS+A+++Q++ CN D IHIVYSLSKD+GFPGFRVGI+YS+ND V +CARKMSSF
Sbjct  245   FSSPRFISVAEVMQDMDCNRDLIHIVYSLSKDMGFPGFRVGIVYSFNDDVTNCARKMSSF  304

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVS+QTQ L+A+MLSD EFV NF+ ESS+RL KRH  FT+GL +VGI T+KSN GLF W
Sbjct  305   GLVSSQTQFLLASMLSDDEFVGNFLRESSKRLAKRHHVFTKGLEEVGISTIKSNAGLFFW  364

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M++R LLKE T  AE+ELW++IIN++KLNVSPG SF C E GWFRVCFANMDD+T+ VAL
Sbjct  365   MDMRQLLKEQTTKAEIELWRVIINKVKLNVSPGSSFQCSEPGWFRVCFANMDDKTVEVAL  424

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRR----NLKVSLSFRRGLEDCMIS----SPHSP  1617
              RIR  VLQ  G E     + K Q Q +R    NL++S S  R  ++ ++S    SPHSP
Sbjct  425   DRIREFVLQ--GKEETKLEADKSQAQAQRWRKQNLRLSFSSSRLYDESLMSPHMISPHSP  482

Query  1618  M-NSPLVQA  1641
             + +SPLV+A
Sbjct  483   IPHSPLVRA  491



>gb|AAA86471.1| 1-aminocyclopropane 1-carboxylate synthase, partial [Pelargonium 
x hortorum]
Length=390

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/390 (78%), Positives = 350/390 (90%), Gaps = 2/390 (1%)
 Frame = +1

Query  265   YFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNPKASICTPQGAEEFKD  444
             YFDGWKAYDNNPFH   NPQGVIQMGLAENQL F+LI+ WVLNNP+ASICT QG +EFKD
Sbjct  1     YFDGWKAYDNNPFHLTQNPQGVIQMGLAENQLSFELIEQWVLNNPQASICTAQGLQEFKD  60

Query  445   IAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGAHEILAFCLVDPGEAF  624
              AI+QDYHGLPEFR AVA FM KVRG+ V F+PDRIVMSGGATGAHE++AFCL DPG+AF
Sbjct  61    TAIFQDYHGLPEFRYAVANFMGKVRGNRVTFNPDRIVMSGGATGAHEMIAFCLADPGDAF  120

Query  625   LVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYKKAQEDNIRVKGLLIN  804
             LVPTPYYPGFDRDLRWRTGVQL PVVCES N+F++TR+ALE AY++AQEDNIRVKGLLI 
Sbjct  121   LVPTPYYPGFDRDLRWRTGVQLIPVVCESENNFRITRSALEEAYERAQEDNIRVKGLLIT  180

Query  805   NPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEFISIAQIIQE--VQCN  978
             NPSNPLGT+LDR+TL  +V F+N+KNIHLVCDEIYAATVFSQP F+SIA++I++  V CN
Sbjct  181   NPSNPLGTILDRETLVSLVSFINEKNIHLVCDEIYAATVFSQPAFVSIAEVIEQENVSCN  240

Query  979   PDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQTQHLIAAMLSDKE  1158
              D IHIVYSLSKD+GFPGFRVGI+YSYNDAVV+CARKMSSFGLVSTQTQHLIA+MLSD E
Sbjct  241   RDLIHIVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKMSSFGLVSTQTQHLIASMLSDDE  300

Query  1159  FVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNLLKEPTFAAELELW  1338
             FV+ FI+ES++RL +R+ +FTRGLAQV I +LKSNGGLF+WM+LR LLKE TF AE+ LW
Sbjct  301   FVDTFIVESAKRLARRYATFTRGLAQVHIGSLKSNGGLFIWMDLRRLLKEKTFEAEMALW  360

Query  1339  KMIINEMKLNVSPGCSFHCQEAGWFRVCFA  1428
             ++IINE+KLNVSPG SFHC E GWFRVCFA
Sbjct  361   RVIINEVKLNVSPGASFHCSEPGWFRVCFA  390



>ref|NP_001275873.1| 1-aminocyclopropane-1-carboxylate synthase 1-like [Citrus sinensis]
 emb|CAA09477.1| ACC synthase [Citrus sinensis]
Length=459

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/429 (71%), Positives = 362/429 (84%), Gaps = 0/429 (0%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSKIATN+GHGE+SAYFDGWKA+D NPFHP  NP GVIQ+GLAENQLCFDLIK+W+  N
Sbjct  3     ILSKIATNNGHGEDSAYFDGWKAFDRNPFHPTQNPGGVIQLGLAENQLCFDLIKDWITKN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P ASICT +G E FKDIAI+QDYHGLPEFR AVA+FM K RG  V FDPDRIVM GGATG
Sbjct  63    PYASICTAEGVEVFKDIAIFQDYHGLPEFRQAVAKFMGKGRGGRVTFDPDRIVMGGGATG  122

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E++ FCL +PG+AFLVP+PYY  FDRDL WRTGVQ+ PV C+ SN+FK+TR ALE+AY
Sbjct  123   ANELIMFCLANPGDAFLVPSPYYAAFDRDLSWRTGVQIVPVHCDISNNFKITREALEAAY  182

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             ++AQE +I +KGL+I NPSNPLGT LDRDTL  +V F+NDKNIHLVCDEIYAATVFS P+
Sbjct  183   ERAQEASINIKGLIITNPSNPLGTTLDRDTLKSLVSFINDKNIHLVCDEIYAATVFSSPK  242

Query  937   FISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             F S+A++IQE+ CN D IHI+YSLSKD+G PGFRVGI+YS+ND VV+C RKMSSFGLVS+
Sbjct  243   FTSVAEVIQEMDCNRDLIHIIYSLSKDMGLPGFRVGIVYSFNDTVVNCGRKMSSFGLVSS  302

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQ+L+A+MLSD EFV+NF++E+S+RL KRH +FT+GL QVGI  LKSN GLF WM+LR+
Sbjct  303   QTQYLLASMLSDDEFVDNFLVETSKRLAKRHHNFTKGLEQVGINCLKSNAGLFFWMDLRH  362

Query  1297  LLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRT  1476
             LLKE T   E+ LW+ I+N++KLNVSPG SF C E GWFRVCFANMDD+T++VAL RI  
Sbjct  363   LLKEKTLEGEIALWRTIVNDVKLNVSPGSSFQCTEPGWFRVCFANMDDDTLQVALNRIAA  422

Query  1477  SVLQWKGME  1503
              V Q K  E
Sbjct  423   FVQQDKESE  431



>gb|AAM21682.1|AF500119_1 1-aminocyclopropane-1-carboxylate synthase 1 [Persea americana]
Length=489

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/430 (72%), Positives = 360/430 (84%), Gaps = 5/430 (1%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
              +LSK+ATNDGHGE S  FDGWKAYDN+P+HP  NPQGVIQMGLAENQLCFDLI+ W+  
Sbjct  10    SLLSKMATNDGHGEKSRIFDGWKAYDNDPYHPTTNPQGVIQMGLAENQLCFDLIEEWIKK  69

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPK SICT +GA EFKDIA+YQDYHGLP FR+A+A+FMEKVRG   KF+PDRIVMSGGAT
Sbjct  70    NPKWSICTAEGASEFKDIALYQDYHGLPAFRSAIAKFMEKVRGGRAKFNPDRIVMSGGAT  129

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GAHE++AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVC   NDFK+TR ALE A
Sbjct  130   GAHELVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCYGKNDFKITRVALEEA  189

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             YKKAQEDNIRVKG++I NPSNPLGTVLDR+TL  I +FVN+KNIHLVCDEI+AATVF+QP
Sbjct  190   YKKAQEDNIRVKGVIITNPSNPLGTVLDRETLRSIAKFVNEKNIHLVCDEIFAATVFNQP  249

Query  934   EFISIAQII-----QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             +FI I++I+     ++VQ N D  H+VYSLSKDLGFPGFRVG++YSYND V++C RKMSS
Sbjct  250   DFIGISEILEEEEEEDVQYNLDLFHVVYSLSKDLGFPGFRVGVVYSYNDDVMNCGRKMSS  309

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+LIA MLSD+ FVENF+ ES  RL  RH+ FT+ L +VGI  L SN GL+ 
Sbjct  310   FGLVSTQTQYLIAGMLSDEVFVENFLAESHRRLAARHKFFTKDLDEVGIGCLNSNAGLYC  369

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             W++LR LLKE T A E+ LW+ IINE+KLNVSPG S H  E GWFRVCFANMDDETM+ A
Sbjct  370   WVDLRRLLKEATVAGEIALWRTIINEVKLNVSPGSSCHSSEPGWFRVCFANMDDETMKEA  429

Query  1459  LMRIRTSVLQ  1488
             + RIR  V +
Sbjct  430   IKRIRKFVFE  439



>ref|XP_004510689.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Cicer arietinum]
Length=480

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/488 (65%), Positives = 391/488 (80%), Gaps = 14/488 (3%)
 Frame = +1

Query  196   SMRQQT-QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDL  372
             S+R ++ Q+LSKIATND HGENS YFDGW AY  NPFHP  NPQGVIQMGLAENQLCFDL
Sbjct  2     SLRSESYQLLSKIATNDQHGENSPYFDGWTAYKKNPFHPTTNPQGVIQMGLAENQLCFDL  61

Query  373   IKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRI  552
              + W+ NNPKASICTP+G  +F+DIA +QDYHGLPEF +A+A +M KVRG  V+FDP+RI
Sbjct  62    FEEWMKNNPKASICTPEGVHKFRDIANFQDYHGLPEFTSAMANYMSKVRGGRVRFDPNRI  121

Query  553   VMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVT  732
             +MSGGATGA+E++ FCL DPG+AFLVPTPYYP F RDL WRT  QL PV C+SSN+FK+T
Sbjct  122   LMSGGATGANELIMFCLADPGDAFLVPTPYYPAFLRDLCWRTKAQLIPVHCDSSNNFKIT  181

Query  733   RTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYA  912
             R ALE++YKKAQEDNI VKGL+I NPSNPLGT ++++TL  IV F+N+K IHLVCDEIYA
Sbjct  182   REALEASYKKAQEDNINVKGLIITNPSNPLGTTIEKETLKSIVSFINEKTIHLVCDEIYA  241

Query  913   ATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             ATVFS P ++S++++IQE++CN + IHI+YSLSKDLGFPGFRVGI+YSYND VVSC RKM
Sbjct  242   ATVFSSPSYVSVSEVIQEMKCNLNLIHIIYSLSKDLGFPGFRVGIVYSYNDEVVSCGRKM  301

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQ+++A+MLSD++FV+ F+LESS RL KRHE F +GL +V I    SN GL
Sbjct  302   SSFGLVSTQTQYMLASMLSDEKFVDKFLLESSRRLSKRHEKFIKGLEEVNISRFPSNAGL  361

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             F WMNL++LLKE TF  EL+LW++IINE+KLNVSPG SF+C E GWFRVCFAN+DDET+ 
Sbjct  362   FCWMNLKSLLKEETFEGELKLWRLIINEVKLNVSPGSSFNCSEVGWFRVCFANIDDETVE  421

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM----  1620
             +AL RIR  +               + K+ + NL++S + RR  E  +  SPH+ +    
Sbjct  422   IALKRIRDFI-------GKETKKKVEVKRWQPNLRLSFTSRRFDESVL--SPHNHIIISP  472

Query  1621  NSPLVQAT  1644
             +SPLV+AT
Sbjct  473   HSPLVRAT  480



>ref|XP_006598931.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
 gb|KHN18815.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=474

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/478 (66%), Positives = 383/478 (80%), Gaps = 11/478 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATND HGENS YFDGWKAYD NPFHP  NPQGVIQMGLAENQLCFDLI+ W+ N
Sbjct  5     QLLSKIATNDKHGENSPYFDGWKAYDRNPFHPTKNPQGVIQMGLAENQLCFDLIEEWIRN  64

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICTP+G  +F++IA +QDYHGL EF   +A FM KVRG  VKFDPDRI+MSGGAT
Sbjct  65    NPRASICTPEGVHQFRNIANFQDYHGLREFTNEMANFMSKVRGGRVKFDPDRILMSGGAT  124

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL DPG+AF++PTP+YPGF RDL WRTGVQ+ PV C+SSN+FK+TR ALE A
Sbjct  125   GANELIMFCLADPGDAFMIPTPFYPGFVRDLCWRTGVQIIPVHCDSSNNFKITREALEVA  184

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             YKKA+EDNI VKGL+I NPSNPLGT LD+DTL  +V F+N+KNIHLVCDEIYAATVFS P
Sbjct  185   YKKAKEDNINVKGLIITNPSNPLGTTLDKDTLKSLVNFINEKNIHLVCDEIYAATVFSSP  244

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S+A++IQE++ C  D IH++YSLSKD+GFPGFRVGI+YS+ND VV+C RKMSSFGLV
Sbjct  245   SYVSVAEVIQEMEHCKRDLIHVIYSLSKDMGFPGFRVGIVYSFNDEVVNCGRKMSSFGLV  304

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             STQTQH++A+M SD++FV  F+ E+S RL +RHE F +GL +V I    SN GLF WMNL
Sbjct  305   STQTQHMLASMFSDEKFVTRFLSENSRRLEQRHEKFMKGLEEVNITRFPSNAGLFCWMNL  364

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             ++LL+EP+F AEL+LW++II+E+KLNVSPG SF+C E GWFRVCFANMDDET+ VAL RI
Sbjct  365   KSLLEEPSFEAELKLWRVIIHEVKLNVSPGSSFNCSEPGWFRVCFANMDDETVDVALNRI  424

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQA  1641
             R  V    G E   +   K     R    + LSF   + D  + SPHSP+  SPLV A
Sbjct  425   RAFV----GKETKKSVGFK-----RWQPNLRLSFSSRIFDESVMSPHSPIPTSPLVGA  473



>gb|AAC49154.1| 1-aminocyclopropane 1-carboxylate synthase, partial [Pelargonium 
x hortorum]
Length=390

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/390 (78%), Positives = 349/390 (89%), Gaps = 2/390 (1%)
 Frame = +1

Query  265   YFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNPKASICTPQGAEEFKD  444
             YFDGWKAYDNNPFH   NPQGVIQMGLAENQL F+LI+ WVLNNP+ASICT QG +EFKD
Sbjct  1     YFDGWKAYDNNPFHLTQNPQGVIQMGLAENQLSFELIEQWVLNNPQASICTAQGLQEFKD  60

Query  445   IAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGAHEILAFCLVDPGEAF  624
              AI+QDYHGLPEFR AVA FM KVRG+ V F+PDRIVMSGGATGAHE++AFCL DPG+AF
Sbjct  61    TAIFQDYHGLPEFRYAVANFMGKVRGNRVTFNPDRIVMSGGATGAHEMIAFCLADPGDAF  120

Query  625   LVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYKKAQEDNIRVKGLLIN  804
             LVPTPYYPGFDRDLRWRTGVQL PVVCES N+F++TR+ALE AY++AQEDNIRVKGLLI 
Sbjct  121   LVPTPYYPGFDRDLRWRTGVQLIPVVCESENNFRITRSALEEAYERAQEDNIRVKGLLIT  180

Query  805   NPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEFISIAQIIQE--VQCN  978
             NPSNPLGT+LDR+TL  +V F+N+KNIHLVCDEIYAATVFSQP F+SIA++I++  V CN
Sbjct  181   NPSNPLGTILDRETLVSLVSFINEKNIHLVCDEIYAATVFSQPAFVSIAEVIEQENVSCN  240

Query  979   PDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQTQHLIAAMLSDKE  1158
              D IHIVYSLSKD+GFPGF VGI+YSYNDAVV+CARKMSSFGLVSTQTQHLIA+MLSD E
Sbjct  241   RDLIHIVYSLSKDMGFPGFGVGIVYSYNDAVVNCARKMSSFGLVSTQTQHLIASMLSDDE  300

Query  1159  FVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNLLKEPTFAAELELW  1338
             FV+ FI+ES++RL +R+ +FTRGLAQV I +LKSNGGLF+WM+LR LLKE TF AE+ LW
Sbjct  301   FVDTFIVESAKRLARRYATFTRGLAQVHIGSLKSNGGLFIWMDLRRLLKEKTFEAEMALW  360

Query  1339  KMIINEMKLNVSPGCSFHCQEAGWFRVCFA  1428
             ++IINE+KLNVSPG SFHC E GWFRVCFA
Sbjct  361   RVIINEVKLNVSPGASFHCSEPGWFRVCFA  390



>gb|ABK97620.1| 1-aminocyclopropane-1-carboxylic acid synthase [Durio zibethinus]
Length=490

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/486 (66%), Positives = 392/486 (81%), Gaps = 8/486 (2%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             R+  Q+LS+ ATNDGHGENS YFDGWKAYD++P+H   NP GVIQMGLAENQLCFDLIK 
Sbjct  5     RKNKQLLSRKATNDGHGENSPYFDGWKAYDSDPYHRSQNPNGVIQMGLAENQLCFDLIKK  64

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W+L NP ASICT +G ++FKDIAIYQDYHGL EF  A+A+FM +V G+ V FDP+RIVMS
Sbjct  65    WILENPDASICTAEGVDKFKDIAIYQDYHGLKEFIEALAKFMGRVGGNRVTFDPNRIVMS  124

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGA+E + FCL DPG+AFLVP+PYYP F RDLRWRTG+++ PV C+SSN+F++TR A
Sbjct  125   GGATGANETVMFCLADPGDAFLVPSPYYPAFARDLRWRTGLEIVPVDCKSSNNFRITRAA  184

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE AY+KAQ  NI VKG++I NPSNPLGT+LDR+T+  IV F+N++NIHLV DEIYAATV
Sbjct  185   LEEAYEKAQRSNINVKGVIIANPSNPLGTILDRETMRSIVSFINEQNIHLVFDEIYAATV  244

Query  922   FSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
             FS P FISIA+IIQ++ CN D IHIVYSLSKD+GFPGFRVGI+YS+ND VV+CARKMSSF
Sbjct  245   FSSPRFISIAEIIQDMDCNRDLIHIVYSLSKDMGFPGFRVGIVYSFNDVVVNCARKMSSF  304

Query  1102  GLV-STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             GLV S+QTQ+L+A+MLSD++FV NF+ ESS+RL KRH  FT+GL QVGI  LKSN GLF 
Sbjct  305   GLVSSSQTQYLLASMLSDEDFVGNFLRESSKRLAKRHHVFTKGLEQVGISCLKSNAGLFF  364

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM++R LLKE T   E+ELW++II+E+KLNVSPG SF C E GWFRVCFANMD ET+ VA
Sbjct  365   WMDMRPLLKEQTVKGEMELWRVIIDEVKLNVSPGSSFQCSEPGWFRVCFANMDGETVEVA  424

Query  1459  LMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM-N  1623
             L RIR  VLQ  G E   AA    ++  ++NL++S S  R  ++  +S    SPHS + +
Sbjct  425   LDRIRKFVLQ--GKEEDHAAPETSKRWQKKNLRLSFSSSRLYDESTMSPPMISPHSRIPH  482

Query  1624  SPLVQA  1641
             SPLV A
Sbjct  483   SPLVPA  488



>ref|XP_003552421.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
 gb|KHN40434.1| 1-aminocyclopropane-1-carboxylate synthase [Glycine soja]
Length=480

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/479 (67%), Positives = 383/479 (80%), Gaps = 9/479 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATND HGENS YFDGWKAYD+NPFHP  NPQGVIQMGLAENQLCFDLI+ W+ N
Sbjct  9     QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDLIQEWIRN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM KVRG  V+FDPDRI+MSGGAT
Sbjct  69    NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFMSKVRGGRVRFDPDRILMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL DPG+AFLVP+PYYP F RDL WRT  QL PV C SSN+FK+TR ALE A
Sbjct  129   GANELIMFCLADPGDAFLVPSPYYPAFVRDLCWRTRTQLIPVECHSSNNFKITREALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+E NI VKGL+I NPSNPLGT LDR+TL  IV F+N+KNIHLVCDEIYAATVF  P
Sbjct  189   YEKAKEGNINVKGLIITNPSNPLGTTLDRETLKSIVGFINEKNIHLVCDEIYAATVFRAP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              F+S+++++Q+++ C  D IHI+YSLSKDLG PGFRVGI+YSYND VV+  RKMSSFGLV
Sbjct  249   SFVSVSEVMQDIEHCKKDLIHIIYSLSKDLGLPGFRVGIVYSYNDEVVNSGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ+ +AA+LSD EFVE F+ ES+ RL  RH  FT+GL +V I  L SN GLF WMNL
Sbjct  309   SSQTQYFLAALLSDDEFVERFLAESARRLAARHSHFTKGLEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF  E+ LW++IINE+KLNVSPG +F+C E GW+RVCFANMDDET+ VALMRI
Sbjct  369   RGLLKEKTFEGEMMLWRVIINEVKLNVSPGSAFNCSEPGWYRVCFANMDDETVDVALMRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQAT  1644
             R  V +  G         K+ K+ + NL++S S  R  ++ ++ SPHSPM +SPLV+AT
Sbjct  429   RAFVGKETG------KPPKELKRWKSNLRLSFSNSRRFDENVM-SPHSPMPHSPLVRAT  480



>dbj|BAF44097.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus x bretschneideri]
Length=453

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/421 (74%), Positives = 356/421 (85%), Gaps = 1/421 (0%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIAT +GHGENS YFDGWKAYD++PFHP  NP GVIQMGLAEN++CFDLI
Sbjct  4     TLGNQQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAENEMCFDLI  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + WVLNNP+ASICT  G  EFKDIAI+QDYHGLPEFR AVA FM +VRG+ V FD D IV
Sbjct  64    QEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGRVRGNRVTFDADWIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVP PYYPGFDRDL WRTGVQL PV C+SSN+FKVTR
Sbjct  124   MSGGATGAHETMAFCLADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDSSNNFKVTR  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ+ NIRVKGLLI NPSNPLGTVLDRDTL  +V F+N+K IHLVCDEIYAA
Sbjct  184   AALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLRSLVTFINEKKIHLVCDEIYAA  243

Query  916   TVFSQPEF-ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             TVFSQP F      I ++++CN + IHIVYSLSKD+GFPGFRVGI+YSYND VV+CARKM
Sbjct  244   TVFSQPSFISIAEIIEEDIECNRNLIHIVYSLSKDMGFPGFRVGIVYSYNDDVVNCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVSTQTQHLIA+MLSD EFVE F+ +S++RL+ RH  FT  LAQVG   LKSNGGL
Sbjct  304   SSFGLVSTQTQHLIASMLSDNEFVERFVAQSAKRLKARHMRFTMELAQVGTSCLKSNGGL  363

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             FVWM+LR LLKE TF AE+ LW  II+E+KLNVSPG SFHC E GWFRVCFANMDD+TM 
Sbjct  364   FVWMDLRRLLKEQTFDAEMVLWHKIIHEVKLNVSPGSSFHCPEPGWFRVCFANMDDKTME  423

Query  1453  V  1455
             +
Sbjct  424   I  424



>ref|XP_011023276.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Populus euphratica]
Length=486

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/481 (65%), Positives = 387/481 (80%), Gaps = 7/481 (1%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M +Q Q+LSKIATNDGHGENS YFDGWKAYD NPFHP  NP GVIQMGLAENQL  DLI 
Sbjct  1     MERQHQLLSKIATNDGHGENSPYFDGWKAYDKNPFHPTENPHGVIQMGLAENQLSADLII  60

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
             +W+  +PKASIC P+G   FKDIA +QDYHGLPEFR A+A+FME+VRG  V FDPDRIVM
Sbjct  61    DWMKKHPKASICNPEGVHLFKDIANFQDYHGLPEFRQAIAKFMERVRGGRVTFDPDRIVM  120

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+F++T+ 
Sbjct  121   SGGATGANELIMFCLADPGDAFLVPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFQITKV  180

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE+AY KAQ+D I VKGL+I NPSNPLGT LDR+TL  ++ F+N+KNIH+VCDEIYAAT
Sbjct  181   ALEAAYDKAQQDGINVKGLIITNPSNPLGTTLDRETLKCLLSFINEKNIHIVCDEIYAAT  240

Query  919   VFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             +FS   F+SI+++I+EV  C  D IHIVYSLSKD+G PGFRVG++YSYNDAVV+C RKMS
Sbjct  241   IFSSQNFVSISEVIEEVIDCKRDLIHIVYSLSKDMGLPGFRVGLVYSYNDAVVNCGRKMS  300

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQ+L+A+MLSD+EFVE+F+ ESS+RL+KRH   T+GL Q+GI  L+S  GLF
Sbjct  301   SFGLVSSQTQYLLASMLSDEEFVEDFLAESSKRLKKRHGILTKGLEQIGISCLESKAGLF  360

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             VWMNLR+LLKE T   E+ LW++I+N++KLNVSPG SFHC E GWFRVCFANMDDET+ V
Sbjct  361   VWMNLRHLLKEQTNDGEMALWRVIVNDVKLNVSPGSSFHCVEPGWFRVCFANMDDETLEV  420

Query  1456  ALMRIRTSVLQWKGMEaaaaasak--kqkqC-RRNLKVSLS---FRRGLEDCMISSPHSP  1617
             AL RI   V + K  EA +  +     + +C ++NL++S S   F  G+   +  SPHSP
Sbjct  421   ALKRIHAFVGEQKEREALSTKTKDMPSKTKCWKKNLRLSFSSRIFEEGIGSPIAMSPHSP  480

Query  1618  M  1620
             +
Sbjct  481   L  481



>gb|AAM21683.1|AF500120_1 1-aminocyclopropane-1-carboxylate synthase 2 [Persea americana]
Length=483

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/483 (67%), Positives = 388/483 (80%), Gaps = 4/483 (1%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             +R Q Q+LSK+AT +GHGENS  F+GWKAYD+NP+H   NP GVIQMGLAENQL FDL++
Sbjct  4     LRNQ-QLLSKMATGNGHGENSP-FEGWKAYDSNPYHAIKNPDGVIQMGLAENQLSFDLVE  61

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
             +W+  NP++SICT +G  +FKDIA++QDYHGL  FR AVA FM KVRG  VKF+PDRIVM
Sbjct  62    DWIKENPESSICTLKGVSQFKDIALFQDYHGLSAFRNAVANFMGKVRGGKVKFNPDRIVM  121

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGAHE +AFCL +PG+AFLVPTPYY GFDRDLRWRTGVQL PVVCESSN FKVTR 
Sbjct  122   SGGATGAHETMAFCLANPGDAFLVPTPYYAGFDRDLRWRTGVQLIPVVCESSNGFKVTRD  181

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE AYKKAQEDNI+VKG+LI NPSNPLGT+LDR+TL  IV F+N++NIHL+CDEIYAAT
Sbjct  182   ALEIAYKKAQEDNIKVKGVLITNPSNPLGTILDRETLKSIVSFINEQNIHLICDEIYAAT  241

Query  919   VFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             VFSQP+FISI++I++E + CN D IH+VYSLSKDLGFPGFRVG+IYSYND VV+CAR+MS
Sbjct  242   VFSQPDFISISEILEEGITCNLDLIHVVYSLSKDLGFPGFRVGVIYSYNDDVVNCAREMS  301

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             S GLVSTQTQHL++AMLSD++FV+  I ES+ERL  RH+ FT  L +VGI  LKSN GLF
Sbjct  302   SLGLVSTQTQHLLSAMLSDEQFVDKLISESAERLASRHKMFTIELGKVGISCLKSNAGLF  361

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL++ T   E+ LW+ II ++KLNVSPG SFHC E GWFRVCFANMDDETM+V
Sbjct  362   CWMDLRALLEKKTVEGEMALWRTIIEKVKLNVSPGSSFHCSEPGWFRVCFANMDDETMKV  421

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNSPLV  1635
             AL RI   V +    E  A    +++ Q   +L++SL  RR  E        SP +SPLV
Sbjct  422   ALDRIIDFVFKPNKKEIMAPKKVQQKWQANLHLRLSLCGRRHEEVTKTPCTMSP-HSPLV  480

Query  1636  QAT  1644
             +AT
Sbjct  481   RAT  483



>dbj|BAA94600.1| 1-aminocyclopropane-1-carboxylate synthase [Populus x canadensis]
Length=486

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/481 (65%), Positives = 386/481 (80%), Gaps = 7/481 (1%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M +Q Q+LSKIATND HGENS YFDGWKAYD NPFHP  NP GVIQMGLAENQL  D I 
Sbjct  1     MERQHQLLSKIATNDRHGENSPYFDGWKAYDKNPFHPTDNPDGVIQMGLAENQLSADSII  60

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
             +W+  +PKASIC P+G   FKDIA +QDYHGLPEFR A+A+FM +VRG  V FDPDRIVM
Sbjct  61    DWIKKHPKASICNPEGVHMFKDIANFQDYHGLPEFRQAIAKFMGRVRGGRVTFDPDRIVM  120

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+F++T+ 
Sbjct  121   SGGATGANELIMFCLADPGDAFLVPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFQITKV  180

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE+AY KAQ+D I VKGL+I NPSNPLGT LDR+TL  ++ F+N+KNIH+VCDEIYAAT
Sbjct  181   ALEAAYDKAQQDGINVKGLIITNPSNPLGTTLDRETLKCLLSFINEKNIHIVCDEIYAAT  240

Query  919   VFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             +FS   F+S++++I+EV  CN D IHIVYSLSKD+G PGFRVGI+YSYNDAVV+C RKMS
Sbjct  241   IFSSQNFVSVSEVIEEVMDCNRDLIHIVYSLSKDMGLPGFRVGIVYSYNDAVVNCGRKMS  300

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQ+L+A+MLSD+EFVE+F+ ESS+RL+KRH  FT+GL Q+GI  L+S  GLF
Sbjct  301   SFGLVSSQTQYLLASMLSDEEFVEDFLAESSKRLKKRHGIFTKGLEQIGISCLESKAGLF  360

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             VWMNLR+LLKE T   E+ELW++I+N++KLNVSPG SFHC E GWFRVCFANMDDET+ V
Sbjct  361   VWMNLRHLLKEQTNDGEMELWRVIVNDVKLNVSPGSSFHCVEPGWFRVCFANMDDETLEV  420

Query  1456  ALMRIRTSVLQWKGMEaaaaasak--kqkqC-RRNLKVSLS---FRRGLEDCMISSPHSP  1617
             AL RI   V + K  E  +  +     + +C ++NL++S S   F  G+   +  SPHSP
Sbjct  421   ALKRIHAFVGEQKERETLSTKTKDMPSKTKCWKKNLRLSFSSRIFEEGIGSPIAMSPHSP  480

Query  1618  M  1620
             +
Sbjct  481   L  481



>ref|XP_010053212.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW77476.1| hypothetical protein EUGRSUZ_D01814 [Eucalyptus grandis]
Length=486

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/482 (66%), Positives = 388/482 (80%), Gaps = 15/482 (3%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS+ ATN+GH EN  YFDGWKAYD +PFHP  NP GVIQMGLAE+QLCFDL++ W+++N
Sbjct  11    LLSRKATNEGHAENCPYFDGWKAYDKDPFHPSQNPDGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM +VRGD VKFDPDRIVMSGGATG
Sbjct  71    PEASICTKKGVDKFRDIALFQDYHGLPAFRNAVAKFMGRVRGDKVKFDPDRIVMSGGATG  130

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE++ FCL DPG+AFLVPTPYY GFDRDL WRT  +L PVVC SSN+FKVTR ALE AY
Sbjct  131   AHEMITFCLADPGDAFLVPTPYYAGFDRDLCWRTEARLLPVVCHSSNNFKVTRKALEEAY  190

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KA E NI VKGLL+ NPSNPLGT+LDRDTL + + F+N+KNIHL+CDEIYAATVF QP+
Sbjct  191   AKAVEANISVKGLLLTNPSNPLGTILDRDTLREAMSFINEKNIHLICDEIYAATVFRQPD  250

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E Q  N + +HI+YSLSKD+GFPGFRVGI+YSYNDAVV C R+MSSFGLVS
Sbjct  251   FISIAEIIEEDQEYNRNLVHIIYSLSKDMGFPGFRVGIVYSYNDAVVECGRRMSSFGLVS  310

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+LIA+MLSD +F+  F+LES+ERL  RH++FT GL QVGI+ L  N GLF+WM+LR
Sbjct  311   SQTQYLIASMLSDDQFIGKFLLESAERLETRHKNFTDGLHQVGIKCLNGNAGLFLWMDLR  370

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LL E T  AE  LW+ IINE KLNVSPG SFHC E GWFRVC ANM++ETM+VAL RIR
Sbjct  371   ELLMESTVEAETALWRGIINEFKLNVSPGSSFHCSEPGWFRVCIANMNEETMKVALARIR  430

Query  1474  TSVLQWKGMEaaaaasakkqkqCRR-NLKVSLSFRRGLEDCM----ISSPHSPM-NSPLV  1635
               V +             ++++CR+ +L++ LSFRR ++D +    I SPHSP+  SPLV
Sbjct  431   EFVRR-------NGDKLNRKEKCRQSDLRLRLSFRR-MDDVLRSPCIMSPHSPIPQSPLV  482

Query  1636  QA  1641
             + 
Sbjct  483   RT  484



>gb|AAB96658.1| 1-aminocyclopropane-1-carboxylate synthase [Rumex palustris]
Length=489

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/487 (67%), Positives = 390/487 (80%), Gaps = 14/487 (3%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q   +LSKIA+ DGHGE SAYFDGWKAYD +PFH   NP GVIQMGLAENQLC DL+++W
Sbjct  5     QANNLLSKIASGDGHGEESAYFDGWKAYDKDPFHSSKNPLGVIQMGLAENQLCVDLVQDW  64

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V+ NP ASICTP G + FK++A +QDYHGLPEFR AVARFMEKVRGD V  DP RIVMSG
Sbjct  65    VVKNPSASICTPGGVDGFKEMANFQDYHGLPEFRNAVARFMEKVRGDRVNSDPTRIVMSG  124

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGAHE++AFCL DPGEAFLVPTPYYPGFDRDLRWRTG+QL P+   SSN FK+T+ AL
Sbjct  125   GATGAHELMAFCLADPGEAFLVPTPYYPGFDRDLRWRTGIQLLPIETLSSNGFKITKAAL  184

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AY KA E  IRVKG+LI NPSNPLGTVLD+DTL  ++ F+N   IHLVCDEIY+ATVF
Sbjct  185   EEAYNKAMEAGIRVKGVLITNPSNPLGTVLDKDTLVLLLTFINHYQIHLVCDEIYSATVF  244

Query  925   SQ--PEFISIAQIIQ--EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             S     F SIA++++  EV CN + IH+VYSLSKD+GFPGFRVGI+YSYNDAVV+CARKM
Sbjct  245   SDMPNRFTSIAELLEDGEVPCNRNLIHLVYSLSKDMGFPGFRVGIVYSYNDAVVNCARKM  304

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVS+QTQHLIA+MLSD +FV+ ++ ES +RL  R++ FT GL+ VGI +LKSNGGL
Sbjct  305   SSFGLVSSQTQHLIASMLSDDQFVDKYLSESKKRLATRYKFFTWGLSMVGISSLKSNGGL  364

Query  1273  FVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMR  1452
             F+WM+LR LL+EPT  AEL LW++IINE+KLNVSPG SFHC EAGWFR  FANMDD+T+ 
Sbjct  365   FLWMDLRRLLQEPTVEAELSLWRVIINEVKLNVSPGSSFHCSEAGWFRFAFANMDDKTVD  424

Query  1453  VALMRIRTSVLQWKGMEaaaaasakkqkqCRR----NLKVSLSFRRGLEDCMISSPHSPM  1620
             VAL RIR+ ++  KG EAAA        + ++    +L++ LS RR LE+ M  SPHSP+
Sbjct  425   VALRRIRSFMV--KGEEAAAGDKPTVVAKKKKCWQMDLQLRLSARR-LEEVM--SPHSPL  479

Query  1621  N-SPLVQ  1638
               SPLV+
Sbjct  480   PLSPLVR  486



>emb|CAA72191.1| 1-aminocyclopropane-1-carboxylate synthase [Carica papaya]
Length=488

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/489 (67%), Positives = 389/489 (80%), Gaps = 16/489 (3%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M +  ++LSKIAT++GHGE+S YFDGWKAYD++PFHP  NP+GVIQMGLAENQLCF+LI 
Sbjct  4     MLRNQELLSKIATSNGHGEDSPYFDGWKAYDSDPFHPTQNPEGVIQMGLAENQLCFNLIH  63

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
              W+L NP+ASIC   GA EF+DIAI+QDYHGLPEFR AVA FM KV  +   FDP  I  
Sbjct  64    EWLLKNPEASICYSTGAAEFRDIAIFQDYHGLPEFREAVAEFMGKVEEERASFDPAWIDE  123

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGA+E++AFCL DPG+AFLVPTPYYPGFDRDLRWRTGV+L PVVCESSND+++T  
Sbjct  124   SGGATGANEMIAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVKLIPVVCESSNDYQITIE  183

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE+AY+  QE +I+ KGLLI NPSNPLGT+  +DTL  +V F N  NIHLVCDEIYAAT
Sbjct  184   ALEAAYETPQEADIKGKGLLITNPSNPLGTIYYKDTLEALVTFTNHNNIHLVCDEIYAAT  243

Query  919   VFSQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             VFSQPEF SIA+II+E  + CN D IHI+YSLSKD+GFPGFRVGI+YSYNDAVVSCARKM
Sbjct  244   VFSQPEFTSIAEIIEEDKICCNRDLIHIIYSLSKDMGFPGFRVGIVYSYNDAVVSCARKM  303

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFT-RGLAQVGIETLKSNGG  1269
             SSFGLVS+QTQ+LIA+ML+D EFV+ FI+ES +RL  RH  FT R L QVGI  LKSN G
Sbjct  304   SSFGLVSSQTQYLIASMLADDEFVDKFIVESRKRLAMRHSFFTQRTLHQVGINCLKSNAG  363

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             LFVWM+LR LLKE TF AE+ LW++IINEMKLNVSPG SF+C E GWFRVCFANMDD+TM
Sbjct  364   LFVWMDLRRLLKEQTFEAEMVLWRVIINEMKLNVSPGSSFNCSEPGWFRVCFANMDDKTM  423

Query  1450  RVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS-----SPHS  1614
              +AL RI+T +LQ +       A   K+K C +   + LSF    ED M +     SPHS
Sbjct  424   EIALSRIKTFMLQHR------EAMVPKKKLCWQT-SLRLSFSSRYEDIMKTPGSFMSPHS  476

Query  1615  PM-NSPLVQ  1638
             P+ ++PLV+
Sbjct  477   PIPHTPLVR  485



>ref|XP_003534540.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Glycine 
max]
Length=485

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 383/483 (79%), Gaps = 12/483 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATND HGENS YFDGWKAYD+NPFHP  NPQGVIQMGLAENQLCFD+I+ W+ N
Sbjct  9     QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDMIQEWIRN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM KVRG  V+FDPDRI+MSGGAT
Sbjct  69    NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFMSKVRGGRVRFDPDRILMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL D G+AFLVP+PYYP F RDL WRT  QL PV C SSN+FK+TR ALE +
Sbjct  129   GANELIMFCLADAGDAFLVPSPYYPAFVRDLCWRTRAQLIPVECHSSNNFKITREALEES  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+E NI VKGL+I NPSNPLGT +D++TL  IV F+N+KNIHLVCDEIYAATVF  P
Sbjct  189   YRKAKEGNINVKGLIITNPSNPLGTTIDKETLKSIVGFINEKNIHLVCDEIYAATVFRAP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              F+S+++++Q+++ C  D IHI+YSLSKDLG PGFRVGI+YSYND VV+  RKMSSFGLV
Sbjct  249   SFVSVSEVMQDMEHCKKDLIHIIYSLSKDLGLPGFRVGIVYSYNDEVVNSGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH +AA+LSD EFVE F+ ES+ RL  RH  FT+GL +V I  L SN GLF WMNL
Sbjct  309   SSQTQHFLAALLSDDEFVERFLAESARRLAARHSHFTKGLEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             + LLKE TF  E+ LW++IINE+KLNVSPG +F+C E GW+RVCFANMDDET+ VALMRI
Sbjct  369   KGLLKEKTFEGEMMLWRVIINEVKLNVSPGSAFNCPEPGWYRVCFANMDDETVDVALMRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM-NSPLV  1635
             R  V +  G         K+ K+ + NL++S S  R  ++ ++S    SPHSPM +SPLV
Sbjct  429   RAFVGKETG------KPPKELKRWKSNLRLSFSNSRRFDENLMSPHMMSPHSPMPHSPLV  482

Query  1636  QAT  1644
             +AT
Sbjct  483   RAT  485



>ref|XP_010040891.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=486

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/480 (66%), Positives = 385/480 (80%), Gaps = 13/480 (3%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS+ ATN+GH EN  YFDGWKAYD NPFHP  NP GVIQMGLAE+QLCFDL++ W+++N
Sbjct  11    LLSRKATNEGHAENCPYFDGWKAYDKNPFHPSQNPDGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM +VRGD VKFDPDRIVMSGGATG
Sbjct  71    PEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFMGRVRGDKVKFDPDRIVMSGGATG  130

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE++ FCL DPG+AFLVPTPYY GFDRDL WRT  +L PVVC SSN+FKVTR ALE AY
Sbjct  131   AHEMITFCLADPGDAFLVPTPYYAGFDRDLCWRTEARLLPVVCHSSNNFKVTRKALEEAY  190

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KA E NI VKGLL+ NPSNPLGT+LDRDTL + + F+N+KNIHL+CDEIYAATVF QP+
Sbjct  191   AKAVEANISVKGLLLTNPSNPLGTILDRDTLREAMSFINEKNIHLICDEIYAATVFRQPD  250

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E Q  N + +HI+YSLSKD+GFPGFRVGI+YSYNDAVV C RKMSSFGLVS
Sbjct  251   FISIAEIIEEDQEYNRNLVHIIYSLSKDMGFPGFRVGIVYSYNDAVVECGRKMSSFGLVS  310

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+LIA+MLSD +F+  F+LES+ RL  RH  FT GL QVGI+ L  N GLF+WM+LR
Sbjct  311   SQTQYLIASMLSDDQFIGKFLLESAGRLATRHNDFTDGLRQVGIKCLNGNAGLFLWMDLR  370

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LL + T  AE  LW+MIIN++KLNVSPG SFHC E GWFRVC ANM++ET +VAL RIR
Sbjct  371   GLLIDSTVEAETALWQMIINDVKLNVSPGSSFHCSEPGWFRVCIANMNEETTKVALARIR  430

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM----ISSPHSPM-NSPLVQ  1638
               VL+            +K+K  + +L++ LSFRR ++D +    I SPHSP+  SPLV+
Sbjct  431   EFVLR------NGNKPNRKEKCGQSDLRLRLSFRR-IDDVLRSPCIMSPHSPIPQSPLVR  483



>gb|KHN29314.1| 1-aminocyclopropane-1-carboxylate synthase CMW33 [Glycine soja]
Length=485

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 382/483 (79%), Gaps = 12/483 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATND HGENS YFDGWKAYD+NPFHP  NPQGVIQMGLAENQLCFD+I+ W+ N
Sbjct  9     QLLSKIATNDKHGENSPYFDGWKAYDSNPFHPTKNPQGVIQMGLAENQLCFDMIQEWIRN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICT +G  +FK IA +QDYHGLPEFR AVA FM KVRG  V+FDPDRI+MSGGAT
Sbjct  69    NPKASICTAEGVNQFKYIANFQDYHGLPEFRNAVANFMSKVRGGRVRFDPDRILMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
              AHE++ FCL D G+AFLVP+PYYP F RDL WRT  QL PV C SSN+FK+TR ALE +
Sbjct  129   RAHEVIMFCLADAGDAFLVPSPYYPAFVRDLCWRTRAQLIPVECHSSNNFKITREALEES  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+E NI VKGL+I NPSNPLGT +D++TL  IV F+N+KNIHLVCDEIYAATVF  P
Sbjct  189   YRKAKEGNINVKGLIITNPSNPLGTTIDKETLKSIVGFINEKNIHLVCDEIYAATVFRAP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              F+S+++++Q+++ C  D IHI+YSLSKDLG PGFRVGI+YSYND VV+  RKMSSFGLV
Sbjct  249   SFVSVSEVMQDMEHCKKDLIHIIYSLSKDLGLPGFRVGIVYSYNDEVVNSGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH +AA+LSD EFVE F+ ES+ RL  RH  FT+GL +V I  L SN GLF WMNL
Sbjct  309   SSQTQHFLAALLSDDEFVERFLAESARRLAARHSHFTKGLEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             + LLKE TF  E+ LW++IINE+KLNVSPG +F+C E GW+RVCFANMDDET+ VALMRI
Sbjct  369   KGLLKEKTFEGEMMLWRVIINEVKLNVSPGSAFNCPEPGWYRVCFANMDDETVDVALMRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM-NSPLV  1635
             R  V +  G         K+ K+ + NL++S S  R  ++ ++S    SPHSPM +SPLV
Sbjct  429   RAFVGKETG------KPPKELKRWKSNLRLSFSNSRRFDENLMSPHMMSPHSPMPHSPLV  482

Query  1636  QAT  1644
             +AT
Sbjct  483   RAT  485



>ref|XP_003529924.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Glycine max]
Length=581

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/482 (66%), Positives = 385/482 (80%), Gaps = 11/482 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q  Q+LSKIA ND HGENS YFDG KAYD NPFHPK NPQGVIQMGLAENQLCFDLI+ W
Sbjct  109   QNQQLLSKIANNDKHGENSPYFDGLKAYDRNPFHPKKNPQGVIQMGLAENQLCFDLIEEW  168

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             + NNPK SICTP+G  +F++IA +QDYHGL EF  A+A FM KVRG  VKFD DRI+MSG
Sbjct  169   IRNNPKTSICTPEGVHQFRNIANFQDYHGLREFTNAMANFMSKVRGGRVKFDADRILMSG  228

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E++ FCL DPG+AF++PTP+YPGF RDL WRTGVQL PV C+SSN+FK+TR AL
Sbjct  229   GATGANELIMFCLADPGDAFMIPTPFYPGFVRDLCWRTGVQLIPVHCDSSNNFKITREAL  288

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E AYKKA+EDNI VKGL+I NPSNPLGT LD+DTL  +V F+N+KNIHLVCDEIYAATVF
Sbjct  289   EVAYKKAKEDNINVKGLIITNPSNPLGTTLDKDTLKSLVSFINEKNIHLVCDEIYAATVF  348

Query  925   SQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
             S P ++S+A++IQE++ C  D IH++YSLSKD+G+PGFRVGI+YS+ND VV+C RKMSSF
Sbjct  349   SSPSYVSVAEVIQEMKHCKRDLIHVIYSLSKDMGYPGFRVGIVYSFNDEVVNCGRKMSSF  408

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQH++A+MLSD++FV  F+ E+S RL +RH+ F +GL +V I    SN GLF W
Sbjct  409   GLVSTQTQHMLASMLSDEKFVTRFLSENSRRLEQRHDKFMKGLEEVNITRFPSNAGLFCW  468

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             MNL+ LL+EPTF AEL+LW++II+E+KLNVSPG SF+C E GWFRVCFANMDDET+ VAL
Sbjct  469   MNLKCLLEEPTFEAELKLWRVIIHEVKLNVSPGSSFNCSEPGWFRVCFANMDDETVDVAL  528

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQ  1638
              RIR  V    G E       K+    + NL++S S R   E  M  SPHSP+  SPL+ 
Sbjct  529   NRIRAFV----GKETKKPVGFKRW---QPNLRLSFSSRMFEESVM--SPHSPIPTSPLIG  579

Query  1639  AT  1644
             AT
Sbjct  580   AT  581



>ref|XP_010053214.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like isoform 
X1 [Eucalyptus grandis]
Length=486

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/481 (66%), Positives = 386/481 (80%), Gaps = 15/481 (3%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS+ ATNDGH EN  YFDGWKAYD +PFHP  NP GVIQMGLAE+QLCFDL++ W+++N
Sbjct  11    LLSRKATNDGHAENCPYFDGWKAYDKDPFHPTQNPSGVIQMGLAEHQLCFDLVQEWLVSN  70

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM +VRGD V+FDPDRIVMSGGATG
Sbjct  71    PEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFMGRVRGDKVEFDPDRIVMSGGATG  130

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE++ FCL DPG+AFLVPTPYY GFDRDL WRT  +L PVVC SSN+FKVTR ALE AY
Sbjct  131   AHEMITFCLADPGDAFLVPTPYYAGFDRDLCWRTEARLLPVVCHSSNNFKVTRKALEEAY  190

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KA E NI VKGLL+ NPSNPLGT+LDRDTL + + F+N+KNIHL+CDEIYAATVF QP+
Sbjct  191   AKAVEANISVKGLLLTNPSNPLGTILDRDTLREAMSFINEKNIHLICDEIYAATVFRQPD  250

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E Q  N + +HI+YSLSKD+GFPGFRVGI+YSYNDAVV C RKMSSFGLVS
Sbjct  251   FISIAEIIEEDQEYNRNLVHIIYSLSKDMGFPGFRVGIVYSYNDAVVECGRKMSSFGLVS  310

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+LIA+MLSD +F+  F+LES+ RL  RH  FT GL QVGI+ L  N GLF+WM+LR
Sbjct  311   SQTQYLIASMLSDDQFIGKFLLESAGRLATRHNDFTDGLRQVGIKCLNGNAGLFLWMDLR  370

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LL E T  AE  LW++IIN++KLNVSPG SFHC E GWFRVC ANM++ET +VAL RIR
Sbjct  371   GLLMESTVEAETALWRVIINDVKLNVSPGSSFHCSEPGWFRVCIANMNEETTKVALARIR  430

Query  1474  TSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCM----ISSPHSPM-NSPLV  1635
               VL+             ++++C + +L++ LSFRR ++D +    I SPHSP+  SPLV
Sbjct  431   EFVLR-------NGNKPNRKEKCWQSDLRLRLSFRR-IDDVLRSPCIMSPHSPIPQSPLV  482

Query  1636  Q  1638
             +
Sbjct  483   R  483



>gb|KCW77477.1| hypothetical protein EUGRSUZ_D01815 [Eucalyptus grandis]
Length=564

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/481 (66%), Positives = 385/481 (80%), Gaps = 13/481 (3%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS+ ATNDGH EN  YFDGWKAYD +PFHP  NP GVIQMGLAE+QLCFDL++ W+++N
Sbjct  89    LLSRKATNDGHAENCPYFDGWKAYDKDPFHPTQNPSGVIQMGLAEHQLCFDLVQEWLVSN  148

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G ++F+DIA++QDYHGLP FR AVA+FM +VRGD V+FDPDRIVMSGGATG
Sbjct  149   PEASICTKEGVDKFRDIALFQDYHGLPAFRNAVAKFMGRVRGDKVEFDPDRIVMSGGATG  208

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE++ FCL DPG+AFLVPTPYY GFDRDL WRT  +L PVVC SSN+FKVTR ALE AY
Sbjct  209   AHEMITFCLADPGDAFLVPTPYYAGFDRDLCWRTEARLLPVVCHSSNNFKVTRKALEEAY  268

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
              KA E NI VKGLL+ NPSNPLGT+LDRDTL + + F+N+KNIHL+CDEIYAATVF QP+
Sbjct  269   AKAVEANISVKGLLLTNPSNPLGTILDRDTLREAMSFINEKNIHLICDEIYAATVFRQPD  328

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E Q  N + +HI+YSLSKD+GFPGFRVGI+YSYNDAVV C RKMSSFGLVS
Sbjct  329   FISIAEIIEEDQEYNRNLVHIIYSLSKDMGFPGFRVGIVYSYNDAVVECGRKMSSFGLVS  388

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+LIA+MLSD +F+  F+LES+ RL  RH  FT GL QVGI+ L  N GLF+WM+LR
Sbjct  389   SQTQYLIASMLSDDQFIGKFLLESAGRLATRHNDFTDGLRQVGIKCLNGNAGLFLWMDLR  448

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LL E T  AE  LW++IIN++KLNVSPG SFHC E GWFRVC ANM++ET +VAL RIR
Sbjct  449   GLLMESTVEAETALWRVIINDVKLNVSPGSSFHCSEPGWFRVCIANMNEETTKVALARIR  508

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM----ISSPHSPM-NSPLVQ  1638
               VL+            +K+K  + +L++ LSFRR ++D +    I SPHSP+  SPLV+
Sbjct  509   EFVLR------NGNKPNRKEKCWQSDLRLRLSFRR-IDDVLRSPCIMSPHSPIPQSPLVR  561

Query  1639  A  1641
              
Sbjct  562   T  562



>gb|AES80302.2| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=484

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/482 (67%), Positives = 387/482 (80%), Gaps = 11/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATND HGENS YFDGWKAY++NPFHP  NPQGVIQMGLAENQLCFDLI+ W+ N
Sbjct  9     QLLSKIATNDKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCFDLIEEWIRN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICTP+G  EF+ IA +QDYHGLPEFR AVA FM KVRG  V+FDPDRI+MSGGAT
Sbjct  69    NPKASICTPEGVNEFRHIANFQDYHGLPEFRNAVANFMSKVRGGRVRFDPDRILMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQL PV C SSN+FK+TR ALE A
Sbjct  129   GANELIMFCLADPGDAFLVPSPYYPAFVRDLCWRTGVQLIPVQCHSSNNFKITREALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             +KKAQE+NI VKGL+I NPSNPLGT L++DTL  IV F+N+ NIHLVCDEIY+ TVF+ P
Sbjct  189   HKKAQEENINVKGLIITNPSNPLGTTLEKDTLKSIVSFINENNIHLVCDEIYSGTVFNTP  248

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S+A++IQE+ +C  D IHI+YSLSKD+G PGFRVG++YSYND VV+C RKMSSFGLV
Sbjct  249   TYVSVAEVIQEMEECKKDLIHIIYSLSKDMGLPGFRVGLVYSYNDEVVNCGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH +AAMLSD  FV+ F+ ESS RLR+R E FT+GL +V I  L SN GLF WMNL
Sbjct  309   SSQTQHFLAAMLSDDIFVDKFLEESSRRLRERREFFTKGLEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF  E++LW++IINE+KLNVSPG +F+C E GW+RVCFANMD ET+ +AL RI
Sbjct  369   RGLLKEKTFEGEMKLWRLIINEVKLNVSPGSAFNCSEPGWYRVCFANMDHETVEIALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQ  1638
             R  V    G E        + K+ + NL++S S RR  E+ M   + SPHSPM +SPLV+
Sbjct  429   RAFV---NGRE---KGKTVEIKRWKSNLRLSFSSRRFDENVMSPHMMSPHSPMPHSPLVR  482

Query  1639  AT  1644
             AT
Sbjct  483   AT  484



>ref|XP_010092578.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Morus notabilis]
 gb|EXB51626.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Morus notabilis]
Length=496

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/492 (66%), Positives = 379/492 (77%), Gaps = 17/492 (3%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +  Q+LSKIATNDGHGEN+ YFDGWKAYD +PFH   NP GVIQMGLAENQLCFDLI++W
Sbjct  7     ENRQLLSKIATNDGHGENTPYFDGWKAYDRDPFHLTKNPSGVIQMGLAENQLCFDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G ++FKD+AI+QDYHG PEFR A+A+FM KVRG  V FDPDRIVM G
Sbjct  67    IRKNPIASICTAEGVKDFKDVAIFQDYHGFPEFRKAIAKFMSKVRGGRVTFDPDRIVMGG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+EI+ FCL DPG+AFLVPTPYYP F RDL WRTG Q+ PV C+SSN+F+VT+ AL
Sbjct  127   GATGANEIVMFCLADPGDAFLVPTPYYPAFVRDLGWRTGAQIVPVHCDSSNNFQVTKQAL  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E+AY+KAQ DNI VKGLLI NPSNPLGT LDR TL  +V FVNDKNIHLVCDEIYAATVF
Sbjct  187   EAAYEKAQNDNINVKGLLITNPSNPLGTTLDRQTLKTLVNFVNDKNIHLVCDEIYAATVF  246

Query  925   SQPEF-ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
               P +      + +   CN D IHIVYSLSKD+G PGFRVGI+YSYNDAVVSC RKMSSF
Sbjct  247   DYPSYVGVTEVVEEVENCNKDLIHIVYSLSKDMGLPGFRVGIVYSYNDAVVSCGRKMSSF  306

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVS+QTQ L+A+ML D  FV NF+ ESS+RL+KR+E+FT+GL +VGI  LKSN GLF W
Sbjct  307   GLVSSQTQRLLASMLDDDVFVSNFLSESSKRLKKRYENFTKGLEEVGITCLKSNAGLFFW  366

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             MNL+ LLKE TF  E+ LW +IINE+KLNVSPG SF C E GWFRVCFANM++ET+ VAL
Sbjct  367   MNLQRLLKEQTFEGEMALWLVIINEVKLNVSPGSSFQCSEPGWFRVCFANMEEETVNVAL  426

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqCRR-----NLKVSLSFRRGLED------CMISSP  1608
              RIR+ V    G EA  AA     K  R      NL++S + RR  ++        + SP
Sbjct  427   ERIRSFV----GKEAKQAAVPPVAKAKRNWRNNGNLRLSFNSRRHEQEGGFMSAAHMLSP  482

Query  1609  HSPM-NSPLVQA  1641
             HSPM  SPL++A
Sbjct  483   HSPMPQSPLLRA  494



>emb|CAA79478.1| 1-aminocyclopropane-1-carboxylate synthase [Petunia x hybrida]
 gb|AAB06724.1| 1-aminocyclopropane-1-carboxylate synthase [Petunia x hybrida]
Length=490

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/485 (64%), Positives = 388/485 (80%), Gaps = 9/485 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   +LSK+ATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI++W
Sbjct  7     KNNSVLSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPKASICT +G + F+ IA +QDYHGLPEFR A+A+FMEK RG  V FDPDR+VM+G
Sbjct  67    IKRNPKASICTTEGIKSFRGIANFQDYHGLPEFRRAIAKFMEKTRGGRVSFDPDRVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL D G+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN FK+T  A+
Sbjct  127   GATGANETIIFCLADAGDAFLVPSPYYPAFNRDLRWRTGVQLIPIPCESSNSFKITTKAM  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ A + NIRVKGL++ NPSNPLGT LDRDTL  ++ F N++NIHLVCDEIYAATVF
Sbjct  187   KEAYENAIKANIRVKGLILTNPSNPLGTTLDRDTLKSLLNFTNERNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQEVQC--NPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             + P+F+SIA+I+ + +   N D +HIVYSLSKD+G PGFR+GI+YSYNDAVV+CARKMSS
Sbjct  247   NTPQFVSIAEILNDEKSNFNKDLVHIVYSLSKDMGLPGFRIGIVYSYNDAVVNCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQHL+A MLSD+EFV NF+ ESS RL KRH+ FT GL QVGI+ LKSN GLF 
Sbjct  307   FGLVSTQTQHLLAKMLSDEEFVANFLCESSMRLGKRHKHFTNGLEQVGIKCLKSNSGLFC  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR+LL+  T  +E+ LW++IIN+++LNVSPG SF CQE GWFRVCFANMDDET+ VA
Sbjct  367   WMDLRHLLENSTLDSEMSLWRVIINDVRLNVSPGSSFDCQEPGWFRVCFANMDDETVEVA  426

Query  1459  LMRIRTSV---LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NS  1626
             L RIR  V   ++  G E     + ++ K  + NL+VS S +R  ++ ++S   SP+ +S
Sbjct  427   LARIRRFVGVGVKENGEETKPVKNKEQWK--KSNLRVSFS-KRMYDESVLSPLSSPIPHS  483

Query  1627  PLVQA  1641
             PLV+A
Sbjct  484   PLVRA  488



>ref|XP_007219056.1| hypothetical protein PRUPE_ppa004774mg [Prunus persica]
 gb|EMJ20255.1| hypothetical protein PRUPE_ppa004774mg [Prunus persica]
Length=492

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/437 (69%), Positives = 356/437 (81%), Gaps = 0/437 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S      +LSKIAT++GHGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL 
Sbjct  1     MGSSSATSNRLLLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI++W+  NPKASICTP+G EEFK++AI+QDYHG PEFR AVA FM K RG  V FDP
Sbjct  61    FDLIEDWIKKNPKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFMSKARGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +R+VMSGGATGA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+F
Sbjct  121   NRVVMSGGATGANELVMFCLADPGDAFLVPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++T+ AL +AY+KAQ++NI VKGL+I NPSNPLGT LDRDTL  +V F+N KNIHLVCDE
Sbjct  181   QITKEALAAAYEKAQKNNINVKGLIITNPSNPLGTTLDRDTLESLVEFINQKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             IYAATVFS P F  I+++IQ + CNP+ IHIVYSLSKD+G PG RVGI+YSYND VV+  
Sbjct  241   IYAATVFSSPTFTCISEVIQNMNCNPNLIHIVYSLSKDMGLPGLRVGIVYSYNDDVVNIG  300

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGLVS+QTQH++A+ML D+EFV  F+  SS+RL KRH  FT+GL +VGI  LKSN
Sbjct  301   RKMSSFGLVSSQTQHMLASMLLDEEFVARFLETSSKRLAKRHGVFTKGLEEVGINCLKSN  360

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
              GLF WM+LR LLK+ TF  E+ LW++I+NE+ LNVSPG SF C E GWFRVCFANMDDE
Sbjct  361   AGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVGLNVSPGSSFKCVEPGWFRVCFANMDDE  420

Query  1444  TMRVALMRIRTSVLQWK  1494
             T+ VAL RIRT V Q K
Sbjct  421   TVEVALKRIRTFVRQGK  437



>ref|XP_009786813.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Nicotiana 
sylvestris]
Length=491

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 388/483 (80%), Gaps = 4/483 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             + + ILSK+ATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  7     KNSSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G + F+ IA +QDYHGLPEFR+A+A+FMEK RG  V FDP+R+VM+G
Sbjct  67    IKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRSAIAKFMEKTRGGRVTFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL D G+AFLVP+PYYP F+RDLRWRTGVQL P+ C+SSN+F++T  A+
Sbjct  127   GATGANETIIFCLADTGDAFLVPSPYYPAFNRDLRWRTGVQLIPIPCDSSNNFQITTKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
               AY+ AQ+ NI+VKGL++ NPSNPLGT LDRDTL +++ F N  NIHLVCDEIYAATVF
Sbjct  187   REAYENAQKSNIKVKGLILTNPSNPLGTTLDRDTLKNLLTFTNQHNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             + P+F+SIA+I+ +    CN D +HIVYSLSKD+G PGFRVGI+YS+NDAVV+CARKMSS
Sbjct  247   NTPQFVSIAEILDDETSHCNKDLVHIVYSLSKDMGLPGFRVGIVYSFNDAVVNCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A MLSD+ FV NF+ ESS+RL KRH+ FT GL +VGI+ L+SN GLF 
Sbjct  307   FGLVSTQTQYLLAEMLSDERFVSNFLTESSKRLAKRHKHFTNGLEEVGIKCLRSNAGLFC  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLKE TF +E+ LW++IIN++KLNVSPG SF CQE G+FRVCFANMDDET+ +A
Sbjct  367   WMDLRPLLKESTFDSEMSLWRVIINDVKLNVSPGSSFDCQEPGFFRVCFANMDDETVDIA  426

Query  1459  LMRIRTSV-LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR+ V ++  G E+      KKQ+  + NL++S S R   E   +S   SP+ +SPL
Sbjct  427   LARIRSFVGVKKSGDESTPILMEKKQQWKKNNLRLSFSKRMYDESVNLSPLSSPIPHSPL  486

Query  1633  VQA  1641
             V+A
Sbjct  487   VRA  489



>ref|XP_008364813.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Malus domestica]
Length=503

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 381/490 (78%), Gaps = 8/490 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  + + +LSKIATN+ HGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL  DL+
Sbjct  4     SASEHSLLLSKIATNEQHGENSPYFDGWKAYDQNPFHPTENPEGVIQMGLAENQLSLDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  NPKAS+CT +G E+F+ +A +QDYHG PEFR A+A FM K RG  V FDPDR+V
Sbjct  64    EEWIRKNPKASLCTAEGVEKFRSVANFQDYHGFPEFRQAIATFMSKARGGRVTFDPDRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL DPG+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLADPGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              A+E+AY+KA+  NI VKGL+I NPSNPLGT LD+DTL  +V F+N  NIHLVCDEIYAA
Sbjct  184   EAVEAAYEKAKNSNINVKGLIITNPSNPLGTTLDKDTLESLVAFINQNNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P++  I ++IQ++ CNP+ IHIVYSLSKD+GFPG RVGI+YSYND VV+  RKMS
Sbjct  244   TVFSSPKYTCITEVIQDMDCNPNLIHIVYSLSKDMGFPGLRVGIVYSYNDDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQH++A+MLSD++FVE F+  SS+RL KRH  FT+GL +VGI  LKSN GLF
Sbjct  304   SFGLVSSQTQHMLASMLSDEDFVEKFLATSSKRLVKRHGVFTKGLEEVGISCLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK+ TF  E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQW-KGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM------ISSPHS  1614
             AL RIR  V Q  K  E A   S KK+ Q    L  S S RR  ++ +      + SPHS
Sbjct  424   ALKRIRALVGQGKKAQEQAQVKSTKKRWQSNLRLSFSSSTRRFEQEGVSVLSPHMMSPHS  483

Query  1615  PMN-SPLVQA  1641
             PM+ SP VQA
Sbjct  484   PMSHSPFVQA  493



>ref|XP_009366562.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Pyrus x bretschneideri]
Length=495

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/491 (63%), Positives = 384/491 (78%), Gaps = 8/491 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  + + +LSKIATN+ HGENS YF+GWKAYD NPFHP  NP+GVIQMGLAENQL FDL+
Sbjct  4     SASKNSLLLSKIATNEKHGENSPYFNGWKAYDQNPFHPTENPEGVIQMGLAENQLSFDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  NPKAS CT +G E+F+ +A +QDYHG PEFR A+A FM K RG  V FDPDR+V
Sbjct  64    EEWIRKNPKASFCTAEGVEKFRSVANFQDYHGFPEFRQAMATFMSKARGGRVTFDPDRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL DPG+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLADPGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              A+E+AY+KA+ +NI+VKGL+I NPSNPLGT LD+DTL  +V F+N KNIHLVCDEIYAA
Sbjct  184   EAVEAAYEKAKNNNIKVKGLIITNPSNPLGTTLDKDTLESLVTFINQKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P++  I ++IQ++ CNP+ IHIVYSLSKD+GFPG RVGI+YSYN+ VV+  RKMS
Sbjct  244   TVFSSPKYTCITEVIQDMDCNPNLIHIVYSLSKDMGFPGLRVGIVYSYNNDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQH++A+MLSD++FV+NF+  SS+RL KRH  FT+GL +VGI  LKSN GLF
Sbjct  304   SFGLVSSQTQHMLASMLSDEDFVQNFLATSSKRLAKRHRVFTKGLEEVGISYLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK+ T   E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLKDQTLDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQW-KGMEaaaaasakkqkqCRRNLKVSLSFRR------GLEDCMISSPHS  1614
             AL RIR  V Q  K  E A   S KK+ Q    L  S S RR       ++   + SPHS
Sbjct  424   ALKRIRALVGQEKKAQEQAQVKSTKKRWQSNLRLSFSSSTRRFEQEGVSVKSPHMMSPHS  483

Query  1615  PM-NSPLVQAT  1644
             PM ++P V+AT
Sbjct  484   PMPHTPFVRAT  494



>gb|AAX99362.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus persica]
Length=492

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/437 (68%), Positives = 356/437 (81%), Gaps = 0/437 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S      +LSKIAT++GHGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL 
Sbjct  1     MGSSSATSNRLLLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI++W+  NPKASICTP+G EEFK++AI+QDYHG PEFR AVA FM K RG  V FDP
Sbjct  61    FDLIEDWIKKNPKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFMSKARGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +R+VMSGGATGA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+F
Sbjct  121   NRVVMSGGATGANELVMFCLADPGDAFLVPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++T+ AL +AY+KAQ++NI VKGL+I NPSNPLGT LDRDTL  +V F+N KNIHLVCDE
Sbjct  181   QITKEALAAAYEKAQKNNINVKGLIITNPSNPLGTTLDRDTLESLVEFINQKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             IYAATVFS P F  I+++IQ + CNP+ IHIVYSLSKD+G PG RVGI+YSYND VV+  
Sbjct  241   IYAATVFSSPTFTCISEVIQNMNCNPNLIHIVYSLSKDMGLPGLRVGIVYSYNDDVVNIG  300

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGLVS+QTQH++A+ML D+EFV  F+  SS+RL +RH  FT+GL +VGI  LKSN
Sbjct  301   RKMSSFGLVSSQTQHMLASMLLDEEFVARFLETSSKRLARRHGVFTKGLEEVGINCLKSN  360

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
              GLF WM+LR LLK+ TF  E+ LW++I+NE+ LNVSPG SF C E GWFRVCFANMDDE
Sbjct  361   AGLFCWMDLRRLLKDRTFDGEMVLWRVIVNEVGLNVSPGSSFKCVEPGWFRVCFANMDDE  420

Query  1444  TMRVALMRIRTSVLQWK  1494
             T+ VAL RIRT V Q K
Sbjct  421   TVEVALKRIRTFVRQGK  437



>ref|XP_008779569.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Phoenix 
dactylifera]
Length=483

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/482 (64%), Positives = 370/482 (77%), Gaps = 19/482 (4%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSK+ATNDGHGENS+YFDGWKAYD++PFHP  NP+GVIQMGLAENQLC DL++ W+  N
Sbjct  14    LLSKMATNDGHGENSSYFDGWKAYDSDPFHPIDNPEGVIQMGLAENQLCLDLMQEWIKKN  73

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT  G  EFK IA +QDYHGLPEFR A+A+FM KVRG+ + FDP RIVMSGGATG
Sbjct  74    PKASICTEAGVPEFKAIANFQDYHGLPEFREAIAKFMGKVRGEGINFDPARIVMSGGATG  133

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A EILAFCL DPGEAFLVPTPYYP FDRDLRWRTG+QL+P+ CES+N FK+T++ALESAY
Sbjct  134   AAEILAFCLADPGEAFLVPTPYYPAFDRDLRWRTGIQLFPIHCESTNHFKITQSALESAY  193

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             +KAQ+ NIRVKG+L+ NPSNPLGT LD+ TL  +V F+N K IHL+CDEI+A TVFS+P 
Sbjct  194   EKAQQANIRVKGVLVTNPSNPLGTTLDKKTLRTLVSFINAKRIHLICDEIFAGTVFSEPR  253

Query  937   FISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F+ +++I++E   C+   IHI YSLSK LG PGFRVG++YSYND VV CAR+MSSFGLVS
Sbjct  254   FVGVSEILEEDPNCDQSLIHITYSLSKVLGLPGFRVGVVYSYNDTVVRCARRMSSFGLVS  313

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+L+A+MLSD EF    I ES  RL KRHE FT  LAQ GI+ L+SN GLF WMNL+
Sbjct  314   SQTQYLLASMLSDDEFTTELIAESRRRLSKRHEIFTSRLAQEGIQCLESNAGLFCWMNLK  373

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLKE T   ELELW+ II++MKLNVSPG SFHC E GWFRVCFAN+DDETM VAL R +
Sbjct  374   MLLKESTVEGELELWRRIIDDMKLNVSPGSSFHCSEPGWFRVCFANIDDETMEVALQRFK  433

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM----NSPLVQA  1641
             + + Q K                R    + LSF R  E     +P +P     +SP+V+A
Sbjct  434   SFMRQAKKK--------------RWQNGLRLSFPRRFEGMTTMTPMTPSLLSPHSPVVRA  479

Query  1642  TN  1647
             T 
Sbjct  480   TT  481



>emb|CDP10864.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/419 (70%), Positives = 358/419 (85%), Gaps = 0/419 (0%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATN+ HGENS YFDGWKAYDN+P+HP  NP GVIQMGLAEN L FDL++ W+  
Sbjct  9     QLLSKIATNEQHGENSPYFDGWKAYDNDPYHPTQNPNGVIQMGLAENPLSFDLVEEWIRK  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             +P ASICT +G ++F+DIAI+QDYHGL EFR AVARFM KVRG  V FDP RIVM+GGAT
Sbjct  69    HPSASICTSEGVQKFRDIAIFQDYHGLTEFRNAVARFMGKVRGGRVTFDPARIVMAGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E++  CL DPG+AFLVPTPYYPGFDRDL+WRTGVQL PV+CESSN+FK+T+ ALE A
Sbjct  129   GACELITCCLADPGDAFLVPTPYYPGFDRDLKWRTGVQLIPVICESSNNFKITKEALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             ++ A++ +I+VKG++I NPSNPLGT ++R+T   +V F+N+K IHLVCDEIY+AT+FS+P
Sbjct  189   FENAKKSSIKVKGVIIANPSNPLGTTVERETQITLVNFINEKQIHLVCDEIYSATIFSRP  248

Query  934   EFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
              FISIA+II+EV+CN D IHI+YSLSKD+GFPGFRVGI+YSYNDAVV C RKMSSFGLVS
Sbjct  249   NFISIAEIIEEVECNRDLIHIIYSLSKDMGFPGFRVGIVYSYNDAVVDCGRKMSSFGLVS  308

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQH +A+MLSD EF+++F+  SS RL KRH++FT GL +VGI+ L SN GLF WM+LR
Sbjct  309   SQTQHFLASMLSDDEFIDHFLKTSSMRLAKRHQTFTSGLEEVGIKCLNSNAGLFCWMDLR  368

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
              LLKEPTF AE+ LW++I++++KLNVSPG SFHC E GWFRVCFANMDDET+ +AL RI
Sbjct  369   PLLKEPTFEAEMVLWRLIVHKVKLNVSPGFSFHCVEPGWFRVCFANMDDETLEIALKRI  427



>dbj|BAA96743.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus persica]
Length=492

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/437 (68%), Positives = 355/437 (81%), Gaps = 0/437 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S      +LSKIAT++GHGEN  YFDGWKAYD NPFHP  NP+GVIQMGLAENQL 
Sbjct  1     MGSSSATSNRLLLSKIATSEGHGENPPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI++W+  NPKASICTP+G EEFK++AI+QDYHG PEFR AVA FM K RG  V FDP
Sbjct  61    FDLIEDWIKKNPKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFMSKARGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +R+VMSGGATGA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+F
Sbjct  121   NRVVMSGGATGANELVMFCLADPGDAFLVPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++T+ AL +AY+KAQ++NI VKGL+I NPSNPLGT LDRDTL  +V F+N KNIHLVCDE
Sbjct  181   QITKEALAAAYEKAQKNNINVKGLIITNPSNPLGTTLDRDTLESLVEFINQKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             IYAATVFS P F  I+++IQ + CNP+ IHIVYSLSKD+G PG RVGI+YSYND VV+  
Sbjct  241   IYAATVFSSPTFTCISEVIQNMNCNPNLIHIVYSLSKDMGLPGLRVGIVYSYNDDVVNIG  300

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGLVS+QTQH++A+ML D+EFV  F+  SS+RL KRH  FT+GL +VGI  LKSN
Sbjct  301   RKMSSFGLVSSQTQHMLASMLLDEEFVARFLETSSKRLAKRHGVFTKGLEEVGINCLKSN  360

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
              GLF WM+LR LLK+ TF  E+ LW++I+NE+ LNVSPG SF C E GWFRVCFANMDDE
Sbjct  361   AGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVGLNVSPGSSFKCVEPGWFRVCFANMDDE  420

Query  1444  TMRVALMRIRTSVLQWK  1494
             T+ VAL RIRT V Q K
Sbjct  421   TVEVALKRIRTFVRQGK  437



>dbj|BAB47124.1| ACC synthase [Cucurbita maxima]
Length=485

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/479 (66%), Positives = 385/479 (80%), Gaps = 8/479 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSK+A  +GHGE+S YFDGWKAYD +PFHP  NP+GVIQMGLAENQL F+ +++W+ NN
Sbjct  11    LLSKLAKGNGHGEDSPYFDGWKAYDTDPFHPIMNPRGVIQMGLAENQLSFEFVEDWIKNN  70

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASIC+ +G +EFKDIAI+QDYHGLPEFR A      KVRGD VKFDPDR+VMSGGATG
Sbjct  71    PQASICSVEGLDEFKDIAIFQDYHGLPEFRNAWRILWGKVRGDRVKFDPDRVVMSGGATG  130

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             AHE +AFCL DPGEAFLVP PYYPGFDRDLRWRTGV++ PVVC SSN+FK+TR ALE+AY
Sbjct  131   AHETVAFCLADPGEAFLVPVPYYPGFDRDLRWRTGVKIVPVVCNSSNNFKLTREALETAY  190

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             +KAQE NI++KGLLI NPSNPLGTV DR TL   V F+N K IHLVCDEIYAATVF++P 
Sbjct  191   EKAQESNIKIKGLLITNPSNPLGTVCDRQTLETAVAFINQKKIHLVCDEIYAATVFTEPG  250

Query  937   FISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISI+++I+ + +C+ + IH+VYSLSKD+GFPGFRVGIIYSYNDAVV+CARKMSSFGLVS
Sbjct  251   FISISEVIENDTKCDKNLIHVVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKMSSFGLVS  310

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHLIA+MLSD EFVE+F++ S+++L  RH +FTRGLAQVGI  L+ +GGLF+WM+LR
Sbjct  311   SQTQHLIASMLSDDEFVESFLVGSAKKLAARHRNFTRGLAQVGIGYLRGSGGLFLWMDLR  370

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFH-CQEAGWFRVCFANMDDETMRVALMRI  1470
             +LL E T  AE+ LW++IIN++K     G  F      GWFRVCFANMDD TM +++ RI
Sbjct  371   HLLTEKTLEAEMALWRVIINDVKAECVAGVVFPLLGSPGWFRVCFANMDDNTMEISITRI  430

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPLVQAT  1644
             R  VLQ K  E       +K    + +L++ LS RR LED M  SPHSP+  SP+++AT
Sbjct  431   RNFVLQNK--EVTTKIKKQKFCWRQSSLELRLSSRR-LEDIM--SPHSPLPQSPMLRAT  484



>gb|ABW03085.1| 1-aminocyclopropane 1-carboxylate synthase 4 [Prunus salicina]
Length=492

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/437 (68%), Positives = 354/437 (81%), Gaps = 0/437 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M   S      +LSKIAT++GHGENS YFDGWKAYD NPFH   NP+GVIQMGLAENQL 
Sbjct  1     MGSSSATANRLLLSKIATSEGHGENSPYFDGWKAYDRNPFHSTKNPEGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W+  NPKASICTP+G EEF+++AI+QDYHG PEFR AVA FM K RG  V FDP
Sbjct  61    FDLIEAWIKKNPKASICTPEGVEEFRNVAIFQDYHGFPEFRKAVAMFMSKARGGRVTFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +R+VMSGGATGA+E++ FCL DPG+AFLVP+PYYP F RDL WR GVQ+ PV C+SSN+F
Sbjct  121   NRVVMSGGATGANELVMFCLADPGDAFLVPSPYYPAFYRDLGWRAGVQIVPVDCDSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T+ AL +AY+KAQ++NI VKGL+I NPSNPLGT LDRDTL  +V F+N KNIHLVCDE
Sbjct  181   KITKEALAAAYEKAQKNNINVKGLIITNPSNPLGTTLDRDTLESLVEFINQKNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             IYAATVFS P F  I+++IQ + CNP+ IHIVYSLSKD+G PG RVGI+YSYND VV+  
Sbjct  241   IYAATVFSSPTFTCISEVIQNMNCNPNLIHIVYSLSKDMGLPGLRVGIVYSYNDDVVNIG  300

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGLVS+QTQH++A+ML D+EFV  F+  SS+RL KRH  FT+GL +VGI  LKSN
Sbjct  301   RKMSSFGLVSSQTQHMLASMLLDEEFVARFLETSSKRLAKRHGVFTKGLEEVGINCLKSN  360

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
              GLF WM+LR LLK+ TF  E+ LW++I+NE+ LNVSPG SF C E GWFRVCFANMDDE
Sbjct  361   AGLFCWMDLRRLLKDQTFDGEMVLWRVIVNEVGLNVSPGSSFKCVEPGWFRVCFANMDDE  420

Query  1444  TMRVALMRIRTSVLQWK  1494
             T+ VAL RIRTSV Q K
Sbjct  421   TVDVALKRIRTSVRQGK  437



>sp|Q07262.1|1A1C_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate synthase; Short=ACC 
synthase; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Nicotiana tabacum]
 emb|CAA46797.1| 1-aminocyclopropane 1-carboxylate synthase [Nicotiana tabacum]
 prf||1909369A aminocyclopropane carboxylate synthase
Length=491

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 387/483 (80%), Gaps = 4/483 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             + + ILSK+ATN+  GENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  7     KNSSILSKLATNEELGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G + F+ IA +QDYHGLPEFR+A+A+FMEK RG  V FDP+R+VM+G
Sbjct  67    IKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRSAIAKFMEKTRGGRVTFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL D G+AFLVP+PYYP F+RDLRWRTGVQL P+ C+SSN+F++T  A+
Sbjct  127   GATGANETIIFCLADTGDAFLVPSPYYPAFNRDLRWRTGVQLIPIPCDSSNNFQITTKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
               AY+ AQ+ NI+VKGL++ NPSNPLGT LDRDTL +++ F N  NIHLVCDEIYAATVF
Sbjct  187   REAYENAQKSNIKVKGLILTNPSNPLGTTLDRDTLKNLLTFTNQHNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             + P+F+SIA+I+ +    CN D +HIVYSLSKD+G PGFRVGI+YS+NDAVV+CARKMSS
Sbjct  247   NTPQFVSIAEILDDETSHCNKDLVHIVYSLSKDMGLPGFRVGIVYSFNDAVVNCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A MLSD+ FV NF+ ESS+RL KRH+ FT GL +VGI+ L+SN GLF 
Sbjct  307   FGLVSTQTQYLLAEMLSDERFVSNFLTESSKRLAKRHKHFTNGLEEVGIKCLRSNAGLFC  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLKE TF +E+ LW++IIN++KLNVSPG SF CQE G+FRVCFANMDDET+ +A
Sbjct  367   WMDLRPLLKESTFDSEMSLWRVIINDVKLNVSPGSSFDCQEPGFFRVCFANMDDETVDIA  426

Query  1459  LMRIRTSV-LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR+ V ++  G E+      KKQ+  + NL++S S R   E   +S   SP+ +SPL
Sbjct  427   LARIRSFVGVKKSGDESTPILMEKKQQWKKNNLRLSFSKRMYDESVNLSPLSSPIPHSPL  486

Query  1633  VQA  1641
             V+A
Sbjct  487   VRA  489



>ref|XP_003624084.1| 1-aminocyclopropane-1-carboxylate synthase [Medicago truncatula]
Length=533

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/481 (67%), Positives = 385/481 (80%), Gaps = 11/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATND HGENS YFDGWKAY++NPFHP  NPQGVIQMGLAENQLCFDLI+ W+ N
Sbjct  9     QLLSKIATNDKHGENSPYFDGWKAYESNPFHPTKNPQGVIQMGLAENQLCFDLIEEWIRN  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICTP+G  EF+ IA +QDYHGLPEFR AVA FM KVRG  V+FDPDRI+MSGGAT
Sbjct  69    NPKASICTPEGVNEFRHIANFQDYHGLPEFRNAVANFMSKVRGGRVRFDPDRILMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQL PV C SSN+FK+TR ALE A
Sbjct  129   GANELIMFCLADPGDAFLVPSPYYPAFVRDLCWRTGVQLIPVQCHSSNNFKITREALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             +KKAQE+NI VKGL+I NPSNPLGT L++DTL  IV F+N+ NIHLVCDEIY+ TVF+ P
Sbjct  189   HKKAQEENINVKGLIITNPSNPLGTTLEKDTLKSIVSFINENNIHLVCDEIYSGTVFNTP  248

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S+A++IQE+ +C  D IHI+YSLSKD+G PGFRVG++YSYND VV+C RKMSSFGLV
Sbjct  249   TYVSVAEVIQEMEECKKDLIHIIYSLSKDMGLPGFRVGLVYSYNDEVVNCGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH +AAMLSD  FV+ F+ ESS RLR+R E FT+GL +V I  L SN GLF WMNL
Sbjct  309   SSQTQHFLAAMLSDDIFVDKFLEESSRRLRERREFFTKGLEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF  E++LW++IINE+KLNVSPG +F+C E GW+RVCFANMD ET+ +AL RI
Sbjct  369   RGLLKEKTFEGEMKLWRLIINEVKLNVSPGSAFNCSEPGWYRVCFANMDHETVEIALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQ  1638
             R  V    G E       K+    + NL++S S RR  E+ M   + SPHSPM +SPLV+
Sbjct  429   RAFV---NGREKGKTVEIKRW---KSNLRLSFSSRRFDENVMSPHMMSPHSPMPHSPLVR  482

Query  1639  A  1641
             +
Sbjct  483   S  483



>ref|XP_004306735.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Fragaria vesca subsp. vesca]
Length=493

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/490 (64%), Positives = 384/490 (78%), Gaps = 14/490 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
              +LSKIATNDGHGEN AYFDGWKAYD NPFHP  NP+GVIQMGLAENQL FD+I+ W++ 
Sbjct  5     SLLSKIATNDGHGENLAYFDGWKAYDRNPFHPTQNPEGVIQMGLAENQLSFDVIQEWIMK  64

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPKASICTP+G  EFK++A +QDYHG P+FR A+A FM K RG  VKFDPDR+VM+GGAT
Sbjct  65    NPKASICTPEGLAEFKNVANFQDYHGFPDFRKAIANFMSKARGGRVKFDPDRVVMAGGAT  124

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E + FCL +PG+AFLVP+PYYP F RDL WRTGV++ PV C+SSN+F+VTR ALE+A
Sbjct  125   GANETVMFCLANPGDAFLVPSPYYPAFYRDLGWRTGVKIVPVDCDSSNNFQVTRAALEAA  184

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+ +NI +KGL+I NPSNPLGT LDR TL  +V+F+NDKNIHLVCDEIYA TVFS P
Sbjct  185   YEKARNNNINIKGLIITNPSNPLGTTLDRATLTSLVKFINDKNIHLVCDEIYAGTVFSSP  244

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             +F  + ++++EV+ CN D IHIVYSLSKD+G PG RVGI+YSYND VV CARKMSSFGLV
Sbjct  245   KFTCVTEVMKEVKNCNRDLIHIVYSLSKDMGVPGLRVGIVYSYNDTVVKCARKMSSFGLV  304

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH++AAML D EFV NF+  SS+RL +RH  FT GL +VGI  LK N GLF WM+L
Sbjct  305   SSQTQHMLAAMLLDDEFVTNFLETSSKRLARRHWIFTTGLEKVGINCLKGNAGLFCWMDL  364

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLK+ TF AE+ LW+MIIN++KLNVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  365   RKLLKDKTFEAEMVLWRMIINDVKLNVSPGSSFRCVEPGWFRVCFANMDEHTVEVALKRI  424

Query  1471  RTSV-LQWKGMEaaaaasakkqkqCRRN------LKVSL-SFRRGLEDCM---ISSPHSP  1617
             R  V ++++G +    A        R+N      L++S  S  R  E+ M   + SPHSP
Sbjct  425   RAFVGVEFEGNKKRNNAEVFVNSP-RKNRWGKDGLRLSFGSATRRYEEVMSPRMMSPHSP  483

Query  1618  M-NSPLVQAT  1644
             M +SPL++A+
Sbjct  484   MPHSPLLRAS  493



>ref|XP_008345341.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Malus 
domestica]
Length=495

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/491 (63%), Positives = 378/491 (77%), Gaps = 8/491 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  +   +LSKIATN+ HGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL FDL+
Sbjct  4     SASENRLLLSKIATNEKHGENSPYFDGWKAYDQNPFHPTENPEGVIQMGLAENQLSFDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  NPKASICT +G E+F+++A +QDYHG PEFR A+A FM K RG  V FDP R+V
Sbjct  64    EEWIRKNPKASICTAEGIEKFRNVANFQDYHGFPEFRQAIATFMSKARGGRVTFDPHRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL DPG+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLADPGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ +NI VKGL+I NPSNPLGT LD+DTL  +V F+N KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQXNNINVKGLIITNPSNPLGTTLDKDTLESLVTFINQKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P+F  I ++IQ + CNP+ IHIVYSLSKD+GFPG RVGI+YSYND VV+  RKMS
Sbjct  244   TVFSSPKFTCITEVIQNMNCNPNLIHIVYSLSKDMGFPGLRVGIVYSYNDDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQH++A+MLSD++FVE F+  S++RL KRH  FT GL +VGI  LKSN GLF
Sbjct  304   SFGLVSSQTQHMLASMLSDEDFVEKFLTTSAKRLAKRHGVFTDGLEEVGINCLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK+ TF  E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS-------SPHS  1614
             AL RIR  V Q K  +  A   + K++          S  R  E   +S       SPHS
Sbjct  424   ALKRIRAFVGQGKKAQEQAQVKSPKKRWQSNLRLSFSSSSRRFEQEGVSVMSPRMMSPHS  483

Query  1615  PM-NSPLVQAT  1644
             PM +SPL++AT
Sbjct  484   PMPHSPLLRAT  494



>ref|XP_009591161.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Nicotiana 
tomentosiformis]
Length=489

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/483 (64%), Positives = 384/483 (80%), Gaps = 6/483 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  7     KNNSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G + F+ IA +QDYHGLPEFR A+A+FMEK RG  V FDP+R+VM+G
Sbjct  67    IKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRRAIAKFMEKTRGGRVTFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL D G+AFLVP+PYYP F+RDLRWRTGVQL P+ C+SSN+F++T  A+
Sbjct  127   GATGANETIIFCLADAGDAFLVPSPYYPAFNRDLRWRTGVQLIPIPCDSSNNFQITTKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+VKGL++ NPSNPLGT LDRDTL  ++ F N  NIHLVCDEIYAATVF
Sbjct  187   KEAYENAQKSNIKVKGLILTNPSNPLGTTLDRDTLKSLLTFTNQHNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             S P+F+SIA+I+ +    CN D +HIVYSLSKD+G PGFR+GI+YS+ND VV+CARKMSS
Sbjct  247   STPQFVSIAEILNDEMSHCNKDLVHIVYSLSKDMGLPGFRIGIVYSFNDTVVNCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQHL+A MLSD++FV NF+ ESS+RL KRH  FT GL +VGI+ L+SN GLF 
Sbjct  307   FGLVSTQTQHLLAEMLSDEKFVANFLAESSKRLAKRHMHFTNGLEEVGIKCLRSNAGLFC  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LL+E TF AE+ LW++IIN++KLNVSPG SF CQE G+FRVCFANMDDET+ +A
Sbjct  367   WMDLRPLLEESTFDAEMSLWRVIINDVKLNVSPGSSFDCQEPGFFRVCFANMDDETVDIA  426

Query  1459  LMRIRTSV-LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR  V ++  G E+ A    ++ K  + NL++S S R   E   +S   SP+ +SPL
Sbjct  427   LARIRRFVGVKKSGDESTAMEKQQQWK--KSNLRLSFSKRMFDESVNLSPLSSPIPHSPL  484

Query  1633  VQA  1641
             V+A
Sbjct  485   VRA  487



>ref|NP_001280199.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Prunus mume]
 dbj|BAH66892.1| 1-aminocyclopropane-1-carboxylate synthase [Prunus mume]
Length=492

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/426 (69%), Positives = 353/426 (83%), Gaps = 0/426 (0%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIAT++GHGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL FD I++W+  N
Sbjct  12    LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDSIEDWIKKN  71

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM K RG  V FDP+R+VMSGGATG
Sbjct  72    PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFMSKARGGRVTFDPNRVVMSGGATG  131

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+ ALE+AY
Sbjct  132   ANELVMFCLADPGDAFLVPSPYYPAFFRDLGWRTGVQIVPVDCDSSNNFKITKEALEAAY  191

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             +KAQ++NI VKGL+I NPSNPLGT LDR+TL  +V F+N KNIHLVCDEIYAATVFS P 
Sbjct  192   EKAQKNNINVKGLIITNPSNPLGTTLDRNTLESLVEFINQKNIHLVCDEIYAATVFSSPT  251

Query  937   FISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             F  I+++IQ + CNP+ IHIVYSLSKD+  PG RVGI+YSYND VV+  RKMSSFGLVS+
Sbjct  252   FTCISEVIQNMNCNPNLIHIVYSLSKDMELPGLRVGIVYSYNDDVVNIGRKMSSFGLVSS  311

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQH++A+ML D+EFV  F+  SS+RL KRH  FT+GL +VGI  LKSN GLF WM+LR 
Sbjct  312   QTQHMLASMLLDEEFVARFLETSSKRLAKRHGVFTKGLEEVGINCLKSNAGLFCWMDLRR  371

Query  1297  LLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRT  1476
             LL++ TF  E+ LW++I+NE+ LNVSPG SF C E GWFRVCFANMDDET+ VAL RIRT
Sbjct  372   LLEDQTFDGEMVLWRVIVNEVGLNVSPGSSFKCVEPGWFRVCFANMDDETLEVALKRIRT  431

Query  1477  SVLQWK  1494
              V Q K
Sbjct  432   FVRQGK  437



>gb|ABQ51839.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
 gb|ABQ51841.1| 1-aminocyclopropane-1-carboxylate synthase [Pelargonium x hortorum]
Length=482

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/480 (66%), Positives = 373/480 (78%), Gaps = 14/480 (3%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +  Q+LSKIATNDGHGENS YFDGWKAYD +PFHP  NP GVIQMGLAENQL  DLI++W
Sbjct  4     KSKQLLSKIATNDGHGENSPYFDGWKAYDRDPFHPSQNPNGVIQMGLAENQLSSDLIEDW  63

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V +NP+ASICT +G  +FKD+A +QDYHGL EFR AVA+FM + RG  V FDPDR+VMSG
Sbjct  64    VRSNPEASICTLEGVGKFKDVANFQDYHGLLEFRHAVAKFMSRGRGGKVTFDPDRVVMSG  123

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             G TGA+E++ FCL +PG+AFL+P+PYYP  DRDL+WRTG Q+ PV C SSN FK+TR AL
Sbjct  124   GPTGANELIVFCLANPGDAFLLPSPYYPANDRDLQWRTGAQIIPVHCNSSNGFKITREAL  183

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E +Y +AQE NI VKG+L+ NPSNPLGT+LDRDTL  IV FV D NIHLV DEIYAATVF
Sbjct  184   ERSYAQAQESNINVKGVLLTNPSNPLGTILDRDTLKSIVSFVTDNNIHLVIDEIYAATVF  243

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             + PEF+S+++I+QE+    CNPD IHIVYSLSKDLG PGFRVGI+YS+ND VVSCARKMS
Sbjct  244   AAPEFVSVSEILQEMDDTTCNPDLIHIVYSLSKDLGMPGFRVGIVYSFNDDVVSCARKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQHL+AAMLSD  FVE F+ E S  L +RH  FT+GL ++GI  LKSN GL+
Sbjct  304   SFGLVSTQTQHLLAAMLSDDVFVERFLAE-SRSLGRRHGVFTKGLEELGIGCLKSNAGLY  362

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDDET+ V
Sbjct  363   FWMDLRKLLEEETFEAEMVLWKVIINEVKLNVSPGSSFHCVEPGWFRVCFANMDDETVHV  422

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS-----SPHSPM  1620
             AL RIR  V      +       +K+     NL++S S  R  E  M+S     SPHSP+
Sbjct  423   ALKRIRAFV-----RKKEVGPVKRKRFMDNLNLRLSFSSLRYDESVMLSPHIMVSPHSPL  477



>gb|AAC49153.1| 1-aminocyclopropane 1-carboxylate synthase [Pelargonium x hortorum]
Length=482

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/484 (66%), Positives = 376/484 (78%), Gaps = 12/484 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +  Q+LSKIATNDGHGENS YFDGWKAYD +PFHP  NP GVIQMGLAENQL  DLI++W
Sbjct  4     KSKQLLSKIATNDGHGENSPYFDGWKAYDRDPFHPSQNPNGVIQMGLAENQLSSDLIEDW  63

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             V +NP+ASICT +G  +FKD+A +QDYHGL EFR AVA+FM + RG  V FDPDR+VMSG
Sbjct  64    VRSNPEASICTLEGVGKFKDVANFQDYHGLLEFRHAVAKFMSRGRGGKVTFDPDRVVMSG  123

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E++ FCL +PG+AFL+P+PYYP  DRDL+WRTG Q+ PV C SSN FK+TR AL
Sbjct  124   GATGANELIVFCLANPGDAFLLPSPYYPANDRDLQWRTGAQIIPVHCNSSNGFKITREAL  183

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             E +Y +AQE NI VKG+L+ NPSNPLGT+LDRDTL  IV FV D NIHLV DEIYAATVF
Sbjct  184   ERSYAQAQESNINVKGVLLTNPSNPLGTILDRDTLKSIVSFVTDNNIHLVIDEIYAATVF  243

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               PEF+S+++I+QE+    CNPD IHIVYSLSKDLG PGFRVGI+YS+ND VVSCARKMS
Sbjct  244   VAPEFVSVSEILQEMDDTTCNPDLIHIVYSLSKDLGMPGFRVGIVYSFNDDVVSCARKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQHL+AAMLSD  FVE F+ E   RL +RH  FT+GL ++GI  LKSN GL+
Sbjct  304   SFGLVSTQTQHLLAAMLSDDVFVERFLAE-RRRLGRRHGVFTKGLEELGIGCLKSNAGLY  362

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF AE+ LWK+IINE+KLNVSPG SFHC E GWFRVCFANMDDET+ V
Sbjct  363   FWMDLRKLLEEETFEAEMVLWKVIINEVKLNVSPGSSFHCVEPGWFRVCFANMDDETVHV  422

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSP  1629
             AL RIR  V      +       +K+     NL++S S  R  E  M+ SPH     +SP
Sbjct  423   ALKRIRAFV-----RKKEVGPVKRKRFMDNLNLRLSFSSLRYDESVML-SPHIMVSTHSP  476

Query  1630  LVQA  1641
             LV+A
Sbjct  477   LVRA  480



>emb|CAJ34918.1| 1-aminocyclopropane-1-carboxylate synthase [Carica papaya]
Length=488

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/480 (67%), Positives = 377/480 (79%), Gaps = 7/480 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIATND HGE+S YFDGWKAYD NPFHP  NP GVIQMGL+ENQLCFDLI+ WV  N
Sbjct  9     LLSKIATNDRHGEDSPYFDGWKAYDRNPFHPTRNPDGVIQMGLSENQLCFDLIEKWVKKN  68

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P ASICT +G E FK IA +QDYHGL EFR  VA+ M K RG  V FDP+RIVMSGGATG
Sbjct  69    PNASICTAEGVENFKHIANFQDYHGLKEFRQEVAKLMGKARGGRVTFDPERIVMSGGATG  128

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+A LVPTPYYP F+RDLRWRTGVQ+ PV C SSN+F VTR A+E+AY
Sbjct  129   ASETIMFCLADPGDASLVPTPYYPAFNRDLRWRTGVQIIPVQCSSSNNFTVTREAVEAAY  188

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             +KAQE NI VKGL+I NPSNPLGT LD  TL  +V FVNDK IHLVCDEIYAATVFS PE
Sbjct  189   QKAQEANINVKGLIITNPSNPLGTTLDSQTLQSLVNFVNDKTIHLVCDEIYAATVFSSPE  248

Query  937   FISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             F+SIA+IIQE+  N D IHI+YSLSKD+G PGFRVGI+YSYND V+SC R+MSSFGLVS+
Sbjct  249   FVSIAEIIQEMDVNRDLIHIIYSLSKDMGLPGFRVGIVYSYNDGVLSCGRRMSSFGLVSS  308

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQ+ +A +LSD EFV+ F+ ESS+RL +RH   TRGL QVGI+ LKSN GLFVWM+LR 
Sbjct  309   QTQYFLATLLSDDEFVDYFLRESSKRLARRHHKLTRGLEQVGIKCLKSNAGLFVWMDLRR  368

Query  1297  LLKEPT-FAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
             LL+ PT F AE++LW+ I+N++KLNVSPG SFH  E GWFRVCFANM++ETM VAL RI+
Sbjct  369   LLEGPTSFDAEMKLWRTIVNDVKLNVSPGSSFHVAEPGWFRVCFANMEEETMDVALQRIQ  428

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGL--EDCMISSPH--SPMNSPLVQA  1641
               V + K  EAAAAA+  K++    NL++S S R  +  E     SPH  SP  SPLV+A
Sbjct  429   AFVCRAKEREAAAAATTNKKRGT-MNLRLSFSSRNQVYEEQYYAMSPHMMSP-RSPLVEA  486



>ref|XP_008362641.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1-like 
[Malus domestica]
Length=491

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/433 (68%), Positives = 353/433 (82%), Gaps = 0/433 (0%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  +   +LSKIATN+ HGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL FDL+
Sbjct  4     SASENRLLLSKIATNEKHGENSPYFDGWKAYDQNPFHPTENPEGVIQMGLAENQLSFDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  NPKASICT +G E+F+++A +QDYHG PEFR A+A FM K RG  V FDP R+V
Sbjct  64    EEWIRKNPKASICTAEGIEKFRNVANFQDYHGFPEFRQAIATFMSKARGGRVTFDPHRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL DPG+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLADPGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ +NI VKGL+I NPSNPLGT LD+DTL  +V F+N KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQSNNINVKGLIITNPSNPLGTTLDKDTLESLVTFINQKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P+F  I ++IQ + CNP+ IHIVYSLSKD+GFPG RVGI+YSYND VV+  RKMS
Sbjct  244   TVFSSPKFTCITEVIQNMNCNPNLIHIVYSLSKDMGFPGLRVGIVYSYNDDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQH++A+MLSD++FVE F+  S++RL KRH  FT GL +VGI  LKSN GLF
Sbjct  304   SFGLVSSQTQHMLASMLSDEDFVEKFLTTSAKRLAKRHGVFTDGLEEVGINCLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK+ TF  E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQWK  1494
             AL RIR  V Q K
Sbjct  424   ALKRIRAFVGQGK  436



>gb|ACX69843.1| ACC synthase [Rubus idaeus]
Length=491

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 379/490 (77%), Gaps = 9/490 (2%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M   + +LSKIATN GHGEN AYFDGWKAYD NPFHP  NP+GVIQMGLAENQL  DLI+
Sbjct  1     MGSNSALLSKIATNGGHGENLAYFDGWKAYDRNPFHPTQNPEGVIQMGLAENQLSLDLIE  60

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
              W+  NPKASICT +G EEFK++A +QDY+G P+FR A+A FM K RG  V FDPDR+VM
Sbjct  61    EWIRKNPKASICTAEGVEEFKNVANFQDYYGFPDFRKAIANFMSKARGGRVTFDPDRVVM  120

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             +GGATGA+E+L FCL DPG+AFLVP+PYYP F RDL WRTGV++ PV C+SSN+F+VTR 
Sbjct  121   AGGATGANELLMFCLADPGDAFLVPSPYYPAFYRDLGWRTGVKIVPVDCDSSNNFQVTRA  180

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALE+AY+KA+ +NI +KGL+I NPSNPLGT LDRDTL  +V+F+NDKNIHLVCDEIY+ T
Sbjct  181   ALEAAYEKARNNNINIKGLIITNPSNPLGTTLDRDTLTSLVKFINDKNIHLVCDEIYSGT  240

Query  919   VFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             VFS P F  +++++Q+V+  N D IHIVYSLSKD+G PG RVGI+YSYNDAVV+C RKMS
Sbjct  241   VFSSPTFTCVSEVMQDVKNFNRDLIHIVYSLSKDMGVPGLRVGIVYSYNDAVVNCGRKMS  300

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQHL++AML D  FV NF+  SS+RL +RHE FT GL +VGI  LKSN GL+
Sbjct  301   SFGLVSSQTQHLLSAMLLDDVFVSNFLKTSSKRLARRHEVFTTGLKEVGINCLKSNAGLY  360

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK  TF AE+ LW++IINE+KLNVSPG SF C E GWFRVCFANMD+ T+ V
Sbjct  361   CWMDLRKLLKGQTFEAEMVLWRVIINEVKLNVSPGSSFRCVEPGWFRVCFANMDEHTVEV  420

Query  1456  ALMRIRTSV-LQWKGMEaaaaasakkqkqCRR---NLKVSLSFRRGLEDCM---ISSPHS  1614
             AL RIR  V +Q       A     K    +R   +L++S    +  E+ M   I SPHS
Sbjct  421   ALKRIRAFVGVQGNKKSNNADQVFVKSPNKKRSQNDLRLSFPATKRYEEVMSPHIMSPHS  480

Query  1615  PM-NSPLVQA  1641
             PM +SPL++A
Sbjct  481   PMPHSPLLRA  490



>gb|AAR99390.1| ACC synthase ACS1 [Nicotiana attenuata]
Length=490

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 384/486 (79%), Gaps = 7/486 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  7     KNNSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G + F+ IA +QDYHGLPEFR A+A+FMEK RG+ V FDP+R+VM+G
Sbjct  67    IKRNPNASICTTEGIKSFRAIANFQDYHGLPEFRRAIAKFMEKTRGERVTFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL D G+AFLVP+PYYP F+RDLRWRTGVQL P+ C+SSN+F++T  A+
Sbjct  127   GATGANETIIFCLADAGDAFLVPSPYYPAFNRDLRWRTGVQLIPIPCDSSNNFQITTKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
               AY+ AQ+ NI+VKGL++ NPSNPLGT LDRDTL + + F N  NIHLVCDEIYAATVF
Sbjct  187   NEAYENAQKSNIKVKGLILTNPSNPLGTTLDRDTLKNFLTFTNQHNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             + P+F+SIA+I+ +    CN D +HIVYSLSKD+G PGFRVGI+YS+NDAVV+CARKMSS
Sbjct  247   NTPQFVSIAEILNDEMSHCNKDLVHIVYSLSKDMGLPGFRVGIVYSFNDAVVNCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A MLSD++FV NF+ ESS+RL KRH+ FT GL +VGI+ L+SN GLF 
Sbjct  307   FGLVSTQTQYLLAEMLSDEKFVSNFLAESSKRLAKRHKHFTNGLEEVGIKCLRSNAGLFC  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLK+  F AE+ LWK+IIN++KLNVSPG SF CQE G+FRVCFANMDDET+ +A
Sbjct  367   WMDLRPLLKQSNFDAEMSLWKVIINDVKLNVSPGSSFDCQEPGFFRVCFANMDDETVDIA  426

Query  1459  LMRIRTSV-LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSP-HSPM-NSP  1629
             L RIR  V ++  G E  A    ++ K  + NL++S   R   E     SP  SP+ +SP
Sbjct  427   LARIRRFVGVKESGDETTAMEKKQQWK--KNNLRLSFPKRMYDESVNNLSPLSSPIPHSP  484

Query  1630  LVQATN  1647
             LV+A N
Sbjct  485   LVRARN  490



>gb|ACV30003.1| ACC synthase family protein [Musa acuminata AAA Group]
Length=483

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/481 (65%), Positives = 376/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  9     QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  69    NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  129   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  189   YRKARNSHIRVKGILVTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  248

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  249   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  309   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  369   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  429   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  482

Query  1645  N  1647
              
Sbjct  483   T  483



>gb|ACV33064.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=483

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/481 (65%), Positives = 376/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  9     QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  69    NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  129   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  189   YRKARNSHIRVKGILVTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  248

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  249   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  309   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  369   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  429   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  482

Query  1645  N  1647
              
Sbjct  483   T  483



>ref|XP_007135134.1| hypothetical protein PHAVU_010G103900g [Phaseolus vulgaris]
 gb|ESW07128.1| hypothetical protein PHAVU_010G103900g [Phaseolus vulgaris]
Length=478

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/489 (65%), Positives = 384/489 (79%), Gaps = 13/489 (3%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             MDL   R+   +LSKIATND HGENS YFDGWKAY+ NPFHP  NPQGVIQMGLAENQLC
Sbjct  1     MDLG--RKSQHLLSKIATNDKHGENSPYFDGWKAYERNPFHPTKNPQGVIQMGLAENQLC  58

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W+LNNPKASICTP+G  +F++IA +QDYHGL EFR  +A +M KVRG  V+FDP
Sbjct  59    FDLIEEWILNNPKASICTPEGVHQFRNIANFQDYHGLKEFRNGIANWMSKVRGGRVRFDP  118

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGA+E + FCL D G+AF++PTP+YPGF RDL WRT +QL PV C SSN+F
Sbjct  119   DRIVMSGGATGANEQIMFCLADHGDAFMIPTPFYPGFVRDLCWRTQMQLIPVHCHSSNNF  178

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+TR ALE AYKKA+EDNI VKGL+I NPSNPLGT LD+DTL  +V F+N+KNIHLVCDE
Sbjct  179   KITREALEEAYKKAKEDNINVKGLIITNPSNPLGTTLDKDTLKSLVSFINEKNIHLVCDE  238

Query  904   IYAAT-VFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             IYAAT   S P ++S+ ++IQE++ C  D IH++YSLSKD+GFPGFRVGIIYS+ND VV 
Sbjct  239   IYAATVFSSSPSYVSVVEVIQEMEHCKRDLIHVIYSLSKDMGFPGFRVGIIYSFNDEVVG  298

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
              ARKMSSFGLVS+QTQH++A+MLSD++FV  F+ E+S RL KRH+ F +GL +V I    
Sbjct  299   SARKMSSFGLVSSQTQHMLASMLSDEKFVTKFLSENSRRLEKRHDMFMKGLEEVNITWFP  358

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SN GLF WMNL++LLKE TF AEL+LW++II+E+KLNVSPG SF+C E GWFRVCFANMD
Sbjct  359   SNAGLFFWMNLKSLLKEATFEAELKLWRVIIHEVKLNVSPGSSFNCSEPGWFRVCFANMD  418

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSP  1617
             DET+ VAL RIR  V    G E          K  + NL+  LSF   + D  + SPHSP
Sbjct  419   DETVDVALNRIRELV----GKE---TKKPVGMKSWQPNLR--LSFNSRMFDESVMSPHSP  469

Query  1618  MNSPLVQAT  1644
             + SPLVQAT
Sbjct  470   ITSPLVQAT  478



>sp|Q9MB95.1|1A11_PRUMU RecName: Full=1-aminocyclopropane-1-carboxylate synthase 1; Short=ACC 
synthase 1; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Prunus mume]
 dbj|BAA90549.1| ACC synthase [Prunus mume]
Length=492

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/426 (69%), Positives = 351/426 (82%), Gaps = 0/426 (0%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIAT++GHGENS YFDGWKAYD NPFHP  NP+GVIQMGLAENQL FD I++W+  N
Sbjct  12    LLSKIATSEGHGENSPYFDGWKAYDRNPFHPTKNPEGVIQMGLAENQLSFDSIEDWIKKN  71

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICTP+G EEFK++AI+QDYHG PEFR AVA FM K RG  V FDP+R+VMSGGATG
Sbjct  72    PKASICTPEGVEEFKNVAIFQDYHGFPEFRKAVAMFMSKARGGRVTFDPNRVVMSGGATG  131

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E++ FCL DPG+AFLVP+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+ ALE+AY
Sbjct  132   ANELVMFCLADPGDAFLVPSPYYPAFFRDLGWRTGVQIVPVDCDSSNNFKITKEALEAAY  191

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             +KAQ++NI VKGL+I NPSNPLGT LDR+TL  +V F+N KNIHLVCDEIYAATVFS P 
Sbjct  192   EKAQKNNINVKGLIITNPSNPLGTTLDRNTLESLVEFINQKNIHLVCDEIYAATVFSSPT  251

Query  937   FISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVST  1116
             F  I+++IQ + CNP+ IHIVYSLSKD+G PG RVGI+YSYND VV+  RKMSSFGLVS+
Sbjct  252   FTCISEVIQNMNCNPNLIHIVYSLSKDMGLPGLRVGIVYSYNDDVVNIGRKMSSFGLVSS  311

Query  1117  QTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRN  1296
             QTQH++ +ML D+EFV  F+  S +RL KRH  FT+GL +VGI  LKSN GLF WM+LR 
Sbjct  312   QTQHMLPSMLLDEEFVARFLETSPKRLAKRHGVFTKGLEEVGINCLKSNAGLFCWMDLRR  371

Query  1297  LLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRT  1476
             LL++ TF  E+ LW++I+NE+  NVSPG SF C E GWFRVCFANMDDET+ VAL RIRT
Sbjct  372   LLEDQTFDGEMVLWRVIVNEVGPNVSPGSSFKCVEPGWFRVCFANMDDETLEVALKRIRT  431

Query  1477  SVLQWK  1494
              V Q K
Sbjct  432   FVRQGK  437



>ref|XP_006345579.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 4-like 
[Solanum tuberosum]
Length=496

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/501 (61%), Positives = 383/501 (76%), Gaps = 36/501 (7%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             + + +LSK+A+N+ HGE S YFDGWKAYDN+PFHP +NP GVIQMGLAENQL  DLI++W
Sbjct  12    KSSVVLSKLASNEQHGEKSPYFDGWKAYDNDPFHPVNNPNGVIQMGLAENQLSVDLIEDW  71

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPKASICT  G E F+ IA +QDYHGLPEF  A+A+FMEK RG  VKFD  R+VM+G
Sbjct  72    IKRNPKASICTNDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKVKFDSKRVVMAG  131

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E L  CL DPG+AFLVP+PYYPGF+RDLRWR+GVQL P+ C+SSN+FK+T  A+
Sbjct  132   GATGANETLILCLADPGDAFLVPSPYYPGFNRDLRWRSGVQLLPISCKSSNNFKITIEAI  191

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+K Q+ N+++KGL++ NPSNPLGT+LDRDTL +I  F N+ NIHLVCDEIYAATVF
Sbjct  192   KEAYEKGQQANVKIKGLILTNPSNPLGTILDRDTLKNIFTFTNEHNIHLVCDEIYAATVF  251

Query  925   SQPEFISIAQIIQEVQC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
                 F+SIA+II +  C N D +HIV SLSKDLGFPGFRVGI+YS+ND VV+CARKMSSF
Sbjct  252   DASRFVSIAEIINDEICINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDDVVNCARKMSSF  311

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVSTQTQHL+A+MLSD EFVE F++ES++RLR+R+E FTRGL ++GI+ L+SN G++ W
Sbjct  312   GLVSTQTQHLLASMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIKCLESNAGVYCW  371

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR LLKEPT  AE+ LWK+IIN +KLNVSPG SF+C E GWFRVCFAN+DD+TM +AL
Sbjct  372   MDLRLLLKEPTLDAEMSLWKLIINVVKLNVSPGSSFNCSEVGWFRVCFANIDDQTMEIAL  431

Query  1462  MRIR---------------TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM  1596
              RIR                + LQWK                R NL+++ S     E+ M
Sbjct  432   ARIRMFMDANNNVDENGILKNKLQWK----------------RNNLRLNFSNGEYDENVM  475

Query  1597  ---ISSPHSPM-NSPLVQATN  1647
                + SP+SP+  SPLV+A N
Sbjct  476   SLNMMSPNSPIPRSPLVRARN  496



>gb|ACM48506.3| 1-aminocyclopropane-carboxylate synthase [Dimocarpus longan]
Length=478

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/479 (64%), Positives = 383/479 (80%), Gaps = 9/479 (2%)
 Frame = +1

Query  220   LSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNNP  399
             LSK+AT+D HGENS YF GWKAYD NP+HP  +P GVIQMGLAEN LCFDLIK+W++ NP
Sbjct  4     LSKMATSDQHGENSPYFYGWKAYDRNPYHPTQSPHGVIQMGLAENPLCFDLIKDWIVKNP  63

Query  400   KASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATGA  579
              ASICTP+G ++FK+IAI+QDYHGL  F+ AVA+FM K RG  V FDPDR+VM+GGATGA
Sbjct  64    DASICTPEGVDKFKEIAIFQDYHGLQIFKQAVAKFMSKARGGRVTFDPDRVVMAGGATGA  123

Query  580   HEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAYK  759
             +E++ FC+ DPG+A+LVPTPYYP F RDL WRTGV++ PV C SSN+F+VTR +LE AY+
Sbjct  124   NELITFCIADPGDAYLVPTPYYPAFGRDLGWRTGVKIVPVDCYSSNNFQVTRASLEDAYE  183

Query  760   KAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPEF  939
             KA++ NI +KGLLI NPSNPLGT L+RDTL  +V F+N+ NIHLV DEIYAATVF+ P+F
Sbjct  184   KARKANINIKGLLITNPSNPLGTTLERDTLKALVSFINETNIHLVVDEIYAATVFNSPKF  243

Query  940   ISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVSTQ  1119
             ISIA++I+E+ CN D IH++YSLSKD+GFPGFRVGI+YSYND VV+C  KMSSFGLVS+Q
Sbjct  244   ISIAEVIEEMDCNRDNIHLIYSLSKDMGFPGFRVGIVYSYNDEVVNCGTKMSSFGLVSSQ  303

Query  1120  TQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLRNL  1299
             TQ+L+A+MLSD EFV+NF+ ESS+RL KR+ +FT GL Q GI  L+SN GLF WMNLR+L
Sbjct  304   TQYLLASMLSDDEFVDNFLAESSKRLAKRYHTFTMGLDQAGITCLRSNAGLFFWMNLRHL  363

Query  1300  LKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIRTS  1479
             LKE T   E+ L +MIIN+ KLNVSPG SF C E+GW+RVCFANMDDET++VAL RIR  
Sbjct  364   LKERTEEGEMALGRMIINDAKLNVSPGSSFQCTESGWYRVCFANMDDETVQVALTRIRDF  423

Query  1480  VLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS----SPHSPM-NSPLVQA  1641
             V   +  E  +    KK++  + NL++S S  R  E  ++S    SPHSP+  SPLV+A
Sbjct  424   V---RRAEETSCEPPKKKRWKQNNLRLSFS-SRIYEASVMSPHKMSPHSPIPQSPLVRA  478



>gb|AAC31571.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAQ13437.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAR00512.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/481 (65%), Positives = 376/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  192   YRKARNSHIRVKGILVTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>gb|ABK95257.1| unknown [Populus trichocarpa]
Length=433

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/444 (71%), Positives = 367/444 (83%), Gaps = 18/444 (4%)
 Frame = +1

Query  337   MGLAENQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKV  516
             MGLAENQLCFDLI++W+  NPKASIC+P+G  EF++IAI+QDYHGLPEFR AVA FMEKV
Sbjct  1     MGLAENQLCFDLIQDWLKKNPKASICSPEGLNEFREIAIFQDYHGLPEFRNAVANFMEKV  60

Query  517   RGDTVKFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYP  696
             RG+ V FDPDRIVMSGGATGAHE +AFCL DPGEAFLVPTPYYPGFDRDLRWRTGV+L P
Sbjct  61    RGNRVAFDPDRIVMSGGATGAHETIAFCLADPGEAFLVPTPYYPGFDRDLRWRTGVKLIP  120

Query  697   VVCESSNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVND  876
             V  +SSN+F VT+ ALE+AY+ AQ DNI+VKGLLI NPSNPLGT+LDR+TL  IVRF+N+
Sbjct  121   VDSDSSNNFMVTKEALENAYEMAQLDNIKVKGLLITNPSNPLGTILDRETLRSIVRFINE  180

Query  877   KNIHLVCDEIYAATVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIY  1053
             KNIHLVCDEIYAATVFSQP+FIS+A+I+QE ++CN D +HIVYSLSKD+GFPG RVGIIY
Sbjct  181   KNIHLVCDEIYAATVFSQPDFISVAEILQEDIECNLDLVHIVYSLSKDMGFPGLRVGIIY  240

Query  1054  SYNDAVVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLA  1233
             SYNDAVVSCARKMSSFGLVSTQTQ+LIA+MLSD EFVE FI ES  RL  R+  FTRGL 
Sbjct  241   SYNDAVVSCARKMSSFGLVSTQTQYLIASMLSDNEFVEMFIRESKSRLAARYRVFTRGLD  300

Query  1234  QVGIETLK-SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGW  1410
             QVGIE LK SN GLF+WM+L  LLKE TF AE+ELW++II+E+KLNVSPGCSFHC + GW
Sbjct  301   QVGIECLKTSNAGLFLWMDLSRLLKEQTFEAEMELWRVIIHEVKLNVSPGCSFHCLKPGW  360

Query  1411  FRVCFANMDDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRR----  1578
             FRVCFANMDDETM+VAL RI+T V +  G + +           ++NL+   S +     
Sbjct  361   FRVCFANMDDETMQVALSRIKTFVNKEAGTKKS-----------KKNLRWQGSLKLLNSP  409

Query  1579  GLEDCMISSPHSPM-NSPLVQATN  1647
              + D  I+SPHSP+  SPLV+A N
Sbjct  410   RIYDDFINSPHSPIPQSPLVRARN  433



>ref|XP_010919415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Elaeis 
guineensis]
Length=492

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/480 (65%), Positives = 369/480 (77%), Gaps = 10/480 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSK+AT+DGHGENS+YFDGWKAYD +PFHP  NP+GVIQ+GLAENQLC D I+ W+ NN
Sbjct  15    LLSKMATSDGHGENSSYFDGWKAYDCDPFHPTSNPEGVIQLGLAENQLCLDPIQEWIKNN  74

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT  G  EFK+IA +QDYHGL  FR AVA+FM KVRG    F PDRIVMSGGATG
Sbjct  75    PKASICTEVGVSEFKNIANFQDYHGLRVFREAVAKFMRKVRGGRSDFHPDRIVMSGGATG  134

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E++AFCL DPGEAFLVPTPYYP FDRDLRWRTG+Q+ P+ C+SSN FK+TRTALESAY
Sbjct  135   AAEVIAFCLADPGEAFLVPTPYYPAFDRDLRWRTGIQVLPIQCKSSNHFKITRTALESAY  194

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             +KAQ+ N+RVK +++ NPSNPLGT+LDR+TL  +V F N K IHL+CDEI+A TVF  P+
Sbjct  195   EKAQKANVRVKAVMVANPSNPLGTILDRETLRMLVNFTNGKRIHLICDEIFAGTVFKDPQ  254

Query  937   FISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F+S+++I+ E   C+   IHI YSLSKDLG PGFRVG++YSYND VV CAR+MSSFGLVS
Sbjct  255   FVSVSEIVDEDPNCDRSLIHITYSLSKDLGLPGFRVGVVYSYNDTVVRCARRMSSFGLVS  314

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ+L+A+MLSD EF    I E   RL KRHE FT  LA+VGI+ L+SN GLF WM+LR
Sbjct  315   SQTQYLLASMLSDDEFTTKLIEEVRRRLSKRHELFTSRLAKVGIQCLESNAGLFCWMDLR  374

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLKE T   ELELW++IIN++KLNVSPG SFHC E GWFRVCFANMDDETM VAL RI 
Sbjct  375   RLLKEFTVEGELELWRVIINDVKLNVSPGSSFHCHEPGWFRVCFANMDDETMDVALGRIE  434

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLED--CMISSPHSPMNSPLVQATN  1647
             + VL+ K     A     KQ   R      LS  R  ED   M SS  SP +SPLV AT 
Sbjct  435   SFVLRTKEAAVQAKKKKWKQDGLR------LSLPRRFEDMATMTSSLMSP-HSPLVPATT  487



>ref|XP_010422075.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
Length=495

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/486 (66%), Positives = 379/486 (78%), Gaps = 7/486 (1%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LS+IA+ DGHGENS+YFDGWKAY+ NPFH    P GVIQMGLAENQLC DL++ 
Sbjct  9     KQDLNLLSRIASGDGHGENSSYFDGWKAYEENPFHQIDRPDGVIQMGLAENQLCGDLMRK  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WVL +P+ASICT QG  +F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDRIVMS
Sbjct  69    WVLEHPEASICTEQGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNRVKFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SS+ FK+T  A
Sbjct  129   GGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSDGFKITMKA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE AY+KA+  NI VKGLL+ NPSNPLGT LDR+ L  +V F N+K IHL+ DEIYAAT 
Sbjct  189   LEDAYEKARLSNIPVKGLLMTNPSNPLGTTLDRECLKSLVNFTNEKRIHLIADEIYAATT  248

Query  922   FSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F Q EFIS+A++I+E++ CN D IHIVYSLSKD+G PGFRVGIIYSYND VV  ARKMSS
Sbjct  249   FGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGFRVGIIYSYNDRVVQIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQ LIA MLSD++FVE FI ES  RL  RH+  T GL  +GI  LK+  GLF+
Sbjct  309   FGLVSSQTQRLIAKMLSDEDFVEEFIRESKLRLAARHKELTTGLDGLGIGWLKAEAGLFL  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  369   WMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  428

Query  1459  LMRIR--TSVL--QWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMN-  1623
             L RIR  TS L  + K + AA   + KK+K  + NL++S S +R  +D    SPHSP+  
Sbjct  429   LERIRVFTSQLEEETKPVAAATMMAKKKKKCWQSNLRLSFSDKRRFDDGFF-SPHSPVTP  487

Query  1624  SPLVQA  1641
             SPLV+A
Sbjct  488   SPLVRA  493



>dbj|BAF33503.1| ACC synthase [Orobanche minor]
Length=497

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/495 (63%), Positives = 384/495 (78%), Gaps = 11/495 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M+LK+     Q+LSKIATN+ HGENS YFDGWKAYDNNPFH   NP GVIQMGLAENQL 
Sbjct  3     MELKNGGTNCQLLSKIATNNEHGENSPYFDGWKAYDNNPFHTTKNPNGVIQMGLAENQLS  62

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              +L++ W  NNPK+SIC+P+G + FKD+AI+QDYHGLPEFR AVA+FM K RG  VKFDP
Sbjct  63    SELVEKWTKNNPKSSICSPEGIDAFKDMAIFQDYHGLPEFRNAVAKFMGKSRGGKVKFDP  122

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +RIVM+GGATGA+E+L FCL DP +AFL+PTPYYPGFDRDL+WRT VQL P+VCESSN F
Sbjct  123   ERIVMAGGATGANELLMFCLADPKDAFLIPTPYYPGFDRDLKWRTHVQLLPIVCESSNKF  182

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++T+ ALE AY  AQ+  I+VKGL+I NPSNPLGT +D+ TL  +V F+N K IHLVCDE
Sbjct  183   RITKEALEEAYMNAQKAKIKVKGLIITNPSNPLGTTMDKATLTALVTFINKKQIHLVCDE  242

Query  904   IYAATVFSQPEFISIAQIIQEVQ--CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             +YA TV S P F SI++++Q+++  CN + IH+VYSLSKD+G PGFRVGI+YSYND VV+
Sbjct  243   VYAGTVHS-PNFTSISEVVQDMEDHCNHELIHVVYSLSKDMGLPGFRVGIVYSYNDTVVN  301

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
               RKMSSFGLVS+QTQHL+A+MLSD+ F++  ILES  RL  RH+ FT+GL QVGI  L+
Sbjct  302   IGRKMSSFGLVSSQTQHLLASMLSDEGFIDELILESKRRLASRHDLFTKGLEQVGIRCLE  361

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SN GLF WM+LR LL+EPTF  E++LW++IIN++KLNVSPG SFHC E GWFRVCFANMD
Sbjct  362   SNAGLFCWMDLRTLLEEPTFEEEMKLWRVIINDVKLNVSPGSSFHCHEPGWFRVCFANMD  421

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNL-KVSLSFRRGLEDCM----IS  1602
             D TM VAL RIR  V + K          K++K  +R L ++SLS     E+ +     S
Sbjct  422   DLTMEVALRRIRMFVEKGKEDSTEVIIVRKEKKAWQRRLGRLSLSTLMYDENILTTSQFS  481

Query  1603  SPH--SPMNSPLVQA  1641
             SPH  SP +SPLV A
Sbjct  482   SPHMMSP-HSPLVLA  495



>ref|XP_006339629.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum 
tuberosum]
Length=486

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 388/482 (80%), Gaps = 6/482 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+AT++ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W
Sbjct  7     KTNSILSKLATSEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPKASIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+G
Sbjct  67    IKRNPKASICSNEGIKSFKAIANFQDYHGLPEFRRAIAKFMEKTRGGRVRFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A+
Sbjct  127   GATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLLPIHCESSNNFKITSKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+V+GL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF
Sbjct  187   KEAYENAQKSNIKVRGLILTNPSNPLGTTLDKDTLKSLLSFTNQHNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               P+F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFR+GI+YS+ND VV+CARKMS
Sbjct  247   DTPQFVSIAEILDEKEMTYCNKDLVHIVYSLSKDMGLPGFRIGIVYSFNDDVVNCARKMS  306

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ+ +AAMLSD++FV+NF+ ES+ RL KRH+ FT GL +VGI+ LK+N GLF
Sbjct  307   SFGLVSTQTQYFLAAMLSDEKFVDNFLTESAIRLAKRHKHFTNGLEEVGIKCLKNNAGLF  366

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +
Sbjct  367   CWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDI  426

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             AL RIR  V   K  + ++A   K+Q + + NL++S S +R  ++ ++S   SP+  SPL
Sbjct  427   ALARIRRFVRVEKSGDESSAMEKKQQWK-KNNLRLSFS-KRMYDESVLSPLSSPIPASPL  484

Query  1633  VQ  1638
             V+
Sbjct  485   VR  486



>ref|XP_009397633.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
 gb|AAQ13436.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAR00513.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/481 (64%), Positives = 376/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  192   YRKARNSHIRVKGILVTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ +  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVSEVIEDDPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>ref|XP_009624194.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=495

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/509 (62%), Positives = 387/509 (76%), Gaps = 39/509 (8%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             MD +S    +  LSK+A ++ HGENS YFDGWKAYDN+PFH   NP GVIQMGLAENQL 
Sbjct  1     MDSESGNFNSVFLSKLAISEEHGENSPYFDGWKAYDNDPFHLVKNPNGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W+  NPKASICT +G + F++IA +QDYHGLPEFR+A+A+FMEK R   VKFD 
Sbjct  61    FDLIEEWIKRNPKASICTTEGIKSFRNIANFQDYHGLPEFRSAIAKFMEKTRRGRVKFDT  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             +R+VM+GGATGA+E L FCL DPG+AFLVP+PYYPGF+RDLRWRTGVQL P+ C SSN+F
Sbjct  121   ERVVMAGGATGANETLIFCLADPGDAFLVPSPYYPGFNRDLRWRTGVQLLPIPCYSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T  A++  Y+KAQ+ NI+VKGL++ NPSNPLGT LD+DTL +++ F N  NIHLVCDE
Sbjct  181   KITTEAVKETYEKAQQSNIKVKGLILTNPSNPLGTTLDKDTLKNLLTFTNKHNIHLVCDE  240

Query  904   IYAATVFSQPEFISIAQIIQEV-----QC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYND  1065
             IYAATVF  PEF+SIA+II +      +C N D +HIVYSLSKD+GFPGFRVGIIYS+N+
Sbjct  241   IYAATVFDSPEFVSIAEIINDEMDKMDECINKDLVHIVYSLSKDMGFPGFRVGIIYSFNN  300

Query  1066  AVVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGI  1245
              VVSCARKMSSF LV+TQTQHL+A MLSD EFV+ F+LESS+RLRKRH+ FT GL +VGI
Sbjct  301   DVVSCARKMSSFSLVTTQTQHLLATMLSDDEFVDKFLLESSKRLRKRHKKFTTGLEEVGI  360

Query  1246  ETLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCF  1425
               LK N GL+ WM+LR LLK+PTF +E+ LWK+IIN++KLNVSPG SF+C E GWFRVCF
Sbjct  361   NCLKGNAGLYCWMDLRPLLKKPTFDSEMILWKLIINDVKLNVSPGSSFNCPEPGWFRVCF  420

Query  1426  ANMDDETMRVALMRIRTSV-------LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGL  1584
             AN+DD+T+ +AL RI+  V        QWK                R NL++S S R+  
Sbjct  421   ANIDDQTVEIALGRIQMLVENGAKNKQQWK----------------RNNLRLSFSNRKYD  464

Query  1585  EDC-------MISSPHSPMN---SPLVQA  1641
             E+         + SPHSP+N   SPLV+A
Sbjct  465   ENVMSSRMNMNMMSPHSPINIPKSPLVRA  493



>emb|CAE53271.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata]
Length=486

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/481 (64%), Positives = 375/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKV+G   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFMEKVKGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+++  PSNPLGT +DRDTL  +V FVN+K +HLVCDE+++ TVF +P
Sbjct  192   YRKARNSHIRVKGIVVTKPSNPLGTTMDRDTLRTLVSFVNEKRMHLVCDEVFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S+A++IQ +  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVAEVIQDDPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>ref|XP_006287590.1| hypothetical protein CARUB_v10000800mg [Capsella rubella]
 gb|EOA20488.1| hypothetical protein CARUB_v10000800mg [Capsella rubella]
Length=495

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/485 (65%), Positives = 376/485 (78%), Gaps = 5/485 (1%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LS+IA+ DGHGENS+YFDGWKAY+ NPFHP   P GVIQMGLAENQLC D+++ 
Sbjct  9     KQNLNLLSRIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDVMRK  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WVL +P+ASICT QG   F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDRIVMS
Sbjct  69    WVLKHPEASICTEQGLNGFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNRVKFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SS+ FK+T  A
Sbjct  129   GGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSDGFKITVEA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY+KA+E NI VKGLL+ NPSNPLGT LDR+ L  +V+F N+K IHL+ DEIYAAT 
Sbjct  189   LEAAYEKARESNIPVKGLLMTNPSNPLGTTLDRECLKSLVKFTNEKKIHLIADEIYAATT  248

Query  922   FSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F Q EFIS+A++I+E++ CN D IHIVYSLSKD+G PGFRVGI+YSYND VV  ARKMSS
Sbjct  249   FGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGFRVGIVYSYNDRVVQIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQHLIA MLSD++FV+ FI ES  RL  RH   T GL  +GI  LK+  GLF+
Sbjct  309   FGLVSSQTQHLIAKMLSDEDFVDEFIRESKLRLAARHAELTTGLDGLGIGWLKAEAGLFL  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++II+++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  369   WMDLRNLLKTATFDSETELWRVIIHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  428

Query  1459  LMRIR--TSVL--QWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNS  1626
             L RIR  TS L  + K M +    + KK+K  + NL++S + +R  +D   S       S
Sbjct  429   LERIRVFTSQLEEETKPMASTTMMAKKKKKCWQSNLRLSFNDKRRFDDGFFSPHSPVPPS  488

Query  1627  PLVQA  1641
             PLV+A
Sbjct  489   PLVRA  493



>gb|AAD22099.2| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=485

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/481 (64%), Positives = 374/481 (78%), Gaps = 10/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILS+IATNDGHGENS+YFDGWKAY+N+PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    EILSRIATNDGHGENSSYFDGWKAYENDPFHLTDNPTGVIQMGLAENQLSLDLIQDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+++  PSNPLGT +DRDTL  +V FVN+K +HLVCDE+++ TVF +P
Sbjct  192   YRKARNSHIRVKGIVVTKPSNPLGTTMDRDTLRTLVSFVNEKRMHLVCDEVFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S+A++IQ +  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVAEVIQDDPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
                V +    E  AA  AK +++    L++SL   R  ED  I +PH  SP +SPLVQA 
Sbjct  432   ENFVYR----ENDAAVQAKNKRKWDETLRLSLP--RRFEDPTIMTPHLMSP-HSPLVQAA  484

Query  1645  N  1647
              
Sbjct  485   T  485



>gb|ACZ54911.3| 1-aminocyclopropane-1-carboxylic acid synthase [Narcissus tazetta 
var. chinensis]
Length=490

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/480 (63%), Positives = 370/480 (77%), Gaps = 6/480 (1%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATNDGHGEN +YFDGWKAY+++PFHP  NP GVIQMGLAENQLC DLI++W+  
Sbjct  13    QLLSKIATNDGHGENCSYFDGWKAYESDPFHPTRNPNGVIQMGLAENQLCHDLIQDWIKR  72

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR  +A+FMEKVRG  V+FDPDRIVMSGGAT
Sbjct  73    NPEASICTAEGVNEFKSIANFQDYHGLPSFRQXLAKFMEKVRGGRVRFDPDRIVMSGGAT  132

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E++AFCL DPG+AFL+PTPYYPGFDRD RWRTGVQL P+ C+SSN FK+T  ALESA
Sbjct  133   GAQELIAFCLADPGDAFLIPTPYYPGFDRDFRWRTGVQLLPIHCKSSNKFKITMDALESA  192

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             +  A++ NIRVKG+L+ NPSNPLGT +DR+TL  +V FVN K IHLVCDEI+A T F+  
Sbjct  193   FDDARKANIRVKGILLTNPSNPLGTSMDRETLESVVTFVNTKRIHLVCDEIFAGTTFTXX  252

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             +F+ +++II+E + C+P+ IHIVYSLSK LG PGFRVG++YSYND VV+C RKMSSFGLV
Sbjct  253   KFVGVSEIIRENKNCDPNLIHIVYSLSKVLGLPGFRVGVVYSYNDQVVACGRKMSSFGLV  312

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             STQTQHL+A++LSD EF   F+ ES+ RL KRH  FT GL ++GI  L+SN GLF WM+L
Sbjct  313   STQTQHLLASILSDDEFTTKFLAESARRLAKRHAVFTSGLDKMGIRCLESNAGLFCWMDL  372

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
                LKE T   E++LW  IIN +KLNVSPG SF C E GWFRVCFANMDDETM +AL RI
Sbjct  373   SXRLKEKTSEEEIKLWXXIINXVKLNVSPGASFXCTEPGWFRVCFANMDDETMEIALRRI  432

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMN--SPLVQAT  1644
             ++ +    G +   A   + +K+  +   + LS  R  ED  I SPH  M+  SPLV A 
Sbjct  433   KSFI---GGSDNNIAIRVQAKKKNWQATSLRLSLNRRFEDMAIVSPHIVMSPHSPLVHAA  489



>dbj|BAG30910.1| ACC synthase [Capsicum chinense]
Length=486

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 386/482 (80%), Gaps = 6/482 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  7     KNNAILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPKASIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+G
Sbjct  67    IKRNPKASICSNEGIKSFKAIANFQDYHGLPEFRRAIAKFMEKTRGGRVRFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+F++T  A+
Sbjct  127   GATGANESIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFQITAKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+VKGL++ NPSNPLGT LD+ TL  ++ F N  N+HLVCDEIYAATVF
Sbjct  187   KEAYENAQKSNIKVKGLILTNPSNPLGTTLDKHTLKSLLNFTNQHNLHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               P+F+SIA+I+++ +   CN D +HIVYSLSKD+G PGFR+GIIYS+NDAVVSCARKMS
Sbjct  247   DMPQFVSIAEILEDNEMSHCNKDLVHIVYSLSKDMGLPGFRIGIIYSFNDAVVSCARKMS  306

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQH +AAML+D++FV N++ ES+ RL  RH+ FT GL +VGI  LK+N GLF
Sbjct  307   SFGLVSTQTQHFLAAMLNDEKFVVNYLAESARRLDNRHKHFTDGLEEVGITCLKNNAGLF  366

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL++ TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +
Sbjct  367   CWMDLRKLLRDSTFDSEMSLWRVIINDVKLNVSPGSSFDCQEPGWFRVCFANMDDGTVDI  426

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             AL RIR  V   K  + + A   K+Q + + NL++S S +R  ++ ++S   SP+ +SPL
Sbjct  427   ALARIRRFVGVKKSGDESNAMEKKQQWK-KNNLRLSFS-KRMYDESVLSPLSSPIPHSPL  484

Query  1633  VQ  1638
             V+
Sbjct  485   VR  486



>dbj|BAA93712.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=493

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/480 (65%), Positives = 376/480 (78%), Gaps = 6/480 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGE+S YFDGWKAYDN+PFHP++NP GVIQMGLAENQL  DLI +W+  +
Sbjct  13    LLSKIAISDGHGEDSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQLSPDLIVDWIRKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT +G   FKDIA +QDYHGLPEFR A+A FM K RG  VKFDP RIVM GGATG
Sbjct  73    PKASICTDEGLLNFKDIANFQDYHGLPEFRNAIASFMGKARGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFL+P+PYY  FDRDL+WRT  Q+ PV C SSN+F++TR ALE AY
Sbjct  133   ASETVIFCLADPGDAFLIPSPYYAAFDRDLQWRTRAQIIPVHCNSSNNFQITREALEVAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKA+E NI+VKGL+I NPSNPLGT+ DRDTL  +V FVND NIHL+CDEIY+ATVF  P 
Sbjct  193   KKAEESNIKVKGLIITNPSNPLGTIYDRDTLKSLVNFVNDNNIHLICDEIYSATVFKSPS  252

Query  937   FISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F SIA+II+E+  C  + IHI+ SLSKD+G PGFRVGI+YSYND VVS ARKMSSFGLVS
Sbjct  253   FTSIAEIIEEMDHCKKELIHILSSLSKDMGLPGFRVGILYSYNDTVVSIARKMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD+EFV+NF++E+S+RL KRH  FT  L ++GI  L SN GLFVWM+LR
Sbjct  313   SQTQHLLAAMLSDEEFVDNFLVENSKRLAKRHARFTEELEKMGITCLNSNAGLFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ +F +E+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   KLLKDQSFESEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMDDNTVGVALDRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V +    E +      K+K     L++S SF  RR  E  ++ SPH  SP +SPLV+A
Sbjct  433   SFVGKIDKKENSTIPMPPKKKHRENKLRLSFSFSGRRYEEGNVLKSPHMMSP-HSPLVRA  491



>ref|XP_009398061.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/482 (62%), Positives = 368/482 (76%), Gaps = 11/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILS++AT DGHGEN++YFDGWKAYDN+PFHP HNP GVIQMGLAENQLC DL+++W+  
Sbjct  7     EILSRVATGDGHGENTSYFDGWKAYDNDPFHPIHNPNGVIQMGLAENQLCLDLMRDWIRK  66

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EF+ IA +QDYHGLP+FR A+A+FMEK RG   +FDP+RIVMSGGAT
Sbjct  67    NPQASICTKEGVSEFEAIANFQDYHGLPDFRKAIAKFMEKARGGRARFDPERIVMSGGAT  126

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL +PG+AFL+PTPYYP FDRD RWRTGVQL P+ C S ++FK+T   L +A
Sbjct  127   GAQETIAFCLANPGDAFLIPTPYYPAFDRDFRWRTGVQLLPIRCHSHDNFKITEAELAAA  186

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA++  IRVKG+LI NPSNPLGT +DR+TL  +VRF N++ IHLVCDEI++ TVF  P
Sbjct  187   YRKARDSKIRVKGILITNPSNPLGTTMDRETLRTLVRFANEERIHLVCDEIFSGTVFDGP  246

Query  934   EFISIAQIIQE--VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             E++S+A+I+QE    C+ D IHIVYSLSKDLG PGFRVGIIYS+NDAVVSCAR+MSSFGL
Sbjct  247   EYVSVAEILQEDPSTCDGDLIHIVYSLSKDLGVPGFRVGIIYSFNDAVVSCARRMSSFGL  306

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ L+A+ML D +F  + + ES  RL  RH +FT GL  VGI  L+SN GLF WM+
Sbjct  307   VSTQTQRLLASMLGDDDFTTDLLAESRRRLMHRHRTFTAGLEGVGIRCLQSNAGLFCWMS  366

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             L+ LLK+ T   E+ELW++I+NE+KLN+SPG SFHC E GWFR CFANMD+ETM  AL R
Sbjct  367   LKPLLKDATAEGEVELWRVIVNEVKLNISPGSSFHCTEPGWFRACFANMDEETMETALRR  426

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQA  1641
             IRT V +      AA          R +  + LS  R  E+  + +P   SP  SPLVQA
Sbjct  427   IRTFVRRANDAATAAKTKK------RWDTSLRLSLPRRFEEMTVLTPRLMSP-RSPLVQA  479

Query  1642  TN  1647
               
Sbjct  480   AT  481



>ref|XP_010455533.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
 ref|XP_010455534.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6-like 
[Camelina sativa]
Length=495

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/486 (65%), Positives = 377/486 (78%), Gaps = 7/486 (1%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LS+IA+ DGHGENS+YFDGWKAY+ NPFHP   P GVIQMGLAENQLC DL++ 
Sbjct  9     KQDLNLLSRIASGDGHGENSSYFDGWKAYEANPFHPIDRPDGVIQMGLAENQLCGDLMRQ  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WV+ +P+ASICT QG  +F DIAIYQDYHGLPEFR AVA+FMEK R + VKFDPDRIVMS
Sbjct  69    WVIEHPEASICTEQGVNQFSDIAIYQDYHGLPEFRQAVAKFMEKTRNNRVKFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SS+ FK+T  A
Sbjct  129   GGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSDGFKITVKA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE AY+KA+  NI VKGLL+ NPSNPLGT LD + L  +V F N+K IHL+ DEIYAAT 
Sbjct  189   LEDAYEKARLSNIPVKGLLMTNPSNPLGTTLDWECLKSLVNFTNEKRIHLIADEIYAATT  248

Query  922   FSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F Q EFIS+A++I+E++ CN D IHIVYSLSKD+G PGFRVGI+YSYND VV  ARKMSS
Sbjct  249   FGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGFRVGIVYSYNDRVVQIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQ LI  MLSD++FVE FI ES  RL  RH+  T GL  +GI  LK+  GLF+
Sbjct  309   FGLVSSQTQRLIGKMLSDEDFVEEFIRESKLRLAARHKELTTGLDGLGIGWLKAEAGLFL  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  369   WMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  428

Query  1459  LMRIR--TSVLQWKGMEaaaaasakkqkqC--RRNLKVSLSFRRGLEDCMISSPHSPMN-  1623
             L RIR  TS L+ +    AAA    K+K+   + NL++S S +R  +D    SPHSP+  
Sbjct  429   LERIRVFTSQLEEETKPMAAATMMAKKKKKCWQSNLRLSFSDKRRFDDGFF-SPHSPVTP  487

Query  1624  SPLVQA  1641
             SPLV+A
Sbjct  488   SPLVRA  493



>emb|CAD44267.2| putative aminocyclopropane carboxylic acid synthase [Musa AAB 
Group]
Length=485

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 373/481 (78%), Gaps = 10/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKV+G   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPAFRKAIAQFMEKVKGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+++  PSNPLGT +DRDTL  +V FVN+K +HLVCDE+++ TVF +P
Sbjct  192   YRKARNSHIRVKGIVVTKPSNPLGTTMDRDTLRTLVSFVNEKRMHLVCDEVFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S+A++IQ +  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVAEVIQDDPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
                V +    E  AA  AK +++    L++SL   R  ED  I +PH  SP +SPLVQA 
Sbjct  432   ENFVYR----ENDAAVQAKNKRKWDETLRLSLP--RRFEDPTIMTPHLMSP-HSPLVQAA  484

Query  1645  N  1647
              
Sbjct  485   T  485



>gb|ABO76787.1| 1-aminocyclopropane-1-carboxylate synthase [Citrullus colocynthis 
x Citrullus lanatus var. lanatus]
Length=494

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/495 (63%), Positives = 382/495 (77%), Gaps = 8/495 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQIL-SKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQL  360
             M    + ++ Q+L SKIA NDGHGE+S YFDGWKAYDN+PFHP++NP GVIQMGLAENQL
Sbjct  1     MGFHQIGERNQVLLSKIAINDGHGEDSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQL  60

Query  361   CFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFD  540
               DLI +W+  +PKASICT +G E FK IA YQDYHGL EFR A+A FM K RG  VKFD
Sbjct  61    SSDLIVDWIRKHPKASICTDEGLESFKVIANYQDYHGLLEFRNAIASFMGKARGGRVKFD  120

Query  541   PDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSND  720
             P RIVM GGATGA E + FCL DPG+AFLVP+PYY  FDRDL+WRT  Q+ PV C SSN+
Sbjct  121   PSRIVMGGGATGASETVIFCLADPGDAFLVPSPYYAAFDRDLQWRTRAQIIPVHCHSSNN  180

Query  721   FKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCD  900
             F++ + ALE+AYKKAQE NI+VKG++I NPSNPLGT  DRDTL  +V FVND NIHL+CD
Sbjct  181   FQIRKEALEAAYKKAQEANIKVKGVIITNPSNPLGTTYDRDTLKSLVNFVNDNNIHLICD  240

Query  901   EIYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             EIY+ATVF  P F SIA+II+E++ CN + IHI+YSLSKD+G PGFRVGI+YSYND VVS
Sbjct  241   EIYSATVFKSPSFTSIAEIIEEMEHCNKELIHILYSLSKDMGLPGFRVGILYSYNDNVVS  300

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
               RKMSSFGLVS+QTQHL+AAMLSD+EFV+NF+ E+S+RL KRH  FT+ L ++GI  L 
Sbjct  301   TGRKMSSFGLVSSQTQHLLAAMLSDEEFVDNFLAENSKRLAKRHHRFTKELEKMGITCLN  360

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
              N GLFVWM+LR LLK+ +F +E+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMD
Sbjct  361   GNAGLFVWMDLRKLLKDQSFKSEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMD  420

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRN-LKVSLSFRRGL--EDCMISSP  1608
             D T+ VAL RI + V +    E     +   + + R N L+++ SF  G   E  +++SP
Sbjct  421   DNTVDVALDRIHSFVGKNDKKEDNITLTMPPKTKRRENKLRLNFSFSGGRYEEGNVLNSP  480

Query  1609  H--SPMNSPLVQATN  1647
             H  SP +SPLV+A N
Sbjct  481   HMMSP-HSPLVRAHN  494



>ref|XP_006396926.1| hypothetical protein EUTSA_v10028605mg [Eutrema salsugineum]
 gb|ESQ38379.1| hypothetical protein EUTSA_v10028605mg [Eutrema salsugineum]
Length=493

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/488 (64%), Positives = 374/488 (77%), Gaps = 4/488 (1%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             L + +Q   +LS+IA  DGHGENS+YFDGWKAY+ NPFHP   P GVIQMGLAENQLC D
Sbjct  4     LAAEKQDRNLLSRIAAGDGHGENSSYFDGWKAYEENPFHPIERPDGVIQMGLAENQLCGD  63

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             L++ WVL +P+ASICT +G   F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDR
Sbjct  64    LMRKWVLEHPEASICTAEGVNHFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNRVKFDPDR  123

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVMSGGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C+SSN FK+
Sbjct  124   IVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCQSSNGFKI  183

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             T  ALE+AY+ A+E NI VKGLLI NPSNPLGT LDR+ L  +V F NDK IHL+ DEIY
Sbjct  184   TVEALEAAYQSARESNIPVKGLLITNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIY  243

Query  910   AATVFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCAR  1086
             AAT F Q EFIS+A++I+++  CN D IHIVYSLSKD+G PG RVGI+YSYN+ VV+ AR
Sbjct  244   AATTFGQSEFISVAEVIEDIPDCNRDLIHIVYSLSKDMGLPGLRVGIVYSYNNRVVNIAR  303

Query  1087  KMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNG  1266
             KMSSFGLVS+QTQHLIA MLSD++FV+ FI ES  RL  RH   T GL  +GI  LK+  
Sbjct  304   KMSSFGLVSSQTQHLIAKMLSDEDFVDEFIRESKLRLAARHAELTTGLDGLGIGWLKAEA  363

Query  1267  GLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDET  1446
             GLF+WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +T
Sbjct  364   GLFLWMDLRNLLKTATFDSETELWRVIVHKVKLNVSPGGSFHCHEPGWFRVCFANMDHKT  423

Query  1447  MRVALMRIR--TSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSP  1617
             M  AL RIR  T  L+ + +      +A K+K+C + +L++S +  R  ED   S     
Sbjct  424   METALERIRVFTRQLEQENLNRTKPMAATKKKKCWQSSLRLSFNDTRRFEDGFFSPHSPV  483

Query  1618  MNSPLVQA  1641
               SPLV+A
Sbjct  484   PPSPLVRA  491



>ref|NP_192867.1| 1-aminocyclopropane-1-carboxylate synthase 6 [Arabidopsis thaliana]
 sp|Q9SAR0.2|1A16_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase 6; Short=ACC 
synthase 6; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
6 [Arabidopsis thaliana]
 gb|AAK27237.1|AF361097_1 ACC synthase ACS6 [Arabidopsis thaliana]
 gb|AAL16124.1|AF428292_1 AT4g11280/F8L21_70 [Arabidopsis thaliana]
 emb|CAB51412.1| ACC synthase (AtACS-6) [Arabidopsis thaliana]
 emb|CAB81229.1| ACC synthase (AtACS-6) [Arabidopsis thaliana]
 gb|AAN18056.1| At4g11280/F8L21_70 [Arabidopsis thaliana]
 gb|AEE82992.1| 1-aminocyclopropane-1-carboxylate synthase 6 [Arabidopsis thaliana]
Length=495

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/430 (69%), Positives = 345/430 (80%), Gaps = 1/430 (0%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LSKIA+ DGHGENS+YFDGWKAY+ NPFHP   P GVIQMGLAENQLC DL++ 
Sbjct  9     KQDLNLLSKIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRK  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WVL +P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDRIVMS
Sbjct  69    WVLKHPEASICTSEGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SSN FK+T  A
Sbjct  129   GGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKITVEA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY+ A++ NI VKGLL+ NPSNPLGT LDR+ L  +V F NDK IHL+ DEIYAAT 
Sbjct  189   LEAAYENARKSNIPVKGLLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATT  248

Query  922   FSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F Q EFIS+A++I+E++ CN D IHIVYSLSKD+G PG RVGI+YSYND VV  ARKMSS
Sbjct  249   FGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGLRVGIVYSYNDRVVQIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQHLIA MLSD+EFV+ FI ES  RL  RH   T GL  +GI  LK+  GLF+
Sbjct  309   FGLVSSQTQHLIAKMLSDEEFVDEFIRESKLRLAARHAEITTGLDGLGIGWLKAKAGLFL  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  369   WMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  428

Query  1459  LMRIRTSVLQ  1488
             L RIR    Q
Sbjct  429   LERIRVFTSQ  438



>ref|XP_009386742.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/480 (64%), Positives = 371/480 (77%), Gaps = 8/480 (2%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LS IAT+DGHGENS+YFDGWKAYDN+PFHP  NPQGVIQMGLAENQLC DL++ W+  N
Sbjct  13    VLSSIATSDGHGENSSYFDGWKAYDNDPFHPIDNPQGVIQMGLAENQLCLDLMQQWIKQN  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G  EFKD+A +QDYHGLP+FR A+ARFM K RG    FDP+RIVMSGGATG
Sbjct  73    PQASICTGEGVSEFKDVANFQDYHGLPDFRKAIARFMGKARGGGATFDPERIVMSGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E +AFCL +PGEAFL+PTPYYPGFDRD RWRTGVQL P+ C S ++FK+T  AL +AY
Sbjct  133   AQETIAFCLANPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIQCHSFDNFKITEPALVTAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             ++AQ  NIRVKG+L+ NPSNPLGT LDR+TL  +V F N+K IHLVCDEI++ TVF +P 
Sbjct  193   QRAQTANIRVKGILVTNPSNPLGTTLDRETLRTLVSFANEKRIHLVCDEIFSGTVFDKPT  252

Query  937   FISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             ++S+++I++E    + D IHIVYSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLVS
Sbjct  253   YVSVSEIVEEEPYYDRDLIHIVYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             TQTQHL+A+ML D +F   F+ ES  RL +RH+ FT GL +V I+ L+SN GLF WMNL 
Sbjct  313   TQTQHLLASMLGDDDFTTKFLAESRRRLSRRHKYFTAGLHRVDIKCLESNAGLFCWMNLT  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
             +LL E T  AEL+LW++II E+KLN+SPG SFHC E GWFRVCFANMDD TM  AL RIR
Sbjct  373   HLLNEATVEAELKLWRVIIKEVKLNISPGSSFHCSEPGWFRVCFANMDDNTMETALKRIR  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQATN  1647
               V          AA+  K+K  R +  + LS  R  E+  I +P   SP +SPLVQA N
Sbjct  433   KFV----SPGNHTAAAQAKKKNKRWDAALRLSLPRRFEELSIMTPRLMSP-HSPLVQAAN  487



>gb|AAC83146.1| 1-aminocyclopropane-1-carboxylate synthase [Nicotiana glutinosa]
Length=489

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/483 (63%), Positives = 380/483 (79%), Gaps = 6/483 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQLCFDLI+ W
Sbjct  7     KNNSILSKLATNEEHGENSPYFDGWKAYDNDPFHPLKNPNGVIQMGLAENQLCFDLIEEW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G + F+ IA +QDYHGL EFR A+A+FMEK RG  V FDP+R+VM+G
Sbjct  67    IKRNPNASICTTEGIKSFRAIANFQDYHGLTEFRRAIAKFMEKTRGGRVTFDPERVVMAG  126

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL D G+AFLVP+PYYP F+RDLRWRTGVQL P+ C+SSN+F++T  A+
Sbjct  127   GATGANETIIFCLADAGDAFLVPSPYYPAFNRDLRWRTGVQLIPIPCDSSNNFQITTKAV  186

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             +  Y+ AQ+ NI+VKGL++ NPSNPLGT LDRDTL +++ F N  NIHLVCDEIYAATVF
Sbjct  187   KEVYENAQKSNIKVKGLILTNPSNPLGTTLDRDTLKNLLTFTNQHNIHLVCDEIYAATVF  246

Query  925   SQPEFISIAQIIQEV--QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             S P+F+SIA+I+ +    CN D +HIVYSLSKD+G PGFR+GI+YS+ND VVSCARKMSS
Sbjct  247   STPQFVSIAEIVNDEMRHCNKDLVHIVYSLSKDMGLPGFRIGIVYSFNDTVVSCARKMSS  306

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVSTQTQ+L+A MLSD++FV NF+ ESS+RL KRH+ FT GL QVGI+ L+SN GLF 
Sbjct  307   FGLVSTQTQYLLAEMLSDEKFVSNFLTESSKRLAKRHKHFTNGLEQVGIKCLRSNAGLFC  366

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LR LLKE  F AE+ LW++IIN++KLNVS G SF CQE G+FRV FANMDDET+ +A
Sbjct  367   WMDLRPLLKESNFDAEMSLWRVIINDVKLNVSKGSSFDCQEPGFFRVFFANMDDETVDIA  426

Query  1459  LMRIRTSV-LQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPM-NSPL  1632
             L RIR  V ++  G E  A    ++ K  + NL++S S R   E   +S   SP+ +SPL
Sbjct  427   LRRIRRFVSVKRTGDETTAMERKQQWK--KNNLRLSFSKRMYDESVNLSPLSSPIPHSPL  484

Query  1633  VQA  1641
             V+A
Sbjct  485   VRA  487



>ref|NP_001234280.1| 1-aminocyclopropane-1-carboxylate synthase 4 [Solanum lycopersicum]
 sp|P29535.1|1A14_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase 4; Short=ACC 
synthase 4; AltName: Full=Le-ACS4; Short=ACS-4; AltName: 
Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
4 [Solanum lycopersicum]
 gb|AAA34131.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
 gb|AAA03164.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=476

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/435 (67%), Positives = 357/435 (82%), Gaps = 5/435 (1%)
 Frame = +1

Query  184   MDLKSMR----QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAE  351
             MDL++      + + +LSK+A+N+ HGENS YFDGWKAYDN+PFH  +N  GVIQMGLAE
Sbjct  1     MDLETSEISNYKSSVVLSKLASNEQHGENSPYFDGWKAYDNDPFHLVNNLNGVIQMGLAE  60

Query  352   NQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTV  531
             NQL  DLI+ W+  NPKASICT  G E F+ IA +QDYHGLPEF  A+A+FMEK RG  V
Sbjct  61    NQLSVDLIEEWIKRNPKASICTNDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKV  120

Query  532   KFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCES  711
             KFD  R+VM+GGATGA+E L  CL DPG+AFLVPTPYYPGF+RDLRWR+GVQL P+ C+S
Sbjct  121   KFDAKRVVMAGGATGANETLILCLADPGDAFLVPTPYYPGFNRDLRWRSGVQLLPISCKS  180

Query  712   SNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHL  891
              N+FK+T  A+E AY+K Q+ N+++KGL++ NP NPLGT+LDRDTL  I  F N+ NIHL
Sbjct  181   CNNFKITIEAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTFTNEHNIHL  240

Query  892   VCDEIYAATVFSQPEFISIAQIIQEVQC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYNDA  1068
             VCDEIYAATVF+ P+F+SIA+II E  C N D +HIV SLSKDLGFPGFRVGI+YS+ND 
Sbjct  241   VCDEIYAATVFNSPKFVSIAEIINEDNCINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDD  300

Query  1069  VVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIE  1248
             VV+CARKMSSFGLVSTQTQHL+A MLSD EFVE F++ES++RLR+R+E FTRGL ++GI+
Sbjct  301   VVNCARKMSSFGLVSTQTQHLLAFMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIK  360

Query  1249  TLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFA  1428
              L+SN G++ WM+LR+LLKE T  AE+ LWK+IINE+KLNVSPG SF+C E GWFRVCFA
Sbjct  361   CLESNAGVYCWMDLRSLLKEATLDAEMSLWKLIINEVKLNVSPGSSFNCSEVGWFRVCFA  420

Query  1429  NMDDETMRVALMRIR  1473
             N+DD+TM +AL RIR
Sbjct  421   NIDDQTMEIALARIR  435



>dbj|BAA78333.1| 1-aminocyclopropane-1-carboxylic acid synthase [Pyrus pyrifolia]
 gb|ABQ45958.1| ACC synthase [Pyrus pyrifolia]
 gb|AGG19161.1| aminocyclopropane-1-carboxylic acid synthase [Pyrus pyrifolia]
Length=495

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/491 (62%), Positives = 375/491 (76%), Gaps = 8/491 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  +   +LSKIATN+ HGENS YFDGW  Y+ NPFH   NP+GVIQMGLAENQL FDL+
Sbjct  4     SASENRLLLSKIATNEKHGENSPYFDGWNKYNQNPFHLTENPEGVIQMGLAENQLSFDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  NPKASICT +G E+F+++A +QDYHGLPEFR A+A FM K RG  V FDP R+V
Sbjct  64    EEWIRKNPKASICTAEGIEKFRNVANFQDYHGLPEFRQAIATFMSKARGGRVTFDPHRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL D G+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLADRGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ +NI VKGL+I NPSNPLGT LD+DTL  +V F+N KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQNNNINVKGLIITNPSNPLGTTLDKDTLESLVTFINQKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P+F  I ++IQ + CNP+ IHIVYSLSKD+GFPG RVGI+YSYND VV+  RKMS
Sbjct  244   TVFSSPKFTCITEVIQNMNCNPNLIHIVYSLSKDMGFPGLRVGIVYSYNDDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQH++A+MLSD++FVE F+  S++RL KRH  FT GL +VGI  LKSN GLF
Sbjct  304   SFGLVSSQTQHMLASMLSDEDFVEKFLTTSAKRLAKRHGVFTDGLEEVGINCLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK+ TF  E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS-------SPHS  1614
             AL RIR  V Q K  +  A   + K++          S  R  E   +S       SPHS
Sbjct  424   ALKRIRAFVGQGKKAQEQAQVKSPKKRWQSNLRLSFSSSSRRFEQEGVSVMSPRMMSPHS  483

Query  1615  PM-NSPLVQAT  1644
             PM +SPL++AT
Sbjct  484   PMPHSPLLRAT  494



>gb|AAU09672.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 373/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFMEKVRGGRTRFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ T F +P
Sbjct  192   YRKARNSHIRVKGILVTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTAFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+E   +F+  S   L  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEELTTSFLATSRTGLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>gb|AEY82446.1| 1-aminocyclopropane-1-carboxylate synthase [Momordica charantia]
Length=495

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/496 (63%), Positives = 381/496 (77%), Gaps = 11/496 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M  +S +    +LSKIATNDGHGE+S YFDGWKAYDN+PFHP  NP GVIQMGLAENQL 
Sbjct  1     MGFESNQGNQFLLSKIATNDGHGEDSPYFDGWKAYDNDPFHPDKNPSGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DLI +W+  NPKAS+CT +G   FKDIA +QDYHGLPEFR  +A FM K RG  V+FDP
Sbjct  61    SDLIVDWIRRNPKASLCTEEGLGSFKDIANFQDYHGLPEFREGIANFMGKARGGRVRFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
              RIVM GGATGA E++ FCL DPG+AFLVP+PYYP FDRDL WRT  Q+ PV C SSN+F
Sbjct  121   SRIVMGGGATGASEMIIFCLADPGDAFLVPSPYYPAFDRDLGWRTRAQIIPVHCNSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             ++T  ALE+AYKKA+E NI++KG++I NPSNPLGT  D DTL ++V FVND NIHL+CDE
Sbjct  181   QITIPALEAAYKKARESNIKIKGVIITNPSNPLGTTYDHDTLKNLVTFVNDNNIHLICDE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IY+ATVF  P F SIA+I+QE++ C  + IHI+YSLSKD+G PGFRVGI+YSY+DAVV+ 
Sbjct  241   IYSATVFKSPSFTSIAEIVQEMEHCKKELIHILYSLSKDMGLPGFRVGILYSYSDAVVNN  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             +RKMSSFGLVS+QTQHL+AAMLSD+EFVENF++E+S+RL +RH  FTR L ++GI  L S
Sbjct  301   SRKMSSFGLVSSQTQHLLAAMLSDEEFVENFLVENSKRLAERHSRFTRELEKMGITCLNS  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             N GLFVWM+LR LLKE +F AE+ELW++II+E+KLNVSPG SFH  E GWFRVCFANMDD
Sbjct  361   NAGLFVWMDLRQLLKEQSFEAEMELWRVIIDEVKLNVSPGSSFHVTEPGWFRVCFANMDD  420

Query  1441  ETMRVALMRIRTSVLQWKGMEaaaaasakkqkqC---RRNLKVSLSF----RRGLEDCMI  1599
              T+ VAL RI+  V +    E   A +          RR  K+ LSF    RR  +  ++
Sbjct  421   NTVNVALNRIQCFVGKNNKKEDDVAVTVAVVAPTKPKRRESKLRLSFSFSGRRYEDGGVL  480

Query  1600  SSPH--SPMNSPLVQA  1641
             +SPH  SP +SPLV+ 
Sbjct  481   NSPHMMSP-HSPLVRG  495



>ref|NP_001233875.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
 emb|CAA41857.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
 emb|CAH56504.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=476

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/435 (67%), Positives = 357/435 (82%), Gaps = 5/435 (1%)
 Frame = +1

Query  184   MDLK----SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAE  351
             MDL+    S  + + +LSK+A+N+ HGENS YFDGWKAYDN+PFH  +N  GVIQMGLAE
Sbjct  1     MDLETSEISNYKSSAVLSKLASNEQHGENSPYFDGWKAYDNDPFHLVNNLNGVIQMGLAE  60

Query  352   NQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTV  531
             NQL  DLI+ W+  NPKASICT  G E F+ IA +QDYHGLPEF  A+A+FMEK RG  V
Sbjct  61    NQLSVDLIEEWIKRNPKASICTNDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKV  120

Query  532   KFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCES  711
             KFD  R+VM+GGATGA+E L  CL DPG+AFLVPTPYYPGF+RDLRWR+GVQL P+ C+S
Sbjct  121   KFDAKRVVMAGGATGANETLILCLADPGDAFLVPTPYYPGFNRDLRWRSGVQLLPISCKS  180

Query  712   SNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHL  891
              N+FK+T  A+E AY+K Q+ N+++KGL++ NP NPLGT+LDRDTL  I  F N+ NIHL
Sbjct  181   CNNFKITIEAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTFTNEHNIHL  240

Query  892   VCDEIYAATVFSQPEFISIAQIIQEVQC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYNDA  1068
             VCDEIYAATVF+ P+F+SIA+II E  C N D +HIV SLSKDLGFPGFRVGI+YS+ND 
Sbjct  241   VCDEIYAATVFNPPKFVSIAEIINEDNCINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDD  300

Query  1069  VVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIE  1248
             VV+CARKMSSFGLVSTQTQHL+A MLSD EFVE F++ES++RLR+R+E FTRGL ++GI+
Sbjct  301   VVNCARKMSSFGLVSTQTQHLLAFMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIK  360

Query  1249  TLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFA  1428
              L+SN G++ WM+LR+LLKE T  AE+ LWK+IINE+KLNVSPG SF+C E GWFRVCFA
Sbjct  361   CLESNAGVYCWMDLRSLLKEATLDAEMSLWKLIINEVKLNVSPGSSFNCSEVGWFRVCFA  420

Query  1429  NMDDETMRVALMRIR  1473
             N+DD+TM +AL RIR
Sbjct  421   NIDDQTMEIALARIR  435



>gb|AAO91942.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 372/481 (77%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  + RVKG+L+ NP NPLGT +DR+TL  +  FVN K +HLVCDEI++ TVF +P
Sbjct  192   YRKARNSHFRVKGILVTNPPNPLGTTMDRETLRTLFSFVNKKRMHLVCDEIFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLEDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>sp|P23599.1|1A11_CUCMA RecName: Full=1-aminocyclopropane-1-carboxylate synthase CMW33; 
Short=ACC synthase; AltName: Full=S-adenosyl-L-methionine 
methylthioadenosine-lyase [Cucurbita maxima]
 dbj|BAA00838.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita maxima]
 prf||1710321A aminocyclopropane carboxylate synthase
 prf||1916421A aminocyclopropane carboxylate synthase:ISOTYPE=wound-induced
Length=493

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/494 (63%), Positives = 381/494 (77%), Gaps = 7/494 (1%)
 Frame = +1

Query  184   MDLKSMRQQTQ-ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQL  360
             M+   + ++ Q +LSKIA +DGHGENS YFDGWKAYDN+PFHP+ NP GVIQMGLAENQL
Sbjct  1     MEFHQIDERNQALLSKIAVDDGHGENSPYFDGWKAYDNDPFHPEDNPLGVIQMGLAENQL  60

Query  361   CFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFD  540
              FD+I +W+  +P+ASICTP+G E FK IA +QDYHGLPEFR  +A FM KVRG  V+FD
Sbjct  61    SFDMIVDWIRKHPEASICTPKGLERFKSIANFQDYHGLPEFRNGIASFMGKVRGGRVQFD  120

Query  541   PDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSND  720
             P RIVM GGATGA E + FCL DPG+AFLVP+PYY  FDRDL+WRT  Q+  V C SSN+
Sbjct  121   PSRIVMGGGATGASETVIFCLADPGDAFLVPSPYYAAFDRDLKWRTRAQIIRVHCNSSNN  180

Query  721   FKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCD  900
             F+VT+ ALE AYKKAQE NI+VKG++I NPSNPLGT  DRDTL  +V FVN  +IHL+CD
Sbjct  181   FQVTKAALEIAYKKAQEANIKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICD  240

Query  901   EIYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             EIY+ATVF  P FISIAQI++E++ C  + IHI+YSLSKD+G PGFRVGIIYSYND VV 
Sbjct  241   EIYSATVFKAPTFISIAQIVEEMEHCKKELIHILYSLSKDMGLPGFRVGIIYSYNDVVVR  300

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
              AR+MSSFGLVS+QTQHL+AAMLSD++FV+ F+ E+S+RL +RH  FT+ L ++GI  L 
Sbjct  301   RARQMSSFGLVSSQTQHLLAAMLSDEDFVDKFLAENSKRLAERHARFTKELDKMGITCLN  360

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
             SN G+FVWM+LR LLK+ TF AE+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMD
Sbjct  361   SNAGVFVWMDLRRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMD  420

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH  1611
             D T+ VAL RI + V      E    A   K ++    L++S SF  RR  E  +++SPH
Sbjct  421   DNTVDVALNRIHSFVENIDKKEDNTVAMPSKTRRRENKLRLSFSFSGRRYDEGNVLNSPH  480

Query  1612  --SPMNSPLVQATN  1647
               SP +SPLV A N
Sbjct  481   TMSP-HSPLVIAKN  493



>ref|XP_002878386.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54645.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/481 (62%), Positives = 374/481 (78%), Gaps = 11/481 (2%)
 Frame = +1

Query  211   TQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVL  390
             +Q+LSK+A++D HGE S YFDGWKAYDNNP+HP HNP GVIQMGLAENQLC DLIK W+ 
Sbjct  2     SQLLSKLASSDKHGEASPYFDGWKAYDNNPYHPTHNPHGVIQMGLAENQLCSDLIKEWIR  61

Query  391   NNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGA  570
              NP+ASICT +G + F DIA++QDYHGL +FR A+A FME+ RG  V F+ +R+VMSGGA
Sbjct  62    KNPQASICTAEGIDSFSDIAVFQDYHGLKQFRQAIAAFMERARGGRVSFEVERVVMSGGA  121

Query  571   TGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALES  750
             TGA+E L FCL DPG+AFLVPTPYY  FDRDLRWRTG+++ PV C SSN+F+VT+ ALES
Sbjct  122   TGANETLMFCLADPGDAFLVPTPYYAAFDRDLRWRTGIRIIPVECNSSNNFQVTKQALES  181

Query  751   AYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQ  930
              Y KAQE  I++KGL+I NPSNPLGT LDR+TL  +V F+NDK IHLVCDEIYAATVF++
Sbjct  182   TYLKAQETGIKIKGLIIANPSNPLGTSLDRETLESLVSFINDKQIHLVCDEIYAATVFAE  241

Query  931   PEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             P+FIS+A+II E V  N D IHIVYSLSKD+G PGFRVG++YSYND VVSCARKMSSFGL
Sbjct  242   PKFISVAEIILEMVHVNRDLIHIVYSLSKDMGLPGFRVGVVYSYNDVVVSCARKMSSFGL  301

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VS+Q Q  +AAMLSD+ FV+N ++E S+R+ KRH  FT GL ++GI  L+SN GL+V M+
Sbjct  302   VSSQIQSFVAAMLSDQRFVDNILVEVSKRVAKRHHMFTEGLEEMGISCLRSNAGLYVLMD  361

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR +LK+ TF +E+ LW++IIN++K+N+SPG SFHC E GWFRVCFANMD++T+++ L R
Sbjct  362   LRQMLKDQTFESEIALWRVIINKVKINISPGSSFHCSEPGWFRVCFANMDEDTLQIGLER  421

Query  1468  IRTSVLQWKG-------MEaaaaasakkqkqCRRNLKVSLS---FRRGLEDCMISSPHSP  1617
             I+  VL  K                 KK+K  ++NLK+S S   +   +    + SPHSP
Sbjct  422   IKDFVLGDKASKNKNCNCICNNKRENKKRKSFQKNLKLSFSSMMYDEHVRSPKLMSPHSP  481

Query  1618  M  1620
             +
Sbjct  482   L  482



>ref|XP_010541198.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6 [Tarenaya 
hassleriana]
Length=496

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/432 (68%), Positives = 345/432 (80%), Gaps = 1/432 (0%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M + +  +Q Q LSKIA  +GHGENSAYFDGWKAY+  PF P H P GVIQMGLAENQL 
Sbjct  1     MAVVAAEKQNQTLSKIAAGEGHGENSAYFDGWKAYEEYPFDPVHRPDGVIQMGLAENQLS  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
              DLI+ W++ +P+ASIC P+G   F DIAI+QDYHGLPEFR A+ +FM K RG+  KFDP
Sbjct  61    SDLIRKWLMEHPEASICAPEGVNRFNDIAIFQDYHGLPEFRHAITKFMTKTRGNKAKFDP  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGA E LAFC+ DPG+AFLVPTPYYPGFDRDLRWRTG++L+PVVC SSN F
Sbjct  121   DRIVMSGGATGAQETLAFCIADPGDAFLVPTPYYPGFDRDLRWRTGLKLWPVVCHSSNGF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T  ALE+AY++A+E N+ VKGLLI NPSNPLGT LDRD L  +V F N KNIHL+ DE
Sbjct  181   KITVEALEAAYREARESNVPVKGLLITNPSNPLGTTLDRDCLKSLVNFTNGKNIHLIADE  240

Query  904   IYAATVFSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSC  1080
             IYAAT F QPEF S+A+II EV  CN D IHIVYSLSKD+G PGFRVGIIYSYND VV+ 
Sbjct  241   IYAATTFQQPEFTSVAEIIDEVSDCNRDLIHIVYSLSKDMGLPGFRVGIIYSYNDQVVNA  300

Query  1081  ARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKS  1260
             ARKMSSFGLVS+QTQH+++ MLSD  FV+ F+ ES +RL +R    T GL  +GI  LK 
Sbjct  301   ARKMSSFGLVSSQTQHMMSKMLSDDNFVDEFLRESKQRLAERCAELTTGLKDLGIGCLKG  360

Query  1261  NGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDD  1440
             N GLF+WM+LRNLL+  TF AE ELW++I++++KLNVSPG SFHC E GWFRVCFANM  
Sbjct  361   NAGLFLWMDLRNLLESSTFEAETELWRVIVHKVKLNVSPGGSFHCTEPGWFRVCFANMSH  420

Query  1441  ETMRVALMRIRT  1476
             ETM +AL RIRT
Sbjct  421   ETMEIALERIRT  432



>dbj|BAA84945.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/481 (64%), Positives = 374/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYERDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EFK IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFKAIANFQDYHGLPTFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E +AFCL DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETIAFCLADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPS PLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  192   YRKARNSHIRVKGILVTNPSKPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ +  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVV+CARKMSSFGLV
Sbjct  252   SYVSVSEVIEDDPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVTCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRV FANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVSFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>gb|KFK35337.1| hypothetical protein AALP_AA5G271900 [Arabis alpina]
Length=476

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/478 (63%), Positives = 370/478 (77%), Gaps = 9/478 (2%)
 Frame = +1

Query  199   MRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIK  378
             M     +LSK+A  D HGE+S YFDGWKAYDNNPFH  HNPQGVIQMGLAENQLC DLIK
Sbjct  1     MSPDKNLLSKLAAGDKHGEDSPYFDGWKAYDNNPFHHDHNPQGVIQMGLAENQLCSDLIK  60

Query  379   NWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVM  558
              W+  NP+ASICT +G   F DIAI+QDYHGL +FR A+A FME+ RG  VKFD DR+VM
Sbjct  61    EWIKANPQASICTAEGIHGFSDIAIFQDYHGLKQFREAIAGFMERTRGGKVKFDADRVVM  120

Query  559   SGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRT  738
             SGGATGA+E L FCL DPG+AFLVPTPYY  FDRDLRWRTGV++ PV C SSN+FKVT+ 
Sbjct  121   SGGATGANETLLFCLADPGDAFLVPTPYYAAFDRDLRWRTGVRIIPVECNSSNNFKVTKQ  180

Query  739   ALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAAT  918
             ALES Y KAQE  I++KGL++ NPSNPLGT LD+DTL  +V F+NDK IHLVCDEIYAAT
Sbjct  181   ALESTYLKAQETGIKIKGLILANPSNPLGTTLDQDTLETLVNFINDKQIHLVCDEIYAAT  240

Query  919   VFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             VF+   FIS+A+IIQ++   N D IHIVYSLSKD+G PGFRVG++YSYNDAVVS AR+MS
Sbjct  241   VFAGQRFISVAEIIQDMDHVNRDLIHIVYSLSKDMGLPGFRVGVVYSYNDAVVSSARRMS  300

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQ  +AAMLSD+ FV+NF++E S+R+ KRH  FT GL ++GI  L+SN GLF
Sbjct  301   SFGLVSSQTQSFLAAMLSDERFVDNFLVEVSKRVAKRHRMFTEGLEEIGISCLRSNAGLF  360

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
             V M+LR +LK+ +F +E+ LW++II+++K+NVSPG SFHC E GWFRVCFANMD+ET+++
Sbjct  361   VLMDLRKMLKDQSFESEMALWRVIIDKVKINVSPGSSFHCSEPGWFRVCFANMDEETLQI  420

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLS---FRRGLEDCMISSPHSPM  1620
              L RI+  V              KK+K  ++NLK+S S   +   +    + SPHSP+
Sbjct  421   GLERIKEFVFG-----DRDKNKNKKRKSFQKNLKLSFSSMIYEEHVRSPSLMSPHSPL  473



>ref|NP_001284464.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Cucumis melo]
 dbj|BAA06464.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
 dbj|BAA83618.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis melo]
Length=493

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 375/480 (78%), Gaps = 6/480 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGE+S YFDGWKAYDN+PFHP++NP GVIQMGLAENQL  DLI +W+  +
Sbjct  13    LLSKIAISDGHGEDSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQLSPDLIVDWIRKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASI T +G   FKDIA +QDYHGLPEFR A+A FM K RG  VKFDP RIVM GGATG
Sbjct  73    PKASIYTDEGLLNFKDIANFQDYHGLPEFRNAIASFMGKARGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFL+P+PYY  FDRDL+WRT  Q+ PV C SSN+F++TR ALE AY
Sbjct  133   ASETVIFCLADPGDAFLIPSPYYAAFDRDLQWRTRAQIIPVHCNSSNNFQITREALEVAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKA+E NI+VKGL+I NPSNPLGT+ DRDTL  +V FVND NIHL+CDEIY+ATVF  P 
Sbjct  193   KKAEESNIKVKGLIITNPSNPLGTIYDRDTLKSLVNFVNDNNIHLICDEIYSATVFKSPS  252

Query  937   FISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F SIA+II+E+  C  + IHI+ SLSKD+G PGFRVGI+YSYND VVS ARKMSSFGLVS
Sbjct  253   FTSIAEIIEEMDHCKKELIHILSSLSKDMGLPGFRVGILYSYNDTVVSIARKMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD+EFV+NF++E+S+RL KRH  FT  L ++GI  L SN GLFVWM+LR
Sbjct  313   SQTQHLLAAMLSDEEFVDNFLVENSKRLAKRHARFTEELEKMGITCLNSNAGLFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ +F +E+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   KLLKDQSFESEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMDDNTVGVALDRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V +    E +      K+K     L++S SF  RR  E  ++ SPH  SP +SPLV+A
Sbjct  433   SFVGKIDKKENSTIPMPPKKKHRENKLRLSFSFSGRRYEEGNVLKSPHMMSP-HSPLVRA  491



>emb|CAH56694.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=476

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/435 (67%), Positives = 356/435 (82%), Gaps = 5/435 (1%)
 Frame = +1

Query  184   MDLK----SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAE  351
             MDL+    S  + + +LSK+A+N+ HGENS YFDGWKAYDN+PFH  +N  GVIQMGLAE
Sbjct  1     MDLETSEISNYKSSAVLSKLASNEQHGENSPYFDGWKAYDNDPFHLVNNLNGVIQMGLAE  60

Query  352   NQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTV  531
             NQL  DLI+ W+  NPKASIC   G E F+ IA +QDYHGLPEF  A+A+FMEK RG  V
Sbjct  61    NQLSVDLIEEWIKRNPKASICANDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKV  120

Query  532   KFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCES  711
             KFD  R+VM+GGATGA+E L  CL DPG+AFLVPTPYYPGF+RDLRWR+GVQL P+ C+S
Sbjct  121   KFDAKRVVMAGGATGANETLILCLADPGDAFLVPTPYYPGFNRDLRWRSGVQLLPISCKS  180

Query  712   SNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHL  891
              N+FK+T  A+E AY+K Q+ N+++KGL++ NP NPLGT+LDRDTL  I  F N+ NIHL
Sbjct  181   CNNFKITIEAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTFTNEHNIHL  240

Query  892   VCDEIYAATVFSQPEFISIAQIIQEVQC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYNDA  1068
             VCDEIYAATVF+ P+F+SIA+II E  C N D +HIV SLSKDLGFPGFRVGI+YS+ND 
Sbjct  241   VCDEIYAATVFNPPKFVSIAEIINEDNCINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDD  300

Query  1069  VVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIE  1248
             VV+CARKMSSFGLVSTQTQHL+A MLSD EFVE F++ES++RLR+R+E FTRGL ++GI+
Sbjct  301   VVNCARKMSSFGLVSTQTQHLLAFMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIK  360

Query  1249  TLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFA  1428
              L+SN G++ WM+LR+LLKE T  AE+ LWK+IINE+KLNVSPG SF+C E GWFRVCFA
Sbjct  361   CLESNAGVYCWMDLRSLLKEATLDAEMSLWKLIINEVKLNVSPGSSFNCSEVGWFRVCFA  420

Query  1429  NMDDETMRVALMRIR  1473
             N+DD+TM +AL RIR
Sbjct  421   NIDDQTMEIALARIR  435



>gb|KGN45694.1| hypothetical protein Csa_6G006800 [Cucumis sativus]
Length=493

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/480 (65%), Positives = 373/480 (78%), Gaps = 6/480 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGE+S YFDGWKAYDN+PFHP++NP GVIQMGLAENQL  DL+ +W+  +
Sbjct  13    LLSKIAISDGHGEDSPYFDGWKAYDNDPFHPENNPSGVIQMGLAENQLSPDLLVDWIKKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT +G   FKDIA +QDYHGLPEFR A+A FM K RG  VKFDP RIVM GGATG
Sbjct  73    PKASICTDEGLLNFKDIANFQDYHGLPEFRNAIASFMGKARGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFL+P+PYY  FDRDL+WRT  Q+ PV C SSN+F++TR ALE AY
Sbjct  133   ASEAVIFCLADPGDAFLIPSPYYAAFDRDLQWRTRAQIIPVHCNSSNNFQITREALEVAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKA+E NI+VKGL+I NPSNPLGT+ DRDTL  +V FVND NIHLVCDEIY ATVF  P 
Sbjct  193   KKAEESNIKVKGLIITNPSNPLGTIYDRDTLKSLVNFVNDNNIHLVCDEIYCATVFKSPS  252

Query  937   FISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E+  C  + IHI+ SLSKD+G PGFRVGI+YSYND VVS ARKMSSFGLVS
Sbjct  253   FISIAEIIEEMDHCKKELIHILSSLSKDMGLPGFRVGILYSYNDTVVSIARKMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD EFV+NF++E+S+RL KRH  FT+ L ++GI  L  N GLFVWM+LR
Sbjct  313   SQTQHLLAAMLSDDEFVDNFLVENSKRLAKRHARFTKELEKMGITCLNGNAGLFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ +F +E+ELW++IINE+KLNVSPG SF   E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   KLLKDQSFESEMELWRVIINEVKLNVSPGSSFRVTEPGWFRVCFANMDDNTVDVALGRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V +    E        K+K     L++S SF  RR  E  ++ SPH  SP +SPLV+A
Sbjct  433   SFVGKIDKKENNTIPMPPKKKPRENKLRLSFSFSGRRYEEGNVLKSPHMMSP-HSPLVRA  491



>gb|AAD28181.1|AF109927_1 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
Length=486

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/481 (64%), Positives = 373/481 (78%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EF+ IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFEAIANFQDYHGLPTFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E + FC  DPGEAFL+PTPYYPGFDRD RWRTGVQL P+ C SSN FK+T+ ALE+A
Sbjct  132   GAQETITFCPADPGEAFLIPTPYYPGFDRDFRWRTGVQLLPIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  192   YRNARNSHIRVKGILMTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYSYNDAVVSCARKMSSFGLV
Sbjct  252   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSYNDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTDGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>emb|CAA44397.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=477

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/425 (68%), Positives = 354/425 (83%), Gaps = 4/425 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSK+ATN+ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W+  N
Sbjct  3     ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIKRN  62

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PK SIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+GGATG
Sbjct  63    PKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATG  121

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A++ AY
Sbjct  122   ANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAY  181

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             + AQ+ NI+VKGL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF  P+
Sbjct  182   ENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQ  241

Query  937   FISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFRVGIIYS+ND VV+CARKMSSFGL
Sbjct  242   FVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGL  301

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ+ +AAMLSD++FV+NF+ ES+ RL KRH+ FT GL  VGI+ LK+N GLF WM+
Sbjct  302   VSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMD  361

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR LL+E TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +AL R
Sbjct  362   LRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDIALAR  421

Query  1468  IRTSV  1482
             IR  V
Sbjct  422   IRRFV  426



>sp|P18485.2|1A12_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate synthase 2; Short=ACC 
synthase 2; AltName: Full=Le-ACS2; Short=ACS-2; AltName: 
Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
2 [Solanum lycopersicum]
 emb|CAA41855.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/429 (68%), Positives = 355/429 (83%), Gaps = 4/429 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W
Sbjct  7     KTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+G
Sbjct  67    IKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAG  125

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A+
Sbjct  126   GATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAV  185

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+VKGL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF
Sbjct  186   KEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVF  245

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               P+F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFRVGIIYS+ND VV+CARKMS
Sbjct  246   DTPQFVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMS  305

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ+ +AAMLSD++FV+NF+ ES+ RL KRH+ FT GL  VGI+ LK+N GLF
Sbjct  306   SFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLF  365

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +
Sbjct  366   CWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDI  425

Query  1456  ALMRIRTSV  1482
             AL RIR  V
Sbjct  426   ALARIRRFV  434



>pdb|1IAX|A Chain A, Crystal Structure Of Acc Synthase Complexed With Plp
 pdb|1IAX|B Chain B, Crystal Structure Of Acc Synthase Complexed With Plp
 pdb|1IAY|A Chain A, Crystal Structure Of Acc Synthase Complexed With Cofactor 
Plp And Inhibitor Avg
Length=428

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/425 (68%), Positives = 354/425 (83%), Gaps = 4/425 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSK+ATN+ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W+  N
Sbjct  1     ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIKRN  60

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PK SIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+GGATG
Sbjct  61    PKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATG  119

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A++ AY
Sbjct  120   ANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAY  179

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             + AQ+ NI+VKGL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF  P+
Sbjct  180   ENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQ  239

Query  937   FISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFRVGIIYS+ND VV+CARKMSSFGL
Sbjct  240   FVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGL  299

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VSTQTQ+ +AAMLSD++FV+NF+ ES+ RL KRH+ FT GL  VGI+ LK+N GLF WM+
Sbjct  300   VSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMD  359

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR LL+E TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +AL R
Sbjct  360   LRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDIALAR  419

Query  1468  IRTSV  1482
             IR  V
Sbjct  420   IRRFV  424



>ref|NP_001234178.1| 1-aminocyclopropane-1-carboxylate synthase 2 [Solanum lycopersicum]
 gb|AAP96918.1| ripening-related ACC synthase 2 [Solanum lycopersicum]
Length=485

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/429 (68%), Positives = 355/429 (83%), Gaps = 4/429 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W
Sbjct  7     KTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+G
Sbjct  67    IKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAG  125

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A+
Sbjct  126   GATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAV  185

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+VKGL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF
Sbjct  186   KEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVF  245

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               P+F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFRVGIIYS+ND VV+CARKMS
Sbjct  246   DTPQFVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMS  305

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ+ +AAMLSD++FV+NF+ ES+ RL KRH+ FT GL  VGI+ LK+N GLF
Sbjct  306   SFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLF  365

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +
Sbjct  366   CWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDI  425

Query  1456  ALMRIRTSV  1482
             AL RIR  V
Sbjct  426   ALARIRRFV  434



>ref|NP_191710.1| 1-aminocyclopropane-1-carboxylate synthase [Arabidopsis thaliana]
 sp|Q06429.2|1A11_ARATH RecName: Full=1-aminocyclopropane-1-carboxylate synthase-like 
protein 1 [Arabidopsis thaliana]
 gb|AAA96006.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 gb|AAB60312.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 emb|CAB71081.1| 1-aminocyclopropane-1-carboxylate synthase-like protein [Arabidopsis 
thaliana]
 gb|AAM91649.1| 1-aminocyclopropane-1-carboxylate synthase ACS1 [Arabidopsis 
thaliana]
 gb|AEE80216.1| 1-aminocyclopropane-1-carboxylate synthase [Arabidopsis thaliana]
 prf||2204225A aminocyclopropanecarboxylate synthase
Length=488

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 379/482 (79%), Gaps = 14/482 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             + Q+LSK+A +D HGE S YF GWKAYDNNPFHP HNPQGVIQMGLAENQLC DLIK W+
Sbjct  7     ENQLLSKLALSDKHGEASPYFHGWKAYDNNPFHPTHNPQGVIQMGLAENQLCSDLIKEWI  66

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
               NP+ASICT +G + F DIA++QDYHGL +FR A+A FME+ RG  V+F+ +R+VMSGG
Sbjct  67    KENPQASICTAEGIDSFSDIAVFQDYHGLKQFRQAIATFMERARGGRVRFEAERVVMSGG  126

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
             ATGA+E + FCL DPG+AFLVPTPYY  FDRDLRWRTGV++ PV C SSN+F++T+ ALE
Sbjct  127   ATGANETIMFCLADPGDAFLVPTPYYAAFDRDLRWRTGVRIIPVECSSSNNFQITKQALE  186

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
             SAY KAQE  I++KGL+I   SNPLGT LDR+TL  +V F+NDK IHLVCDEIYAATVF+
Sbjct  187   SAYLKAQETGIKIKGLII---SNPLGTSLDRETLESLVSFINDKQIHLVCDEIYAATVFA  243

Query  928   QPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFG  1104
             +P FIS+A+IIQE+   N D IHIVYSLSKD+G PGFRVG++YSYND VVSCAR+MSSFG
Sbjct  244   EPGFISVAEIIQEMYYVNRDLIHIVYSLSKDMGLPGFRVGVVYSYNDVVVSCARRMSSFG  303

Query  1105  LVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWM  1284
             LVS+QTQ  +AAMLSD+ FV+NF++E S+R+ KRH  FT GL ++GI  L+SN GLFV M
Sbjct  304   LVSSQTQSFLAAMLSDQSFVDNFLVEVSKRVAKRHHMFTEGLEEMGISCLRSNAGLFVLM  363

Query  1285  NLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             +LR++LK+ TF +E+ LW++IIN++K+NVSPG SFHC E GWFRVCFANMD++T+++AL 
Sbjct  364   DLRHMLKDQTFDSEMALWRVIINKVKINVSPGSSFHCSEPGWFRVCFANMDEDTLQIALE  423

Query  1465  RIRTSVLQWKGMEaaaaa-------sakkqkqCRRNLKVSLSFRRGLEDC---MISSPHS  1614
             RI+  V+  +  +              KK+K  ++NLK+SLS  R  E      + SPHS
Sbjct  424   RIKDFVVGDRANKNKNCNCICNNKRENKKRKSFQKNLKLSLSSMRYEEHVRSPKLMSPHS  483

Query  1615  PM  1620
             P+
Sbjct  484   PL  485



>gb|AAL66200.1|AF386518_1 1-aminocyclopropane 1-carboxylate synthase 4 [Pyrus communis]
Length=495

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/491 (62%), Positives = 374/491 (76%), Gaps = 8/491 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  +   +LS+IATN+ HGENS YFDGWKAYD NPFH   NP+GVIQMGLAENQL FDL+
Sbjct  4     SASENRLLLSRIATNEKHGENSPYFDGWKAYDQNPFHLTENPEGVIQMGLAENQLSFDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             + W+  NPKASICT +G E+F+ +A +QDYHGLPEFR A+A FM K RG  V F P R+V
Sbjct  64    EEWIRKNPKASICTAEGIEKFRSVANFQDYHGLPEFRQAIASFMWKARGGRVTFGPHRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL + G+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLANRGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY KAQ +NI VKGL+I NPSNPLGT LD+DTL  +V F+N KNIHLVCDEIYAA
Sbjct  184   EALEAAYGKAQNNNINVKGLIITNPSNPLGTTLDKDTLESLVTFINQKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P+F  I ++IQ + CNP+ IHIVYSLSKD+GFPG RVGI+YSYND VV+  RKMS
Sbjct  244   TVFSSPKFTCITEVIQNMNCNPNLIHIVYSLSKDMGFPGLRVGIVYSYNDDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVS+QTQH++A+MLSD++FVE F+  S++RL KRH  FT GL +VGI  LKSN GLF
Sbjct  304   SFGLVSSQTQHMLASMLSDEDFVEKFLTTSAKRLAKRHGVFTDGLEEVGINCLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL++ TF  E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLRDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS-------SPHS  1614
             AL RIR  V Q K  +  A   + K++          S  R  E   +S       SPHS
Sbjct  424   ALKRIRAFVGQAKKAQEQAQVKSPKKRWQSNLRLSFSSSSRRFEQEGVSVMSPRMMSPHS  483

Query  1615  PM-NSPLVQAT  1644
             PM +SPL++AT
Sbjct  484   PMPHSPLLRAT  494



>emb|CAA41856.1| 1-aminocyclopropane 1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/429 (68%), Positives = 354/429 (83%), Gaps = 4/429 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W
Sbjct  7     KTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM G
Sbjct  67    IKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMVG  125

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A+
Sbjct  126   GATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAV  185

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+VKGL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF
Sbjct  186   KEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVF  245

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               P+F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFRVGIIYS+ND VV+CARKMS
Sbjct  246   DTPQFVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMS  305

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ+ +AAMLSD++FV+NF+ ES+ RL KRH+ FT GL  VGI+ LK+N GLF
Sbjct  306   SFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLF  365

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF +E+ LW++IIN++KLNVSPG SF CQE GWFRVCFANMDD T+ +
Sbjct  366   CWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDI  425

Query  1456  ALMRIRTSV  1482
             AL RIR  V
Sbjct  426   ALARIRRFV  434



>ref|XP_010055081.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Eucalyptus 
grandis]
Length=486

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/491 (62%), Positives = 376/491 (77%), Gaps = 12/491 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M+  S+R+ + +LS IA N GHGE+S YFDGWKAYD NPFHP  NP GVIQMGLAENQL 
Sbjct  1     MEPASVRKHS-LLSMIARNGGHGEHSPYFDGWKAYDRNPFHPTQNPDGVIQMGLAENQLS  59

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W+ NNP ASICTP G  +FKD+AI+QDYHGLPEFR A+A+FM +VR     FDP
Sbjct  60    FDLIEEWIKNNPTASICTPDGVGKFKDVAIFQDYHGLPEFRQAIAKFMGRVRRGKATFDP  119

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRIVMSGGATGA E L FCL D G+AFLVP+PYYP FDRDLRWRTGV+L P  C+S+N+F
Sbjct  120   DRIVMSGGATGASETLIFCLADRGDAFLVPSPYYPAFDRDLRWRTGVRLIPFACDSTNNF  179

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             +VT   +ESAY KA E NI VKG+++ NPSNPLG  L ++TL  ++ F  +KN+H+VCDE
Sbjct  180   QVTLAQMESAYAKAIEANINVKGVILTNPSNPLGINLSKETLTSLLSFTFEKNLHMVCDE  239

Query  904   IYAATVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCA  1083
             IY+ATVF  P F SIA+++QE +CNPD +HI+YSLSKD+G PGFRVGIIYSYND VV+CA
Sbjct  240   IYSATVFKSPAFTSIAEVMQETECNPDLVHIIYSLSKDMGLPGFRVGIIYSYNDQVVNCA  299

Query  1084  RKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSN  1263
             RKMSSFGL+S+Q+QHL+A+MLSD+ F+E F+ E+S RL KRH     GL Q GI  L+ N
Sbjct  300   RKMSSFGLISSQSQHLLASMLSDEVFIEKFLEENSRRLGKRHSRVVEGLKQEGINCLEGN  359

Query  1264  GGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDE  1443
              GLF+WM+LR+LLKEPT  AE+ELW++II ++KLNVSPG SFHC E G+FRVCFANMDD 
Sbjct  360   AGLFLWMDLRHLLKEPTPDAEMELWRVIIKDVKLNVSPGSSFHCPEPGFFRVCFANMDDH  419

Query  1444  TMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM----ISSPH  1611
             T+ VAL RIR  V   KG +        +    +R+L++S + R+  E  +    I SPH
Sbjct  420   TVEVALQRIREFVS--KGNKNGDDKKHWR----KRDLRLSFTSRKCDESLISPRQIMSPH  473

Query  1612  SPM-NSPLVQA  1641
             SP+  SPLV+A
Sbjct  474   SPVPQSPLVRA  484



>emb|CAH56693.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=476

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/435 (67%), Positives = 355/435 (82%), Gaps = 5/435 (1%)
 Frame = +1

Query  184   MDLK----SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAE  351
             MDL+    S  + + +LSK+A+N+ HGENS YFDGWKAYDN+PFH  +N  GVIQMGLAE
Sbjct  1     MDLETSEISNYKSSAVLSKLASNEQHGENSPYFDGWKAYDNDPFHLVNNLNGVIQMGLAE  60

Query  352   NQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTV  531
             NQL  DLI+ W+  NPKASIC   G E F+ IA +QDYHGLPEF  A+A+FMEK RG  V
Sbjct  61    NQLSVDLIEEWIKRNPKASICANDGIESFRRIANFQDYHGLPEFTNAIAKFMEKTRGGKV  120

Query  532   KFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCES  711
             KFD  R+VM+GGATGA+E L  CL DPG+AFLVPTPYYPGF+RDLRWR+GVQL P+ C+S
Sbjct  121   KFDAKRVVMAGGATGANETLILCLADPGDAFLVPTPYYPGFNRDLRWRSGVQLLPISCKS  180

Query  712   SNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHL  891
              N+FK+T  A+E AY+K Q+ N+++KGL++ NP NPLGT+LDRDTL  I    N+ NIHL
Sbjct  181   CNNFKITIEAIEEAYEKGQQANVKIKGLILTNPCNPLGTILDRDTLKKISTLTNEHNIHL  240

Query  892   VCDEIYAATVFSQPEFISIAQIIQEVQC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYNDA  1068
             VCDEIYAATVF+ P+F+SIA+II E  C N D +HIV SLSKDLGFPGFRVGI+YS+ND 
Sbjct  241   VCDEIYAATVFNPPKFVSIAEIINEDNCINKDLVHIVSSLSKDLGFPGFRVGIVYSFNDD  300

Query  1069  VVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIE  1248
             VV+CARKMSSFGLVSTQTQHL+A MLSD EFVE F++ES++RLR+R+E FTRGL ++GI+
Sbjct  301   VVNCARKMSSFGLVSTQTQHLLAFMLSDDEFVEEFLIESAKRLRERYEKFTRGLEEIGIK  360

Query  1249  TLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFA  1428
              L+SN G++ WM+LR+LLKE T  AE+ LWK+IINE+KLNVSPG SF+C E GWFRVCFA
Sbjct  361   CLESNAGVYCWMDLRSLLKEATLDAEMSLWKLIINEVKLNVSPGSSFNCSEVGWFRVCFA  420

Query  1429  NMDDETMRVALMRIR  1473
             N+DD+TM +AL RIR
Sbjct  421   NIDDQTMEIALARIR  435



>ref|XP_002872570.1| 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48829.1| 1-aminocyclopropane-1-carboxylic acid (acc) synthase 6 [Arabidopsis 
lyrata subsp. lyrata]
Length=495

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/485 (64%), Positives = 372/485 (77%), Gaps = 5/485 (1%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LS+IA+ DGHGENS+YFDGWKAY+ NPFHP   P GVIQMGLAENQLC DL++ 
Sbjct  9     KQDLNLLSRIASGDGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRK  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WVL +P+ASICT +G   F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDRIVMS
Sbjct  69    WVLKHPEASICTSEGVNRFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGF+RDLRWRTGV L PV C SS+ FK+T  A
Sbjct  129   GGATGAHETVAFCLANPGDGFLVPTPYYPGFNRDLRWRTGVNLVPVTCHSSDGFKITVEA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY+ A++ NI VKGLL+ NPSNPLGT LDR+ L  +V F NDK IHL+ DEIYAAT 
Sbjct  189   LEAAYENARKSNIPVKGLLVTNPSNPLGTTLDRECLKSLVNFTNDKGIHLIADEIYAATT  248

Query  922   FSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F Q EFIS+A++++E++ CN D IHIVYSLSKD+G PG RVGI+YSYND VV  ARKMSS
Sbjct  249   FGQSEFISVAEVVEEIEDCNRDLIHIVYSLSKDMGLPGLRVGIVYSYNDRVVQIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQHLI+ MLSD++FV+ FI ES  RL  RH   T GL  +GI  LK+  GLF+
Sbjct  309   FGLVSSQTQHLISKMLSDEDFVDEFIRESKLRLAARHAEITTGLDGLGIGWLKAKAGLFL  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  369   WMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  428

Query  1459  LMRIR--TSVL--QWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNS  1626
             L RIR  TS L  + K M +    + KK+K  + NL++S S  R  +D   S       S
Sbjct  429   LERIRVFTSQLEEETKPMVSTTMMAKKKKKCWQSNLRLSFSDTRRFDDGFFSPHSPVPPS  488

Query  1627  PLVQA  1641
             PLV+A
Sbjct  489   PLVRA  493



>dbj|BAA33374.1| ACC synthase [Cucumis sativus]
 dbj|BAA93714.1| 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]
Length=493

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 376/492 (76%), Gaps = 7/492 (1%)
 Frame = +1

Query  184   MDLKSMRQQTQIL-SKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQL  360
             M  +   +  Q+L SKIA +DGHGE+S YFDGWKAYDN+PFHP++NP GVIQMGLAENQL
Sbjct  1     MGFQQTHETNQVLLSKIAISDGHGEDSPYFDGWKAYDNDPFHPENNPSGVIQMGLAENQL  60

Query  361   CFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFD  540
               DL+ +W+  +PKASICT +G   FKDIA +QDYHGLPEFR A+A FM K RG  VKFD
Sbjct  61    SPDLLVDWIKKHPKASICTDEGLLNFKDIANFQDYHGLPEFRNAIASFMGKARGGRVKFD  120

Query  541   PDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSND  720
             P RIVM GGATGA E + FCL DPG+AFL+P+PYY  FDRDL+WRT  Q+ PV C SSN+
Sbjct  121   PSRIVMGGGATGASEAVIFCLADPGDAFLIPSPYYAAFDRDLQWRTRAQIIPVHCNSSNN  180

Query  721   FKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCD  900
             F++TR ALE AYKKA+E NI+VKGL+I NPSNPLGT+ DRDTL  +V FVND NIHLVCD
Sbjct  181   FQITREALEVAYKKAEESNIKVKGLIITNPSNPLGTIYDRDTLKSLVNFVNDNNIHLVCD  240

Query  901   EIYAATVFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVS  1077
             EIY ATVF  P FISIA+II+E+  C  + IHI+ SLSKD+  PGFRVGI+YSYND VVS
Sbjct  241   EIYCATVFKSPSFISIAEIIEEMDHCKKELIHILSSLSKDMELPGFRVGILYSYNDTVVS  300

Query  1078  CARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLK  1257
              ARKMSSFGLVS+QTQHL+AAMLSD EFV+NF++E+S+RL KRH  FT+ L ++GI  L 
Sbjct  301   IARKMSSFGLVSSQTQHLLAAMLSDDEFVDNFLVENSKRLAKRHARFTKELEKMGITCLN  360

Query  1258  SNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMD  1437
              N GLFVWM+LR LLK+ +F +E+ELW++IINE+KLNVSPG SF   E GWFRVCFANMD
Sbjct  361   GNAGLFVWMDLRKLLKDQSFESEMELWRVIINEVKLNVSPGSSFRVTEPGWFRVCFANMD  420

Query  1438  DETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH  1611
             D T+ VAL RI + V +    E        K+K     L++S SF  RR  E  ++ SPH
Sbjct  421   DNTVDVALGRIHSFVGKIDKKENNTIPMPPKKKPRENKLRLSFSFSGRRYEEGNVLKSPH  480

Query  1612  --SPMNSPLVQA  1641
               SP +SPLV+A
Sbjct  481   MMSP-HSPLVRA  491



>ref|XP_004159772.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase CMW33-like 
[Cucumis sativus]
Length=493

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/480 (65%), Positives = 372/480 (78%), Gaps = 6/480 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGE+S YFDGWKAYDN+PFHP++NP GVIQMGLAENQL  DL+ +W+  +
Sbjct  13    LLSKIAISDGHGEDSPYFDGWKAYDNDPFHPENNPSGVIQMGLAENQLSPDLLVDWIKKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             PKASICT +G   FKDIA +Q YHGLPEFR A+A FM K RG  VKFDP RIVM GGATG
Sbjct  73    PKASICTDEGLLNFKDIANFQHYHGLPEFRNAIASFMGKARGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFL+P+PYY  FDRDL+WRT  Q+ PV C SSN+F++TR ALE AY
Sbjct  133   ASEAVIFCLADPGDAFLIPSPYYAAFDRDLQWRTRAQIIPVHCNSSNNFQITREALEVAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKA+E NI+VKGL+I NPSNPLGT+ DRDTL  +V FVND NIHLVCDEIY ATVF  P 
Sbjct  193   KKAEESNIKVKGLIITNPSNPLGTIYDRDTLKSLVNFVNDNNIHLVCDEIYCATVFKSPS  252

Query  937   FISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FISIA+II+E+  C  + IHI+ SLSKD+G PGFRVGI+YSYND VVS ARKMSSFGLVS
Sbjct  253   FISIAEIIEEMDHCKKELIHILSSLSKDMGLPGFRVGILYSYNDTVVSIARKMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD EFV+NF++E+S+RL KRH  FT+ L ++GI  L  N GLFVWM+LR
Sbjct  313   SQTQHLLAAMLSDDEFVDNFLVENSKRLAKRHARFTKELEKMGITCLNGNAGLFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ +F +E+ELW++IINE+KLNVSPG SF   E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   KLLKDQSFESEMELWRVIINEVKLNVSPGSSFRVTEPGWFRVCFANMDDNTVDVALGRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V +    E        K+K     L++S SF  RR  E  ++ SPH  SP +SPLV+A
Sbjct  433   SFVGKIDKKENNTIPMPPKKKPRENKLRLSFSFSGRRYEEGNVLKSPHMMSP-HSPLVRA  491



>sp|P23279.1|1A11_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase 1; Short=ACC 
synthase 1; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Cucurbita pepo]
 gb|AAA33113.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=493

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 375/482 (78%), Gaps = 6/482 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGENS YFDGWKAYDN+PFHP++NP GVIQMGLAENQL FD+I +W+  +
Sbjct  13    LLSKIALDDGHGENSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQLSFDMIVDWIRKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICTP+G E FK IA +QDYHGLPEFR A+A FM KVRG  VKFDP RIVM GGATG
Sbjct  73    PEASICTPEGLERFKSIANFQDYHGLPEFRNAIANFMGKVRGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFLVP+PYY GFDRDL+WRT  Q+  V C  SN+F+VT+ ALE AY
Sbjct  133   ASETVIFCLADPGDAFLVPSPYYAGFDRDLKWRTRAQIIRVHCNGSNNFQVTKAALEIAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKAQE N++VKG++I NPSNPLGT  DRDTL  +V FVN  +IHL+CDEIY+ATVF  P 
Sbjct  193   KKAQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPT  252

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F SIA+I+++++ C  + IHI+YSLSKD+G PGFRVGIIYSYND VV  AR+MSSFGLVS
Sbjct  253   FTSIAEIVEQMEHCKKELIHILYSLSKDMGLPGFRVGIIYSYNDVVVRRARQMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD++FV+ F+ E+S+R+ +RH  FT+ L ++GI  L SN G+FVWM+LR
Sbjct  313   SQTQHLLAAMLSDEDFVDKFLAENSKRVGERHARFTKELDKMGITCLNSNAGVFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ TF AE+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   RLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMDDNTVDVALNRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V      E    A   K +     L++S SF  RR  E  +++SPH  SP +SPLV A
Sbjct  433   SFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSGRRYDEGNVLNSPHTMSP-HSPLVIA  491

Query  1642  TN  1647
              N
Sbjct  492   KN  493



>gb|AAA33111.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=493

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 375/482 (78%), Gaps = 6/482 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGENS YFDGWKAYDN+PFHP++NP GVIQMGLAENQL FD+I +W+  +
Sbjct  13    LLSKIALDDGHGENSPYFDGWKAYDNDPFHPENNPLGVIQMGLAENQLSFDMIVDWIRKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICTP+G E FK IA +QDYHGLPEFR A+A FM KVRG  VKFDP RIVM GGATG
Sbjct  73    PEASICTPEGLERFKSIANFQDYHGLPEFRNAIANFMGKVRGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFLVP+PYY GFDRDL+WRT  Q+  V C  SN+F+VT+ ALE AY
Sbjct  133   ASETVIFCLADPGDAFLVPSPYYAGFDRDLKWRTRAQIIRVHCNRSNNFQVTKAALEIAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKAQE N++VKG++I NPSNPLGT  DRDTL  +V FVN  +IHL+CDEIY+ATVF  P 
Sbjct  193   KKAQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPT  252

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F SIA+I+++++ C  + IHI+YSLSKD+G PGFRVGIIYSYND VV  AR+MSSFGLVS
Sbjct  253   FTSIAEIVEQMEHCKKELIHILYSLSKDMGLPGFRVGIIYSYNDVVVRRARQMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD++FV+ F+ E+S+R+ +RH  FT+ L ++GI  L SN G+FVWM+LR
Sbjct  313   SQTQHLLAAMLSDEDFVDKFLAENSKRVGERHARFTKELDKMGITCLNSNAGVFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ TF AE+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   RLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMDDNTVDVALNRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V      E    A   K +     L++S SF  RR  E  +++SPH  SP +SPLV A
Sbjct  433   SFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSGRRYDEGNVLNSPHTMSP-HSPLVIA  491

Query  1642  TN  1647
              N
Sbjct  492   KN  493



>sp|Q00379.1|1A12_CUCPE RecName: Full=1-aminocyclopropane-1-carboxylate synthase 2; Short=ACC 
synthase 2; AltName: Full=S-adenosyl-L-methionine methylthioadenosine-lyase 
[Cucurbita pepo]
Length=494

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 375/480 (78%), Gaps = 6/480 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGENSAYFDGWKAYDNNPFHP++NP GVIQMGLAENQL F +I +W+  +
Sbjct  13    LLSKIAIDDGHGENSAYFDGWKAYDNNPFHPENNPLGVIQMGLAENQLSFGMIVDWIRKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICTP+G E+FK IA +QDYHGL EFR A+A FM KVRG  VKFDP RIVM GGATG
Sbjct  73    PEASICTPEGLEKFKSIANFQDYHGLQEFRKAMASFMGKVRGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFLVP+PYY  FDRDL+WRT  Q+ PV C SSN+F+VT  ALE AY
Sbjct  133   ASETVIFCLADPGDAFLVPSPYYAAFDRDLKWRTRAQIIPVHCNSSNNFQVTEAALEIAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKAQE N++VKG++I NPSNPLGT  DRDTL  +V FVN  +IHL+CDEIY+ATVF  P 
Sbjct  193   KKAQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPT  252

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F SIA+I+++++ C  + IHI+YSLSKD+G PGFRVGIIYSYND VV  AR+MSSFGLVS
Sbjct  253   FTSIAEIVEQMEHCKKELIHILYSLSKDMGLPGFRVGIIYSYNDVVVRRARQMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQHL+AAMLSD++FV+ F+ E+S+RL +RH  FT+ L ++GI  L SN G+FVWM+LR
Sbjct  313   SQTQHLLAAMLSDEDFVDKFLAENSKRLGERHARFTKELDKMGITCLNSNAGVFVWMDLR  372

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
              LLK+ TF AE+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMDD T+ VAL RI 
Sbjct  373   RLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMDDNTVDVALNRIH  432

Query  1474  TSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQA  1641
             + V      E    A   K +     L++S SF  RR  +  +++SPH  SP +SPLV+A
Sbjct  433   SFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSGRRYDKGNVLNSPHTMSP-HSPLVRA  491



>emb|CDY13251.1| BnaC09g24050D [Brassica napus]
Length=491

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/434 (67%), Positives = 344/434 (79%), Gaps = 1/434 (0%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             L + +Q   +LS++A  DGHGE SAYFDGWKAY+ NPFHP   P GVIQMGLAENQLC D
Sbjct  4     LTAEKQDQNLLSRMAAGDGHGEKSAYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGD  63

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             L++ WVL +P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDR
Sbjct  64    LMRKWVLEHPEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDR  123

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVMSGGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SSN FK+
Sbjct  124   IVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKI  183

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             T  AL++AY+ A+  NI VKGLLI NPSNPLGT LDRD L  +V+F NDK IHL+ DEIY
Sbjct  184   TAEALDAAYENARVSNIPVKGLLITNPSNPLGTTLDRDCLKSLVKFTNDKGIHLIADEIY  243

Query  910   AATVFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCAR  1086
             AAT F + EFIS+A++I E+  CN D IHIVYSLSKD+G PG RVGI+YSYND VV  AR
Sbjct  244   AATTFGESEFISVAEVIDEIPDCNTDLIHIVYSLSKDMGLPGLRVGIVYSYNDRVVQIAR  303

Query  1087  KMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNG  1266
             KMSSFGLVS+QTQHLIA MLSD++FV+ FI +S  RL +RH   T GL  +GI  LK+  
Sbjct  304   KMSSFGLVSSQTQHLIAKMLSDEDFVDEFIRKSKLRLAERHAELTTGLDGLGIGWLKAGA  363

Query  1267  GLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDET  1446
             GLF+WM+LRNLLK  TF +E+ELW++I++++KLNVSPG S HC E GWFRVCFANMD +T
Sbjct  364   GLFIWMDLRNLLKTATFDSEMELWRVIVHKVKLNVSPGGSCHCHEPGWFRVCFANMDYQT  423

Query  1447  MRVALMRIRTSVLQ  1488
             M  AL RIR    Q
Sbjct  424   METALERIRVFTCQ  437



>gb|KFK31896.1| hypothetical protein AALP_AA6G173200 [Arabis alpina]
Length=497

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/430 (68%), Positives = 346/430 (80%), Gaps = 1/430 (0%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LSK+A+ +GHGENS+YFDGWKAY+ NPFHP   P GVIQMGLAENQLC DL++ 
Sbjct  8     KQDLNLLSKMASGEGHGENSSYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRK  67

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WVL +P+ASICT +G ++F + AI+QDYHGLPEFR AVARFMEK R + VKFDPDRIVMS
Sbjct  68    WVLEHPEASICTSEGVDQFGNFAIFQDYHGLPEFRQAVARFMEKTRDNKVKFDPDRIVMS  127

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SSN FK+T  A
Sbjct  128   GGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKITVEA  187

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE+AY+ A+E NI VKGLLI NPSNPLGT LDR+ L  +V F+NDK IHL+ DEIY+AT 
Sbjct  188   LEAAYQTARESNIPVKGLLITNPSNPLGTTLDRECLISLVNFINDKGIHLIADEIYSATT  247

Query  922   FSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F   EFIS+A++++E+  CN D IHIVYSLSKD+G PGFRVGI+YSYN+ VV+ ARKMSS
Sbjct  248   FGHSEFISVAEVLEEIPNCNRDLIHIVYSLSKDMGLPGFRVGIVYSYNNRVVNIARKMSS  307

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQHLIA MLSD++FV+ FI ES  RL  RH   T GL  +GI  LK+  GLF+
Sbjct  308   FGLVSSQTQHLIAKMLSDEDFVDEFIRESKLRLAARHAELTTGLDSLGIGWLKAKAGLFL  367

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  368   WMDLRNLLKTATFDSETELWRVIVHKVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  427

Query  1459  LMRIRTSVLQ  1488
             L RIR    Q
Sbjct  428   LERIRVFTRQ  437



>ref|XP_010435116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6 [Camelina 
sativa]
Length=495

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/485 (65%), Positives = 374/485 (77%), Gaps = 5/485 (1%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             +Q   +LS+IA+ DGHGENS+YF+GWKAY+ NPFHP   P GVIQMGLAENQLC DL++ 
Sbjct  9     KQDLNLLSRIASGDGHGENSSYFEGWKAYEENPFHPIDRPDGVIQMGLAENQLCGDLMRK  68

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             WV+ +P+ASICT QG  +F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDRIVMS
Sbjct  69    WVIEHPEASICTEQGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNRVKFDPDRIVMS  128

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SS+ FK+T  A
Sbjct  129   GGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSDGFKITVEA  188

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             LE AY+KA   NI VKGLL+ NPSNPLGT LDR+ L  +V F N+K IHL+ DEIYAAT 
Sbjct  189   LEDAYEKALLSNIPVKGLLMTNPSNPLGTTLDRECLKSLVNFTNEKRIHLIADEIYAATT  248

Query  922   FSQPEFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSS  1098
             F Q EFIS+A++I+E++ CN D IHIVYSLSKD+G PGFRVGIIYSYND VV  ARKMSS
Sbjct  249   FGQSEFISVAEVIEEIEDCNRDLIHIVYSLSKDMGLPGFRVGIIYSYNDRVVQIARKMSS  308

Query  1099  FGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFV  1278
             FGLVS+QTQ LIA MLSD++FV+ FI ES  RL  RH+  T GL  +GI  LK+  GLF+
Sbjct  309   FGLVSSQTQRLIAKMLSDEDFVDEFIRESKLRLAARHKELTTGLDGLGIGWLKAEAGLFL  368

Query  1279  WMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVA  1458
             WM+LRNLLK  TF +E ELW++I++++KLNVSPG SFHC E GWFRVCFANMD +TM  A
Sbjct  369   WMDLRNLLKTATFDSETELWRVIVHQVKLNVSPGGSFHCHEPGWFRVCFANMDHKTMETA  428

Query  1459  LMRIR--TSVL--QWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPHSPMNS  1626
             L RIR  TS L  + K + AA   + KK+K  + NL++S S +R  +D   S       S
Sbjct  429   LERIRVFTSQLEEETKPVAAAPMMAKKKKKCWQSNLRLSFSDKRRFDDGFFSPHSPVPPS  488

Query  1627  PLVQA  1641
             PLV+A
Sbjct  489   PLVRA  493



>emb|CAA57716.1| 1-aminocyclopropane-1-carboxylate synthase [Capsicum annuum]
Length=363

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/363 (80%), Positives = 325/363 (90%), Gaps = 1/363 (0%)
 Frame = +1

Query  337   MGLAENQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKV  516
             MGLAENQLCFDLI+ WV+NNPKASICT +GAE+F++IAI+QDYHGLPEFR AVARFMEKV
Sbjct  1     MGLAENQLCFDLIQEWVVNNPKASICTAKGAEDFQEIAIFQDYHGLPEFRQAVARFMEKV  60

Query  517   RGDTVKFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYP  696
             RGD V FDP+RIVMSGGATGAHE+LAFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL+P
Sbjct  61    RGDRVTFDPNRIVMSGGATGAHEMLAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLFP  120

Query  697   VVCESSNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVND  876
             VVCESSNDFKVTR ALE AY+KAQE NI++K LLINNPSNPLGT+LD+DTL DIV F+N 
Sbjct  121   VVCESSNDFKVTRKALEEAYEKAQESNIKIKRLLINNPSNPLGTLLDKDTLRDIVTFINS  180

Query  877   KNIHLVCDEIYAATVFSQPEFISIAQIIQE-VQCNPDRIHIVYSLSKDLGFPGFRVGIIY  1053
             KNIHLVCDEIYAATVF QP FIS+++++ E + CN D IHIVYSLSKDLGFPGFRVGI+Y
Sbjct  181   KNIHLVCDEIYAATVFDQPRFISVSEVVDEMIGCNQDLIHIVYSLSKDLGFPGFRVGIVY  240

Query  1054  SYNDAVVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLA  1233
             SYND VV  ARKMSSFGLVSTQTQHL+A+MLSD+ F+E FI ESSERL KR   FT+GLA
Sbjct  241   SYNDTVVDIARKMSSFGLVSTQTQHLLASMLSDEIFIEKFIAESSERLSKRQGMFTKGLA  300

Query  1234  QVGIETLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWF  1413
             QVGI TLKSN GLF WM+LR LLKEPTF AELELW++II+E+KLNVSPG SFHC E GWF
Sbjct  301   QVGISTLKSNAGLFFWMDLRRLLKEPTFDAELELWRIIIHEVKLNVSPGVSFHCSEPGWF  360

Query  1414  RVC  1422
             RVC
Sbjct  361   RVC  363



>ref|XP_011092964.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 1 [Sesamum 
indicum]
Length=477

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 370/480 (77%), Gaps = 14/480 (3%)
 Frame = +1

Query  208   QTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWV  387
             + Q+LSKIA++D HGENS YFDGWKAYDN+PFHP  NP GVIQMGLAENQL  DLI+ W+
Sbjct  8     KRQLLSKIASSDEHGENSPYFDGWKAYDNDPFHPTQNPHGVIQMGLAENQLPVDLIEEWI  67

Query  388   LNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGG  567
               NP ASICT +G   FK  A+YQDYHGLPEFR AVA+ M K RG  V FDPDRIVM+GG
Sbjct  68    KKNPSASICTTEGLHAFKSTALYQDYHGLPEFRHAVAKLMAKSRGGRVSFDPDRIVMAGG  127

Query  568   ATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALE  747
                  E+L FCL DPG+ FL+P+PYY  FDRDL WR  V+L PV C SSN+F++T  ALE
Sbjct  128   G----EMLMFCLADPGDGFLIPSPYYAAFDRDLGWRPRVRLLPVTCHSSNNFQITLEALE  183

Query  748   SAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFS  927
             +AY+ A++ NI VKGL++ NPSNPLGT LD  TL  +V F+N K IHLVCDEIYAATVF 
Sbjct  184   AAYQSARKANINVKGLILANPSNPLGTTLDTSTLRTLVTFINHKQIHLVCDEIYAATVFR  243

Query  928   QPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
              P F+S+++IIQE++CN D IHIV SLSKD+G PGFRVGI+YSYND VV+  RKMSSFGL
Sbjct  244   GPSFLSVSEIIQEMECNRDLIHIVCSLSKDMGLPGFRVGIVYSYNDTVVNLGRKMSSFGL  303

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VS+QTQHL+A+MLSD+EFVE F+ ES+ RL  RH+SFT+GL QVGI+ LKSN GLF WM+
Sbjct  304   VSSQTQHLLASMLSDEEFVERFLSESARRLASRHDSFTKGLDQVGIKCLKSNAGLFCWMD  363

Query  1288  LRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMR  1467
             LR+LLKEPTF  E+ LWK+II+++KLNVSPG SFHC E GWFRVCFANMDDET+ VAL R
Sbjct  364   LRHLLKEPTFEGEMGLWKVIISDVKLNVSPGSSFHCHEPGWFRVCFANMDDETVEVALRR  423

Query  1468  IRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQA  1641
             IR  V ++K +E       + +K  +RNL++S       ++ M SSP   SP  SPLV+A
Sbjct  424   IRVFVGKYKEVE------VQVKKSWQRNLRLSFPTLM-YDENMASSPRMMSP-QSPLVRA  475



>ref|XP_010559100.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 [Tarenaya hassleriana]
Length=487

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/488 (61%), Positives = 372/488 (76%), Gaps = 12/488 (2%)
 Frame = +1

Query  169   LKIIYMDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLA  348
             +  I  D     ++  +LS+IA  + HGE+S YFDGWK YDN+PFHP  NP+GVIQMGLA
Sbjct  5     MAAISSDRNMQPKKENLLSRIAAGEQHGEDSPYFDGWKVYDNDPFHPTRNPRGVIQMGLA  64

Query  349   ENQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDT  528
             ENQLC DLIK W+  NP+ASI TP G   F D+A++QDYHGL  FR  +ARFM K RG  
Sbjct  65    ENQLCSDLIKEWIKVNPQASIFTPDGINAFSDVAVFQDYHGLTGFRQGIARFMGKARGGR  124

Query  529   VKFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCE  708
             V+F+PDR+VMSGGATGA+E L FCL DPG+AFLVPTPYY  FDRDLRWRTG+++ PV C 
Sbjct  125   VRFEPDRVVMSGGATGANETLMFCLADPGDAFLVPTPYYAAFDRDLRWRTGLRIIPVECN  184

Query  709   SSNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIH  888
             SSN+F++TR ALES+Y KAQE +I++KGL++ NPSNPLGT LDR TL  ++ F++DK IH
Sbjct  185   SSNNFQITRQALESSYLKAQESDIKIKGLILANPSNPLGTSLDRVTLETLISFISDKQIH  244

Query  889   LVCDEIYAATVFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYND  1065
             LVCDEIYAATVF  P F S+A+IIQE+   N D IHIVYSLSKD+G PGFRVGIIYS+ND
Sbjct  245   LVCDEIYAATVFHGPRFTSVAEIIQEMDHVNRDFIHIVYSLSKDMGLPGFRVGIIYSFND  304

Query  1066  AVVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGI  1245
             AVVSCARKMSSFGLVS+ TQ  +AAMLSD+ FV++F+  SS+RL +RH  FTRGL Q GI
Sbjct  305   AVVSCARKMSSFGLVSSHTQSFLAAMLSDERFVDDFLARSSKRLARRHGIFTRGLEQTGI  364

Query  1246  ETLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCF  1425
               LKSN GLFVWM+LR +LK+ +F +E++LW++IIN++K+NVSPG SFHC E GWFR CF
Sbjct  365   SCLKSNAGLFVWMDLRPMLKDQSFESEMDLWRVIINKVKINVSPGSSFHCSEPGWFRACF  424

Query  1426  ANMDDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---  1596
             ANMD+ET+ V L RI+  V+          + +K +   ++NL++S S R   E  M   
Sbjct  425   ANMDEETLEVGLRRIQEFVV--------GNSKSKTRGGWQKNLRLSFSSRMYDEHAMSPR  476

Query  1597  ISSPHSPM  1620
             + SPHSP+
Sbjct  477   LMSPHSPL  484



>dbj|BAJ10416.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=500

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/491 (62%), Positives = 379/491 (77%), Gaps = 15/491 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  8     EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  67

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  68    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  127

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  128   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  187

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  188   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSP  247

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  248   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  307

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IAA+LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  308   SSQTQFMIAALLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  367

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  368   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  427

Query  1471  RTSVLQWK------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS------SPH  1611
             R+ V + +         AA   +    K+ R  +++ LSF  R  ED +IS      SPH
Sbjct  428   RSFVTRGRVDNSTMTTTAATTTTTTTIKKKRGQMELRLSFNNRRFEDGLISPHSSLLSPH  487

Query  1612  SPM-NSPLVQA  1641
             SPM  SPLV+A
Sbjct  488   SPMPQSPLVKA  498



>gb|AAA33112.1| 1-aminocyclopropane-1-carboxylate synthase [Cucurbita pepo]
Length=495

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 376/481 (78%), Gaps = 7/481 (1%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             +LSKIA +DGHGENSAYFDGWKAYDNNPFHP++NP GVIQMGLAENQL F +I +W+  +
Sbjct  13    LLSKIAIDDGHGENSAYFDGWKAYDNNPFHPENNPLGVIQMGLAENQLSFGMIVDWIRKH  72

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICTP+G E+FK IA +QDYHGL EFR A+A FM KVRG  VKFDP RIVM GGATG
Sbjct  73    PEASICTPEGLEKFKSIANFQDYHGLQEFRKAMASFMGKVRGGRVKFDPSRIVMGGGATG  132

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E + FCL DPG+AFLVP+PYY  FDRDL+WRT  Q+ PV C SSN+F+VT  ALE AY
Sbjct  133   ASETVIFCLADPGDAFLVPSPYYAAFDRDLKWRTRAQIIPVHCNSSNNFQVTEAALEIAY  192

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKAQE N++VKG++I NPSNPLGT  DRDTL  +V FVN  +IHL+CDEIY+ATVF  P 
Sbjct  193   KKAQEANMKVKGVIITNPSNPLGTTYDRDTLKTLVTFVNQHDIHLICDEIYSATVFKAPT  252

Query  937   FISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             F SIA+I+++++ C  + IHI+YSLSKD+G PGFRVGIIYSYND VV  AR+MSSFGLVS
Sbjct  253   FTSIAEIVEQMEHCKKELIHILYSLSKDMGLPGFRVGIIYSYNDVVVRRARQMSSFGLVS  312

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHES-FTRGLAQVGIETLKSNGGLFVWMNL  1290
             +QTQHL+AAMLSD++FV+ F+ E+S+RL +RH S FT+ L ++GI  L SN G+FVWM+L
Sbjct  313   SQTQHLLAAMLSDEDFVDKFLAENSKRLGERHASRFTKELDKMGITCLNSNAGVFVWMDL  372

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLK+ TF AE+ELW++IINE+KLNVSPG SFH  E GWFRVCFANMDD T+ VAL RI
Sbjct  373   RRLLKDQTFKAEMELWRVIINEVKLNVSPGSSFHVTEPGWFRVCFANMDDNTVDVALNRI  432

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSF--RRGLEDCMISSPH--SPMNSPLVQ  1638
              + V      E    A   K +     L++S SF  RR  +  +++SPH  SP +SPLV+
Sbjct  433   HSFVENIDKKEDNTVAMPSKTRHRDNKLRLSFSFSGRRYDKGNVLNSPHTMSP-HSPLVR  491

Query  1639  A  1641
             A
Sbjct  492   A  492



>ref|NP_001289261.1| 1-aminocyclopropane-1-carboxylate synthase 1 [Pyrus x bretschneideri]
 dbj|BAF44096.1| 1-aminocyclopropane-1-carboxylate synthase [Pyrus x bretschneideri]
Length=495

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/491 (62%), Positives = 372/491 (76%), Gaps = 8/491 (2%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             S  +   +LSKIATN+ HGENS YFDGW  Y+ NPFH   NP+GVIQMGLAENQL FDL+
Sbjct  4     SASENRLLLSKIATNEKHGENSPYFDGWNKYNQNPFHLTENPEGVIQMGLAENQLSFDLV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             +  +  NPKASICT +G E+F+++A +QDYHGLPEFR A+A FM K RG  V FDP R+V
Sbjct  64    EERIRKNPKASICTAEGIEKFRNVANFQDYHGLPEFRQAIATFMSKARGGRVTFDPHRVV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGA+E++ FCL D G+AFL+P+PYYP F RDL WRTGVQ+ PV C+SSN+FK+T+
Sbjct  124   MSGGATGANELVMFCLADRGDAFLIPSPYYPAFYRDLGWRTGVQIVPVDCDSSNNFKITK  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQ +NI VKGL+I NPSNPLGT LD+DTL  +V F+N KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQNNNINVKGLIITNPSNPLGTTLDKDTLESLVTFINQKNIHLVCDEIYAA  243

Query  916   TVFSQPEFISIAQIIQEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
             TVFS P+F  I ++IQ + CNP+ IHIVYSL+KD+GFPG RVGI+YSYND VV+  RKMS
Sbjct  244   TVFSSPKFTCITEVIQNMNCNPNLIHIVYSLAKDMGFPGLRVGIVYSYNDDVVNIGRKMS  303

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             S GLVS+QTQH++A+MLSD++FVE F+  S++RL KRH  FT GL +VGI  LKSN GLF
Sbjct  304   SSGLVSSQTQHMLASMLSDEDFVEKFLTTSAKRLAKRHGVFTDGLEEVGINCLKSNAGLF  363

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LLK+ TF  E+ LW++I+NE+KLNVSPG SF C E GWFRVCFANMDD+T+ V
Sbjct  364   CWMDLRRLLKDQTFDGEMVLWRVIVNEVKLNVSPGSSFKCVEPGWFRVCFANMDDDTVEV  423

Query  1456  ALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMIS-------SPHS  1614
             AL RIR  V Q K  +      + K++          S  R  E   +S       SPHS
Sbjct  424   ALKRIRAFVGQGKKAQEQVQVKSPKKRWQSNLRLSFSSSSRRFEQEGVSVMSPRMMSPHS  483

Query  1615  PM-NSPLVQAT  1644
             PM +SPL++AT
Sbjct  484   PMPHSPLLRAT  494



>dbj|BAK19923.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=506

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/494 (61%), Positives = 375/494 (76%), Gaps = 18/494 (4%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  11    EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  70

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  71    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRGAVAKFMGKARDEKVIFNPDRIVMSGGAT  130

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  131   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  190

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  191   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNAKNIHLVCDEIYATTVFNSP  250

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  251   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  310

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IA +LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  311   SSQTQFMIATLLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  370

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  371   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  430

Query  1471  RTSVLQWK----------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS-----  1602
             R+ V + +                  +    K+ R  +++ LSF  R  ED ++S     
Sbjct  431   RSFVTRGRVDNSTMTTTAATTTTTTTTTTTIKKKRGQMELRLSFNNRRFEDGLMSPHSSL  490

Query  1603  -SPHSPMNSPLVQA  1641
              SPHSPM SPLV+A
Sbjct  491   LSPHSPMQSPLVKA  504



>dbj|BAJ10406.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10408.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/492 (62%), Positives = 378/492 (77%), Gaps = 16/492 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  8     EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  67

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  68    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  127

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  128   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  187

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  188   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSP  247

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  248   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  307

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IAA+LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  308   SSQTQFMIAALLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  367

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  368   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  427

Query  1471  RTSVLQWK-------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS------SP  1608
             R+ V + +          A    +    K+ R  +++ LSF  R  ED +IS      SP
Sbjct  428   RSFVTRGRVDNSTMTTTAATTTTTTTTIKKKRGQMELRLSFNNRRFEDGLISPHSSLLSP  487

Query  1609  HSPM-NSPLVQA  1641
             HSPM  SPLV+A
Sbjct  488   HSPMPQSPLVKA  499



>emb|CAA57724.1| 1-aminocyclopropane-1-carboxylate synthase [Brassica oleracea]
Length=491

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/434 (67%), Positives = 343/434 (79%), Gaps = 1/434 (0%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             L + +Q   +LS++A  DGHGE SAYFDGWKAY+ NPFHP   P GVIQMGLAENQLC D
Sbjct  4     LTAEKQDQNLLSRMAAGDGHGEKSAYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGD  63

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             L++ WVL +P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDR
Sbjct  64    LMRKWVLEHPEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDR  123

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVMSGGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SSN FK+
Sbjct  124   IVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKI  183

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             T  AL++AY+ A+  NI VKGLLI NPSNPLGT LDRD L  +V+F NDK IHL+ DEIY
Sbjct  184   TAEALDAAYENARVSNIPVKGLLITNPSNPLGTTLDRDCLKSLVKFTNDKGIHLIADEIY  243

Query  910   AATVFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCAR  1086
             AAT F + EFIS+A++I E+  CN D IHIVYSLSKD+G PG RVGI+YSYND VV  AR
Sbjct  244   AATTFGESEFISVAEVIDEIPDCNTDLIHIVYSLSKDMGLPGLRVGIVYSYNDRVVQIAR  303

Query  1087  KMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNG  1266
             KMSSFGLVS+QTQHLIA MLSD++FV+ FI +S  RL +RH   T GL  + I  LK+  
Sbjct  304   KMSSFGLVSSQTQHLIAKMLSDEDFVDEFIRKSKLRLAERHAELTTGLDGLSIGWLKAGA  363

Query  1267  GLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDET  1446
             GLF+WM+LRNLLK  TF +E+ELW++I++++KLNVSPG S HC E GWFRVCFANMD +T
Sbjct  364   GLFIWMDLRNLLKTATFDSEMELWRVIVHKVKLNVSPGGSCHCHEPGWFRVCFANMDYQT  423

Query  1447  MRVALMRIRTSVLQ  1488
             M  AL RIR    Q
Sbjct  424   METALERIRVFTSQ  437



>dbj|BAK19925.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=507

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 375/495 (76%), Gaps = 19/495 (4%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  11    EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  70

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  71    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  130

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PGEAFL+P+PYYP F+RDLRWRTGV L P  C S N+FK+T+ AL+SA
Sbjct  131   GASETLLFCLANPGEAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSPNNFKITKAALQSA  190

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  191   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNAKNIHLVCDEIYATTVFNSP  250

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  251   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  310

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IA +LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  311   SSQTQFMIATLLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  370

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  371   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  430

Query  1471  RTSVLQWK-----------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS----  1602
             R+ V + +                   +    K+ R  +++ LSF  R  ED ++S    
Sbjct  431   RSFVTRGRVDNSTMTTTAATTTTTTTTTTTTIKKKRGQMELRLSFNNRRFEDGLMSPHSS  490

Query  1603  --SPHSPMNSPLVQA  1641
               SPHSPM SPLV+A
Sbjct  491   PLSPHSPMQSPLVKA  505



>dbj|BAJ10420.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
 dbj|BAJ10421.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=504

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/492 (62%), Positives = 378/492 (77%), Gaps = 16/492 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  11    EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  70

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  71    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  130

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  131   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  190

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  191   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSP  250

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  251   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  310

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IAA+LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  311   SSQTQFMIAALLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  370

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  371   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  430

Query  1471  RTSVLQWK-------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS------SP  1608
             R+ V + +          A    +    K+ R  +++ LSF  R  ED +IS      SP
Sbjct  431   RSFVTRGRVDNSTMTTTAATTTTTTTTIKKKRGQMELRLSFNNRRFEDGLISPHSSLLSP  490

Query  1609  HSPM-NSPLVQA  1641
             HSPM  SPLV+A
Sbjct  491   HSPMPQSPLVKA  502



>gb|AAA81580.1| 1-aminocyclopropane-1-carboxylate synthase [Solanum lycopersicum]
Length=485

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/429 (67%), Positives = 353/429 (82%), Gaps = 4/429 (1%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             +   ILSK+ATN+ HGENS YFDGWKAYD++PFHP  NP GVIQMGLAENQLC DLI++W
Sbjct  7     KTNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDW  66

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NPK SIC+ +G + FK IA +QDYHGLPEFR A+A+FMEK RG  V+FDP+R+VM+G
Sbjct  67    IKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAG  125

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E + FCL DPG+AFLVP+PYYP F+RDLRWRTGVQL P+ CESSN+FK+T  A+
Sbjct  126   GATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAV  185

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             + AY+ AQ+ NI+VKGL++ NPSNPLGT LD+DTL  ++ F N  NIHLVCDEIYAATVF
Sbjct  186   KEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVF  245

Query  925   SQPEFISIAQIIQEVQ---CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMS  1095
               P+F+SIA+I+ E +   CN D +HIVYSLSKD+G PGFRVGIIYS+ND VV+CARKMS
Sbjct  246   DTPQFVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMS  305

Query  1096  SFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLF  1275
             SFGLVSTQTQ+ +AAM SD++FV+NF+ ES+ RL KRH+ FT GL  VGI+ LK+N GLF
Sbjct  306   SFGLVSTQTQYFLAAMPSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLF  365

Query  1276  VWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRV  1455
              WM+LR LL+E TF +E+ LW++IIN++KLNVS G SF CQE GWFRVCFANMDD T+ +
Sbjct  366   CWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSLGSSFECQEPGWFRVCFANMDDGTVDI  425

Query  1456  ALMRIRTSV  1482
             AL RIR  V
Sbjct  426   ALARIRRFV  434



>ref|XP_010474747.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2 [Camelina 
sativa]
Length=497

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/484 (63%), Positives = 376/484 (78%), Gaps = 16/484 (3%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSKIATN+ HGENS YF+GWKAYD +PFH  HNP G+IQMGLAENQLC DLIK+W+  N
Sbjct  11    ILSKIATNNQHGENSEYFEGWKAYDKDPFHLSHNPHGIIQMGLAENQLCLDLIKDWIKEN  70

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G  +F DIA +QDYHGL +FR A+A FM K RG  V FDP+R+VMSGGATG
Sbjct  71    PEASICTLEGVHQFSDIANFQDYHGLKKFREAIAHFMGKARGGRVTFDPERVVMSGGATG  130

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A+E + FCL DPG+ FL+P+PYY  FDRDLRWRTGV++ PV C SSN+F++T  A+  AY
Sbjct  131   ANETIMFCLADPGDVFLIPSPYYAAFDRDLRWRTGVEIIPVPCSSSNNFRLTVEAVGWAY  190

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             KKAQE N +VKGL++ NPSNPLGT+LD+DTL D+VRFV  KNIHLV DEIYAATVFS   
Sbjct  191   KKAQESNKKVKGLILTNPSNPLGTMLDKDTLKDLVRFVTKKNIHLVVDEIYAATVFSGDN  250

Query  937   FISIAQIIQEV---QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGL  1107
             F+S+A+++ +V   + N D IHIVYSLSKD+G PGFRVGI+YSYND+VVSCARKMSSFGL
Sbjct  251   FVSVAEVVNDVDISEVNVDLIHIVYSLSKDMGLPGFRVGIVYSYNDSVVSCARKMSSFGL  310

Query  1108  VSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMN  1287
             VS+QTQ ++A+MLSD+ FVENF++E+S+RL  RHE FT GL +  I  L S+GGLFVWM+
Sbjct  311   VSSQTQLMLASMLSDERFVENFLMENSKRLGIRHEVFTTGLKKADITCLTSSGGLFVWMD  370

Query  1288  LRNLLKE-PTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALM  1464
             LR+LL++  +F +E+ELW++II+++KLNVSPG SFHC E GWFRVCFANMDD+T+RVAL 
Sbjct  371   LRHLLRDRNSFESEIELWRIIIHKVKLNVSPGSSFHCTEPGWFRVCFANMDDDTLRVALR  430

Query  1465  RIRTSVLQWKGMEaaaaasakkqkqCRRNLK--------VSLSFRRGLEDCM----ISSP  1608
             RI+  V +    +    A+ K Q     N K        + LSFRR  ED +    I SP
Sbjct  431   RIQDFVSKNNNNKIVEKATDKDQVIQNNNAKKQKWRQSNLRLSFRRLYEDGLSSPGIMSP  490

Query  1609  HSPM  1620
             HSP+
Sbjct  491   HSPL  494



>ref|XP_009108182.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 6 [Brassica 
rapa]
 emb|CDX86796.1| BnaA09g21860D [Brassica napus]
Length=488

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/486 (63%), Positives = 367/486 (76%), Gaps = 5/486 (1%)
 Frame = +1

Query  190   LKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFD  369
             L + +Q   +LS++A  DGHGENSAYFDGWKAY+ NPFHP   P GVIQMGLAENQLC D
Sbjct  4     LTAEKQDHNLLSRMAAGDGHGENSAYFDGWKAYEENPFHPIDRPDGVIQMGLAENQLCGD  63

Query  370   LIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDR  549
             L++ WVL +P+ASICT +G  +F DIAI+QDYHGLPEFR AVA+FMEK R + VKFDPDR
Sbjct  64    LMRKWVLEHPEASICTAEGVNQFSDIAIFQDYHGLPEFRQAVAKFMEKTRNNKVKFDPDR  123

Query  550   IVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKV  729
             IVMSGGATGAHE +AFCL +PG+ FLVPTPYYPGFDRDLRWRTGV L PV C SSN FK+
Sbjct  124   IVMSGGATGAHETVAFCLANPGDGFLVPTPYYPGFDRDLRWRTGVNLVPVTCHSSNGFKI  183

Query  730   TRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIY  909
             T  AL++AY+ A+   + VKGLLI NPSNPLGT LDRD L  +V+F NDK IHL+ DEIY
Sbjct  184   TVEALDAAYENAR---VPVKGLLITNPSNPLGTTLDRDCLKSLVKFTNDKGIHLIADEIY  240

Query  910   AATVFSQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCAR  1086
             AAT F + EFIS+A++I+E+  CN D IHIVYSLSKD+G PG R+GIIYSYN+ VV  AR
Sbjct  241   AATTFGESEFISVAEVIEEIPDCNRDLIHIVYSLSKDMGLPGLRIGIIYSYNNRVVQIAR  300

Query  1087  KMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNG  1266
             KMSSFGLVS+QTQHLIA MLSDK+FV+ FI +S  RL +RH   T GL  +GI  LK+  
Sbjct  301   KMSSFGLVSSQTQHLIAKMLSDKDFVDEFIRKSKLRLAERHAELTTGLDGLGIGWLKAGA  360

Query  1267  GLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDET  1446
             GLF+WM+LRNLLK  TF +E+ELW++I++++KLNVSPG S HC E GWFRVCFANMD +T
Sbjct  361   GLFIWMDLRNLLKTATFDSEMELWRVIVHKVKLNVSPGGSCHCHEPGWFRVCFANMDHQT  420

Query  1447  MRVALMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLEDCMISSPHSPMN  1623
             M  AL RIR    Q +           K+K+C + +L++S    R  E+   S       
Sbjct  421   METALERIRVFTSQIEEESLKLTKQMAKKKKCWQSSLRLSFKDTRRFEEGFFSPHSPVPP  480

Query  1624  SPLVQA  1641
             SPLV+A
Sbjct  481   SPLVRA  486



>ref|XP_010669851.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Beta 
vulgaris subsp. vulgaris]
Length=497

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 386/483 (80%), Gaps = 8/483 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LSKIATN+GHGE+  YFDGWKAYDN+P+H   NP GVIQMGLAENQL FDLIK W++ 
Sbjct  14    QLLSKIATNNGHGEDVEYFDGWKAYDNDPYHITKNPNGVIQMGLAENQLSFDLIKEWMVQ  73

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G ++F DIA +QDYHGLPEFR AVA++M K+RGD+V FDP+RIVMSGGAT
Sbjct  74    NPQASICTNEGVDKFTDIANFQDYHGLPEFRHAVAKYMGKMRGDSVSFDPERIVMSGGAT  133

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E L FCL DPG+AFLVP+PYYP F+RDL WRTGV+L P+ CES NDFK+T+ AL SA
Sbjct  134   GANETLIFCLADPGDAFLVPSPYYPAFNRDLGWRTGVKLIPITCESWNDFKITKEALTSA  193

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ AQ  NI++KG++I NPSNPLG V D+DTL  +V FVNDK IHLVCDEIYA TVF+ P
Sbjct  194   YEDAQNKNIKIKGIIITNPSNPLGIVQDKDTLTMLVNFVNDKRIHLVCDEIYAGTVFTLP  253

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
             +F S+A++++++   N D IHI+YSLSKD+G PGFRVGI+YSYND VV+ AR+MSSFGLV
Sbjct  254   KFTSVAEVVKDMSNINLDLIHIIYSLSKDMGMPGFRVGIVYSYNDRVVTTARRMSSFGLV  313

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQH++AAMLSD  FV  F+  + +RL +RH+ FT  LAQVGI+ L SN GLFVWM+L
Sbjct  314   SSQTQHMLAAMLSDDTFVAQFLDTNKQRLSRRHQHFTSELAQVGIKCLNSNAGLFVWMDL  373

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL+E T AAEL+LW++IIN++K+NVSPG SFHC E GWFRVCFANMDD+T+ VAL RI
Sbjct  374   RHLLEEATMAAELKLWRVIINDVKINVSPGSSFHCSEPGWFRVCFANMDDDTVEVALQRI  433

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM-----ISSPHSPM-NSPL  1632
             RT V   K ME     + KK+K+  +  ++S + RR  E  M     + SPHSP+  SPL
Sbjct  434   RTFVSHGK-MEERPKHTLKKRKEQMKLGRLSFNNRRFEESLMSPHNNLVSPHSPIPQSPL  492

Query  1633  VQA  1641
             V+A
Sbjct  493   VKA  495



>dbj|BAJ10410.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/492 (62%), Positives = 377/492 (77%), Gaps = 16/492 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  8     EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  67

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  68    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  127

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  128   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  187

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  188   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSP  247

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  248   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  307

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IAA+LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  308   SSQTQFMIAALLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  367

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  368   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  427

Query  1471  RTSVLQWK-------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS------SP  1608
             R+ V + +          A    +    K+ R  +++ LSF  R  ED +IS      SP
Sbjct  428   RSFVTRGRVDNSTMTTTAATTTTTTTTIKKKRGQMELRLSFNNRRFEDGLISPHSSLLSP  487

Query  1609  HSPM-NSPLVQA  1641
             HSPM  S LV+A
Sbjct  488   HSPMPQSSLVKA  499



>dbj|BAK19924.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus petraeus]
Length=506

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/493 (62%), Positives = 375/493 (76%), Gaps = 18/493 (4%)
 Frame = +1

Query  217   ILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLNN  396
             ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L N
Sbjct  12    ILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLKN  71

Query  397   PKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGATG  576
             P+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGATG
Sbjct  72    PQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGATG  131

Query  577   AHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESAY  756
             A E L FCL +PG+AFL+P+PYYP F RDLRWRTGV L P  C SSN+FK+T+ AL+SAY
Sbjct  132   ASETLLFCLANPGDAFLIPSPYYPAFSRDLRWRTGVNLIPFTCSSSNNFKITKEALQSAY  191

Query  757   KKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQPE  936
             + A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P 
Sbjct  192   EDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSPR  251

Query  937   FISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLVS  1113
             FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLVS
Sbjct  252   FISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLVS  311

Query  1114  TQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNLR  1293
             +QTQ +IAA+LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+LR
Sbjct  312   SQTQFMIAALLSDDDFVGRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDLR  371

Query  1294  NLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRIR  1473
             +LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RIR
Sbjct  372   HLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRIR  431

Query  1474  TSVLQWK---------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS------S  1605
             + V + +                 +    K+ R  +++ LSF  R  ED +IS      S
Sbjct  432   SFVTRGRVDNSTMTTAATTTTTTTTTTTIKKKRGQMELRLSFNNRRFEDGLISPHSSLLS  491

Query  1606  PHSPM-NSPLVQA  1641
             PHSPM  SPLV+A
Sbjct  492   PHSPMPQSPLVKA  504



>emb|CAA75749.1| 1-aminocyclopropane-1-carboxylate synthase [Musa acuminata AAA 
Group]
 gb|AAD00350.1| ACC synthase [Musa acuminata AAA Group]
Length=486

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/481 (63%), Positives = 370/481 (77%), Gaps = 9/481 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             QILS+IATNDGHGENS+YFDGWKAY+ +PFH   NP GVIQMGLAENQL  DLI++W+  
Sbjct  12    QILSRIATNDGHGENSSYFDGWKAYEKDPFHLTDNPTGVIQMGLAENQLSLDLIRDWMKK  71

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  EF+ IA +QDYHGLP FR A+A+FMEKVRG   +FDPDRIVMSGGAT
Sbjct  72    NPQASICTEEGVSEFEAIANFQDYHGLPTFRKAIAQFMEKVRGGRARFDPDRIVMSGGAT  131

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E + FC VDPGE FL+PT YYPGFDRD RWRTGVQL  + C SSN FK+T+ ALE+A
Sbjct  132   GAQETITFCPVDPGEVFLIPTLYYPGFDRDFRWRTGVQLLSIHCHSSNKFKITQAALETA  191

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+KA+  +IRVKG+L+ NPSNPLGT +DR+TL  +V FVN+K +HLVCDEI++ TVF +P
Sbjct  192   YRKARNSHIRVKGILMTNPSNPLGTTMDRETLRTLVSFVNEKRMHLVCDEIFSGTVFDKP  251

Query  934   EFISIAQIIQ-EVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              ++S++++I+ E  C+ D IHI YSLSKDLG PGFRVG+IYS  DAVVSCARKMSSFGLV
Sbjct  252   SYVSVSEVIEDEPYCDRDLIHIAYSLSKDLGVPGFRVGVIYSTTDAVVSCARKMSSFGLV  311

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQHL+A+ML D+EF  +F+  S  RL  R   FT GL +VGI  L  N GLF WM+L
Sbjct  312   SSQTQHLLASMLGDEEFTTSFLATSRTRLCGRRRVFTVGLKRVGIHCLDGNAGLFCWMDL  371

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE T  AEL LW++IIN++KLN+SPG SFHC E GWFRVCFANMDD  M++AL RI
Sbjct  372   RPLLKEATVEAELRLWRVIINDVKLNISPGSSFHCSEPGWFRVCFANMDDTAMKIALRRI  431

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCMISSPH--SPMNSPLVQAT  1644
              + V +    E  AA  AK +++    L++SL  RR  ED  I +PH  SP +SPLVQA 
Sbjct  432   ESFVYR----ENDAAVQAKNKRRWDEALRLSLP-RRRFEDPTIMTPHLMSP-HSPLVQAA  485

Query  1645  N  1647
              
Sbjct  486   T  486



>ref|XP_010512497.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like protein 
1 isoform X1 [Camelina sativa]
Length=490

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/484 (60%), Positives = 366/484 (76%), Gaps = 12/484 (2%)
 Frame = +1

Query  205   QQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNW  384
             Q   +LSK+A+ D HGE S YFDGWKAYDNNP+HP HNPQGVIQMGLAENQLC DLIK+W
Sbjct  4     QGASLLSKLASGDKHGEASPYFDGWKAYDNNPYHPTHNPQGVIQMGLAENQLCSDLIKDW  63

Query  385   VLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSG  564
             +  NP ASICT +G + F DIA++QDYHGL  FR A+A FME+ RG    F+ DR+VMSG
Sbjct  64    IKENPHASICTAEGVDSFSDIAVFQDYHGLKLFRQAIAAFMERARGGRASFEADRVVMSG  123

Query  565   GATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTAL  744
             GATGA+E L FCL DPG+AFLVPTPYY  FDRDLRWRTG+++ PV C SSN+F+VT+ AL
Sbjct  124   GATGANETLMFCLADPGDAFLVPTPYYAAFDRDLRWRTGIRIIPVDCNSSNNFQVTKHAL  183

Query  745   ESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVF  924
             ES Y  +QE  I++KGL++ NPSNPLGT L R+ L  IV F+NDK IHLVCDEIYAATVF
Sbjct  184   ESTYLASQETGIKIKGLILANPSNPLGTTLHREVLETIVNFINDKQIHLVCDEIYAATVF  243

Query  925   SQPEFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSF  1101
             ++P FIS+A+IIQE+   N D IHIVYSLSKD+G PGFRVG++YSYNDAVVSCAR+MSSF
Sbjct  244   TEPGFISVAEIIQEMDHVNRDLIHIVYSLSKDMGLPGFRVGVVYSYNDAVVSCARRMSSF  303

Query  1102  GLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVW  1281
             GLVS+ TQ  +AAMLSD+ FV+NF++E S+R+ KRH  FT GL ++GI  L+SN GLFV 
Sbjct  304   GLVSSHTQSFLAAMLSDQRFVDNFLIEVSKRVAKRHRMFTEGLKEMGISCLRSNAGLFVL  363

Query  1282  MNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVAL  1461
             M+LR +L + TF +E+ LW++II+++K+NVSPG SFHC E GWFRVCFANMD++T++  L
Sbjct  364   MDLRQMLIDQTFESEMALWRVIIDKVKINVSPGSSFHCSEPGWFRVCFANMDEDTLQTGL  423

Query  1462  MRIRTSVLQWKGMEaaaaasakkqkqC--------RRNLKVSLS---FRRGLEDCMISSP  1608
              RI+  VL  +  +       +   +         ++NLK+S S   +        + SP
Sbjct  424   ERIKDFVLGDRANKVNNNCKCRCNNKKENKKRKSFQKNLKLSFSSMMYEEHARSPKLMSP  483

Query  1609  HSPM  1620
             HSP+
Sbjct  484   HSPL  487



>ref|XP_009624213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana 
tomentosiformis]
Length=487

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/446 (66%), Positives = 360/446 (81%), Gaps = 8/446 (2%)
 Frame = +1

Query  184   MDLKSMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLC  363
             M  +S    + +LSK+ATN+ HGENS YFDGWKAYDN+PFH   NP GVIQMGLAENQLC
Sbjct  1     MSSESGNFNSVVLSKLATNEEHGENSPYFDGWKAYDNDPFHLVKNPNGVIQMGLAENQLC  60

Query  364   FDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDP  543
             FDLI+ W++ NPKASICT +G + F+ IA +QDYHGLPEFR A+A+FMEK+R   VKFD 
Sbjct  61    FDLIEEWIMRNPKASICTTEGIKYFRTIANFQDYHGLPEFRKAIAKFMEKIRRGRVKFDA  120

Query  544   DRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDF  723
             DRI+M+GGATGA+E L FCL +PG+AFLVP+PYYPGF+RDL WRT VQL P+ C SSN+F
Sbjct  121   DRILMAGGATGANETLIFCLAEPGDAFLVPSPYYPGFNRDLSWRTRVQLLPIPCNSSNNF  180

Query  724   KVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDE  903
             K+T  A++ AY+KAQ+ N ++KGL++ NPSNPLGT LD+DTL +++ F N  NIHLV DE
Sbjct  181   KITTEAVKEAYEKAQQSNTKIKGLILTNPSNPLGTTLDKDTLKNLLTFTNKHNIHLVSDE  240

Query  904   IYAATVFSQPEFISIAQIIQEV-----QC-NPDRIHIVYSLSKDLGFPGFRVGIIYSYND  1065
             IYAATV+  PEF+SIA+I+ +      QC N D +HIV SLSKD+GFPGFRVGIIYS+ND
Sbjct  241   IYAATVYDSPEFVSIAEIMDDEMDKMDQCFNKDLVHIVNSLSKDMGFPGFRVGIIYSFND  300

Query  1066  AVVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGI  1245
              VVS ARKMSSFGLVSTQTQHL+A MLSD EFV+ F++ESS+RLRKRH+ FT GL +VGI
Sbjct  301   VVVSRARKMSSFGLVSTQTQHLLATMLSDDEFVDKFLVESSKRLRKRHKKFTTGLEEVGI  360

Query  1246  ETLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCF  1425
               LK N GL+ WM+LR LLK+PTF +E+ LWK+IIN+ KLNVSPG SF+C E GWFRVCF
Sbjct  361   NCLKGNAGLYCWMDLRPLLKKPTFDSEMALWKLIINDAKLNVSPGSSFNCPEPGWFRVCF  420

Query  1426  ANMDDETMRVALMRIRTSVLQWKGME  1503
             AN+DD+T+ +AL RI+  VL   G+E
Sbjct  421   ANIDDQTVEIALGRIQ--VLVENGVE  444



>dbj|BAJ10414.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus longicalyx]
Length=501

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/492 (62%), Positives = 377/492 (77%), Gaps = 16/492 (3%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  8     EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  67

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  68    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  127

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  128   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  187

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  188   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSP  247

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  248   RFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  307

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IAA+ SD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  308   SSQTQFMIAALPSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  367

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ VAL RI
Sbjct  368   RHLLDEATVEGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDVALNRI  427

Query  1471  RTSVLQWK-------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS------SP  1608
             R+ V + +          A    +    K+ R  +++ LSF  R  ED +IS      SP
Sbjct  428   RSFVTRGRVDNSTMTTTAATTTTTTTTIKKKRGQMELRLSFNNRRFEDGLISPHSSLLSP  487

Query  1609  HSPM-NSPLVQA  1641
             HSPM  SPLV+A
Sbjct  488   HSPMPQSPLVKA  499



>gb|ABD16181.1| 1-aminocyclopropane-1-carboxylate synthase [Cicer arietinum]
Length=436

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/439 (68%), Positives = 363/439 (83%), Gaps = 8/439 (2%)
 Frame = +1

Query  340   GLAENQLCFDLIKNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVR  519
             GLAENQL  DL++NW+++NP+ASICT +G   FK +A +QDYHGLPEFR AVA+FM + R
Sbjct  1     GLAENQLTADLVQNWIMSNPEASICTLEGVHNFKHMANFQDYHGLPEFRNAVAKFMSRTR  60

Query  520   GDTVKFDPDRIVMSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPV  699
             G+ V FDPDRIVMSGGATGAHE+ AFCL DPG+AFLVPTPYYPGFDRDLRWRTGV+L PV
Sbjct  61    GNRVTFDPDRIVMSGGATGAHEVTAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVKLVPV  120

Query  700   VCESSNDFKVTRTALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDK  879
             +CESSN+FK+TR ALE AY+KA+EDNIR+KGLLI NPSNPLGTV+DR TL  +V F+N K
Sbjct  121   ICESSNNFKLTRQALEEAYEKAKEDNIRIKGLLITNPSNPLGTVMDRTTLRTVVNFINQK  180

Query  880   NIHLVCDEIYAATVFSQPEFISIAQIIQE---VQCNPDRIHIVYSLSKDLGFPGFRVGII  1050
              IHL+ DEIYAATVFS P FIS+A+II++   ++C+ D IHI+YSLSKD+GFPGFRVGII
Sbjct  181   RIHLISDEIYAATVFSHPSFISVAEIIEQDTDIECDRDLIHIIYSLSKDMGFPGFRVGII  240

Query  1051  YSYNDAVVSCARKMSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGL  1230
             YSYND+VV+CARKMSSFGLVSTQTQ+L+  +LSD EFVE F+ ES++RL +R+  FT GL
Sbjct  241   YSYNDSVVNCARKMSSFGLVSTQTQYLMTKVLSDDEFVERFLGESAKRLAQRYRIFTGGL  300

Query  1231  AQVGIETLKSNGGLFVWMNLRNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGW  1410
              +VGI+ L+SNGGLFVWM+LR+LLK+PTF +ELELW++II+E+K+NVSPGCSFHC EAGW
Sbjct  301   VKVGIKCLQSNGGLFVWMDLRDLLKKPTFESELELWRVIIHEVKINVSPGCSFHCSEAGW  360

Query  1411  FRVCFANMDDETMRVALMRIRTSVLQWKGMEaaaaasakkqkqC-RRNLKVSLSFRRGLE  1587
             FRVC+ANMDD  +++AL RIR+ VLQ K  E     S K  K C   NLK+SL  RR  E
Sbjct  361   FRVCYANMDDRALQIALQRIRSFVLQ-KNKE--VMVSDKNSKPCWHSNLKLSLKSRR-FE  416

Query  1588  DCMISSPHSPMNSPLVQAT  1644
             D M+S     + SPLVQAT
Sbjct  417   DIMMSLILQFLQSPLVQAT  435



>ref|XP_010480237.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 2-like 
[Camelina sativa]
Length=497

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/489 (62%), Positives = 376/489 (77%), Gaps = 16/489 (3%)
 Frame = +1

Query  202   RQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKN  381
             R    ILSKIATN+ HGENS YFDGWKAYD  PFH  HNP G+IQMGLAENQLC DLIK+
Sbjct  6     RNSGAILSKIATNNQHGENSEYFDGWKAYDKYPFHLSHNPHGIIQMGLAENQLCLDLIKD  65

Query  382   WVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMS  561
             W+  NP++SICT +G  +F DIA +QDYHGL +FR A+A FM K RG    FDP+R+VMS
Sbjct  66    WIKENPESSICTLEGVHQFSDIANFQDYHGLKKFRQAIAHFMGKARGGRATFDPERVVMS  125

Query  562   GGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTA  741
             GGATGA+E + FCL DPG+ FL+P+PYY  FDRDLRWRTGV++ PV C SSN+F++T  A
Sbjct  126   GGATGANETIMFCLADPGDVFLIPSPYYAAFDRDLRWRTGVEIIPVPCSSSNNFRLTVEA  185

Query  742   LESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATV  921
             +  AYKKAQE N +VKGL++ NPSNPLGT+LD+DTL D+VRFV  KNIHLV +EIYAATV
Sbjct  186   VGWAYKKAQEANKKVKGLILTNPSNPLGTILDKDTLKDLVRFVTKKNIHLVVNEIYAATV  245

Query  922   FSQPEFISIAQIIQEV---QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKM  1092
             FS  +F+S+A+++ +V   + N D IHIVYSLSKD+G PGFRVGI+YSYND+VVSCARK+
Sbjct  246   FSGDDFVSVAEVVNDVDSYEVNVDLIHIVYSLSKDMGLPGFRVGIVYSYNDSVVSCARKI  305

Query  1093  SSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGL  1272
             SSFGLVS+QTQ ++A+MLSD+ FVENF++E+S+RL KRHE FT GL +  I  L S+GGL
Sbjct  306   SSFGLVSSQTQLMLASMLSDERFVENFLMENSKRLGKRHEVFTTGLKKADITCLTSSGGL  365

Query  1273  FVWMNLRNLLKE-PTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETM  1449
             FVWM+LR+LL++  +F +E+ELW++II+++KLNVSPG SFHC E GWFRVCFANMDD+T+
Sbjct  366   FVWMDLRHLLRDRNSFESEIELWRIIIHKVKLNVSPGSSFHCTEPGWFRVCFANMDDDTL  425

Query  1450  RVALMRIRTSVLQWKGMEaaaaasakkqkqCRRNLK--------VSLSFRRGLEDCM---  1596
              VAL RI+  V +    +    A+ K Q     N K        + LSFRR  ED +   
Sbjct  426   HVALRRIQDFVSKNSNNKIVEKATDKDQVIQNNNAKKQKWRQSNLRLSFRRLYEDGLSSP  485

Query  1597  -ISSPHSPM  1620
              I SPHSP+
Sbjct  486   GIMSPHSPL  494



>emb|CAB76930.1| ACC synthase [Citrus sinensis]
Length=403

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/394 (73%), Positives = 343/394 (87%), Gaps = 2/394 (1%)
 Frame = +1

Query  196   SMRQQTQILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLI  375
             ++  Q Q+LSKIA  +GHGE+S YFDGWKA++++P+HP  NP GVIQMGLAEN LC +L+
Sbjct  4     ALSNQEQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAENLLCHELV  63

Query  376   KNWVLNNPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIV  555
             ++W++NNPKASIC+ +G  EFK IA +QDYHGLPEFR AVA+FM KVRG+ V FDPDRIV
Sbjct  64    EDWLMNNPKASICSAEGLNEFKGIANFQDYHGLPEFRNAVAKFMGKVRGNRVTFDPDRIV  123

Query  556   MSGGATGAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTR  735
             MSGGATGAHE +AFCL DPG+AFLVPTPYYPGFDRDLRWRTGVQL PVVC+SSNDFKVT 
Sbjct  124   MSGGATGAHETVAFCLADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDSSNDFKVTM  183

Query  736   TALESAYKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAA  915
              ALE+AY+KAQE NIR+KG+LI NPSNPLGT LDR+TL DIV F+N+KNIHLVCDEIYAA
Sbjct  184   EALEAAYEKAQESNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHLVCDEIYAA  243

Query  916   TVFS-QPEFISIAQII-QEVQCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARK  1089
             TVF+ +  F+SIA+II Q++ CN + IHIVYSLSKD+GFPGFRVGIIYSYND VVSCARK
Sbjct  244   TVFTKESSFVSIAEIIDQDIACNRNLIHIVYSLSKDMGFPGFRVGIIYSYNDQVVSCARK  303

Query  1090  MSSFGLVSTQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGG  1269
             MSSFGLVS+QTQHLIA MLSD +FVE FI ES++R+ +RH++FT GL+QVGI  LKSN G
Sbjct  304   MSSFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKAFTWGLSQVGIGCLKSNAG  363

Query  1270  LFVWMNLRNLLKEPTFAAELELWKMIINEMKLNV  1371
             LF+WM+L +LLKE T+ AE+ LW++IINE+KLNV
Sbjct  364   LFLWMDLHHLLKEQTYEAEMALWQVIINEVKLNV  397



>ref|XP_007139782.1| hypothetical protein PHAVU_008G058400g [Phaseolus vulgaris]
 gb|ESW11776.1| hypothetical protein PHAVU_008G058400g [Phaseolus vulgaris]
Length=483

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/482 (63%), Positives = 367/482 (76%), Gaps = 12/482 (2%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             Q+LS+IATN  HGENS+YFDGWKAY+++P+HP  NPQGVIQMGLAEN L  DLI+ W+L 
Sbjct  9     QLLSEIATNGNHGENSSYFDGWKAYESDPYHPTENPQGVIQMGLAENPLSLDLIQEWILK  68

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NPK SICTP+G + FK IA +QDYHGLPEFR  +A +M KVRG  V+FDPDRIVM GG T
Sbjct  69    NPKGSICTPEGVKWFKYIANFQDYHGLPEFRNGLANYMSKVRGGRVRFDPDRIVMGGGTT  128

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA+E++ FCL + G+AFLVP+PYYP F RDL WRT  +L PV C S N+F VTR ALE A
Sbjct  129   GANELIMFCLANGGDAFLVPSPYYPAFARDLCWRTKARLIPVECYSINNFMVTREALEEA  188

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y KA + NI VKGL+I NPSNPLGT +D++TL  IV F+N+KNIHLVCDEIYA TVF  P
Sbjct  189   YNKAIDANINVKGLIITNPSNPLGTTMDKETLKSIVGFINEKNIHLVCDEIYAGTVFRGP  248

Query  934   EFISIAQIIQEVQ-CNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              F+S+++++QE++ CN D IHIVYSLSKDLG PG RVGI+YSYND VV+  RKMSSFGLV
Sbjct  249   RFVSVSEVMQELEHCNKDLIHIVYSLSKDLGIPGLRVGIVYSYNDEVVNQGRKMSSFGLV  308

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             STQTQ  +AA+LSD EFVE F+ ES+ RL  R+  FT+ L +V I  L SN GLF WMNL
Sbjct  309   STQTQFFVAALLSDDEFVERFLAESARRLAARYNHFTKELEKVNITCLPSNAGLFFWMNL  368

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R LLKE TF  E+ LW +IINE+KLNVSPG +F+C E GW+RVCFANMDDET+ VAL RI
Sbjct  369   RGLLKEKTFEGEMMLWHVIINEVKLNVSPGSAFNCSEPGWYRVCFANMDDETVEVALKRI  428

Query  1471  RTSVLQWKGMEaaaaasakkqkqCRRNLKVSLSFRRGLEDCM---ISSPHSPM-NSPLVQ  1638
             R  V +  G          + K+ + NL++S S RR  E+ M   + SPHSPM +SPLV+
Sbjct  429   RAFVGKETG-------KPVELKRWKSNLRLSFSSRRFDENVMSPHMLSPHSPMPHSPLVR  481

Query  1639  AT  1644
             AT
Sbjct  482   AT  483



>dbj|BAJ10405.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
 dbj|BAJ10419.1| 1-aminocyclopropane-1-carboxylate synthase [Dianthus caryophyllus]
Length=512

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/500 (60%), Positives = 377/500 (75%), Gaps = 24/500 (5%)
 Frame = +1

Query  214   QILSKIATNDGHGENSAYFDGWKAYDNNPFHPKHNPQGVIQMGLAENQLCFDLIKNWVLN  393
             +ILSKIATNDGHGEN  YFDGWKAYD +P+H   N  GVIQMGLAENQLCFDL+  W+L 
Sbjct  11    EILSKIATNDGHGENLEYFDGWKAYDRDPYHSTKNSNGVIQMGLAENQLCFDLVTEWLLK  70

Query  394   NPKASICTPQGAEEFKDIAIYQDYHGLPEFRTAVARFMEKVRGDTVKFDPDRIVMSGGAT  573
             NP+ASICT +G  +F DIAI+QDYHGLPEFR+AVA+FM K R + V F+PDRIVMSGGAT
Sbjct  71    NPQASICTNEGVNKFMDIAIFQDYHGLPEFRSAVAKFMGKARDEKVIFNPDRIVMSGGAT  130

Query  574   GAHEILAFCLVDPGEAFLVPTPYYPGFDRDLRWRTGVQLYPVVCESSNDFKVTRTALESA  753
             GA E L FCL +PG+AFL+P+PYYP F+RDLRWRTGV L P  C SSN+FK+T+ AL+SA
Sbjct  131   GASETLLFCLANPGDAFLIPSPYYPAFNRDLRWRTGVNLIPFTCSSSNNFKITKEALQSA  190

Query  754   YKKAQEDNIRVKGLLINNPSNPLGTVLDRDTLHDIVRFVNDKNIHLVCDEIYAATVFSQP  933
             Y+ A + NI+VKG+++ NPSNPLGTVLD+DTL  ++ FVN KNIHLVCDEIYA TVF+ P
Sbjct  191   YEDALKKNIKVKGIIVTNPSNPLGTVLDKDTLKMLLTFVNVKNIHLVCDEIYATTVFNSP  250

Query  934   EFISIAQIIQEV-QCNPDRIHIVYSLSKDLGFPGFRVGIIYSYNDAVVSCARKMSSFGLV  1110
              FIS+A++I+++   N D +HI+YSLSKD+G PGFRVGIIYSYND VVS AR+MSSFGLV
Sbjct  251   SFISVAEVIKDMPHVNQDLVHILYSLSKDMGMPGFRVGIIYSYNDRVVSTARRMSSFGLV  310

Query  1111  STQTQHLIAAMLSDKEFVENFILESSERLRKRHESFTRGLAQVGIETLKSNGGLFVWMNL  1290
             S+QTQ +IAA+LSD +FV  F++ES +RL +RH+ FT  LA++GI  L+ N  LFVWM+L
Sbjct  311   SSQTQFMIAALLSDDDFVRRFLVESRDRLFRRHQHFTSELAKIGIGCLQGNAALFVWMDL  370

Query  1291  RNLLKEPTFAAELELWKMIINEMKLNVSPGCSFHCQEAGWFRVCFANMDDETMRVALMRI  1470
             R+LL E T   EL+LW++IINE+K+NVSPG SF C E GWFRVCFANMD+ T+ +AL RI
Sbjct  371   RHLLDEATVKGELKLWRVIINEVKINVSPGSSFLCSEPGWFRVCFANMDNATLDIALNRI  430

Query  1471  RTSVLQWK---------------GMEaaaaasakkqkqCRRNLKVSLSF-RRGLEDCMIS  1602
             R+ V + +                       +    K+ R  +++ LSF  R  ED ++S
Sbjct  431   RSFVTRGRVDNSTMTTTTTAAATTTTTTTTTTTTTIKKKRGQMELRLSFNNRRFEDGLMS  490

Query  1603  ------SPHSPM-NSPLVQA  1641
                   SPHSPM  SPLV+A
Sbjct  491   PHSSLLSPHSPMPQSPLVKA  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6291085858308