BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22958_g1_i1 len=396 path=[6791:0-13 @6836@!:14-369 52:370-395]

Length=396
                                                                      Score     E

ref|XP_009625156.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   1e-56   
ref|XP_009625154.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   1e-56   
ref|XP_009625153.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   2e-56   
ref|XP_009625152.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   2e-56   
ref|XP_009625151.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   3e-56   
ref|XP_009799801.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    197   4e-56   
ref|XP_006345181.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      196   7e-56   
ref|XP_009799807.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    194   3e-55   
ref|XP_009799792.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    194   6e-55   
emb|CDP16996.1|  unnamed protein product                                189   2e-53   
emb|CAN83148.1|  hypothetical protein VITISV_031934                     182   1e-51   Vitis vinifera
ref|XP_011008330.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    183   4e-51   
ref|XP_011008329.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    183   4e-51   
gb|KDO35993.1|  hypothetical protein CISIN_1g027682mg                   171   1e-50   
ref|XP_010663217.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      181   2e-50   
emb|CBI15090.3|  unnamed protein product                                181   4e-50   
ref|XP_002318632.2|  hypothetical protein POPTR_0012s07760g             180   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_008239708.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      179   9e-50   
ref|XP_007210354.1|  hypothetical protein PRUPE_ppa001642mg             178   2e-49   
ref|XP_010928215.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      177   3e-49   
gb|KCW83403.1|  hypothetical protein EUGRSUZ_B00338                     177   4e-49   
gb|KDP31153.1|  hypothetical protein JCGZ_11529                         176   8e-49   
gb|KCW83402.1|  hypothetical protein EUGRSUZ_B00338                     176   1e-48   
ref|XP_010027879.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    176   2e-48   
ref|XP_010027872.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    176   2e-48   
ref|XP_008793800.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      176   2e-48   
ref|XP_011087174.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      177   2e-48   
ref|XP_006476679.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      175   3e-48   
gb|KHG03421.1|  Alpha-N-acetylglucosaminidase                           174   5e-48   
ref|XP_002517786.1|  alpha-n-acetylglucosaminidase, putative            163   6e-48   Ricinus communis
ref|XP_010112589.1|  hypothetical protein L484_010094                   173   2e-47   
ref|XP_006439737.1|  hypothetical protein CICLE_v10018883mg             171   3e-47   
ref|XP_006439736.1|  hypothetical protein CICLE_v10018883mg             171   3e-47   
ref|XP_007036096.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    172   3e-47   
ref|XP_006439738.1|  hypothetical protein CICLE_v10018883mg             171   6e-47   
ref|XP_002511461.1|  alpha-n-acetylglucosaminidase, putative            169   3e-46   Ricinus communis
ref|XP_003580702.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    167   2e-45   
ref|XP_008393078.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    167   2e-45   
ref|XP_008393079.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    167   2e-45   
ref|XP_004301281.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      167   3e-45   
ref|XP_003599415.1|  Alpha-N-acetylglucosaminidase                      164   4e-45   
ref|XP_008231468.1|  PREDICTED: alpha-N-acetylglucosaminidase           166   7e-45   
ref|XP_004499942.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      165   1e-44   
gb|AES69667.2|  alpha-N-acetylglucosaminidase family protein            165   1e-44   
ref|XP_003599416.1|  Alpha-N-acetylglucosaminidase                      165   1e-44   
dbj|BAK03902.1|  predicted protein                                      165   1e-44   
dbj|BAK07078.1|  predicted protein                                      165   1e-44   
gb|AES69665.2|  alpha-N-acetylglucosaminidase family protein            165   1e-44   
ref|XP_003599414.1|  Alpha-N-acetylglucosaminidase                      165   2e-44   
ref|XP_002314048.1|  hypothetical protein POPTR_0009s06320g             164   4e-44   Populus trichocarpa [western balsam poplar]
gb|KHN19339.1|  Alpha-N-acetylglucosaminidase                           160   5e-44   
ref|XP_007148898.1|  hypothetical protein PHAVU_005G023300g             163   5e-44   
ref|XP_007218923.1|  hypothetical protein PRUPE_ppa001555mg             163   5e-44   
ref|XP_007148897.1|  hypothetical protein PHAVU_005G023300g             163   5e-44   
ref|XP_010257138.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    163   5e-44   
ref|XP_006581937.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    163   8e-44   
gb|KGN63613.1|  hypothetical protein Csa_1G005740                       159   2e-43   
ref|XP_008375270.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      157   4e-43   
ref|XP_008356744.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    157   4e-43   
ref|XP_008356745.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    155   5e-43   
ref|XP_008453133.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      160   5e-43   
ref|XP_008461320.1|  PREDICTED: alpha-N-acetylglucosaminidase           160   6e-43   
ref|XP_004135943.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      160   7e-43   
gb|KGN45103.1|  hypothetical protein Csa_7G425950                       160   7e-43   
gb|KHM99190.1|  Alpha-N-acetylglucosaminidase                           160   8e-43   
ref|XP_004138287.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      160   8e-43   
ref|XP_003535842.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    160   8e-43   
ref|XP_011025477.1|  PREDICTED: alpha-N-acetylglucosaminidase           160   1e-42   
ref|XP_011087998.1|  PREDICTED: alpha-N-acetylglucosaminidase           159   1e-42   
ref|XP_007052478.1|  Alpha-N-acetylglucosaminidase family / NAGLU...    159   1e-42   
gb|EPS69705.1|  hypothetical protein M569_05058                         153   1e-42   
ref|XP_006653830.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      159   2e-42   
gb|KDO83338.1|  hypothetical protein CISIN_1g003545mg                   159   2e-42   
ref|XP_009368036.1|  PREDICTED: alpha-N-acetylglucosaminidase           159   2e-42   
ref|XP_006345419.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      158   3e-42   
ref|XP_004977055.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      158   4e-42   
ref|XP_006581936.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    158   4e-42   
ref|XP_006438966.1|  hypothetical protein CICLE_v10030724mg             158   4e-42   
ref|XP_006851078.1|  hypothetical protein AMTR_s00025p00242240          158   4e-42   
ref|XP_006482916.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      158   4e-42   
gb|EEC78143.1|  hypothetical protein OsI_17702                          158   5e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_002273084.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    158   5e-42   Vitis vinifera
gb|EYU27032.1|  hypothetical protein MIMGU_mgv1a001508mg                158   5e-42   
emb|CBI24942.3|  unnamed protein product                                157   8e-42   
ref|XP_009611357.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...    157   1e-41   
ref|XP_010694988.1|  PREDICTED: alpha-N-acetylglucosaminidase           157   1e-41   
gb|KHG14952.1|  Alpha-N-acetylglucosaminidase                           157   1e-41   
gb|KDP43563.1|  hypothetical protein JCGZ_16850                         156   2e-41   
tpg|DAA35664.1|  TPA: hypothetical protein ZEAMMB73_337226              155   3e-41   
ref|XP_009758541.1|  PREDICTED: alpha-N-acetylglucosaminidase           155   5e-41   
ref|XP_010097439.1|  hypothetical protein L484_004673                   155   5e-41   
tpg|DAA35665.1|  TPA: hypothetical protein ZEAMMB73_337226              156   6e-41   
gb|EEE61812.1|  hypothetical protein OsJ_16433                          155   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004307226.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      153   3e-40   
ref|XP_010067843.1|  PREDICTED: alpha-N-acetylglucosaminidase           153   3e-40   
emb|CAE04506.2|  OSJNBb0059K02.16                                       153   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010324687.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    152   4e-40   
gb|EEE59081.1|  hypothetical protein OsJ_10898                          152   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667109.1|  PREDICTED: uncharacterized protein LOC100192...    152   5e-40   
emb|CAA77084.1|  alpha-N-acetylglucosaminidase                          152   6e-40   Nicotiana tabacum [American tobacco]
emb|CDP19299.1|  unnamed protein product                                150   2e-39   
ref|XP_010534240.1|  PREDICTED: alpha-N-acetylglucosaminidase           150   3e-39   
ref|XP_010938527.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    147   4e-39   
ref|XP_009391536.1|  PREDICTED: alpha-N-acetylglucosaminidase           149   6e-39   
ref|XP_008660142.1|  PREDICTED: alpha-N-acetylglucosaminidase           149   6e-39   
gb|EEC75285.1|  hypothetical protein OsI_11626                          149   7e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_001782392.1|  predicted protein                                  149   8e-39   
gb|KFK25597.1|  hypothetical protein AALP_AA8G134900                    144   1e-38   
ref|XP_010938526.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    148   1e-38   
emb|CAJ86183.1|  H0212B02.15                                            147   2e-38   Oryza sativa [red rice]
ref|XP_008802642.1|  PREDICTED: alpha-N-acetylglucosaminidase           148   2e-38   
ref|XP_010492144.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      148   2e-38   
ref|XP_007138123.1|  hypothetical protein PHAVU_009G182100g             147   2e-38   
ref|XP_003557830.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    146   8e-38   
ref|XP_006287089.1|  hypothetical protein CARUB_v10000251mg             146   9e-38   
ref|XP_010453461.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    145   1e-37   
gb|KFK25594.1|  hypothetical protein AALP_AA8G134900                    145   1e-37   
ref|XP_010453460.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...    145   1e-37   
ref|XP_002465249.1|  hypothetical protein SORBIDRAFT_01g034960          145   2e-37   Sorghum bicolor [broomcorn]
ref|XP_004502129.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      144   7e-37   
ref|XP_006399864.1|  hypothetical protein EUTSA_v100127271mg            140   8e-37   
ref|NP_196873.1|  alpha-N-acetylglucosaminidase                         143   1e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91103.1|  BnaC02g04940D                                          141   5e-36   
emb|CDX85632.1|  BnaA02g01810D                                          140   2e-35   
ref|XP_002871580.1|  alpha-N-acetylglucosaminidase family               139   2e-35   
ref|XP_009125936.1|  PREDICTED: alpha-N-acetylglucosaminidase           139   3e-35   
ref|XP_006651392.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      138   6e-35   
ref|XP_010324692.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    133   3e-33   
ref|XP_010092738.1|  hypothetical protein L484_024633                   129   3e-33   
gb|EMT10178.1|  hypothetical protein F775_30738                         132   1e-32   
ref|XP_006856885.1|  hypothetical protein AMTR_s00055p00202230          130   2e-32   
ref|XP_002974994.1|  hypothetical protein SELMODRAFT_102402             130   5e-32   
gb|KEH35072.1|  alpha-N-acetylglucosaminidase family protein            129   1e-31   
ref|XP_002977411.1|  hypothetical protein SELMODRAFT_107285             129   1e-31   
gb|AES69666.2|  alpha-N-acetylglucosaminidase family protein            121   4e-29   
gb|KEH33252.1|  alpha-N-acetylglucosaminidase family protein            121   5e-29   
ref|XP_010659443.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...    120   7e-29   
ref|XP_009420949.1|  PREDICTED: alpha-N-acetylglucosaminidase-like      114   4e-28   
gb|EMS50400.1|  hypothetical protein TRIUR3_11279                       119   4e-28   
gb|EMT10385.1|  hypothetical protein F775_10757                         107   6e-24   
gb|EMS67905.1|  hypothetical protein TRIUR3_00413                       107   7e-24   
gb|KCW51927.1|  hypothetical protein EUGRSUZ_J01382                   89.7    4e-20   
gb|KCW51928.1|  hypothetical protein EUGRSUZ_J01382                   90.1    6e-20   
ref|XP_002503216.1|  GH family 89 protein                             79.7    3e-14   Micromonas commoda
ref|XP_005645139.1|  hypothetical protein COCSUDRAFT_37819            78.6    5e-14   
ref|XP_004347190.1|  AlphaN-acetylglucosaminidase (NAGLU)             67.4    4e-10   
gb|EYU29516.1|  hypothetical protein MIMGU_mgv1a0184371mg             64.7    6e-10   
ref|XP_010027888.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  62.4    2e-08   
ref|WP_030563824.1|  alpha-N-acetylglucosaminidase                    62.0    2e-08   
ref|XP_008798054.1|  PREDICTED: uncharacterized protein LOC103713067  57.8    5e-08   
ref|WP_037661705.1|  alpha-N-acetylglucosaminidase                    60.5    8e-08   
ref|WP_030360990.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      60.1    1e-07   
ref|WP_030687294.1|  alpha-N-acetylglucosaminidase                    58.9    2e-07   
ref|WP_031069576.1|  alpha-N-acetylglucosaminidase                    58.5    3e-07   
ref|WP_030786822.1|  alpha-N-acetylglucosaminidase                    58.2    5e-07   
ref|WP_010987390.1|  alpha-N-acetylglucosaminidase                    57.8    5e-07   
ref|WP_028433739.1|  alpha-N-acetylglucosaminidase                    57.8    6e-07   
ref|WP_009328151.1|  Tat pathway signal sequence domain protein       57.8    6e-07   
ref|WP_019545934.1|  hypothetical protein                             57.4    7e-07   
ref|XP_004987699.1|  alpha-N-acetylglucosaminidase                    57.0    8e-07   
ref|WP_016906832.1|  hypothetical protein                             57.0    1e-06   
gb|KHN16294.1|  hypothetical protein glysoja_030269                   53.1    2e-06   
ref|WP_030570988.1|  alpha-N-acetylglucosaminidase                    55.5    3e-06   
ref|WP_037793649.1|  alpha-N-acetylglucosaminidase                    55.1    4e-06   
ref|WP_028811329.1|  alpha-N-acetylglucosaminidase                    55.1    4e-06   
ref|WP_031508536.1|  alpha-N-acetylglucosaminidase                    55.1    5e-06   
ref|XP_005105870.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    54.3    6e-06   
ref|WP_037975346.1|  alpha-N-acetylglucosaminidase                    54.7    6e-06   
gb|KCW66077.1|  hypothetical protein EUGRSUZ_G03358                   54.3    6e-06   
ref|WP_013992396.1|  alpha-N-acetylglucosaminidase                    54.3    7e-06   
gb|KCW66076.1|  hypothetical protein EUGRSUZ_G03358                   54.3    8e-06   
ref|WP_037838998.1|  alpha-N-acetylglucosaminidase                    54.3    8e-06   
ref|WP_037834967.1|  alpha-N-acetylglucosaminidase                    54.3    8e-06   
ref|WP_033230387.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      54.3    8e-06   
gb|EPD95541.1|  hypothetical protein HMPREF1486_01738                 54.3    9e-06   
ref|XP_005105869.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    53.9    9e-06   
ref|WP_030838665.1|  alpha-N-acetylglucosaminidase                    53.9    1e-05   
ref|WP_029711569.1|  hypothetical protein                             53.1    2e-05   
ref|WP_018530625.1|  alpha-N-acetylglucosaminidase                    53.1    2e-05   
ref|WP_022218286.1|  putative uncharacterized protein                 52.8    2e-05   
ref|XP_003703688.1|  PREDICTED: alpha-N-acetylglucosaminidase         52.8    2e-05   
ref|WP_030382558.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      52.8    2e-05   
gb|EPH41927.1|  hypothetical protein STRAU_5027                       52.8    2e-05   
ref|XP_004209763.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    51.2    2e-05   
ref|WP_006137864.1|  alpha-N-acetylglucosaminidase                    52.8    2e-05   
ref|WP_030083639.1|  alpha-N-acetylglucosaminidase                    52.8    2e-05   
ref|XP_001081442.1|  PREDICTED: alpha-N-acetylglucosaminidase         52.8    2e-05   Rattus norvegicus [brown rat]
ref|XP_001865888.1|  alpha-N-acetyl glucosaminidase                   52.8    2e-05   Culex quinquefasciatus
ref|XP_004342502.1|  alpha-N-acetylglucosaminidase family protein     52.4    3e-05   
ref|WP_006606025.1|  alpha-N-acetylglucosaminidase                    52.4    3e-05   
ref|XP_001656341.1|  alpha-n-acetylglucosaminidase                    52.0    3e-05   Aedes aegypti
ref|WP_033527443.1|  alpha-N-acetylglucosaminidase                    52.4    3e-05   
ref|WP_037792352.1|  alpha-N-acetylglucosaminidase                    52.0    3e-05   
ref|WP_027759705.1|  alpha-N-acetylglucosaminidase                    52.0    4e-05   
ref|WP_019358703.1|  hypothetical protein                             52.0    4e-05   
ref|XP_008191832.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  52.0    4e-05   
ref|XP_973259.1|  PREDICTED: alpha-N-acetylglucosaminidase isofor...  52.0    4e-05   Tribolium castaneum [rust-red flour beetle]
ref|WP_030875804.1|  alpha-N-acetylglucosaminidase                    52.0    5e-05   
ref|WP_030990729.1|  alpha-N-acetylglucosaminidase                    52.0    5e-05   
ref|WP_030892161.1|  MULTISPECIES: alpha-N-acetylglucosaminidase      52.0    5e-05   
ref|WP_030813691.1|  alpha-N-acetylglucosaminidase                    51.6    5e-05   
ref|XP_006963236.1|  glycoside hydrolase family 89                    51.6    6e-05   
ref|XP_008436404.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  51.6    6e-05   
ref|XP_007558657.1|  PREDICTED: alpha-N-acetylglucosaminidase-lik...  51.6    6e-05   
ref|WP_037693934.1|  alpha-N-acetylglucosaminidase                    51.6    6e-05   
ref|WP_037965046.1|  alpha-N-acetylglucosaminidase                    51.6    6e-05   
emb|CDR10964.1|  alpha-N-acetylglucosaminidase                        51.2    7e-05   
ref|WP_009718529.1|  putative alpha-N-acetylglucosaminidase           51.2    7e-05   
ref|XP_008436403.1|  PREDICTED: alpha-N-acetylglucosaminidase iso...  51.2    7e-05   
ref|WP_030617766.1|  alpha-N-acetylglucosaminidase                    50.8    1e-04   
ref|WP_033270781.1|  alpha-N-acetylglucosaminidase                    50.8    1e-04   
gb|KDR09306.1|  Alpha-N-acetylglucosaminidase                         50.8    1e-04   
ref|WP_005929485.1|  hypothetical protein                             50.8    1e-04   
ref|XP_003786703.1|  PREDICTED: alpha-N-acetylglucosaminidase         50.4    1e-04   
ref|WP_005478435.1|  alpha-N-acetylglucosaminidase                    50.4    1e-04   
ref|WP_006349657.1|  alpha-N-acetylglucosaminidase                    50.4    1e-04   
ref|WP_027770937.1|  alpha-N-acetylglucosaminidase                    50.4    1e-04   
ref|XP_004571517.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    50.4    1e-04   
gb|KDS13673.1|  alpha-N-acetylglucosaminidase (NAGLU) C-terminal ...  50.1    2e-04   
ref|WP_032846413.1|  alpha-N-acetylglucosaminidase                    50.1    2e-04   
ref|XP_003743422.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    50.1    2e-04   
ref|WP_020871947.1|  alpha-N-acetylglucosaminidase                    50.1    2e-04   
ref|XP_005950306.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    49.7    2e-04   
ref|WP_014060136.1|  alpha-N-acetylglucosaminidase                    50.1    2e-04   
gb|EFN61518.1|  Alpha-N-acetylglucosaminidase                         49.7    2e-04   
ref|WP_025835426.1|  alpha-N-acetylglucosaminidase                    49.7    2e-04   
ref|XP_005471266.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    49.7    2e-04   
ref|WP_010802636.1|  MULTISPECIES: hypothetical protein               49.7    2e-04   
gb|EDM06080.1|  rCG33377, isoform CRA_c                               48.5    2e-04   
ref|XP_007424968.1|  PREDICTED: alpha-N-acetylglucosaminidase         49.3    2e-04   
ref|XP_003978574.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    49.3    3e-04   
ref|XP_005369092.1|  PREDICTED: alpha-N-acetylglucosaminidase         49.3    3e-04   
ref|XP_010384417.1|  PREDICTED: alpha-N-acetylglucosaminidase         49.3    3e-04   
ref|WP_031231858.1|  alpha-N-acetylglucosaminidase                    49.3    3e-04   
ref|XP_003733088.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  49.3    3e-04   
ref|XP_002827555.2|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    3e-04   
ref|NP_000254.2|  alpha-N-acetylglucosaminidase precursor             48.9    3e-04   Homo sapiens [man]
gb|AAC50512.1|  alpha-N-acetylglucosaminidase                         48.9    3e-04   Homo sapiens [man]
ref|XP_005584302.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    3e-04   
ref|XP_004041658.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    3e-04   
ref|XP_003913130.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    3e-04   
ref|XP_523654.2|  PREDICTED: alpha-N-acetylglucosaminidase            48.9    3e-04   Pan troglodytes
ref|XP_009859446.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    4e-04   
ref|XP_003279518.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  48.9    4e-04   
ref|XP_008010821.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    4e-04   
ref|XP_006092419.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-N-acet...  48.9    4e-04   
ref|WP_007658406.1|  hypothetical protein                             48.9    4e-04   
gb|ETE58649.1|  Alpha-N-acetylglucosaminidase                         48.9    4e-04   
ref|XP_010899528.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.9    4e-04   
gb|EST22032.1|  hypothetical protein M877_30740                       48.9    4e-04   
ref|WP_030548616.1|  alpha-N-acetylglucosaminidase                    48.9    4e-04   
gb|AAB88084.1|  Naglu                                                 48.9    4e-04   Mus musculus [mouse]
ref|NP_038820.2|  alpha-N-acetylglucosaminidase precursor             48.9    4e-04   Mus musculus [mouse]
ref|XP_006801729.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    48.5    4e-04   
ref|WP_018850517.1|  hypothetical protein                             48.9    4e-04   
ref|WP_003960263.1|  alpha-N-acetylglucosaminidase                    48.9    4e-04   
ref|XP_005111892.1|  PREDICTED: alpha-N-acetylglucosaminidase-like    48.5    5e-04   
ref|XP_002719212.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.5    5e-04   Oryctolagus cuniculus [domestic rabbit]
ref|WP_021935997.1|  uncharacterized protein                          48.5    5e-04   
gb|KFM79407.1|  Alpha-N-acetylglucosaminidase                         48.5    5e-04   
ref|WP_030364590.1|  alpha-N-acetylglucosaminidase                    48.5    5e-04   
ref|XP_001095618.2|  PREDICTED: alpha-N-acetylglucosaminidase-like    48.5    5e-04   Macaca mulatta [rhesus macaque]
ref|WP_021967035.1|  putative uncharacterized protein                 48.5    5e-04   
ref|XP_007955960.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.5    5e-04   
gb|KDS88797.1|  alpha-N-acetylglucosaminidase                         48.5    5e-04   
ref|WP_022393136.1|  putative uncharacterized protein                 48.5    6e-04   
ref|XP_008312357.1|  PREDICTED: alpha-N-acetylglucosaminidase         48.1    6e-04   
ref|WP_002558416.1|  hypothetical protein                             48.1    7e-04   
emb|CDQ63621.1|  unnamed protein product                              48.1    7e-04   
ref|WP_014180311.1|  alpha-N-acetylglucosaminidase                    48.1    7e-04   
ref|XP_006901783.1|  PREDICTED: alpha-N-acetylglucosaminidase         47.8    8e-04   
ref|XP_688608.3|  PREDICTED: alpha-N-acetylglucosaminidase            47.8    8e-04   Danio rerio [leopard danio]
ref|XP_001638539.1|  predicted protein                                47.8    0.001   Nematostella vectensis



>ref|XP_009625156.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X5 [Nicotiana 
tomentosiformis]
Length=634

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH SSF+F +IPKE C G++CF I+NHP   + GS EIL+SGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPGSAREGSPEILVSGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISWSKTGG QL SVP PGSLP VQDAG++VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDAGVVVKRPVPWSYYQNAVTSS  171



>ref|XP_009625154.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X4 [Nicotiana 
tomentosiformis]
Length=647

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH SSF+F +IPKE C G++CF I+NHP   + GS EIL+SGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPGSAREGSPEILVSGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISWSKTGG QL SVP PGSLP VQDAG++VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDAGVVVKRPVPWSYYQNAVTSS  171



>ref|XP_009625153.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Nicotiana 
tomentosiformis]
Length=734

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH SSF+F +IPKE C G++CF I+NHP   + GS EIL+SGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPGSAREGSPEILVSGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISWSKTGG QL SVP PGSLP VQDAG++VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDAGVVVKRPVPWSYYQNAVTSS  171



>ref|XP_009625152.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=824

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH SSF+F +IPKE C G++CF I+NHP   + GS EIL+SGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPGSAREGSPEILVSGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISWSKTGG QL SVP PGSLP VQDAG++VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDAGVVVKRPVPWSYYQNAVTSS  171



>ref|XP_009625151.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=832

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH SSF+F +IPKE C G++CF I+NHP   + GS EIL+SGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSSFEFHVIPKEHCGGESCFTISNHPGSAREGSPEILVSGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISWSKTGG QL SVP PGSLP VQDAG++VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWSKTGGAQLASVPNPGSLPAVQDAGVVVKRPVPWSYYQNAVTSS  171



>ref|XP_009799801.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Nicotiana 
sylvestris]
Length=814

 Score =   197 bits (500),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH S+F+F II K+ CDG+ CF I+NHP   + GS EILISGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSTFEFHIITKDHCDGEFCFNISNHPGSAREGSPEILISGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL SVP PGSLP VQDAGI+VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWIKTGGAQLASVPYPGSLPAVQDAGIVVKRPVPWSYYQNAVTSS  171



>ref|XP_006345181.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum tuberosum]
Length=819

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH SSF F IIPKE C G+ CF I+NHP L + GS EILI GTTAV++LSG
Sbjct  55   YGVLNRLIPSHFSSFQFHIIPKEHCGGEFCFNISNHPGLARDGSPEILIRGTTAVDILSG  114

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +HWYLKYWCGAHISWSKTGG QL SVP PGSLP VQDAG++VKRP+PWSYYQNAV+SS
Sbjct  115  VHWYLKYWCGAHISWSKTGGAQLASVPDPGSLPAVQDAGVLVKRPVPWSYYQNAVTSS  172



>ref|XP_009799807.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Nicotiana 
sylvestris]
Length=734

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH S+F+F II K+ CDG+ CF I+NHP   + GS EILISGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSTFEFHIITKDHCDGEFCFNISNHPGSAREGSPEILISGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL SVP PGSLP VQDAGI+VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWIKTGGAQLASVPYPGSLPAVQDAGIVVKRPVPWSYYQNAVTSS  171



>ref|XP_009799792.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Nicotiana 
sylvestris]
Length=822

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRLI SH S+F+F II K+ CDG+ CF I+NHP   + GS EILISGTTAVE+LSG
Sbjct  54   YGVLNRLIPSHFSTFEFHIITKDHCDGEFCFNISNHPGSAREGSPEILISGTTAVEILSG  113

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL SVP PGSLP VQDAGI+VKRP+PWSYYQNAV+SS
Sbjct  114  LHWYLKYWCGAHISWIKTGGAQLASVPYPGSLPAVQDAGIVVKRPVPWSYYQNAVTSS  171



>emb|CDP16996.1| unnamed protein product [Coffea canephora]
Length=842

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VLNRL  SHSSSF+F IIPKE C G+ CFKI+NHPS    G  EILISGTT VEL +G
Sbjct  55   YGVLNRLFPSHSSSFEFKIIPKEHCGGELCFKISNHPSFRYNGYPEILISGTTGVELAAG  114

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL SVPK GSLP VQ AG+ ++RP+PWSYYQNAV+SS
Sbjct  115  LHWYLKYWCGAHISWMKTGGAQLASVPKAGSLPQVQHAGVEIRRPVPWSYYQNAVTSS  172



>emb|CAN83148.1| hypothetical protein VITISV_031934 [Vitis vinifera]
Length=562

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VL+RL+ SHSSSF+F I+ KEQC GD+CF I+NHPS +  G+ EILI+G T VE+++G
Sbjct  53   YGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPSSSGHGAPEILITGVTGVEIMAG  112

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCG+HISW KTGG QL SVP  GS PHVQ+AGI+++RPIPW+YYQNAV+SS
Sbjct  113  LHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPHVQEAGILIQRPIPWNYYQNAVTSS  170



>ref|XP_011008330.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Populus 
euphratica]
Length=812

 Score =   183 bits (464),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSF+F I+ KEQC G++CF I NHPS  + G+ +ILISG T VE+L GL
Sbjct  57   GVLQRLLPSHSSSFEFRIVSKEQCGGESCFIIKNHPSFTRRGAPQILISGVTGVEVLFGL  116

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG+HISW KTGGVQL S+PK GSLP +QD GI+V+RP+PW+YYQNAV+SS
Sbjct  117  HWYLKYWCGSHISWDKTGGVQLNSIPKLGSLPRLQDDGILVQRPVPWNYYQNAVTSS  173



>ref|XP_011008329.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Populus 
euphratica]
Length=813

 Score =   183 bits (464),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSF+F I+ KEQC G++CF I NHPS  + G+ +ILISG T VE+L GL
Sbjct  57   GVLQRLLPSHSSSFEFRIVSKEQCGGESCFIIKNHPSFTRRGAPQILISGVTGVEVLFGL  116

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG+HISW KTGGVQL S+PK GSLP +QD GI+V+RP+PW+YYQNAV+SS
Sbjct  117  HWYLKYWCGSHISWDKTGGVQLNSIPKLGSLPRLQDDGILVQRPVPWNYYQNAVTSS  173



>gb|KDO35993.1| hypothetical protein CISIN_1g027682mg [Citrus sinensis]
Length=220

 Score =   171 bits (434),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            YAVL RL+ SH S+F F II K+QC G+ CF + NHPS    G+ EI+ISG T VE+L+G
Sbjct  58   YAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPSSYIRGTPEIVISGVTGVEVLAG  117

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYL+YWCG+HISW KTGGVQ+ S+PK GS P VQDAG+ VKRPIP +YYQNAV+SS
Sbjct  118  LHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDAGVFVKRPIPLNYYQNAVTSS  175



>ref|XP_010663217.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Vitis vinifera]
Length=813

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VL+RL+ SHSSSF+F I+ KEQC GD+CF I+NHPS +  G+ EILI+G T VE+++G
Sbjct  53   YGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPSSSGHGAPEILITGVTGVEIMAG  112

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCG+HISW KTGG QL SVP  GS P VQ+AGI+++RPIPW+YYQNAV+SS
Sbjct  113  LHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPRVQEAGILIQRPIPWNYYQNAVTSS  170



>emb|CBI15090.3| unnamed protein product [Vitis vinifera]
Length=846

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y VL+RL+ SHSSSF+F I+ KEQC GD+CF I+NHPS +  G+ EILI+G T VE+++G
Sbjct  53   YGVLHRLLPSHSSSFEFGIVSKEQCGGDSCFMISNHPSSSGHGAPEILITGVTGVEIMAG  112

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCG+HISW KTGG QL SVP  GS P VQ+AGI+++RPIPW+YYQNAV+SS
Sbjct  113  LHWYLKYWCGSHISWDKTGGAQLLSVPDSGSFPRVQEAGILIQRPIPWNYYQNAVTSS  170



>ref|XP_002318632.2| hypothetical protein POPTR_0012s07760g, partial [Populus trichocarpa]
 gb|EEE96852.2| hypothetical protein POPTR_0012s07760g, partial [Populus trichocarpa]
Length=760

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSF+F I+ KEQC G++CF I NHPS  + G+ +ILISG T VE+L+GL
Sbjct  16   GVLQRLLPSHSSSFEFRIVSKEQCGGESCFIIKNHPSFTRRGAPQILISGVTGVEVLAGL  75

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG+HISW KTGGVQL S+PK GSLP +QD  I+V+RP+PW+YYQNAV+SS
Sbjct  76   HWYLKYWCGSHISWDKTGGVQLNSIPKLGSLPRLQDDSILVQRPVPWNYYQNAVTSS  132



>ref|XP_008239708.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Prunus mume]
Length=819

 Score =   179 bits (454),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSFDF I+ KEQC G +CF I NHPS  + G  +ILISG T VE+L+GL
Sbjct  61   GVLRRLLPSHSSSFDFQIVSKEQCGGASCFMIKNHPSFRRRGDPQILISGVTGVEILAGL  120

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCG+HISW KTGG QL SVPK G L  VQDAGI+V+RP+PW+YYQNAV+SS
Sbjct  121  HWYLKHWCGSHISWDKTGGAQLFSVPKAGLLSRVQDAGILVQRPVPWNYYQNAVTSS  177



>ref|XP_007210354.1| hypothetical protein PRUPE_ppa001642mg [Prunus persica]
 gb|EMJ11553.1| hypothetical protein PRUPE_ppa001642mg [Prunus persica]
Length=787

 Score =   178 bits (452),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 79/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSFDF I+ +EQC G +CF I NHPS  + G  +ILISG T VE+L+GL
Sbjct  29   GVLRRLLPSHSSSFDFQIVSREQCGGASCFMIKNHPSFRRRGDPQILISGVTGVEILAGL  88

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCG+HISW KTGG QL SVPK G L  VQDAGI+V+RP+PW+YYQNAV+SS
Sbjct  89   HWYLKHWCGSHISWDKTGGAQLFSVPKAGLLSRVQDAGILVQRPVPWNYYQNAVTSS  145



>ref|XP_010928215.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Elaeis guineensis]
Length=823

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            ++L RL+ SH +SF+F IIPK +C G ACF INNHPS    GSSEILI G + VEL +GL
Sbjct  50   SLLGRLLPSHQASFEFEIIPKAKCGGKACFIINNHPSSGIKGSSEILIHGVSGVELSAGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWC AHISW K+GGVQL+SVPKPG+LPHV   G++V+RPIPWSYYQNAVSSS
Sbjct  110  HWYLKYWCLAHISWEKSGGVQLSSVPKPGALPHVSSTGVLVQRPIPWSYYQNAVSSS  166



>gb|KCW83403.1| hypothetical protein EUGRSUZ_B00338 [Eucalyptus grandis]
Length=732

 Score =   177 bits (448),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHW  204
            L RL+ S  SSF+F II K++C G+ CF I NHPS  + G+ EILISG T VE+L+GLHW
Sbjct  63   LRRLLPSRYSSFEFRIISKDECGGEICFVITNHPSFGRRGAPEILISGVTGVEVLAGLHW  122

Query  205  YLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            YLKYWCG+HISW KTGG+Q  S+PK GSLP V DAG+IV+RPIPWSYYQNAVSSS
Sbjct  123  YLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDAGVIVQRPIPWSYYQNAVSSS  177



>gb|KDP31153.1| hypothetical protein JCGZ_11529 [Jatropha curcas]
Length=808

 Score =   176 bits (447),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 77/117 (66%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSS F+F II KE C G +CF I N+P   + G+ EIL+SG T VE+L+GL
Sbjct  53   GVLQRLLPSHSSGFEFRIISKEHCGGQSCFIIKNNPFYTRPGTPEILVSGVTGVEVLAGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG+HISW KTGG QL S+PK GSLP VQD+G++V+RPIPW+YYQNAV+SS
Sbjct  113  HWYLKYWCGSHISWDKTGGAQLNSIPKLGSLPRVQDSGVLVQRPIPWNYYQNAVTSS  169



>gb|KCW83402.1| hypothetical protein EUGRSUZ_B00338 [Eucalyptus grandis]
Length=822

 Score =   176 bits (446),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHW  204
            L RL+ S  SSF+F II K++C G+ CF I NHPS  + G+ EILISG T VE+L+GLHW
Sbjct  63   LRRLLPSRYSSFEFRIISKDECGGEICFVITNHPSFGRRGAPEILISGVTGVEVLAGLHW  122

Query  205  YLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            YLKYWCG+HISW KTGG+Q  S+PK GSLP V DAG+IV+RPIPWSYYQNAVSSS
Sbjct  123  YLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDAGVIVQRPIPWSYYQNAVSSS  177



>ref|XP_010027879.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Eucalyptus 
grandis]
Length=816

 Score =   176 bits (445),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHW  204
            L RL+ S  SSF+F II K++C G+ CF I NHPS  + G+ EILISG T VE+L+GLHW
Sbjct  63   LRRLLPSRYSSFEFRIISKDECGGEICFVITNHPSFGRRGAPEILISGVTGVEVLAGLHW  122

Query  205  YLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            YLKYWCG+HISW KTGG+Q  S+PK GSLP V DAG+IV+RPIPWSYYQNAVSSS
Sbjct  123  YLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDAGVIVQRPIPWSYYQNAVSSS  177



>ref|XP_010027872.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Eucalyptus 
grandis]
Length=817

 Score =   176 bits (445),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHW  204
            L RL+ S  SSF+F II K++C G+ CF I NHPS  + G+ EILISG T VE+L+GLHW
Sbjct  63   LRRLLPSRYSSFEFRIISKDECGGEICFVITNHPSFGRRGAPEILISGVTGVEVLAGLHW  122

Query  205  YLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            YLKYWCG+HISW KTGG+Q  S+PK GSLP V DAG+IV+RPIPWSYYQNAVSSS
Sbjct  123  YLKYWCGSHISWDKTGGLQTYSMPKFGSLPRVHDAGVIVQRPIPWSYYQNAVSSS  177



>ref|XP_008793800.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Phoenix dactylifera]
Length=821

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ SH +SF+F IIPK +C G ACF INNHPS    GS EILI G + VEL +GL
Sbjct  50   GLLGRLLPSHQASFEFEIIPKAECGGKACFIINNHPSSGIKGSPEILIHGVSGVELSAGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWC AHISW K GGVQL+SVPKPG+LPHV   G++V+RPIPWSYYQNAVSSS
Sbjct  110  HWYLKYWCLAHISWEKAGGVQLSSVPKPGALPHVSSTGVLVQRPIPWSYYQNAVSSS  166



>ref|XP_011087174.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Sesamum indicum]
Length=944

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            YA LNRLI SHSSSF F II K+ C G+ CFK+NNHP++N  GS+EILISGTT VELL G
Sbjct  183  YAALNRLIPSHSSSFQFSIISKDLCGGEPCFKLNNHPAVNHDGSAEILISGTTGVELLFG  242

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISWSKTGG Q +SVPK GSL  +QDAGI +KRP PWSYYQNAVSSS
Sbjct  243  LHWYLKYWCGAHISWSKTGGAQFSSVPKSGSLNRIQDAGITMKRPTPWSYYQNAVSSS  300



>ref|XP_006476679.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Citrus sinensis]
Length=814

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            YAVL RL+ SH S+F F II K+QCDG+ CF + NHPS    G+ EI+ISG T VE+L+G
Sbjct  58   YAVLQRLLPSHYSAFQFRIISKKQCDGEYCFILRNHPSSYIRGTPEIVISGVTGVEVLAG  117

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYL+YWCG+HISW KTGGVQ+ S+PK GS P VQDAG++VKRPIP +YYQNAV+SS
Sbjct  118  LHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDAGVLVKRPIPLNYYQNAVTSS  175



>gb|KHG03421.1| Alpha-N-acetylglucosaminidase [Gossypium arboreum]
Length=804

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGD-ACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             VL+RL+ SHSS+F+F II KE+C G+ ACF INNHPS  K+G+ EILISG T VE+L+G
Sbjct  52   GVLHRLLPSHSSAFEFRIISKEKCGGEGACFIINNHPSSYKSGAPEILISGVTGVEVLAG  111

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCG+HISW KTGG QL S+P  GSLP VQ  GI+V+RPIPW+YYQNAV+SS
Sbjct  112  LHWYLKYWCGSHISWQKTGGAQLFSIPPLGSLPRVQVGGILVQRPIPWNYYQNAVTSS  169



>ref|XP_002517786.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
 gb|EEF44593.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Length=174

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H  SF+F I+PK+ C G +CF INN   L++ G  EI I GT+AVEL SGL
Sbjct  56   GVLQRLLPTHVHSFEFEIVPKDVCGGHSCFLINNSNQLSQDGP-EIFIKGTSAVELTSGL  114

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSSSK  375
            HWYLKYWCGAHISW KTGG+Q  S+P PGSLP V+D GI+++RP+PW+YYQN V+SS K
Sbjct  115  HWYLKYWCGAHISWDKTGGIQKASIPNPGSLPPVKDEGIVIQRPVPWNYYQNVVTSSCK  173



>ref|XP_010112589.1| hypothetical protein L484_010094 [Morus notabilis]
 gb|EXC34224.1| hypothetical protein L484_010094 [Morus notabilis]
Length=856

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSFDF II KEQC G +CF I N+PS  + G  EILI+G T VE+L+GL
Sbjct  58   GVLRRLLPSHSSSFDFQIISKEQCGGSSCFIIRNNPSFLRRGDREILITGVTGVEILAGL  117

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK WCG+HISW KTGGVQL SVPK   LP V D G++V+RPIPWSYYQNAV+SS
Sbjct  118  HWYLKNWCGSHISWEKTGGVQLFSVPKSEFLPRVNDDGVLVQRPIPWSYYQNAVTSS  174



>ref|XP_006439737.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52977.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=733

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            YAVL RL+ SH S+F F II K+QC G+ CF + NHPS    G+ EI+ISG T VE+L+G
Sbjct  58   YAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPSSYIRGTPEIVISGVTGVEVLAG  117

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYL+YWCG+HISW KTGGVQ+ S+PK GS P VQDAG+ VKRPIP +YYQNAV+SS
Sbjct  118  LHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDAGVFVKRPIPLNYYQNAVTSS  175



>ref|XP_006439736.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 ref|XP_006439739.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52976.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52979.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=711

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            YAVL RL+ SH S+F F II K+QC G+ CF + NHPS    G+ EI+ISG T VE+L+G
Sbjct  58   YAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPSSYIRGTPEIVISGVTGVEVLAG  117

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYL+YWCG+HISW KTGGVQ+ S+PK GS P VQDAG+ VKRPIP +YYQNAV+SS
Sbjct  118  LHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDAGVFVKRPIPLNYYQNAVTSS  175



>ref|XP_007036096.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
 gb|EOY20597.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
Length=798

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIP-KEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            AVL+RL+ SHSS+F+F II  KE+C G +CF I NHP+ +K G+ EILISG T VE+L+G
Sbjct  53   AVLHRLLPSHSSAFEFRIISSKEECGGGSCFIIKNHPASHKHGAPEILISGVTGVEVLAG  112

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKY CG+HISW KTGG QL+S+PK GSLP VQD GI+V+RPIPW+YYQNAV+SS
Sbjct  113  LHWYLKYLCGSHISWEKTGGAQLSSIPKLGSLPRVQDTGILVQRPIPWNYYQNAVTSS  170



>ref|XP_006439738.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
 gb|ESR52978.1| hypothetical protein CICLE_v10018883mg [Citrus clementina]
Length=814

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            YAVL RL+ SH S+F F II K+QC G+ CF + NHPS    G+ EI+ISG T VE+L+G
Sbjct  58   YAVLQRLLPSHYSAFQFRIISKKQCGGEYCFILRNHPSSYIRGTPEIVISGVTGVEVLAG  117

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYL+YWCG+HISW KTGGVQ+ S+PK GS P VQDAG+ VKRPIP +YYQNAV+SS
Sbjct  118  LHWYLRYWCGSHISWDKTGGVQVASMPKLGSFPRVQDAGVFVKRPIPLNYYQNAVTSS  175



>ref|XP_002511461.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
 gb|EEF52063.1| alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Length=809

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL+RL+ SHSS+F+F II KEQC G +CF I N+P      + EI+ISG   +E+++GL
Sbjct  53   GVLHRLLPSHSSAFEFRIISKEQCGGQSCFIIENYPFSTGPVTPEIIISGVNGMEVVAGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG+HISW KTGG QL S+PK GSLPHVQDAG++V RPIPW+YYQNAV+SS
Sbjct  113  HWYLKYWCGSHISWDKTGGAQLNSIPKLGSLPHVQDAGVLVLRPIPWNYYQNAVTSS  169



>ref|XP_003580702.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Brachypodium 
distachyon]
Length=829

 Score =   167 bits (424),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = +1

Query  4    SEERYA---VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTT  174
            +E+ YA   +L RL+ SHS+SF+F +I  EQC G ACF INNHP  +  G+ EILI G +
Sbjct  49   AEQVYAAEGLLARLLPSHSTSFEFRVISTEQCGGKACFIINNHPLFDGEGTPEILILGVS  108

Query  175  AVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
             VE+ +GLHWYLK++C AHISW+KTGG QL+SVP PGSLPHV   GI+++RP+ WSYYQN
Sbjct  109  GVEISAGLHWYLKHYCAAHISWAKTGGAQLSSVPHPGSLPHVPAGGILIRRPVDWSYYQN  168

Query  355  AVSSS  369
            AV+SS
Sbjct  169  AVTSS  173



>ref|XP_008393078.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Malus 
domestica]
Length=823

 Score =   167 bits (423),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSFDF I+ KEQC G +CF I N+PS  + G  +ILISG T VE+L+GL
Sbjct  57   GVLRRLLPSHSSSFDFQIVSKEQCGGASCFMIKNNPSFRRRGDPQILISGVTGVEILAGL  116

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK  C +HISW KTGG QL SVPK G L  VQDAGI+V+RP+PW+YYQNAV+SS
Sbjct  117  HWYLKNLCNSHISWDKTGGAQLFSVPKSGLLTRVQDAGILVQRPVPWNYYQNAVTSS  173



>ref|XP_008393079.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Malus 
domestica]
Length=822

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSFDF I+ KEQC G +CF I N+PS  + G  +ILISG T VE+L+GL
Sbjct  57   GVLRRLLPSHSSSFDFQIVSKEQCGGASCFMIKNNPSFRRRGDPQILISGVTGVEILAGL  116

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK  C +HISW KTGG QL SVPK G L  VQDAGI+V+RP+PW+YYQNAV+SS
Sbjct  117  HWYLKNLCNSHISWDKTGGAQLFSVPKSGLLTRVQDAGILVQRPVPWNYYQNAVTSS  173



>ref|XP_004301281.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Fragaria vesca 
subsp. vesca]
Length=834

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTG-SSEILISGTTAVELLSG  195
             VL+RL+ SHSSSFDF I+ KEQC G +CF I NHPS  + G   +ILISG T VE+L+G
Sbjct  62   GVLHRLLPSHSSSFDFQIVSKEQCGGASCFMIKNHPSFRRRGIDPQILISGVTGVEILAG  121

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLK WCG+HISW KTGG QL SVPK G L  V D GI+V+RP+PW+YYQNAV+SS
Sbjct  122  LHWYLKNWCGSHISWDKTGGAQLFSVPKAGLLSCVGDGGILVQRPVPWNYYQNAVTSS  179



>ref|XP_003599415.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=539

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F+I+ K+ C GD+CF INN+   ++ G  EI+I GTT VE+ SGL
Sbjct  54   GVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNYNKSSQKGP-EIIIRGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  113  HWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPWNYYQNVVTSS  169



>ref|XP_008231468.1| PREDICTED: alpha-N-acetylglucosaminidase [Prunus mume]
Length=803

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SFDF I+ KE C G +CF +NN+ +L++    EI I GTTAVE+ SGL
Sbjct  50   AVLKRLLPTHVDSFDFKIVSKEACGGQSCFLLNNN-NLSRRQGPEIQIKGTTAVEIASGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGGVQ+ S+PKPGSLP V+D G+ ++RPIPW+YYQN V+SS
Sbjct  109  HWYLKYWCGAHVSWDKTGGVQVVSIPKPGSLPRVRDEGLKIQRPIPWNYYQNVVTSS  165



>ref|XP_004499942.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cicer arietinum]
Length=805

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F I+ K+ C GD+CF INNH   ++ G  EI+I GTT VE+ SGL
Sbjct  53   GVLKRLLPTHFSSFEFKIVSKDVCGGDSCFMINNHNKSSQNGP-EIIIRGTTGVEIASGL  111

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  112  HWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDEGVKIKRPVPWNYYQNVVTSS  168



>gb|AES69667.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=781

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F+I+ K+ C GD+CF INN+   ++ G  EI+I GTT VE+ SGL
Sbjct  54   GVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNYNKSSQKGP-EIIIRGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  113  HWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPWNYYQNVVTSS  169



>ref|XP_003599416.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=807

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F+I+ K+ C GD+CF INN+   ++ G  EI+I GTT VE+ SGL
Sbjct  54   GVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNYNKSSQKGP-EIIIRGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  113  HWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPWNYYQNVVTSS  169



>dbj|BAK03902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=829

 Score =   165 bits (417),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ SHS+SF+F ++  EQC G ACF INNHPS +  G+ EILI G + VE+ +GL
Sbjct  58   GLLARLLPSHSASFEFRVVSTEQCGGKACFNINNHPSFHGEGTPEILILGASGVEISAGL  117

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK++C AHISW+KTGG QL+SVP PGSLP V   GI+++RP+ WSYYQNAV+SS
Sbjct  118  HWYLKHYCAAHISWAKTGGAQLSSVPYPGSLPRVPAGGILIQRPVDWSYYQNAVTSS  174



>dbj|BAK07078.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=829

 Score =   165 bits (417),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ SHS+SF+F ++  EQC G ACF INNHPS +  G+ EILI G + VE+ +GL
Sbjct  58   GLLARLLPSHSASFEFRVVSTEQCGGKACFNINNHPSFHGEGTPEILILGASGVEISAGL  117

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK++C AHISW+KTGG QL+SVP PGSLP V   GI+++RP+ WSYYQNAV+SS
Sbjct  118  HWYLKHYCAAHISWAKTGGAQLSSVPYPGSLPRVPAGGILIQRPVDWSYYQNAVTSS  174



>gb|AES69665.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=806

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F+I+ K+ C GD+CF INN+   ++ G  EI+I GTT VE+ SGL
Sbjct  54   GVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNYNKSSQKGP-EIIIRGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  113  HWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPWNYYQNVVTSS  169



>ref|XP_003599414.1| Alpha-N-acetylglucosaminidase [Medicago truncatula]
Length=832

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F+I+ K+ C GD+CF INN+   ++ G  EI+I GTT VE+ SGL
Sbjct  54   GVLKRLLPTHFSSFEFIIVSKDACGGDSCFIINNYNKSSQKGP-EIIIRGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  113  HWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPWNYYQNVVTSS  169



>ref|XP_002314048.1| hypothetical protein POPTR_0009s06320g [Populus trichocarpa]
 gb|EEE88003.1| hypothetical protein POPTR_0009s06320g [Populus trichocarpa]
Length=806

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ SH  SF F I+ K+ C G +CF INN+   +     EI I GTTAVE+ SGL
Sbjct  52   AVLKRLLPSHIHSFLFKIVSKDVCGGHSCFLINNYYKESSGNGPEISIKGTTAVEIASGL  111

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGGVQ+ S+PKPGSLPHV+D G++++RP+PW+YYQN V+SS
Sbjct  112  HWYLKYWCGAHVSWDKTGGVQIASIPKPGSLPHVKDKGVMIQRPVPWNYYQNVVTSS  168



>gb|KHN19339.1| Alpha-N-acetylglucosaminidase [Glycine soja]
Length=434

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSF+F I+ K+QC G+ CFKI NHPS    G  +ILI GTT V++++GL
Sbjct  51   GVLLRLLPSHSSSFEFRILSKKQCGGEYCFKIKNHPSFTTAGDPQILIEGTTGVDIVAGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPG-SLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCG+HISW KTGG QL SVP  G  LP V  AG+ V+RP+PWSYYQNAV+SS
Sbjct  111  HWYLKHWCGSHISWDKTGGSQLFSVPNVGLLLPRVHHAGVSVQRPVPWSYYQNAVTSS  168



>ref|XP_007148898.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
 gb|ESW20892.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
Length=796

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H SSF+F I+ K+ C GD+CF INNH   +     EI+I GTTAVE+ SGL
Sbjct  50   GLLKRLLPTHLSSFEFKIVSKDVCGGDSCFLINNHKK-SSQNEPEIVIRGTTAVEIASGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TSVP+PGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  109  HWYLKYWCGAHVSWDKTGGIQTTSVPEPGSLPRLKDEGVKIKRPVPWNYYQNVVTSS  165



>ref|XP_007218923.1| hypothetical protein PRUPE_ppa001555mg [Prunus persica]
 gb|EMJ20122.1| hypothetical protein PRUPE_ppa001555mg [Prunus persica]
Length=803

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SFDF I  KE C G +CF +NN+ +L+     EI I GTTAVE+ SGL
Sbjct  50   AVLKRLLPTHVDSFDFKIFSKEACGGQSCFLLNNN-NLSSRQGPEIQIKGTTAVEIASGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGGVQ+ S+PKPGSLP V+D G+ ++RPIPW+YYQN V+SS
Sbjct  109  HWYLKYWCGAHVSWDKTGGVQVVSIPKPGSLPRVRDEGLKIQRPIPWNYYQNVVTSS  165



>ref|XP_007148897.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
 gb|ESW20891.1| hypothetical protein PHAVU_005G023300g [Phaseolus vulgaris]
Length=802

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H SSF+F I+ K+ C GD+CF INNH   +     EI+I GTTAVE+ SGL
Sbjct  50   GLLKRLLPTHLSSFEFKIVSKDVCGGDSCFLINNHKK-SSQNEPEIVIRGTTAVEIASGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG+Q TSVP+PGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  109  HWYLKYWCGAHVSWDKTGGIQTTSVPEPGSLPRLKDEGVKIKRPVPWNYYQNVVTSS  165



>ref|XP_010257138.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Nelumbo 
nucifera]
Length=801

 Score =   163 bits (413),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H SSF+F IIPK+ C G +CF I N    N  G  EILI GTTAVE+ SGL
Sbjct  48   AVLQRLLPTHLSSFEFNIIPKDACGGYSCFWIKNFDPSNSNGP-EILIQGTTAVEITSGL  106

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH SW KTGG Q+ S+P+PGSLP V+D G +V+RP+PW+YYQN V+SS
Sbjct  107  HWYLKYWCGAHFSWDKTGGTQIGSIPRPGSLPLVKDGGEMVQRPVPWNYYQNVVTSS  163



>ref|XP_006581937.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Glycine 
max]
Length=813

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSF+F I+ K+QC G+ CFKI NHPS  K G  +ILI GTT V++++GL
Sbjct  51   GVLLRLLPSHSSSFEFRILSKKQCGGEYCFKIKNHPSFTKAGDPQILIEGTTGVDIVAGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPG-SLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCG+HISW KTGG QL SVP  G  LP V  AG+ V+RP+PWSYYQNAV+SS
Sbjct  111  HWYLKHWCGSHISWDKTGGSQLFSVPNVGLLLPRVHHAGVSVQRPVPWSYYQNAVTSS  168



>gb|KGN63613.1| hypothetical protein Csa_1G005740 [Cucumis sativus]
Length=534

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SH  SFDF I+ K++C G++CF I NH +  K+G  EILI+G T VE+L+GL
Sbjct  136  GVLRRLLPSHLPSFDFQIVSKDKCGGESCFVIRNHRAFRKSGDPEILIAGVTGVEILAGL  195

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCGAHISW KTGG QL SVPK G LP +Q   ++V+RPIP +YYQNAV+SS
Sbjct  196  HWYLKHWCGAHISWDKTGGSQLFSVPKAGLLPRIQTNEVVVQRPIPLNYYQNAVTSS  252



>ref|XP_008375270.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Malus domestica]
Length=397

 Score =   157 bits (396),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SFDF I+ ++ C G +CF +NN+ +L+     EI + GTTAVE+ SGL
Sbjct  48   AVLERLLPTHVHSFDFKIVSQDACGGHSCFMLNNY-NLSSGHGPEIQVKGTTAVEIASGL  106

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG QL S+P PGSLP V+D G+ ++RP+PW+YYQN V+SS
Sbjct  107  HWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRVRDEGLRIQRPVPWNYYQNVVTSS  163



>ref|XP_008356744.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Malus 
domestica]
Length=401

 Score =   157 bits (396),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SFDF I+ ++ C G +CF +NN+ +L+     EI + GTTAVE+ SGL
Sbjct  52   AVLERLLPTHVHSFDFKIVSQDACGGHSCFMLNNY-NLSSGHGPEIQVKGTTAVEIASGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG QL S+P PGSLP V+D G+ ++RP+PW+YYQN V+SS
Sbjct  111  HWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRVRDEGLRIQRPVPWNYYQNVVTSS  167



>ref|XP_008356745.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Malus 
domestica]
Length=352

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SFDF I+ ++ C G +CF +NN+ +L+     EI + GTTAVE+ SGL
Sbjct  52   AVLERLLPTHVHSFDFKIVSQDACGGHSCFMLNNY-NLSSGHGPEIQVKGTTAVEIASGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG QL S+P PGSLP V+D G+ ++RP+PW+YYQN V+SS
Sbjct  111  HWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRVRDEGLRIQRPVPWNYYQNVVTSS  167



>ref|XP_008453133.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis melo]
Length=808

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SH SSFDF I+ K++C G++CF I NH +  K G  EILI+G T VE+L+GL
Sbjct  55   GVLRRLLPSHLSSFDFQIVSKDKCGGESCFVIRNHRAFRKPGDPEILIAGVTGVEVLAGL  114

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCGAHISW KTGG QL SVPK G LP +Q   ++++RPIP +YYQNAV+SS
Sbjct  115  HWYLKHWCGAHISWDKTGGSQLFSVPKAGLLPRIQTDEVVIRRPIPLNYYQNAVTSS  171



>ref|XP_008461320.1| PREDICTED: alpha-N-acetylglucosaminidase [Cucumis melo]
Length=774

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A+L RL+ +H  SF+F I+ ++ C G +CF I+N  S ++ G+ EILI GTTAVE+ SGL
Sbjct  49   ALLRRLLPTHVDSFEFQIVSRDVCSGGSCFLISNFKSSSRNGA-EILIRGTTAVEITSGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +WYLKYWCGAH+SW KTGGVQL S+PKPGSLP ++  G+++KRP+PW+YYQN V+SS
Sbjct  108  YWYLKYWCGAHVSWDKTGGVQLASIPKPGSLPFLKGDGVVIKRPVPWNYYQNVVTSS  164



>ref|XP_004135943.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus]
Length=774

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A+L RL+ +H  SF+F I+ ++ C G +CF I+N  S ++ G+ EILI GTTAVE+ SGL
Sbjct  49   ALLRRLLPTHVDSFEFQIVSRDVCGGGSCFLISNFKSSSRNGA-EILIRGTTAVEITSGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +WYLKYWCGAH+SW KTGGVQL S+PKPGSLP ++  G+++KRP+PW+YYQN V+SS
Sbjct  108  YWYLKYWCGAHVSWDKTGGVQLASIPKPGSLPFLKGNGVVIKRPVPWNYYQNVVTSS  164



>gb|KGN45103.1| hypothetical protein Csa_7G425950 [Cucumis sativus]
Length=765

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A+L RL+ +H  SF+F I+ ++ C G +CF I+N  S ++ G+ EILI GTTAVE+ SGL
Sbjct  49   ALLRRLLPTHVDSFEFQIVSRDVCGGGSCFLISNFKSSSRNGA-EILIRGTTAVEITSGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +WYLKYWCGAH+SW KTGGVQL S+PKPGSLP ++  G+++KRP+PW+YYQN V+SS
Sbjct  108  YWYLKYWCGAHVSWDKTGGVQLASIPKPGSLPFLKGNGVVIKRPVPWNYYQNVVTSS  164



>gb|KHM99190.1| Alpha-N-acetylglucosaminidase [Glycine soja]
Length=807

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSE--ILISGTTAVELLS  192
             +L RL+  H SSF F I+ K+ C GD+CF INNH   NK+  +E  I+I GTTAVE+ S
Sbjct  50   GLLKRLLPIHFSSFQFKIVSKDVCGGDSCFLINNH---NKSSQNEPEIIIRGTTAVEIAS  106

Query  193  GLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            GLHWYLKYWCGAH+SW KTGG+Q TS+P+PGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  107  GLHWYLKYWCGAHVSWDKTGGIQTTSIPEPGSLPSLKDEGLKIKRPVPWNYYQNVVTSS  165



>ref|XP_004138287.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cucumis sativus]
Length=808

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SH  SFDF I+ K++C G++CF I NH +  K+G  EILI+G T VE+L+GL
Sbjct  55   GVLRRLLPSHLPSFDFQIVSKDKCGGESCFVIRNHRAFRKSGDPEILIAGVTGVEILAGL  114

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCGAHISW KTGG QL SVPK G LP +Q   ++V+RPIP +YYQNAV+SS
Sbjct  115  HWYLKHWCGAHISWDKTGGSQLFSVPKAGLLPRIQTNEVVVQRPIPLNYYQNAVTSS  171



>ref|XP_003535842.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Glycine 
max]
Length=807

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSE--ILISGTTAVELLS  192
             +L RL+  H SSF F I+ K+ C GD+CF INNH   NK+  +E  I+I GTTAVE+ S
Sbjct  50   GLLKRLLPIHFSSFQFKIVSKDVCGGDSCFLINNH---NKSSQNEPEIIIRGTTAVEIAS  106

Query  193  GLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            GLHWYLKYWCGAH+SW KTGG+Q TS+P+PGSLP ++D G+ +KRP+PW+YYQN V+SS
Sbjct  107  GLHWYLKYWCGAHVSWDKTGGIQTTSIPEPGSLPSLKDEGLKIKRPVPWNYYQNVVTSS  165



>ref|XP_011025477.1| PREDICTED: alpha-N-acetylglucosaminidase [Populus euphratica]
Length=806

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ SH  SF F I+ K+ C G +CF IN++   +     EI I GTTAVE+ SGL
Sbjct  52   AVLKRLLPSHVHSFLFKIVSKDVCGGHSCFLINDYYKESSGNGPEISIKGTTAVEIASGL  111

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGGVQ+ S+PKPGSLP V+D G++++RP+PW+YYQN V+SS
Sbjct  112  HWYLKYWCGAHVSWDKTGGVQIASIPKPGSLPRVKDKGVMIQRPVPWNYYQNVVTSS  168



>ref|XP_011087998.1| PREDICTED: alpha-N-acetylglucosaminidase [Sesamum indicum]
Length=809

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF F II K+ C G++CF+I+N+ S +K  S+EI+I GTTAV++ SGL
Sbjct  56   GVLRRLLPTHLSSFGFKIITKDACGGNSCFQISNYKSSSK-DSAEIMIKGTTAVDITSGL  114

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG QL S+PKPGSLP V+  G+ V+RP+PW+YYQN V+SS
Sbjct  115  HWYLKYWCGAHVSWDKTGGTQLGSIPKPGSLPPVKYEGVTVQRPMPWNYYQNVVTSS  171



>ref|XP_007052478.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
 gb|EOX96635.1| Alpha-N-acetylglucosaminidase family / NAGLU family isoform 1 
[Theobroma cacao]
Length=809

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SF F I+PK+ C G +CF I N+   ++ G  EI+I GTTAVE+ SGL
Sbjct  56   AVLGRLLPTHFHSFHFEIVPKDVCGGRSCFLIENYNRTSQDGP-EIIIKGTTAVEIASGL  114

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KY+CGAH+SW KTGGVQ+ SVPKPGSLP V+D G++++RPIPW+YYQN V+SS
Sbjct  115  HWYIKYFCGAHVSWDKTGGVQIASVPKPGSLPLVKDGGVLIQRPIPWNYYQNVVTSS  171



>gb|EPS69705.1| hypothetical protein M569_05058, partial [Genlisea aurea]
Length=315

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SH  SFDF IIPKE C G ACF+I NH   +   S+EI+I GTTAV++ SGL
Sbjct  25   GVLKRLLPSHVDSFDFRIIPKEACGGKACFRIRNHER-STINSAEIMIEGTTAVDITSGL  83

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            H+Y KY C AH+SW KTGG QL SVPKPGSLP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  84   HFYFKYSCDAHVSWEKTGGAQLDSVPKPGSLPLVRSNGLEIQRPVPWNYYQNVVTSS  140



>ref|XP_006653830.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oryza brachyantha]
Length=833

 Score =   159 bits (403),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ SHS+SFDF +I  +QC G ACF ++N+P  +  G+ EILI G + VE+ +GL
Sbjct  56   GLLTRLLPSHSASFDFRVISTDQCGGKACFIVDNYPLFDGEGTPEILILGISGVEISAGL  115

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK++C +HISW KTGG QL+SVP+PGSLP V   GI+++RPI WSYYQNAV+SS
Sbjct  116  HWYLKHYCASHISWDKTGGTQLSSVPRPGSLPRVPSGGILIQRPIGWSYYQNAVTSS  172



>gb|KDO83338.1| hypothetical protein CISIN_1g003545mg [Citrus sinensis]
Length=811

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H +SF F I+ K+ C G +CF I+N+   ++    EI I GTTAVE+ SGL
Sbjct  50   AVLQRLLPTHVNSFQFKIVSKDVCGGSSCFLIDNYKRTSQN-EPEITIKGTTAVEITSGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTGG Q+ SVPKPGSLPHV D G+ ++RP+PW+YYQN V+SS
Sbjct  109  HWYIKYWCGAHVSWEKTGGFQIVSVPKPGSLPHVTDGGVKIQRPVPWNYYQNVVTSS  165



>ref|XP_009368036.1| PREDICTED: alpha-N-acetylglucosaminidase [Pyrus x bretschneideri]
Length=808

 Score =   159 bits (401),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 69/117 (59%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SFDF I+ ++ C G +CF +NN+ +L+     EI + GTTAVE+ SGL
Sbjct  52   AVLERLLPTHVHSFDFKIVSQDACGGHSCFMLNNY-NLSSRHGPEIQVKGTTAVEIASGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAH+SW KTGG QL S+P PGSLP V+D G+ ++RP+PW+YYQN V+SS
Sbjct  111  HWYLKYWCGAHVSWDKTGGAQLASIPSPGSLPRVRDEGLRIQRPVPWNYYQNVVTSS  167



>ref|XP_006345419.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Solanum tuberosum]
Length=807

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +HS SF+F I+ K+ C G +CF+I N+ S ++  S EILI GTTAVE+ SGL
Sbjct  49   GVLQRLLPAHSHSFEFKIVSKDLCGGRSCFRITNYKS-SRRNSPEILIQGTTAVEIASGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY CGAHISW KTGGVQL SVPKPG+LP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  108  HWYLKYKCGAHISWDKTGGVQLASVPKPGALPLVEARGVTIQRPVPWNYYQNVVTSS  164



>ref|XP_004977055.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Setaria italica]
Length=830

 Score =   158 bits (400),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L R++ SHS+SF+F II KEQC G ACF I+NHP  +  G+ EILI G + VE+ +G 
Sbjct  60   GLLERILPSHSASFEFRIISKEQCGGKACFIISNHPLFDGEGTPEILILGVSGVEISAGF  119

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK +C AHISW KTGG QL+S+P PGSLP V  AG+ ++RP+ WSYYQNAV+SS
Sbjct  120  HWYLKNYCAAHISWYKTGGAQLSSIPHPGSLPRVPAAGVFIQRPVDWSYYQNAVTSS  176



>ref|XP_006581936.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Glycine 
max]
Length=814

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEIL-ISGTTAVELLSG  195
             VL RL+ SHSSSF+F I+ K+QC G+ CFKI NHPS  K G  +IL I GTT V++++G
Sbjct  51   GVLLRLLPSHSSSFEFRILSKKQCGGEYCFKIKNHPSFTKAGDPQILRIEGTTGVDIVAG  110

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPG-SLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLK+WCG+HISW KTGG QL SVP  G  LP V  AG+ V+RP+PWSYYQNAV+SS
Sbjct  111  LHWYLKHWCGSHISWDKTGGSQLFSVPNVGLLLPRVHHAGVSVQRPVPWSYYQNAVTSS  169



>ref|XP_006438966.1| hypothetical protein CICLE_v10030724mg [Citrus clementina]
 gb|ESR52206.1| hypothetical protein CICLE_v10030724mg [Citrus clementina]
Length=811

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H +SF F I+ K+ C G +CF I+N+   ++    EI I GTTAVE+ SGL
Sbjct  50   AVLQRLLPTHVNSFHFKIVSKDVCGGSSCFLIDNYKRTSQN-EPEITIKGTTAVEITSGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTGG Q+ SVPKPGSLPHV D G+ ++RP+PW+YYQN V+SS
Sbjct  109  HWYIKYWCGAHVSWEKTGGFQIASVPKPGSLPHVTDGGVKIQRPVPWNYYQNVVTSS  165



>ref|XP_006851078.1| hypothetical protein AMTR_s00025p00242240 [Amborella trichopoda]
 gb|ERN12659.1| hypothetical protein AMTR_s00025p00242240 [Amborella trichopoda]
Length=800

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SHSSSF+F +I K+ C G +CF I N  +    GS E+LI G TAVE+ +GL
Sbjct  45   GVLQRLLPSHSSSFEFRVISKDLCGGVSCFWIKNFNNSGVIGSPEMLIEGATAVEIAAGL  104

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTGG Q+ S+P PG LP VQ  G++V+RP+PWSYYQN V+SS
Sbjct  105  HWYIKYWCGAHVSWDKTGGTQIVSIPDPGLLPRVQGNGVMVQRPVPWSYYQNVVTSS  161



>ref|XP_006482916.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Citrus sinensis]
Length=811

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H +SF F I+ K+ C G +CF I+N+   ++    EI I GTTAVE+ SGL
Sbjct  50   AVLQRLLPTHVNSFHFKIVSKDVCGGSSCFLIDNYKRTSQN-EPEITIKGTTAVEITSGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTGG Q+ SVPKPGSLPHV D G+ ++RP+PW+YYQN V+SS
Sbjct  109  HWYIKYWCGAHVSWEKTGGFQIASVPKPGSLPHVTDGGVKIQRPVPWNYYQNVVTSS  165



>gb|EEC78143.1| hypothetical protein OsI_17702 [Oryza sativa Indica Group]
Length=829

 Score =   158 bits (399),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ SHS SFDF +I  +QC G ACF ++NHP  +  G+ ++L+ GT+ VE+ +GL
Sbjct  56   GLLARLLPSHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLLLGTSGVEISAGL  115

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK++C AH+SW KTGG QL+SVP+PGSLP +   GI+++RP+ WSYYQNAV+SS
Sbjct  116  HWYLKHYCAAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWSYYQNAVTSS  172



>ref|XP_002273084.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Vitis vinifera]
Length=803

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SF F I+ K+ C G +CF I+N+   +K G  EI+I GTTAVE+ SGL
Sbjct  49   AVLQRLLPTHLDSFQFEIVSKDVCGGKSCFWISNYNVSSKNGP-EIMIKGTTAVEIASGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTG +Q+ S+PKPGSLP V+D G++++RP+PW+YYQN V+SS
Sbjct  108  HWYIKYWCGAHVSWDKTGSIQIASIPKPGSLPLVKDEGVLIQRPVPWNYYQNVVTSS  164



>gb|EYU27032.1| hypothetical protein MIMGU_mgv1a001508mg [Erythranthe guttata]
Length=806

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F +I K+ C G++CF+I+N+ + ++  S+EI+I GTTAVE+ SGL
Sbjct  56   GVLRRLLPAHLSSFEFEVITKDACGGNSCFQISNYKNSSR-NSAEIMIKGTTAVEITSGL  114

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +WYLKY CGAHISW KTGG QL SVPKPGSLP V++ G++++RP+PW+YYQN V+SS
Sbjct  115  YWYLKYMCGAHISWEKTGGAQLASVPKPGSLPPVRNEGVMIQRPVPWNYYQNVVTSS  171



>emb|CBI24942.3| unnamed protein product [Vitis vinifera]
Length=868

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL RL+ +H  SF F I+ K+ C G +CF I+N+   +K G  EI+I GTTAVE+ SGL
Sbjct  114  AVLQRLLPTHLDSFQFEIVSKDVCGGKSCFWISNYNVSSKNGP-EIMIKGTTAVEIASGL  172

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTG +Q+ S+PKPGSLP V+D G++++RP+PW+YYQN V+SS
Sbjct  173  HWYIKYWCGAHVSWDKTGSIQIASIPKPGSLPLVKDEGVLIQRPVPWNYYQNVVTSS  229



>ref|XP_009611357.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Nicotiana tomentosiformis]
Length=857

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H  SF+F I+ K+ C G +CF+I N+ S ++  S EILI GTTAVE+ SGL
Sbjct  53   GVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRITNYKSSSRN-SPEILIQGTTAVEITSGL  111

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY CGAHISW KTGGVQL SVPKPGSLP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  112  HWYLKYRCGAHISWDKTGGVQLASVPKPGSLPLVEADGVTIQRPVPWNYYQNVVTSS  168



>ref|XP_010694988.1| PREDICTED: alpha-N-acetylglucosaminidase [Beta vulgaris subsp. 
vulgaris]
Length=808

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            ++L RL+ SHSS+F F II K+ CDG++CF + N+    + G  +ILI GTTAVE+ SGL
Sbjct  55   SLLQRLLPSHSSNFIFKIISKDVCDGNSCFWVENYNKSTRHGP-QILIKGTTAVEIASGL  113

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY+CGAH+SW KTGG Q+TS+P+P SLP V+D G+++KRP+PW+YYQN V+SS
Sbjct  114  HWYLKYFCGAHVSWDKTGGAQITSIPEPESLPFVKDEGLVMKRPVPWNYYQNVVTSS  170



>gb|KHG14952.1| Alpha-N-acetylglucosaminidase [Gossypium arboreum]
Length=805

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVL R + +H  SF F I+ K+ C G  CF I N+    + G  EILI GTTAVE+ SGL
Sbjct  53   AVLGRFLPTHLHSFHFKIVSKDVCGGQGCFLIENYDGPTENGP-EILIKGTTAVEIASGL  111

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSSS  372
            HWY+KY+CGAH+SW KTGGVQL SVPKPGSLP V+D+G++++RP+PW+YYQN V+S+S
Sbjct  112  HWYIKYFCGAHVSWDKTGGVQLASVPKPGSLPLVKDSGVLIQRPVPWNYYQNVVTSNS  169



>gb|KDP43563.1| hypothetical protein JCGZ_16850 [Jatropha curcas]
Length=811

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ SH  SF F II K+ C G +CF INN+   N+ G  EI+I GTT V+L SGL
Sbjct  58   GVLKRLLPSHVHSFKFKIISKDVCGGKSCFLINNYKESNQNGP-EIIIKGTTGVDLASGL  116

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWY+KYWCGAH+SW KTGG Q+ S+PK GSLP ++D G++++RP+PW+YYQN V+SS
Sbjct  117  HWYIKYWCGAHLSWDKTGGAQIGSIPKQGSLPLIKDGGVMIQRPVPWNYYQNVVTSS  173



>tpg|DAA35664.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=721

 Score =   155 bits (391),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPK--EQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLS  192
             +L RL+ SHS+SF+F +I    E C G  CF INNHP  +  G+ EILI G + VE+ +
Sbjct  57   GLLARLLPSHSTSFEFRVISTSTELCGGKTCFVINNHPLFDGEGTPEILILGASGVEISA  116

Query  193  GLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            G HWYLK++C AHISW KTGG QL+++P+PGSLP V D G++++RPI WSYYQNAV+SS
Sbjct  117  GFHWYLKHYCAAHISWDKTGGAQLSTIPRPGSLPRVPDGGVLIQRPIDWSYYQNAVTSS  175



>ref|XP_009758541.1| PREDICTED: alpha-N-acetylglucosaminidase [Nicotiana sylvestris]
Length=809

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H  SF+F I+ K+ C G +CF+I N+  ++   S EILI GTTAVE+ SGL
Sbjct  51   GVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRITNY-KVSSRNSPEILIQGTTAVEITSGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY CGAHISW KTGGVQL SVPKPGSLP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  110  HWYLKYRCGAHISWDKTGGVQLASVPKPGSLPLVEADGVTIQRPVPWNYYQNVVTSS  166



>ref|XP_010097439.1| hypothetical protein L484_004673 [Morus notabilis]
 gb|EXB68327.1| hypothetical protein L484_004673 [Morus notabilis]
Length=802

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A+L+RL+ +H SSF F I+P + C G +CF + N+   +K G  EI+I GTT VEL SGL
Sbjct  49   ALLSRLLPTHVSSFVFKIVPMDVCHGHSCFILANYNLSSKHGP-EIMIKGTTGVELASGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCGAHISW KTGG Q+ S+P PGSLP V+D G++++RP+PW+YYQN V+SS
Sbjct  108  HWYLKYWCGAHISWDKTGGAQIASIPNPGSLPPVKDEGVMIQRPVPWNYYQNVVTSS  164



>tpg|DAA35665.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=1202

 Score =   156 bits (394),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPK--EQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLS  192
             +L RL+ SHS+SF+F +I    E C G  CF INNHP  +  G+ EILI G + VE+ +
Sbjct  57   GLLARLLPSHSTSFEFRVISTSTELCGGKTCFVINNHPLFDGEGTPEILILGASGVEISA  116

Query  193  GLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            G HWYLK++C AHISW KTGG QL+++P+PGSLP V D G++++RPI WSYYQNAV+SS
Sbjct  117  GFHWYLKHYCAAHISWDKTGGAQLSTIPRPGSLPRVPDGGVLIQRPIDWSYYQNAVTSS  175



>gb|EEE61812.1| hypothetical protein OsJ_16433 [Oryza sativa Japonica Group]
Length=1129

 Score =   155 bits (392),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +1

Query  43   SHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWC  222
            SHS SFDF +I  +QC G ACF ++NHP  +  G+ ++L+ GT+ VE+ +GLHWYLK++C
Sbjct  364  SHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLLLGTSGVEISAGLHWYLKHYC  423

Query  223  GAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
             AH+SW KTGG QL+SVP+PGSLP +   GI+++RP+ WSYYQNAV+SS
Sbjct  424  AAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWSYYQNAVTSS  472



>ref|XP_004307226.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Fragaria vesca 
subsp. vesca]
Length=778

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A+L RL+ +H  SF+F I+ K+ C G +CF INNH    + G  EI I GTTAVE+ SGL
Sbjct  51   ALLFRLLPTHVDSFEFKIVGKDVCGGHSCFVINNHSPSRRYGP-EIEIKGTTAVEIASGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY+CGAH+SW KTGGVQL S+P  GSLP V+D G+ V+RP+PW+YYQN V+SS
Sbjct  110  HWYLKYFCGAHVSWDKTGGVQLASIPNTGSLPRVKDEGLKVQRPVPWNYYQNVVTSS  166



>ref|XP_010067843.1| PREDICTED: alpha-N-acetylglucosaminidase [Eucalyptus grandis]
Length=804

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+  HS SF F I+PK+ C G  CF I N+    +    EILI GTTAVEL SGL
Sbjct  53   GVLERLLPFHSRSFQFKIVPKDVCGGKNCFLIENY---EEKDGPEILIRGTTAVELASGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWC AH+SW KTGG+Q+ S+PK GSLP ++  G++++RP+PW+YYQN V+SS
Sbjct  110  HWYLKYWCNAHVSWDKTGGIQVASIPKAGSLPRLKGKGVMIQRPVPWNYYQNVVTSS  166



>emb|CAE04506.2| OSJNBb0059K02.16 [Oryza sativa Japonica Group]
Length=829

 Score =   153 bits (386),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +1

Query  43   SHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWC  222
            SHS SFDF +I  +QC G ACF ++NHP  +  G+ ++L+ GT+ VE+ +GLHWYLK++C
Sbjct  64   SHSGSFDFRVISADQCGGKACFIVDNHPLFDGEGTPQVLLLGTSGVEISAGLHWYLKHYC  123

Query  223  GAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
             AH+SW KTGG QL+SVP+PGSLP +   GI+++RP+ WSYYQNAV+SS
Sbjct  124  AAHVSWDKTGGAQLSSVPRPGSLPRLPSGGILIQRPVGWSYYQNAVTSS  172



>ref|XP_010324687.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Solanum 
lycopersicum]
Length=807

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H  SF+F I+ K+ C G +CF+I N+ S ++  S EILI GTTAVE+ SGL
Sbjct  49   GVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRITNYKSSHRN-SPEILIQGTTAVEIASGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +WYLKY CGAHISW KTGGVQL SVPKPG+LP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  108  NWYLKYKCGAHISWDKTGGVQLASVPKPGALPLVEAKGVTIQRPVPWNYYQNVVTSS  164



>gb|EEE59081.1| hypothetical protein OsJ_10898 [Oryza sativa Japonica Group]
Length=812

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQ-CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+ SH+ SF F I+ K   C G +CF+I+N     + G+ EILI GTTAVEL SG
Sbjct  62   GLLRRLLPSHARSFRFQIVSKGGVCGGSSCFRISNADGSRRNGA-EILIQGTTAVELASG  120

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL SVP PGSLP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  121  LHWYLKYWCGAHISWDKTGGAQLASVPLPGSLPQVKGTGVKIERPVPWNYYQNVVTSS  178



>ref|XP_008667109.1| PREDICTED: uncharacterized protein LOC100192858 isoform X1 [Zea 
mays]
 tpg|DAA35663.1| TPA: hypothetical protein ZEAMMB73_337226 [Zea mays]
Length=831

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPK--EQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLS  192
             +L RL+ SHS+SF+F +I    E C G  CF INNHP  +  G+ EILI G + VE+ +
Sbjct  57   GLLARLLPSHSTSFEFRVISTSTELCGGKTCFVINNHPLFDGEGTPEILILGASGVEISA  116

Query  193  GLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            G HWYLK++C AHISW KTGG QL+++P+PGSLP V D G++++RPI WSYYQNAV+SS
Sbjct  117  GFHWYLKHYCAAHISWDKTGGAQLSTIPRPGSLPRVPDGGVLIQRPIDWSYYQNAVTSS  175



>emb|CAA77084.1| alpha-N-acetylglucosaminidase [Nicotiana tabacum]
Length=811

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H  SF+F I+ K+ C G +CF+I N+  ++   S EILI GTTAVE+ SGL
Sbjct  51   GVLQRLLPAHLHSFEFKIVSKDLCGGRSCFRITNY-KVSSRNSPEILIQGTTAVEITSGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY CGAHISW KTGGVQL SVPKPGSLP V+   + ++RP+PW+YYQN V+SS
Sbjct  110  HWYLKYRCGAHISWDKTGGVQLASVPKPGSLPLVKQMELTIQRPVPWNYYQNVVTSS  166



>emb|CDP19299.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   150 bits (380),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF+F I+ K+ CDG +CF+I+N+ S ++  S +ILI GTTA E+ SGL
Sbjct  55   GVLQRLLPTHLSSFEFKIVSKDGCDGRSCFRISNYKS-SRRNSPQILIEGTTATEITSGL  113

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C  H+SW KTGG+Q+ SVPKPG+LP V D  +I++R +PW+YYQN V+SS
Sbjct  114  HWYLKYLCYVHVSWDKTGGIQIASVPKPGALPRVSDNVVIIQRAVPWNYYQNVVTSS  170



>ref|XP_010534240.1| PREDICTED: alpha-N-acetylglucosaminidase [Tarenaya hassleriana]
Length=817

 Score =   150 bits (379),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RLI +H  SFDF I+ K+ C G++CF I NH S ++ G  EI+I GTT VE+ SGL
Sbjct  60   GVLQRLIPTHFHSFDFEIVSKDVCGGNSCFLIENHNSRSRNGP-EIVIKGTTGVEIASGL  118

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AHISW KTGG+Q+ S+P+PG LP +    I+++RP+PW+YYQN V+SS
Sbjct  119  HWYLKYACDAHISWDKTGGIQIASIPRPGHLPRLASDRILIRRPVPWNYYQNVVTSS  175



>ref|XP_010938527.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Elaeis guineensis]
Length=547

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF F I PK  C+   CF+I+N  + +  G  EILI GTTAVE+ SGL
Sbjct  57   GVLKRLLPTHLSSFRFEIAPKGICEEFGCFRISNIDN-SSYGGPEILIQGTTAVEISSGL  115

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG HISW KTGG Q+ SVP PGSLP V+  G+ V+RP+PW+YYQN V+SS
Sbjct  116  HWYLKYWCGTHISWDKTGGNQVASVPPPGSLPRVEGQGVKVERPVPWNYYQNVVTSS  172



>ref|XP_009391536.1| PREDICTED: alpha-N-acetylglucosaminidase [Musa acuminata subsp. 
malaccensis]
Length=811

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +1

Query  43   SHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWC  222
            +H SSF F IIPK  C  + CF I+N  S N  G+ EILI GTTAVE+ SGLHWYLKYWC
Sbjct  67   THHSSFRFEIIPKGICKQNGCFHISNVNSSNSDGA-EILIRGTTAVEISSGLHWYLKYWC  125

Query  223  GAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            GAHISW KTGGVQL SVP PGSL  V   G+ V+RP+PWSYYQN V+SS
Sbjct  126  GAHISWDKTGGVQLASVPPPGSLARVDGEGVKVERPVPWSYYQNVVTSS  174



>ref|XP_008660142.1| PREDICTED: alpha-N-acetylglucosaminidase [Zea mays]
 gb|AFW88340.1| hypothetical protein ZEAMMB73_315381 [Zea mays]
Length=814

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQ-CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+  HS SF F I  K   C   +CF+I+N    +  G +EILI GTTAVEL SG
Sbjct  62   GLLRRLLPFHSGSFSFQIDSKGGVCGQSSCFRISNVVDGSGKGGAEILIQGTTAVELASG  121

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL S+P PGSLP VQ  G+ ++RP+PW+YYQN V+SS
Sbjct  122  LHWYLKYWCGAHISWDKTGGAQLASIPSPGSLPRVQGKGVKIERPVPWNYYQNVVTSS  179



>gb|EEC75285.1| hypothetical protein OsI_11626 [Oryza sativa Indica Group]
Length=812

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQ-CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+ SH+ SF F I+ K   C G +CF+I+N     + G+ EILI GTTAVEL SG
Sbjct  62   GLLRRLLPSHARSFRFQIVSKGGVCGGSSCFRISNADGSRRNGA-EILIQGTTAVELASG  120

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG QL SVP PGSLP V+   + ++RP+PW+YYQN V+SS
Sbjct  121  LHWYLKYWCGAHISWDKTGGAQLASVPLPGSLPQVKRTVVKIERPVPWNYYQNVVTSS  178



>ref|XP_001782392.1| predicted protein [Physcomitrella patens]
 gb|EDQ52786.1| predicted protein [Physcomitrella patens]
Length=801

 Score =   149 bits (376),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 71/125 (57%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = +1

Query  4    SEER--YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTT  174
            ++ER  Y VL RL+ SH SSF+F II KE+C G  CF + NHPS    G + EI ISGTT
Sbjct  45   TQERASYDVLARLLPSHLSSFEFRIITKEECGGKFCFLLQNHPSAGVYGGAPEIRISGTT  104

Query  175  AVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
             VEL +GLHWYLK+WC  HISW KTGG QL +V +PG LP +Q   + ++RP+ W+YYQN
Sbjct  105  GVELCAGLHWYLKHWCNGHISWDKTGGAQLHTVHRPGFLPRLQGDTLTIQRPVDWNYYQN  164

Query  355  AVSSS  369
             V+SS
Sbjct  165  VVTSS  169



>gb|KFK25597.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=344

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RLI +H  SF+F II K+ C G +CF I N+    + G  EI+I GTT VE+ SGL
Sbjct  54   GLLQRLIPTHFHSFEFRIISKDVCGGSSCFVIENYDGSRRIGP-EIVIKGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +   GI+++RP+PW+YYQN V+SS
Sbjct  113  HWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLASKGILIRRPVPWTYYQNVVTSS  169



>ref|XP_010938526.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Elaeis guineensis]
Length=809

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ +H SSF F I PK  C+   CF+I+N  + +  G  EILI GTTAVE+ SGL
Sbjct  57   GVLKRLLPTHLSSFRFEIAPKGICEEFGCFRISNIDN-SSYGGPEILIQGTTAVEISSGL  115

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKYWCG HISW KTGG Q+ SVP PGSLP V+  G+ V+RP+PW+YYQN V+SS
Sbjct  116  HWYLKYWCGTHISWDKTGGNQVASVPPPGSLPRVEGQGVKVERPVPWNYYQNVVTSS  172



>emb|CAJ86183.1| H0212B02.15 [Oryza sativa Indica Group]
 emb|CAJ86322.1| OSIGBa0113E10.5 [Oryza sativa Indica Group]
Length=692

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 24/141 (17%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLII------------------------PKEQCDGDACFKINNHP  126
             +L RL+ SHS SFDF +I                        P++QC G ACF ++NHP
Sbjct  56   GLLARLLPSHSGSFDFRVISADFPLPGTVVVLICKDSQSVPWNPQDQCGGKACFIVDNHP  115

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
              +  G+ ++L+ GT+ VE+ +GLHWYLK++C AH+SW KTGG QL+SVP+PGSLP +  
Sbjct  116  LFDGEGTPQVLLLGTSGVEISAGLHWYLKHYCAAHVSWDKTGGAQLSSVPRPGSLPRLPS  175

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
             GI+++RP+ WSYYQNAV+SS
Sbjct  176  GGILIQRPVGWSYYQNAVTSS  196



>ref|XP_008802642.1| PREDICTED: alpha-N-acetylglucosaminidase [Phoenix dactylifera]
Length=809

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            + VL RL+ +H+SSF F I PK  C+   CF+I++  + +  G  EILI GTTAVE+ SG
Sbjct  56   WGVLKRLLPNHTSSFRFEIAPKGICEEFGCFRISSIEN-SSYGGPEILIQGTTAVEISSG  114

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW KTGG Q+ SVP PGSLP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  115  LHWYLKYWCGAHISWDKTGGNQVASVPPPGSLPRVEGQGVKLERPVPWNYYQNVVTSS  172



>ref|XP_010492144.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Camelina sativa]
Length=807

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H  SFDF II K+ C G +CF I N   L + G  EI+I GTT VE+ SGL
Sbjct  52   GLLQRLLPTHFHSFDFRIISKDVCGGSSCFLIENSDGLRRIGP-EIVIKGTTGVEIASGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +   GI+++RP+PW+YYQN V+SS
Sbjct  111  HWYLKYKCNAHVSWDKTGGIQIDSVPQPGHLPRLDSKGILIRRPVPWNYYQNVVTSS  167



>ref|XP_007138123.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
 gb|ESW10117.1| hypothetical protein PHAVU_009G182100g [Phaseolus vulgaris]
Length=777

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 86/118 (73%), Gaps = 4/118 (3%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             VL RL+ S SSSF F I   +QC G+ CF I NHPS    G  +ILI GTT V+++SGL
Sbjct  52   GVLLRLLPSQSSSFQFRI---KQCGGEYCFVIKNHPSFATPGDPQILIEGTTGVDIVSGL  108

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHV-QDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCG+HISW KTGG QL S+P  G LP +   AGI V+RPIPWSYYQNAV+SS
Sbjct  109  HWYLKHWCGSHISWDKTGGSQLFSLPNVGFLPRIPHSAGISVQRPIPWSYYQNAVTSS  166



>ref|XP_003557830.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Brachypodium 
distachyon]
Length=809

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQ-CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             VL+RL+ SH+ SF F I  K   C   +CF+I+N     + G +EI+I GTTAVEL SG
Sbjct  59   GVLHRLLPSHAHSFRFQIDTKGGVCGESSCFRISNVDGSGR-GGAEIMIQGTTAVELASG  117

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCG HISW KTGG QL SVP PGSLP V   G+ +KRP+PW+YYQN V+SS
Sbjct  118  LHWYLKYWCGVHISWDKTGGAQLASVPSPGSLPRVNGTGVKIKRPVPWNYYQNVVTSS  175



>ref|XP_006287089.1| hypothetical protein CARUB_v10000251mg [Capsella rubella]
 gb|EOA19987.1| hypothetical protein CARUB_v10000251mg [Capsella rubella]
Length=806

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H  SFDF II K  CDG +CF I N+    + G  EI+I GTT VE+ SGL
Sbjct  51   GLLQRLLPAHFHSFDFRIISKNVCDGSSCFLIENYDGTRRFGP-EIVIKGTTGVEIASGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +    I+++RP+PW+YYQN V+SS
Sbjct  110  HWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLDSKRILIRRPVPWNYYQNVVTSS  166



>ref|XP_010453461.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X2 [Camelina 
sativa]
Length=742

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H  SFDF II K+ C G +CF I N+    + G  +I+I GTT VE+ SGL
Sbjct  52   GLLQRLLSNHFHSFDFRIISKDVCGGSSCFLIENYDGPGRIGP-DIVIKGTTGVEIASGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +   GI+++RP+PW+YYQN V+SS
Sbjct  111  HWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLDSKGILIRRPVPWNYYQNVVTSS  167



>gb|KFK25594.1| hypothetical protein AALP_AA8G134900 [Arabis alpina]
Length=733

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RLI +H  SF+F II K+ C G +CF I N+    + G  EI+I GTT VE+ SGL
Sbjct  54   GLLQRLIPTHFHSFEFRIISKDVCGGSSCFVIENYDGSRRIGP-EIVIKGTTGVEIASGL  112

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +   GI+++RP+PW+YYQN V+SS
Sbjct  113  HWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLASKGILIRRPVPWTYYQNVVTSS  169



>ref|XP_010453460.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Camelina 
sativa]
Length=805

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H  SFDF II K+ C G +CF I N+    + G  +I+I GTT VE+ SGL
Sbjct  52   GLLQRLLSNHFHSFDFRIISKDVCGGSSCFLIENYDGPGRIGP-DIVIKGTTGVEIASGL  110

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +   GI+++RP+PW+YYQN V+SS
Sbjct  111  HWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLDSKGILIRRPVPWNYYQNVVTSS  167



>ref|XP_002465249.1| hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
 gb|EER92247.1| hypothetical protein SORBIDRAFT_01g034960 [Sorghum bicolor]
Length=777

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQ-CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+ SH+ SF F I  K   C   +CF+I+N    +  G +EILI GTT VEL SG
Sbjct  62   GLLRRLLPSHAGSFSFQIDSKGAVCGQSSCFRISNVVDGSGKGGAEILIQGTTGVELASG  121

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LHWYLKYWCGAHISW +TGG QL S+P PGSLP VQ  G+ ++RP+ W+YYQN V+SS
Sbjct  122  LHWYLKYWCGAHISWDRTGGAQLASIPSPGSLPRVQGKGVKIERPVLWNYYQNVVTSS  179



>ref|XP_004502129.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Cicer arietinum]
Length=808

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  55   SFDFLIIPKEQCDGDACFKINN--HPSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGA  228
            +F F II K QC G+ CF INN  HPS       +ILI GTT VE+++GLHWYLK WCG+
Sbjct  71   AFYFRIISKNQCGGEYCFTINNNNHPSFVTQRPPQILIEGTTGVEIVAGLHWYLKNWCGS  130

Query  229  HISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HISW KTGG QL SVP  G LP V D GI V+RPIPWSYYQNAV+SS
Sbjct  131  HISWDKTGGSQLFSVPNVGFLPRVPDTGISVRRPIPWSYYQNAVTSS  177



>ref|XP_006399864.1| hypothetical protein EUTSA_v100127271mg, partial [Eutrema salsugineum]
 gb|ESQ41317.1| hypothetical protein EUTSA_v100127271mg, partial [Eutrema salsugineum]
Length=450

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RLI +H  SFDF II K+ C G +CF I N+    + G  EI+I GTT VE+ SGL
Sbjct  51   GLLQRLIPTHFHSFDFSIISKDVCGGSSCFLIENYDGPRRIGP-EIVIKGTTGVEIASGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP PG LP +    I+++RP+PW+YYQN V+SS
Sbjct  110  HWYLKYKCNAHVSWDKTGGIQIASVPHPGHLPRLDSKRILIRRPVPWNYYQNVVTSS  166



>ref|NP_196873.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 dbj|BAB08696.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AAL87291.1| putative alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AAM51254.1| putative alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
 gb|AED91928.1| alpha-N-acetylglucosaminidase [Arabidopsis thaliana]
Length=806

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +HS SF+  II K+ C G +CF I N+    + G  EILI GTT VE+ SGL
Sbjct  51   GLLQRLLPTHSQSFELRIISKDACGGTSCFVIENYDGPGRIGP-EILIKGTTGVEIASGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +    I ++RP+PW+YYQN V+SS
Sbjct  110  HWYLKYKCNAHVSWDKTGGIQVASVPQPGHLPRIDSKRIFIRRPVPWNYYQNVVTSS  166



>emb|CDX91103.1| BnaC02g04940D [Brassica napus]
Length=833

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RLI +HS SF+F II K+ C G +CF I N+      G  E+LI GTT VE+ SGL
Sbjct  80   GLLQRLIPTHSHSFEFTIISKDVCGGSSCFIIENYDGPRGNGP-EMLIKGTTGVEIASGL  138

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP PG LP +    I+++RP+PW+YYQN V+SS
Sbjct  139  HWYLKYKCNAHVSWDKTGGIQVASVPNPGHLPRLYSKRILIRRPVPWNYYQNVVTSS  195



>emb|CDX85632.1| BnaA02g01810D [Brassica napus]
Length=834

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L+RLI +HS SF+F II K+ C G +CF I N+    +TG  EI+I GTT VE+ SGL
Sbjct  80   GLLHRLIPTHSHSFEFSIISKDVCGGSSCFIIENYDGSRETGL-EIVIKGTTGVEIASGL  138

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQ-DAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP PG LP ++    I+++RP+PW+YYQN V+SS
Sbjct  139  HWYLKYKCNAHVSWDKTGGIQIASVPLPGHLPRLEYSKRILIRRPVPWNYYQNVVTSS  196



>ref|XP_002871580.1| alpha-N-acetylglucosaminidase family [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47839.1| alpha-N-acetylglucosaminidase family [Arabidopsis lyrata subsp. 
lyrata]
Length=806

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 1/117 (1%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RL+ +H  SF+F I  K+ C G +CF I N+    + G  EI I GTT VE+ SGL
Sbjct  51   GLLQRLLPTHFHSFEFRIFSKDVCGGTSCFLIENYDDPRRIGP-EIRIKGTTGVEIASGL  109

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP+PG LP +    I+++RPIPW+YYQN V+SS
Sbjct  110  HWYLKYKCNAHVSWDKTGGIQIASVPQPGHLPRLDSKRILIRRPIPWNYYQNVVTSS  166



>ref|XP_009125936.1| PREDICTED: alpha-N-acetylglucosaminidase [Brassica rapa]
Length=833

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L RLI +HS SF+F II K+ C G +CF I NH      G  EI+I GTT VE+ SGL
Sbjct  80   GLLQRLIPTHSHSFEFSIISKDVCGGSSCFIIENHDGPRGNGP-EIVIKGTTGVEIASGL  138

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQ-DAGIIVKRPIPWSYYQNAVSSS  369
            HWYLKY C AH+SW KTGG+Q+ SVP PG LP ++    I+++RP+PW+YYQN V+SS
Sbjct  139  HWYLKYKCNAHVSWDKTGGIQIASVPLPGHLPRLEYSKRILIRRPVPWNYYQNVVTSS  196



>ref|XP_006651392.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oryza brachyantha]
Length=755

 Score =   138 bits (347),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = +1

Query  34   LIHSHSSSFDFLIIPKEQ-CDGDA-CFKINNHPSLNKTGSSEILISGTTAVELLSGLHWY  207
            L+ SH+ SF F I  K   C G++ CF+I+N     K G+ EILI GTTAVEL SGLHWY
Sbjct  9    LLPSHARSFRFQIDSKGGVCGGESSCFRISNAVGSAKNGA-EILIQGTTAVELASGLHWY  67

Query  208  LKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            LKYWCGAHISW KTGG QL SVP P  LP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  68   LKYWCGAHISWDKTGGAQLASVPLPEHLPQVKGTGVKIERPVPWNYYQNVVTSS  121



>ref|XP_010324692.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Solanum 
lycopersicum]
Length=744

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +1

Query  88   CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLT  267
            C G +CF+I N+ S ++  S EILI GTTAVE+ SGL+WYLKY CGAHISW KTGGVQL 
Sbjct  9    CGGRSCFRITNYKSSHRN-SPEILIQGTTAVEIASGLNWYLKYKCGAHISWDKTGGVQLA  67

Query  268  SVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            SVPKPG+LP V+  G+ ++RP+PW+YYQN V+SS
Sbjct  68   SVPKPGALPLVEAKGVTIQRPVPWNYYQNVVTSS  101



>ref|XP_010092738.1| hypothetical protein L484_024633 [Morus notabilis]
 gb|EXB52083.1| hypothetical protein L484_024633 [Morus notabilis]
Length=313

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 7/122 (6%)
 Frame = +1

Query  19   AVLNRLIHS----HSSSFDFL--IIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAV  180
             +L+ L H+    H++SF  L   + K+ C G +CF + N+   +K G  EI+I GTT V
Sbjct  145  TMLHELCHNVHAPHNASFYNLWDELRKDVCHGHSCFILANYNLSSKHGP-EIMIKGTTGV  203

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAV  360
            EL SGLHWYLKYWCGAHISW KT G Q+ S+P PGSLP V+D G++++RP+ W+YYQN V
Sbjct  204  ELASGLHWYLKYWCGAHISWDKTAGAQIASIPNPGSLPLVKDEGVMIQRPVLWNYYQNVV  263

Query  361  SS  366
             +
Sbjct  264  QA  265



>gb|EMT10178.1| hypothetical protein F775_30738 [Aegilops tauschii]
Length=945

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +1

Query  88   CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLT  267
            C   +CF+I+N    +K G +EILI G TAVEL SGLHWYLKYWCG HISW KTGG QL 
Sbjct  50   CGDSSCFRISNVDGSSK-GGAEILIQGNTAVELASGLHWYLKYWCGVHISWDKTGGAQLA  108

Query  268  SVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            SVP PGSLP V+   + V+RP+PW+YYQN V+SS
Sbjct  109  SVPSPGSLPRVKGTAVKVERPVPWNYYQNVVTSS  142



>ref|XP_006856885.1| hypothetical protein AMTR_s00055p00202230 [Amborella trichopoda]
 gb|ERN18352.1| hypothetical protein AMTR_s00055p00202230 [Amborella trichopoda]
Length=727

 Score =   130 bits (328),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I GTT VEL +GLHWYLK+WCGAHISW KTGGVQL S+P PGSLPHVQ AG++V+RPIPW
Sbjct  18   IKGTTGVELSAGLHWYLKHWCGAHISWDKTGGVQLASIPVPGSLPHVQSAGVLVQRPIPW  77

Query  340  SYYQNAVSSS  369
            SYYQNAV+SS
Sbjct  78   SYYQNAVTSS  87



>ref|XP_002974994.1| hypothetical protein SELMODRAFT_102402 [Selaginella moellendorffii]
 gb|EFJ23779.1| hypothetical protein SELMODRAFT_102402 [Selaginella moellendorffii]
Length=761

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = +1

Query  1    RSEERYA--VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTT  174
            R + R A  VL RLI  H+S+F   II  E C G +CF+++   SL   GS +I I GT+
Sbjct  5    RDQLRAAASVLRRLIPGHASAFQLQIITLEDCGGKSCFQLS---SLMDEGSRKISIHGTS  61

Query  175  AVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
             VEL +GL+WYLK WCGAHISW  TGG QL ++P+P +LP +   G+ ++R +PWSYYQN
Sbjct  62   GVELCAGLYWYLKNWCGAHISWDLTGGSQLDTIPEPQALPALPPGGVKIQRSVPWSYYQN  121

Query  355  AVSSS  369
             V+SS
Sbjct  122  VVTSS  126



>gb|KEH35072.1| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=786

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 81/117 (69%), Gaps = 12/117 (10%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +VL RL+ SHS SF F II K        F+ +   SL     +  LI GTT V+++SGL
Sbjct  56   SVLLRLLPSHSDSFHFRIISK-------AFQFSLSISL-----TYFLIEGTTGVDIVSGL  103

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            HWYLK+WCG+HISW KTGG QL SVP  G LP V DAGI V+RP+PWSYYQNAV+SS
Sbjct  104  HWYLKHWCGSHISWDKTGGSQLFSVPNVGLLPRVHDAGISVRRPVPWSYYQNAVTSS  160



>ref|XP_002977411.1| hypothetical protein SELMODRAFT_107285 [Selaginella moellendorffii]
 gb|EFJ21415.1| hypothetical protein SELMODRAFT_107285 [Selaginella moellendorffii]
Length=761

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 5/125 (4%)
 Frame = +1

Query  1    RSEERYA--VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTT  174
            R + R A  VL RLI  H S+F   II  E C G +CF+++   SL   GS +I I GT+
Sbjct  5    RDQLRAAASVLRRLIPGHVSAFQLQIITLEDCGGKSCFQLS---SLMDEGSRKISIHGTS  61

Query  175  AVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
             VEL +GL+WYLK WCGAHISW  TGG QL ++P+P +LP +   G+ ++R +PWSYYQN
Sbjct  62   GVELCAGLYWYLKNWCGAHISWDLTGGSQLDTIPEPQALPALPPGGVKIQRSVPWSYYQN  121

Query  355  AVSSS  369
             V+SS
Sbjct  122  VVTSS  126



>gb|AES69666.2| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=686

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I GTT VE+ SGLHWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW
Sbjct  5    IRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPW  64

Query  340  SYYQNAVSSS  369
            +YYQN V+SS
Sbjct  65   NYYQNVVTSS  74



>gb|KEH33252.1| alpha-N-acetylglucosaminidase family protein [Medicago truncatula]
Length=711

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I GTT VE+ SGLHWYLKYWCGAH+SW KTGG+Q TS+PKPGSLP ++D G+ +KRP+PW
Sbjct  5    IRGTTGVEIASGLHWYLKYWCGAHVSWDKTGGIQTTSIPKPGSLPLLKDGGVKIKRPVPW  64

Query  340  SYYQNAVSSS  369
            +YYQN V+SS
Sbjct  65   NYYQNVVTSS  74



>ref|XP_010659443.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Vitis vinifera]
Length=715

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I GTTAVE+ SGLHWY+KYWCGAH+SW KTG +Q+ S+PKPGSLP V+D G++++RP+PW
Sbjct  7    IKGTTAVEIASGLHWYIKYWCGAHVSWDKTGSIQIASIPKPGSLPLVKDEGVLIQRPVPW  66

Query  340  SYYQNAVSSS  369
            +YYQN V+SS
Sbjct  67   NYYQNVVTSS  76



>ref|XP_009420949.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Musa 
acuminata subsp. malaccensis]
Length=260

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  142  GSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIV  321
            G  EILI GT+ VEL +G HWYLK+WC  HISW KTGG+QL+SVPK GSLPHV  AGI+V
Sbjct  3    GFPEILIQGTSGVELSAGFHWYLKHWCLIHISWEKTGGLQLSSVPKVGSLPHVPSAGILV  62

Query  322  KRPIPWSYYQNAVSSS  369
            +RP+P SYYQNAV+SS
Sbjct  63   QRPVPLSYYQNAVTSS  78



>gb|EMS50400.1| hypothetical protein TRIUR3_11279 [Triticum urartu]
Length=717

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  124  PSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQ  303
            P+  +    E+ I G TAVEL SGLHWYLKYWCG HISW KTGG QL SVP PGSLP V+
Sbjct  69   PACPRMKYLEMRIQGNTAVELASGLHWYLKYWCGVHISWDKTGGAQLASVPSPGSLPRVK  128

Query  304  DAGIIVKRPIPWSYYQNAVSSS  369
            +  + V+RP+PW+YYQN V+SS
Sbjct  129  ETAVKVERPVPWNYYQNVVTSS  150



>gb|EMT10385.1| hypothetical protein F775_10757 [Aegilops tauschii]
Length=768

 Score =   107 bits (266),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I G + VE+ +GLHWYLK +C AHISW+KTGG QL+SVP PGSLP V   GI+++RP+ W
Sbjct  39   ILGASGVEISTGLHWYLKNYCAAHISWAKTGGSQLSSVPYPGSLPRVPAGGILIQRPVDW  98

Query  340  SYYQNAVSSS  369
            SYYQNAV+SS
Sbjct  99   SYYQNAVTSS  108



>gb|EMS67905.1| hypothetical protein TRIUR3_00413 [Triticum urartu]
Length=732

 Score =   107 bits (266),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I G + VE+ +GLHWYLK +C AHISW+KTGG QL+SVP PGSLP V   GI+++RP+ W
Sbjct  3    ILGASGVEISAGLHWYLKNYCAAHISWAKTGGSQLSSVPYPGSLPRVPAGGILIQRPVDW  62

Query  340  SYYQNAVSSS  369
            SYYQNAV+SS
Sbjct  63   SYYQNAVTSS  72



>gb|KCW51927.1| hypothetical protein EUGRSUZ_J01382 [Eucalyptus grandis]
Length=111

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 4/78 (5%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            ISG   VE+++ L W LKY    HISW KT G+Q+ S+PK GSLP V DAG++V+RPIPW
Sbjct  34   ISGVFGVEVVACLRWCLKY----HISWDKTSGLQMHSIPKFGSLPCVHDAGVVVQRPIPW  89

Query  340  SYYQNAVSSSSKETPKTV  393
             Y QNA++SS K +P+ +
Sbjct  90   HYNQNAITSSCKISPRIL  107



>gb|KCW51928.1| hypothetical protein EUGRSUZ_J01382 [Eucalyptus grandis]
Length=138

 Score = 90.1 bits (222),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 4/81 (5%)
 Frame = +1

Query  151  EILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRP  330
            ++ ISG   VE+++ L W LKY    HISW KT G+Q+ S+PK GSLP V DAG++V+RP
Sbjct  58   QLTISGVFGVEVVACLRWCLKY----HISWDKTSGLQMHSIPKFGSLPCVHDAGVVVQRP  113

Query  331  IPWSYYQNAVSSSSKETPKTV  393
            IPW Y QNA++SS K +P+ +
Sbjct  114  IPWHYNQNAITSSCKISPRIL  134



>ref|XP_002503216.1| GH family 89 protein [Micromonas sp. RCC299]
 gb|ACO64474.1| GH family 89 protein [Micromonas sp. RCC299]
Length=1260

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 6/88 (7%)
 Frame = +1

Query  91   DGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTS  270
            +G  CF I N    +K G+  I I+G+T VE  +GLH YL+ +CGAH+ W  TGG QL S
Sbjct  57   EGARCFSIQNG---DKPGT--ISIAGSTGVEQAAGLHHYLRRFCGAHLGWEATGGHQLHS  111

Query  271  VPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
            VP+ GSLP V DAG++V  P   + Y N
Sbjct  112  VPR-GSLPPVDDAGVVVNLPFERTVYMN  138



>ref|XP_005645139.1| hypothetical protein COCSUDRAFT_37819 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20595.1| hypothetical protein COCSUDRAFT_37819 [Coccomyxa subellipsoidea 
C-169]
Length=762

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
             +L+R++  +S  F+   +P       ACF+++       T    I++ G + +E+ SG+
Sbjct  23   GLLDRILPEYSHLFELRALPDCDSIQSACFEVH-------TDGKRIVVKGASGIEMASGI  75

Query  199  HWYLKYWCGAHISWSKTGGVQL-TSVPKPGSLPHVQDAGIIV-KRPIPWSYYQNAVSSS  369
            HW+LKY C +  SW  TGG  + +S  KP SL  +  AG +   R +PWSYYQN V+ S
Sbjct  76   HWFLKYACNSSTSWHLTGGNNIDSSCFKPESLERISLAGPLRGARSVPWSYYQNVVTPS  134



>ref|XP_004347190.1| AlphaN-acetylglucosaminidase (NAGLU) [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21808.1| AlphaN-acetylglucosaminidase (NAGLU) [Acanthamoeba castellanii 
str. Neff]
Length=800

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +V++  + +H  SFDF ++P +   G+  F++    ++N +G           V L SGL
Sbjct  32   SVVDPQVEAHVDSFDFGLVPPQPHSGNDLFQLLPTHTVNGSG-----------VALASGL  80

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +WYLKY+C A ++W + G      +P P  LP V  A +++  P+ W YY N  + S
Sbjct  81   YWYLKYYCNASVTWGENGTGDNLVLPDP--LPQVATA-VVMNAPVRWRYYLNVCTVS  134



>gb|EYU29516.1| hypothetical protein MIMGU_mgv1a0184371mg, partial [Erythranthe 
guttata]
Length=279

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILIS  165
            YA ++RLI SH+SSF F I+ KE C G++CFK++N+P++N++GS EI+I 
Sbjct  17   YAAVSRLIPSHASSFQFNIVTKEFCGGESCFKLSNYPAVNRSGSPEIVID  66



>ref|XP_010027888.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X3 [Eucalyptus 
grandis]
Length=673

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  271  VPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            +PK GSLP V DAG+IV+RPIPWSYYQNAVSSS
Sbjct  1    MPKFGSLPRVHDAGVIVQRPIPWSYYQNAVSSS  33



>ref|WP_030563824.1| alpha-N-acetylglucosaminidase [Streptomyces aureocirculatus]
Length=1045

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/103 (37%), Positives = 53/103 (51%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +VLNR +  H+  F   ++P E  DG   F+++            I +SGTT   L +G+
Sbjct  53   SVLNRQLPHHAEQFKLRLVPAE--DGRDHFRVHG-------AKGRIEVSGTTPAVLCTGV  103

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            HWYLKY CGAHI+W+   G QL     +P P        +LPH
Sbjct  104  HWYLKYVCGAHIAWN---GSQLDLPRRLPAPARPLRRSTALPH  143



>ref|XP_008798054.1| PREDICTED: uncharacterized protein LOC103713067 [Phoenix dactylifera]
Length=130

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 8/82 (10%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKT-GSSEILISGTTAVELLSGL  198
            +L RL+ ++ + F F IIPK +    +       PS+N   GSSEIL      VEL +GL
Sbjct  55   LLGRLLPAYQARFGFEIIPKAKKWWKSMLHYQ-QPSINGIEGSSEIL------VELSAGL  107

Query  199  HWYLKYWCGAHISWSKTGGVQL  264
             W+LKYW  AH+S  KTG VQL
Sbjct  108  RWFLKYWYLAHVSREKTGCVQL  129



>ref|WP_037661705.1| alpha-N-acetylglucosaminidase [Streptomyces aurantiacus]
Length=1049

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 39/104 (38%), Positives = 52/104 (50%), Gaps = 24/104 (23%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            +VLNR +  H+  F   ++P            N       TG+S  I +SGTT   LL+G
Sbjct  55   SVLNRQLPHHADQFRLRLVPAR----------NGRDRFRVTGTSGRIEVSGTTPAVLLTG  104

Query  196  LHWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            +HWYLKY CGAHI+W+   G QL     +P P        +LPH
Sbjct  105  VHWYLKYVCGAHIAWN---GSQLDLPRRLPAPSRPLERSTALPH  145



>ref|WP_030360990.1| MULTISPECIES: alpha-N-acetylglucosaminidase [Streptomyces]
Length=1045

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            +VLNR +  H+  F   ++P  +  G   F++        TGS+  I +SGTT   LL+G
Sbjct  53   SVLNRRLPHHADQFRLRLVPARE--GRDRFRV--------TGSTGRIEVSGTTPAVLLTG  102

Query  196  LHWYLKYWCGAHISWS  243
            +HWYLKY CGAHI+W+
Sbjct  103  VHWYLKYVCGAHIAWN  118



>ref|WP_030687294.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL B-1347]
Length=1042

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            AVLNR +  H+  F   ++P     G   F++        TG  E+  SGTT   LL+G+
Sbjct  50   AVLNRRLPHHADQFRLRLVPARS--GRDRFRVTG-----ATGRVEV--SGTTPAVLLAGV  100

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            HWYLKY CGAH++W+   G QL     +P P        +LPH
Sbjct  101  HWYLKYVCGAHLAWN---GGQLNLPRRLPAPARPLTRSTALPH  140



>ref|WP_031069576.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL S-118]
Length=1023

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 11/75 (15%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F  + +     DG   F++   P         + ++GT+   LL+G+
Sbjct  40   AALERLLPGHADQFRLIPL----TDGPERFRVTGAPG-------RVEVAGTSPATLLTGV  88

Query  199  HWYLKYWCGAHISWS  243
            HWYLKY CGAHISWS
Sbjct  89   HWYLKYVCGAHISWS  103



>ref|WP_030786822.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL S-920]
Length=1040

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 61/128 (48%), Gaps = 26/128 (20%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            + LNRL+  H+  F   + P     G+  F++          +  I +SGTT   LL+G+
Sbjct  48   SALNRLLPRHAEQFRLRLRPAP--GGEDRFRVTG-------ATGRIEVSGTTPGVLLTGV  98

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH---VQDAGIIVKRPIP-  336
            HWYLKY CGAHI+W+   G QL     +P P        SLPH   + D       P   
Sbjct  99   HWYLKYVCGAHITWN---GGQLDLPRRLPAPARPLERSTSLPHRFALNDTNDGYTAPYAD  155

Query  337  WSYYQNAV  360
            W+Y++  +
Sbjct  156  WTYWERMI  163



>ref|WP_010987390.1| alpha-N-acetylglucosaminidase [Streptomyces avermitilis]
 ref|NP_827165.1| alpha-N-acetylglucosaminidase [Streptomyces avermitilis MA-4680 
= NBRC 14893]
 dbj|BAC73700.1| putative alpha-N-acetylglucosaminidase, secreted [Streptomyces 
avermitilis MA-4680 = NBRC 14893]
Length=1038

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 9/75 (12%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            + LNRL+  H+  F   ++ + +  G   F++         G+  I +SGTT   LL+G+
Sbjct  47   SALNRLLPGHAGQFRLSLVGRTR--GRDRFRVTG-------GTGRIQVSGTTPAVLLTGV  97

Query  199  HWYLKYWCGAHISWS  243
            HWYLKY CGAH++W+
Sbjct  98   HWYLKYVCGAHLAWN  112



>ref|WP_028433739.1| alpha-N-acetylglucosaminidase [Streptomyces sp. TAA204]
Length=1037

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 51/99 (52%), Gaps = 12/99 (12%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A   RL+  HS    F  +P    DG   F+++        GS E+  +GT+    L+GL
Sbjct  48   AAARRLLPDHSGQIKFTALP----DGGERFRVSG-----SEGSIEV--AGTSPAVTLTGL  96

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            HWYLKY C AHISW+ +       +P P S PH ++A +
Sbjct  97   HWYLKYTCRAHISWAGSQLELPAQLPAPQS-PHEREATV  134



>ref|WP_009328151.1| Tat pathway signal sequence domain protein [Streptomyces ipomoeae]
 gb|EKX62401.1| Tat pathway signal sequence domain protein [Streptomyces ipomoeae 
91-03]
Length=1042

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A LNRL+  H+  F   ++ +E   GD  F+++        G+  + +  TT   LL G+
Sbjct  47   AALNRLLPGHADQFRLTLVRREGT-GDR-FRVSG-------GTGRVQVQATTPATLLMGV  97

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            HWYLKY CGAH++W+   G QL     +P P        +LPH
Sbjct  98   HWYLKYVCGAHLAWN---GSQLDLPRRLPAPARPLERSTALPH  137



>ref|WP_019545934.1| hypothetical protein [Streptomyces sulphureus]
Length=1050

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 13/100 (13%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            A L RL+  H+  F   ++       D  F++        TGS  +I ++GTT   +L+G
Sbjct  57   AALARLLPDHTEQFTLTLL---DAGTDDRFRV--------TGSQGDIRVAGTTPAAILTG  105

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            +HWYLKY C AHISW+ T      ++P P S P+ Q A +
Sbjct  106  VHWYLKYTCHAHISWAGTRLDLPETLPAPSS-PYEQRATV  144



>ref|XP_004987699.1| alpha-N-acetylglucosaminidase [Salpingoeca rosetta]
 gb|EGD81303.1| alpha-N-acetylglucosaminidase [Salpingoeca rosetta]
Length=696

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 61/116 (53%), Gaps = 7/116 (6%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLH  201
            V  RL     + F+F +I     D   CF++ N    + T +S + I GT+ VE+ +GL+
Sbjct  68   VRRRLGSDALNHFEFYLINTTH-DETLCFELAN----SNTNASVVTIGGTSPVEMATGLN  122

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            ++L+ +     SW+KTGG  +   P P ++P V      V +   ++YYQN V+ S
Sbjct  123  FFLREYLHMSFSWNKTGGDVIH--PLPATMPVVHSHHAHVNKTTFYTYYQNVVTVS  176



>ref|WP_016906832.1| hypothetical protein [Streptomyces xiaopingdaonensis]
Length=1050

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 12/91 (13%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGS-SEILISGTTAVELLSG  195
            A L RL+  H+  F   ++       D  F++        TGS  +I ++GTT   +L+G
Sbjct  57   AALARLLPDHAEQFTLTLL---DAGADDRFRV--------TGSRGDIRVAGTTPAAMLTG  105

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGS  288
            +HWYLKY C AHISW+ T      ++P P S
Sbjct  106  VHWYLKYTCHAHISWAGTRLDLPATLPAPSS  136



>gb|KHN16294.1| hypothetical protein glysoja_030269 [Glycine soja]
Length=152

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  157  LISGTTAVELLSGLHWYLKYWCGAHISWSKTGG  255
            LI GTT V++++GLHWYLK+W G+H+SW K  G
Sbjct  98   LIEGTTGVDIVAGLHWYLKHWRGSHVSWDKRDG  130



>ref|WP_030570988.1| alpha-N-acetylglucosaminidase [Streptomyces sclerotialus]
Length=1041

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 66/129 (51%), Gaps = 28/129 (22%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            + LNRL+  H+  F   ++ + +  GD  F++        TG++  I +SGTT   LL+G
Sbjct  47   SALNRLLPRHADQFVLRLV-EGRGTGDR-FRV--------TGTTGRIQVSGTTPATLLTG  96

Query  196  LHWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH---VQDAGIIVKRPIP  336
            +HWYLKY CGAH++W+   G QL     +P P        +LPH   + D       P  
Sbjct  97   VHWYLKYVCGAHLAWN---GDQLDLPRRLPAPARPLERSTALPHRFALNDTNDGYTAPYA  153

Query  337  -WSYYQNAV  360
             W+Y++  +
Sbjct  154  DWAYWEREI  162



>ref|WP_037793649.1| alpha-N-acetylglucosaminidase [Streptomyces sp. CNT360]
Length=1063

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 15/105 (14%)
 Frame = +1

Query  4    SEERYAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAV  180
            S+     L RL+  H+    F     ++  G   F++        TGS+ +I ++GT  V
Sbjct  60   SDTARQALQRLLPRHAGQVTF-----QEITGAERFEV--------TGSAGQIKVAGTGPV  106

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
             +L+GLHWYLKY C AHISWS +      ++P P +  H Q A +
Sbjct  107  AMLTGLHWYLKYSCDAHISWSGSNLELPKTLPAPRA-QHAQKATV  150



>ref|WP_028811329.1| alpha-N-acetylglucosaminidase [Streptomyces flavidovirens]
Length=1057

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 3/77 (4%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H++ F    +  +   G   F++     +  T +  I ++GT+    L+G+
Sbjct  51   AALERLLPDHAAQFRLTTL--KSGGGHDRFRVEGVEGVEGT-TGRIEVAGTSPAAALTGV  107

Query  199  HWYLKYWCGAHISWSKT  249
            HWYLKY CGAHISWS T
Sbjct  108  HWYLKYVCGAHISWSGT  124



>ref|WP_031508536.1| alpha-N-acetylglucosaminidase [Streptomyces megasporus]
Length=1031

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 36/98 (37%), Positives = 51/98 (52%), Gaps = 17/98 (17%)
 Frame = +1

Query  4    SEERYAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAV  180
            +E   A L RL+  H   F   + P    DG   F++        TG++  I ++GT+  
Sbjct  35   TEPARAALGRLLPDHVDQFH--LTPLSATDGAERFRV--------TGTAGRIEVAGTSPA  84

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQL---TSVPKPG  285
             LL+G+HWYLK  C AHISW+   G QL   T++P P 
Sbjct  85   VLLTGVHWYLKEVCSAHISWA---GSQLNLPTTLPAPA  119



>ref|XP_005105870.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Aplysia californica]
Length=628

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 13/123 (11%)
 Frame = +1

Query  1    RSEERYAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAV  180
            + E    V++RL+   ++ FD  + P      D   K  +   L+ T   +ILI GTT V
Sbjct  43   QREAARGVISRLVKDRAADFDVDVNP------DLGPKERDTFRLSSTKDGKILIEGTTGV  96

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAV  360
             +  GL++Y+KYWC A  +W+     Q T +P   +LP ++   +I      + YY+N  
Sbjct  97   AVSMGLYYYIKYWCNAQRTWAG----QQTELPP--TLPVIEKPVVITSND-RFRYYKNVC  149

Query  361  SSS  369
            + S
Sbjct  150  TES  152



>ref|WP_037975346.1| alpha-N-acetylglucosaminidase [Streptomyces sp. TAA486]
Length=1046

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 12/99 (12%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A + RL+  H     F ++      G   FK++         +  I I+GT+    L+GL
Sbjct  58   AAVQRLLPDHDDQISFTVL----TGGKERFKVSGR-------AGAIEIAGTSPAVALTGL  106

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            HWYLKY C +HISW+ +       +P PGS P+ + A +
Sbjct  107  HWYLKYTCASHISWAGSQTDLPKQLPAPGS-PYERSATV  144



>gb|KCW66077.1| hypothetical protein EUGRSUZ_G03358 [Eucalyptus grandis]
Length=696

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  QLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            ++ S+PK GSLP ++  G++++RP+PW+YYQN V+SS
Sbjct  68   KVASIPKAGSLPRLKGKGVMIQRPVPWNYYQNVVTSS  104



>ref|WP_013992396.1| alpha-N-acetylglucosaminidase [Zobellia galactanivorans]
 ref|YP_004735475.1| alpha-N-acetylglucosaminidase [Zobellia galactanivorans]
 emb|CAZ95084.1| Alpha-N-acetylglucosaminidase, family GH89 [Zobellia galactanivorans]
Length=747

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 36/110 (33%), Positives = 55/110 (50%), Gaps = 17/110 (15%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y +LNR++   +SSF F  I   + D D     N H       + +I+ISG +AV + SG
Sbjct  30   YGILNRILPERASSFVFKEITASK-DKDVFEVSNGH-------AGKIVISGNSAVAMASG  81

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSY  345
            L WYLK +C AHIS      +    +  P +LP +      +++  P+ Y
Sbjct  82   LDWYLKNYCNAHIS------LNYNQLDLPKTLPRLTSK---IRKETPFDY  122



>gb|KCW66076.1| hypothetical protein EUGRSUZ_G03358 [Eucalyptus grandis]
Length=742

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  259  QLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            ++ S+PK GSLP ++  G++++RP+PW+YYQN V+SS
Sbjct  68   KVASIPKAGSLPRLKGKGVMIQRPVPWNYYQNVVTSS  104



>ref|WP_037838998.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL F-5639]
Length=1046

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 15/98 (15%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSGLH  201
            + RL+  H+  F F     ++  G   FK+        TGS+  I ++GT  V +L+G+H
Sbjct  61   VRRLLPRHAGQFTF-----QEIGGPERFKV--------TGSAGRIRVAGTGPVAMLTGVH  107

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            WYLKY C AHISW+ +      ++P P +  H Q A +
Sbjct  108  WYLKYSCDAHISWAGSRLDLPATLPAPRA-QHAQRATV  144



>ref|WP_037834967.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL F-5917]
Length=1046

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 15/98 (15%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSGLH  201
            + RL+  H+  F F     ++  G   FK+        TGS+  I ++GT  V +L+G+H
Sbjct  61   VRRLLPRHAGQFTF-----QEIGGPERFKV--------TGSAGRIRVAGTGPVAMLTGVH  107

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            WYLKY C AHISW+ +      ++P P +  H Q A +
Sbjct  108  WYLKYSCDAHISWAGSRLDLPATLPAPRA-QHAQRATV  144



>ref|WP_033230387.1| MULTISPECIES: alpha-N-acetylglucosaminidase [Streptomyces]
Length=1046

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 15/98 (15%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSGLH  201
            + RL+  H+  F F     ++  G   FK+        TGS+  I ++GT  V +L+G+H
Sbjct  61   VRRLLPRHAGQFTF-----QEIGGPERFKV--------TGSAGRIRVAGTGPVAMLTGVH  107

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            WYLKY C AHISW+ +      ++P P +  H Q A +
Sbjct  108  WYLKYSCDAHISWAGSRLDLPATLPAPRA-QHAQRATV  144



>gb|EPD95541.1| hypothetical protein HMPREF1486_01738 [Streptomyces sp. HPH0547]
Length=1064

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 15/98 (15%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSGLH  201
            + RL+  H+  F F     ++  G   FK+        TGS+  I ++GT  V +L+G+H
Sbjct  79   VRRLLPRHAGQFTF-----QEIGGPERFKV--------TGSAGRIRVAGTGPVAMLTGVH  125

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGI  315
            WYLKY C AHISW+ +      ++P P +  H Q A +
Sbjct  126  WYLKYSCDAHISWAGSRLDLPATLPAPRA-QHAQRATV  162



>ref|XP_005105869.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Aplysia 
californica]
Length=658

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 13/123 (11%)
 Frame = +1

Query  1    RSEERYAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAV  180
            + E    V++RL+   ++ FD  + P      D   K  +   L+ TG   ILI GTT V
Sbjct  52   QREAARGVISRLVKDRAADFDVDVNP------DLGPKERDTFRLSSTGDGRILIEGTTGV  105

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAV  360
             +  G + Y+KYWC A  +W+     Q T +P   +LP ++   +I      + YY+N  
Sbjct  106  AVSMGFYHYIKYWCNAQRTWAG----QQTELPP--TLPVIEKPVVITSND-RFRYYKNVC  158

Query  361  SSS  369
            + S
Sbjct  159  TES  161



>ref|WP_030838665.1| alpha-N-acetylglucosaminidase [Streptomyces hygroscopicus]
Length=1044

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+ +H+  F  L+ P E+  G+  F++       +TG   + +SGT+   LL+G+
Sbjct  51   AALRRLLPAHADQFR-LVAPAER-GGEERFEVGG-----RTG--RLTVSGTSPAVLLTGV  101

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            HWYLKY C A I+WS   G QL     +P P        +LPH
Sbjct  102  HWYLKYTCRAQITWS---GDQLNLPERLPAPARRLTRSTALPH  141



>ref|WP_029711569.1| hypothetical protein [BRC1 bacterium SCGC AAA257-C11]
Length=740

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 20/109 (18%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQ-CDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            VL RLI  H   F    IP+++ CD    F+I +          +I++ G+  V + S L
Sbjct  48   VLERLIPQHVHQFVLETIPQDKGCD---VFEIESR-------GKKIVLRGSNGVSICSAL  97

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSY  345
            +WYLKY C AH+SW+   G QL     P SLP V++    ++R  P  Y
Sbjct  98   NWYLKYHCQAHVSWN---GSQLH---LPESLPVVKEK---IRRVSPHKY  137



>ref|WP_018530625.1| alpha-N-acetylglucosaminidase [Streptomyces sp. HmicA12]
Length=1035

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 22/123 (18%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDF-LIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            A L R +  H+  F   L+ P+   D    F+++            I + GTT   LL+G
Sbjct  44   AALKRQLPHHADQFRLRLLAPQGGADR---FRVSG-------TRGRIEVYGTTPATLLAG  93

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPG-------SLPH---VQDAGIIVKRPIP-WS  342
            +HWYLKY CGAHI+W+ +       +P P        SLPH   + D       P   WS
Sbjct  94   VHWYLKYVCGAHIAWNGSQLELPNRLPAPSRPLERSTSLPHRFALNDTNDGYTAPFADWS  153

Query  343  YYQ  351
            Y++
Sbjct  154  YWE  156



>ref|WP_022218286.1| putative uncharacterized protein [Bacteroides clarus CAG:160]
 emb|CDB83839.1| putative uncharacterized protein [Bacteroides clarus CAG:160]
Length=759

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 15/105 (14%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y ++ R+   ++S ++  +I  EQ +G   ++I  +         +I++ G  AV L S 
Sbjct  30   YGLIERITPGYASQYELELI--EQTEGKDVYEIEGN-------GRKIILRGNNAVSLASA  80

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRP  330
             +WYLKY C AH+SW    G QL     P  LP   D   IV  P
Sbjct  81   FNWYLKYTCNAHVSWF---GNQLN---LPDILPQPADKQRIVIEP  119



>ref|XP_003703688.1| PREDICTED: alpha-N-acetylglucosaminidase [Megachile rotundata]
Length=744

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 9/78 (12%)
 Frame = +1

Query  130  LNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDA  309
            + KT S++I I GT+ V +  GLH+YLK++C AHISW    G QL     P +LP   D 
Sbjct  59   IEKTSSNQIKIVGTSGVAVSWGLHYYLKHYCNAHISWE---GNQLH---LPSTLP---DV  109

Query  310  GIIVKRPIPWSYYQNAVS  363
             + V     + YYQN  S
Sbjct  110  HVKVTSNDRFRYYQNVCS  127



>ref|WP_030382558.1| MULTISPECIES: alpha-N-acetylglucosaminidase [Streptomyces]
Length=1041

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 17/95 (18%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            + LNRL+  H++ F   + P     G   F++        TG++  I ++GT+   LL G
Sbjct  50   SALNRLLPDHAAQFH--LTPLRPSGGHDRFQV--------TGTTGRIGVAGTSPAVLLHG  99

Query  196  LHWYLKYWCGAHISWSKTGGVQLT---SVPKPGSL  291
             HWYLKY CGAH++W+   G QL     +P P  L
Sbjct  100  THWYLKYVCGAHLAWN---GSQLDLPHRLPAPARL  131



>gb|EPH41927.1| hypothetical protein STRAU_5027 [Streptomyces aurantiacus JA 
4570]
Length=966

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 14/64 (22%)
 Frame = +1

Query  139  TGSS-EILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------  285
            TG+S  I +SGTT   LL+G+HWYLKY CGAHI+W+   G QL     +P P        
Sbjct  2    TGTSGRIEVSGTTPAVLLTGVHWYLKYVCGAHIAWN---GSQLDLPRRLPAPSRPLERST  58

Query  286  SLPH  297
            +LPH
Sbjct  59   ALPH  62



>ref|XP_004209763.1| PREDICTED: alpha-N-acetylglucosaminidase-like, partial [Hydra 
vulgaris]
Length=220

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 12/123 (10%)
 Frame = +1

Query  1    RSEERYAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAV  180
            + E    ++ RL+ +H+S F  + I K   D +      ++  +  T +  I ++G+T V
Sbjct  49   QKESVIQLIKRLVPAHASKF-IISINKNYVDSE----FADYFEIVSTTNGNIKVTGSTGV  103

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAV  360
               +G + YLKYWC AHISWS   G  L ++P    L H     +  +R   + YYQN  
Sbjct  104  AAAAGFYHYLKYWCFAHISWS---GNHL-NIPINLPLVHSPVKKVFYER---FRYYQNVC  156

Query  361  SSS  369
            + S
Sbjct  157  TVS  159



>ref|WP_006137864.1| alpha-N-acetylglucosaminidase [Streptomyces griseoaurantiacus]
 gb|EGG49637.1| alpha-N-acetylglucosaminidase [Streptomyces griseoaurantiacus 
M045]
Length=1017

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 22/126 (17%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            + LNRL+  H+  F   + P     G   F++        TG  E+  +GT+   LL G 
Sbjct  26   SALNRLLPDHAGQFR--LTPLRPSGGRERFRVTG-----TTGRVEV--AGTSPAVLLHGA  76

Query  199  HWYLKYWCGAHISWSKTGGVQLT-SVPKPG-------SLPH---VQDAGIIVKRPIP-WS  342
            HWYLKY CGAH++W+  G + L   +P P        +LPH   + D       P   W 
Sbjct  77   HWYLKYVCGAHLAWNG-GTLDLPRRLPAPARPLERSTALPHRFALNDTNDGYTAPYADWP  135

Query  343  YYQNAV  360
            Y+Q+ +
Sbjct  136  YWQHEI  141



>ref|WP_030083639.1| alpha-N-acetylglucosaminidase, partial [Streptomyces decoyicus]
Length=798

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 47/100 (47%), Gaps = 16/100 (16%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F   ++P     G   F++          +  I +SGTT   LL+G+
Sbjct  54   AALARLLPRHADQFQ--LVPLAPDGGADRFRVQGR-------AGRITVSGTTPAVLLTGV  104

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPG-------SLPH  297
            +WYLKY C AH+SW+         +P P        SLPH
Sbjct  105  NWYLKYTCRAHLSWAGDQTALPDRLPAPASPMERATSLPH  144



>ref|XP_001081442.1| PREDICTED: alpha-N-acetylglucosaminidase [Rattus norvegicus]
 ref|XP_002727861.2| PREDICTED: alpha-N-acetylglucosaminidase [Rattus norvegicus]
 gb|EDM06079.1| rCG33377, isoform CRA_b [Rattus norvegicus]
Length=739

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL+  G   +L+ G++ V   +GLH YL+ +CG HI+WS +   QL  +P P  LP V D
Sbjct  64   SLSGGGGVPVLVRGSSGVAAAAGLHRYLRDFCGCHIAWSSS---QL-HLPSP--LPAVPD  117

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
             G+    P  + YYQN  + S
Sbjct  118  -GLTEATPNRYRYYQNVCTHS  137



>ref|XP_001865888.1| alpha-N-acetyl glucosaminidase [Culex quinquefasciatus]
 gb|EDS42452.1| alpha-N-acetyl glucosaminidase [Culex quinquefasciatus]
Length=761

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 17/116 (15%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLH  201
            +++R++   +S F   +        D+  K N+      + SS +LI G++ V    G +
Sbjct  48   LISRIVPERASQFKVTV--------DSALKPNSFKITKTSDSSVVLIVGSSGVAASKGFY  99

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
             YLKY+CG H+SW    G QL     P  LP+V    + V+ P    YYQN  + S
Sbjct  100  HYLKYYCGCHVSWD---GDQLD---LPDDLPNVN---VSVEAPSSIVYYQNVCTWS  146



>ref|XP_004342502.1| alpha-N-acetylglucosaminidase family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20308.1| alpha-N-acetylglucosaminidase family protein [Acanthamoeba castellanii 
str. Neff]
Length=854

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 3/76 (4%)
 Frame = +1

Query  142  GSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIV  321
            G +++ I G++ V L SGLHWYLKY C   +SW   G     ++  P  LP +    + +
Sbjct  103  GVTQVQIQGSSGVALASGLHWYLKYSCNCSVSWGVAGSGN--NLALPSRLPALSKP-LAM  159

Query  322  KRPIPWSYYQNAVSSS  369
            + P+ + YY N  + S
Sbjct  160  QSPVKYRYYLNVCTHS  175



>ref|WP_006606025.1| alpha-N-acetylglucosaminidase [Streptomyces auratus]
 gb|EJJ04702.1| alpha-N-acetylglucosaminidase [Streptomyces auratus AGR0001]
Length=1048

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 46/92 (50%), Gaps = 15/92 (16%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F  + +  +   GD  F++          +  I ++GTT   LL+G+
Sbjct  41   AALTRLLPRHADQFQLVALAPDGT-GDR-FRVEGR-------AGRITVAGTTPAVLLTGV  91

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLP  294
            HWYLKY C AH+SW+         V  PG LP
Sbjct  92   HWYLKYTCRAHLSWAG------DQVELPGRLP  117



>ref|XP_001656341.1| alpha-n-acetylglucosaminidase [Aedes aegypti]
 gb|EAT45604.1| AAEL003150-PA [Aedes aegypti]
Length=763

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 9/88 (10%)
 Frame = +1

Query  106  FKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPG  285
             K+N+   L    S+ + I+G+  V    G ++YLKY+CG H+SW    G QL     P 
Sbjct  69   LKLNSFKILKTNDSTSVSITGSNGVAAAKGFYYYLKYYCGCHVSWD---GDQLN---LPD  122

Query  286  SLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
             LP V    + ++ P    YYQN  + S
Sbjct  123  DLPEVD---VEIQAPSSIVYYQNVCTWS  147



>ref|WP_033527443.1| alpha-N-acetylglucosaminidase [Streptomyces galbus]
Length=1042

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 49/103 (48%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            + LNRL+  H+  F   ++       D    ++       TGS  I +  TT   LL G+
Sbjct  47   SALNRLLPGHAGQFRLSLL-------DRSGTVDRFRVTGTTGS--IRVQATTPATLLMGV  97

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            HWYLKY CGAH++W+   G QL     +P P        +LPH
Sbjct  98   HWYLKYVCGAHLAWN---GSQLDLPRRLPAPARPLERSTALPH  137



>ref|WP_037792352.1| alpha-N-acetylglucosaminidase, partial [Streptomyces natalensis]
Length=620

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 7/58 (12%)
 Frame = +1

Query  145  SSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGS-------LPH  297
            +  I ++GTT   LL+G+HWYLKY C AH+SW+         +P P S       LPH
Sbjct  16   TGRITVAGTTPATLLTGVHWYLKYTCHAHLSWAGDQAALPARLPAPSSPVERATPLPH  73



>ref|WP_027759705.1| alpha-N-acetylglucosaminidase [Streptomyces sp. CNT318]
Length=1040

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+       I  ++  G   FK+         G+  I ++GT  V LL+G+
Sbjct  53   AALRRLLPRHADQ-----ITLQRIGGPERFKVTG-------GAGRIRVAGTGPVALLTGV  100

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKP  282
            HWYLKY C AH+SW+ +      ++P P
Sbjct  101  HWYLKYSCDAHLSWAGSRLDLPETLPAP  128



>ref|WP_019358703.1| hypothetical protein [Streptomyces sp. AA1529]
Length=1040

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+       I  ++  G   FK+         G+  I ++GT  V LL+G+
Sbjct  53   AALRRLLPRHADQ-----ITLQRIGGPERFKVTG-------GAGRIRVAGTGPVALLTGV  100

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKP  282
            HWYLKY C AH+SW+ +      ++P P
Sbjct  101  HWYLKYSCDAHLSWAGSRLDLPETLPAP  128



>ref|XP_008191832.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Tribolium 
castaneum]
 gb|EFA02249.1| hypothetical protein TcasGA2_TC007912 [Tribolium castaneum]
Length=747

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 52/116 (45%), Gaps = 16/116 (14%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLH  201
            ++ RLI   +  FD  I P    +    FKI     L       I I+GTT V   +G +
Sbjct  37   LIKRLIPGQAQFFDIKIQPDLNHEDKDAFKIEKIGDL-------IQITGTTGVAAATGFN  89

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
             YLKY+C  H+SW      + T +  P  LP V     +  R   + YYQN  ++S
Sbjct  90   HYLKYFCNCHVSW------ETTQLKVPEVLPEVNLTITLNDR---FRYYQNVCTTS  136



>ref|XP_973259.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Tribolium 
castaneum]
Length=747

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 52/116 (45%), Gaps = 16/116 (14%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLH  201
            ++ RLI   +  FD  I P    +    FKI     L       I I+GTT V   +G +
Sbjct  37   LIKRLIPGQAQFFDIKIQPDLNHEDKDAFKIEKIGDL-------IQITGTTGVAAATGFN  89

Query  202  WYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
             YLKY+C  H+SW      + T +  P  LP V     +  R   + YYQN  ++S
Sbjct  90   HYLKYFCNCHVSW------ETTQLKVPEVLPEVNLTITLNDR---FRYYQNVCTTS  136



>ref|WP_030875804.1| alpha-N-acetylglucosaminidase [Streptomyces varsoviensis]
Length=1043

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 48/89 (54%), Gaps = 11/89 (12%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F   ++P     G+  F+++         + E+ ++GT+    L+G+
Sbjct  51   AALGRLLPRHADQFR--LVPLH--GGEERFEVSGR-------AGEVEVAGTSPAVQLTGV  99

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPG  285
            HWYLKY CGAH++W+ +       +P PG
Sbjct  100  HWYLKYVCGAHLTWNGSQTDLPRRLPSPG  128



>ref|WP_030990729.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL S-1813]
Length=1053

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 9/90 (10%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F   ++P     G   F++       +TG   I +SGTT   LL+G+
Sbjct  54   AALARLLPRHADQFQ--LVPLAPDGGADRFRV-----AGRTG--RITVSGTTPAVLLTGV  104

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGS  288
            +WYLKY C AH+SW+         +P P S
Sbjct  105  NWYLKYTCRAHLSWAGDQTALPDRLPAPAS  134



>ref|WP_030892161.1| MULTISPECIES: alpha-N-acetylglucosaminidase [Streptomyces]
Length=1045

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  145  SSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKP  282
            +  I + GT  V LL+G+HWYLKY C AHISWS T      ++P P
Sbjct  88   AGRITVQGTGPVALLTGVHWYLKYSCDAHISWSGTQLELPATLPAP  133



>ref|WP_030813691.1| alpha-N-acetylglucosaminidase [Streptomyces sp. NRRL S-337]
Length=1055

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 9/90 (10%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F   ++P         F+++         +  + ++GT+   LL+G+
Sbjct  47   AALERLLPEHADQFR--LVPLAAAGHADRFRVDG-------TAGRVTVAGTSPATLLTGV  97

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGS  288
            HWYLKY C AH+SW+       T++P P S
Sbjct  98   HWYLKYTCRAHLSWAGDQVELPTTLPAPRS  127



>ref|XP_006963236.1| glycoside hydrolase family 89 [Trichoderma reesei QM6a]
 gb|EGR50662.1| glycoside hydrolase family 89 [Trichoderma reesei QM6a]
 gb|ETS05605.1| putative alpha-N-acetylglucosaminidase [Trichoderma reesei RUT 
C-30]
Length=747

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 10/117 (9%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +++ R +  H  SF+F++ P           +N+  +++ T + ++ I GTT   LLSGL
Sbjct  30   SLVKRRLPQHVDSFEFVLEPPH-----GSVVVNDSYTVSSTKNGKVRIEGTTTSALLSGL  84

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            H YL     A I W    G QL   PK  +LP ++ A I     +P+ YY N V++S
Sbjct  85   HKYLSSEANADIWWFI--GSQLDQTPK--NLPKLR-APIKGSSVVPYRYYWNTVTTS  136



>ref|XP_008436404.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X2 [Poecilia 
reticulata]
Length=763

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 17/119 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDG-DACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+ + S+ F   +      D  D C        L    +++I+ +G+T V L SG
Sbjct  45   GLLRRLLGNRSTEFIVSVNRSLSNDSLDVC-------ELRSAKNNKIVATGSTGVALASG  97

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGII-VKRPIPWSYYQNAVSSS  369
            ++ YLKY+C  H+SWS   G QL  VP P  LP  Q  G++ +  P  + YYQN  + S
Sbjct  98   IYNYLKYFCNCHVSWS---GNQL-EVPSP--LP--QLTGVLRINTPHRFRYYQNVCTVS  148



>ref|XP_007558657.1| PREDICTED: alpha-N-acetylglucosaminidase-like isoform X1 [Poecilia 
formosa]
Length=763

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 17/119 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDG-DACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+ + S+ F   +      D  D C        L    +++I+ +G+T V L SG
Sbjct  45   GLLRRLLGNRSTEFIVSVNRSLSNDSLDVC-------ELRSAKNNKIVATGSTGVALASG  97

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGII-VKRPIPWSYYQNAVSSS  369
            ++ YLKY+C  H+SWS   G QL  VP P  LP  Q  G++ +  P  + YYQN  + S
Sbjct  98   IYNYLKYFCNCHVSWS---GNQL-EVPSP--LP--QLTGVLRINTPHRFRYYQNVCTVS  148



>ref|WP_037693934.1| alpha-N-acetylglucosaminidase [Streptomyces scabiei]
 gb|KFG00272.1| alpha-N-acetylglucosaminidase [Streptomyces scabiei]
Length=1042

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 49/103 (48%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            + LNRL+  H+  F   ++       D    ++       TG   I +  TT   LL G+
Sbjct  47   SALNRLLPGHAGQFRLSLL-------DRSATVDRFRVTGTTG--RIQVQATTPATLLMGV  97

Query  199  HWYLKYWCGAHISWSKTGGVQL---TSVPKPG-------SLPH  297
            HWYLKY CGAH++W+   G QL   + +P P        +LPH
Sbjct  98   HWYLKYVCGAHLAWN---GSQLDLPSRLPAPARPLERSTALPH  137



>ref|WP_037965046.1| alpha-N-acetylglucosaminidase [Streptomyces sp. PRh5]
 gb|EXU61997.1| alpha-N-acetylglucosaminidase [Streptomyces sp. PRh5]
Length=1044

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 48/93 (52%), Gaps = 17/93 (18%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDA-CFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            A L RL+ +H+  F  + + K    GD   F++          +  + +SGT+   LL+G
Sbjct  51   AALRRLLPAHADQFRLVALEKR---GDEERFEVGG-------AAGRLTVSGTSPAVLLTG  100

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLP  294
            +HWYLKY C A I+WS   G QL     PG LP
Sbjct  101  VHWYLKYTCHAQITWS---GDQLN---LPGKLP  127



>emb|CDR10964.1| alpha-N-acetylglucosaminidase [Streptomyces iranensis]
Length=1044

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 46/92 (50%), Gaps = 15/92 (16%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F  + + K     +  F++          +  + +SGT+   LL+G+
Sbjct  51   AALRRLLPEHTDQFRLVALEKR--GAEERFEVGG-------SAGRLTVSGTSPAVLLTGV  101

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLP  294
            HWYLKY C A I+WS   G QL     PG LP
Sbjct  102  HWYLKYTCHAQITWS---GDQLN---LPGKLP  127



>ref|WP_009718529.1| putative alpha-N-acetylglucosaminidase, partial [Streptomyces 
himastatinicus]
 gb|EFL26729.1| LOW QUALITY PROTEIN: putative alpha-N-acetylglucosaminidase [Streptomyces 
himastatinicus ATCC 53653]
Length=679

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 49/104 (47%), Gaps = 23/104 (22%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            A L RL+  H+  F  + +P  +                 TGS+  I ++GT+   LL+G
Sbjct  11   AALRRLLPDHAEQFRLVALPGGK---------GKKERFEVTGSTGRITVAGTSPAVLLTG  61

Query  196  LHWYLKYWCGAHISWSKTGGVQL---TSVPKPG-------SLPH  297
            +HWYLKY C   I+W+   G QL     +P PG       +LPH
Sbjct  62   VHWYLKYTCHTQITWA---GDQLELPKKLPAPGGTVERSTALPH  102



>ref|XP_008436403.1| PREDICTED: alpha-N-acetylglucosaminidase isoform X1 [Poecilia 
reticulata]
Length=796

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 17/119 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDG-DACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
             +L RL+ + S+ F   +      D  D C        L    +++I+ +G+T V L SG
Sbjct  78   GLLRRLLGNRSTEFIVSVNRSLSNDSLDVC-------ELRSAKNNKIVATGSTGVALASG  130

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGII-VKRPIPWSYYQNAVSSS  369
            ++ YLKY+C  H+SWS   G QL  VP P  LP  Q  G++ +  P  + YYQN  + S
Sbjct  131  IYNYLKYFCNCHVSWS---GNQL-EVPSP--LP--QLTGVLRINTPHRFRYYQNVCTVS  181



>ref|WP_030617766.1| alpha-N-acetylglucosaminidase [Streptomyces sclerotialus]
Length=1050

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 16/94 (17%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDA-CFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            A L RL+  H+  F   + P+++  G +  F++   P         I ++GT+   +L+G
Sbjct  60   AALQRLLPQHADQFR--LTPQKRAAGTSERFRVTGAPG-------RIEVTGTSPAAMLTG  110

Query  196  LHWYLKYWCGAHISWSKTGGVQL---TSVPKPGS  288
            ++WYLKY C AHISW+   G QL     +P P S
Sbjct  111  VNWYLKYVCQAHISWA---GEQLDLPAKLPAPKS  141



>ref|WP_033270781.1| alpha-N-acetylglucosaminidase [Streptomyces lydicus]
Length=1039

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 50/103 (49%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+  H+  F   ++P     G   F+++            I ++GTT   LL+G+
Sbjct  43   AALERLLPGHAEQF--ALVPLAGEGGTDRFRVSG-------AEGRITVAGTTPAVLLTGV  93

Query  199  HWYLKYWCGAHISWSKTGGVQL---TSVPKPGS-------LPH  297
            +WYLKY C AH+SW+   G QL     +P P S       LPH
Sbjct  94   NWYLKYTCRAHLSWA---GEQLRLPARLPAPDSPVERATALPH  133



>gb|KDR09306.1| Alpha-N-acetylglucosaminidase [Zootermopsis nevadensis]
Length=782

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 14/123 (11%)
 Frame = +1

Query  1    RSEERYAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAV  180
            +++    V+ RLI   +  F   + P+    G   FK+     L + G   + + GT+ V
Sbjct  42   QAQAATGVIKRLIPDKAELFQVTVDPRLGPVGKDTFKV-----LKENGQDRVNLVGTSGV  96

Query  181  ELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAV  360
              + G H YLKY+C  H+SW      QL+    P  LP V      V R   + YYQN  
Sbjct  97   AAVWGFHHYLKYYCFCHVSWDSD---QLS---LPEKLPPVNITVTSVDR---FRYYQNVC  147

Query  361  SSS  369
            ++S
Sbjct  148  TTS  150



>ref|WP_005929485.1| hypothetical protein [Bacteroides salyersiae]
 gb|EOA49534.1| hypothetical protein HMPREF1532_02396 [Bacteroides salyersiae 
WAL 10018 = DSM 18765 = JCM 12988]
Length=728

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 16/118 (14%)
 Frame = +1

Query  16   YAVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            Y +  RL+ +++SSF F     EQ   D+ F       L +T   +I+I G   V +  G
Sbjct  26   YGLAERLLPANNSSFVF-----EQLSSDSDFF-----ELEQTTEDKIIIRGNNGVSMARG  75

Query  196  LHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQNAVSSS  369
            L+ YL+ +C   +SW    G  L+ +P+P  LP V++  I +    P+ YY N  + S
Sbjct  76   LNHYLRNYCHRSVSWC---GNNLSDLPEP--LPPVKEK-IRIDASFPYRYYLNYCTYS  127



>ref|XP_003786703.1| PREDICTED: alpha-N-acetylglucosaminidase [Otolemur garnettii]
Length=756

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL+  G + + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V +
Sbjct  66   SLSGGGGARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVPE  119

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  120  E-LTEATPNRYRYYQNVCTQS  139



>ref|WP_005478435.1| alpha-N-acetylglucosaminidase [Streptomyces bottropensis]
 gb|EMF55563.1| alpha-N-acetylglucosaminidase [Streptomyces bottropensis ATCC 
25435]
Length=1042

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/104 (32%), Positives = 49/104 (47%), Gaps = 24/104 (23%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSS-EILISGTTAVELLSG  195
            + LNRL+  H+  F   ++ +                   TG+  +I +  TT   LL G
Sbjct  47   SALNRLLPGHAGQFRLSLLDRS----------GTVDRFRVTGTKRDIQVQATTPATLLMG  96

Query  196  LHWYLKYWCGAHISWSKTGGVQL---TSVPKPG-------SLPH  297
            +HWYLKY CGAH++W+   G QL   + +P P        +LPH
Sbjct  97   VHWYLKYVCGAHLAWN---GSQLDLPSRLPAPARPLEGSTALPH  137



>ref|WP_006349657.1| alpha-N-acetylglucosaminidase [Streptomyces tsukubaensis]
 gb|EIF89378.1| alpha-N-acetylglucosaminidase [Streptomyces tsukubaensis NRRL18488]
Length=1033

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 9/59 (15%)
 Frame = +1

Query  145  SSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSV---PKPG-----SLPH  297
            +  I + GT+   LL+G+HWYLKY C AHISWS +  V L  V   P+PG     ++PH
Sbjct  81   AGRIAVEGTSPAVLLTGVHWYLKYVCRAHISWSGS-RVDLPDVLPPPRPGLERSATVPH  138



>ref|WP_027770937.1| alpha-N-acetylglucosaminidase [Streptomyces sp. CNQ329]
Length=1034

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 35/110 (32%), Positives = 49/110 (45%), Gaps = 19/110 (17%)
 Frame = +1

Query  25   LNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHW  204
            L RL+  H+  F    +     DGD  F +          +  I + GT+   LL+G+HW
Sbjct  53   LERLLPGHARQFALFAL-----DGDERFTVRGR-------AGRIEVGGTSPAVLLTGVHW  100

Query  205  YLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
            YLKY C A +SWS       +    PG LP   DA I  +  +P  +  N
Sbjct  101  YLKYTCRAVVSWSG------SQTRLPGRLP-APDAPIERRATVPARFALN  143



>ref|XP_004571517.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Maylandia zebra]
 ref|XP_005752738.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Pundamilia nyererei]
Length=751

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 17/118 (14%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDG-DACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +L RL+ + S+ F   I      D  D C        L  T +++++ +G+T V + SG+
Sbjct  47   LLRRLLGNRSAEFIVSINGSLSNDSLDVC-------ELRSTKNNKVVATGSTGVAVASGI  99

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGII-VKRPIPWSYYQNAVSSS  369
            + YLKY+C  H+SWS   G QL  +P+P  LP +   G++ +  P  + YYQN  + S
Sbjct  100  YNYLKYFCNCHVSWS---GNQL-DLPRP--LPKL--TGVLRISTPHRFRYYQNVCTFS  149



>gb|KDS13673.1| alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain protein 
[Bacteroides fragilis str. 3725 D9 ii]
 gb|KDS14492.1| alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain protein 
[Bacteroides ovatus str. 3725 D1 iv]
 gb|KDS20438.1| alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain protein 
[Bacteroides fragilis str. 3725 D9 ii]
 gb|KDS21942.1| alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain protein 
[Bacteroides ovatus str. 3725 D9 iii]
Length=729

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 16/108 (15%)
 Frame = +1

Query  31   RLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYL  210
            RL   H+SSFDF ++     D    F I N         ++I+ISG  A  +  GL+ YL
Sbjct  35   RLFPQHASSFDFRLLNNTSAD---TFTIKNE-------GNKIIISGNNANSMAVGLNHYL  84

Query  211  KYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
            K +C   ISW K   ++L     P +LP +    + +K  +P  ++ N
Sbjct  85   KNYCLTTISWYKDDPIEL-----PNTLPFISTE-VTIKANVPTRFFLN  126



>ref|WP_032846413.1| alpha-N-acetylglucosaminidase [Bacteroides ovatus]
Length=721

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 16/108 (15%)
 Frame = +1

Query  31   RLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGLHWYL  210
            RL   H+SSFDF ++     D    F I N         ++I+ISG  A  +  GL+ YL
Sbjct  27   RLFPQHASSFDFRLLNNTSAD---TFTIKNE-------GNKIIISGNNANSMAVGLNHYL  76

Query  211  KYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
            K +C   ISW K   ++L     P +LP +    + +K  +P  ++ N
Sbjct  77   KNYCLTTISWYKDDPIEL-----PNTLPFISTE-VTIKANVPTRFFLN  118



>ref|XP_003743422.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Metaseiulus occidentalis]
Length=665

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 16/125 (13%)
 Frame = +1

Query  1    RSEERYAVLNRLIHSHSSSFDFLIIP--KEQCDGDACFKINNHPSLNKTGSSEILISGTT  174
            R EE   +L R++   S  F+  + P  K   DG   F++  +       S++I I+GT 
Sbjct  13   RDEEILGLLERVVEEGSPIFELRVDPSLKSVLDGKEGFRVEGN-------STKIFITGTV  65

Query  175  AVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPWSYYQN  354
                 +GL++Y++   G   SWS         +P P  +P  Q A ++V  P    YY+N
Sbjct  66   GYAAANGLNFYIRKLLGGQFSWSG------KRIPLPEKMPAPQRA-LLVTLPDQVRYYEN  118

Query  355  AVSSS  369
              ++S
Sbjct  119  VCTAS  123



>ref|WP_020871947.1| alpha-N-acetylglucosaminidase [Streptomyces rapamycinicus]
 ref|YP_008793422.1| alpha-N-acetylglucosaminidase [Streptomyces rapamycinicus NRRL 
5491]
 gb|AGP58466.1| alpha-N-acetylglucosaminidase [Streptomyces rapamycinicus NRRL 
5491]
Length=1044

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 50/103 (49%), Gaps = 22/103 (21%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            A L RL+ +H+  F  + + K     +  F++          +  + +SGT+   LL+G+
Sbjct  51   AALRRLLPTHADQFRLVALEKR--GAEERFEVGG-------SAGRLTVSGTSPAVLLTGV  101

Query  199  HWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            HWYLKY C A I+WS   G QL     +P P        +LPH
Sbjct  102  HWYLKYTCHAQITWS---GDQLNLPKKLPAPARRVTRSTALPH  141



>ref|XP_005950306.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Haplochromis burtoni]
Length=751

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 17/118 (14%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDG-DACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +L RL+ + S+ F   +      D  D C        L  T +++++ +G+T V + SG+
Sbjct  47   LLRRLLGNRSAEFIVSVNGSLSNDSLDVC-------ELRSTKNNKVVATGSTGVAVASGI  99

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGII-VKRPIPWSYYQNAVSSS  369
            + YLKY+C  H+SWS   G QL  +P+P  LP +   G++ +  P  + YYQN  + S
Sbjct  100  YNYLKYFCNCHVSWS---GNQL-DLPRP--LPKL--TGVLRISTPHRFRYYQNVCTFS  149



>ref|WP_014060136.1| alpha-N-acetylglucosaminidase [Streptomyces violaceusniger]
 ref|YP_004816940.1| alpha-N-acetylglucosaminidase [Streptomyces violaceusniger Tu 
4113]
 gb|AEM86660.1| alpha-N-acetylglucosaminidase [Streptomyces violaceusniger Tu 
4113]
Length=1044

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/104 (33%), Positives = 52/104 (50%), Gaps = 24/104 (23%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDA-CFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            A L RL+ +H+  F  + + K    GD   F+++         +  + +SGT+   LL+G
Sbjct  51   AALRRLLPAHAEQFRLVALAKR---GDEERFEVDG-------SAGRVTVSGTSPAVLLTG  100

Query  196  LHWYLKYWCGAHISWSKTGGVQLT---SVPKPG-------SLPH  297
            +HWYLKY C A ++WS   G QL     +P P        +LPH
Sbjct  101  VHWYLKYTCHAQLTWS---GDQLNLPKKLPAPARRLTHSTALPH  141



>gb|EFN61518.1| Alpha-N-acetylglucosaminidase [Camponotus floridanus]
Length=737

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 15/92 (16%)
 Frame = +1

Query  106  FKINNHPSLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPG  285
            FK+  +P        EI I GT+ V +  GLH+YLK +C  HISW    G Q+T    P 
Sbjct  84   FKVTKNPL------GEIEIRGTSGVAITWGLHYYLKNYCNVHISWD---GTQIT---LPN  131

Query  286  SLPHVQDAGIIVKRPIPWSYYQNAVSSSSKET  381
            +LP V+   I +     + YYQN  +     T
Sbjct  132  TLPEVR---IKITSNDRFRYYQNVCTVGYSST  160



>ref|WP_025835426.1| alpha-N-acetylglucosaminidase [Bacteroides rodentium]
Length=726

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 49/94 (52%), Gaps = 14/94 (15%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDFLIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            ++L RLI +++ SF F    K   +G   F+I +      T  + I+ISG  A  + +GL
Sbjct  34   SMLKRLIPAYADSFLF---KKVDGNGKDLFRIES------TADARIMISGNNANSMATGL  84

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHV  300
            ++YLKY+C   +SW     V++     P  LP V
Sbjct  85   NYYLKYYCLTTVSWYTDQPVEM-----PAKLPQV  113



>ref|XP_005471266.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Oreochromis niloticus]
Length=751

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 62/118 (53%), Gaps = 17/118 (14%)
 Frame = +1

Query  22   VLNRLIHSHSSSFDFLIIPKEQCDG-DACFKINNHPSLNKTGSSEILISGTTAVELLSGL  198
            +L RL+ + S+ F   +      D  D C        L  T ++ ++ +G+T V + SG+
Sbjct  47   LLRRLLGNRSAEFIVSVNGSLSNDSLDVC-------ELRSTKNNRVVATGSTGVAVASGI  99

Query  199  HWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGII-VKRPIPWSYYQNAVSSS  369
            + YLKY+C  H+SWS   G QL  +P+P  LP +   G++ +  P  + YYQN  + S
Sbjct  100  YNYLKYFCNCHVSWS---GNQL-DLPRP--LPKL--TGVLRISTPHRFRYYQNVCTFS  149



>ref|WP_010802636.1| MULTISPECIES: hypothetical protein [Parabacteroides]
 gb|EMZ31117.1| hypothetical protein C825_04002 [Parabacteroides sp. ASF519]
 gb|EOS19442.1| hypothetical protein C803_00121 [Parabacteroides goldsteinii 
dnLKV18]
Length=739

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 14/100 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDF-LIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            A++ R+I   +SSF   +  PK   DG  CF+I       ++  ++I++ G   V + S 
Sbjct  29   ALIKRVIPEKASSFKVEMFQPK---DGKDCFEI-------ESKGNKIILRGNNGVSVASA  78

Query  196  LHWYLKYWCGAHISWSKTG---GVQLTSVPKPGSLPHVQD  306
            L+ YLKY+C AHISW+        +L  VPK  + P   D
Sbjct  79   LYHYLKYYCNAHISWNGDNLNLPSRLPEVPKKITRPTAFD  118



>gb|EDM06080.1| rCG33377, isoform CRA_c [Rattus norvegicus]
Length=239

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL+  G   +L+ G++ V   +GLH YL+ +CG HI+WS +   QL  +P P  LP V D
Sbjct  64   SLSGGGGVPVLVRGSSGVAAAAGLHRYLRDFCGCHIAWSSS---QL-HLPSP--LPAVPD  117

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
             G+    P  + YYQN  + S
Sbjct  118  -GLTEATPNRYRYYQNVCTHS  137



>ref|XP_007424968.1| PREDICTED: alpha-N-acetylglucosaminidase [Python bivittatus]
Length=760

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 7/80 (9%)
 Frame = +1

Query  130  LNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDA  309
            L+      + +SG++ V   SG++ YLK +CG H+SWS   G QL     P SLP V  A
Sbjct  82   LSSEAPGTVNVSGSSGVAAASGIYHYLKDFCGCHVSWS---GTQLR---LPESLPPVS-A  134

Query  310  GIIVKRPIPWSYYQNAVSSS  369
             I+V  P  + +YQN  + S
Sbjct  135  EIVVTSPNRFRFYQNVCTYS  154



>ref|XP_003978574.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Takifugu rubripes]
Length=751

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 50/81 (62%), Gaps = 9/81 (11%)
 Frame = +1

Query  130  LNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDA  309
            L  T +++I+ SG++ V + SG++ Y+KY+C  H+SWS   G QL  +P+P  LP +   
Sbjct  77   LRSTKNNKIVASGSSGVAVASGIYNYMKYFCNCHVSWS---GDQL-DLPRP--LPKL--T  128

Query  310  GII-VKRPIPWSYYQNAVSSS  369
            G++ +  P  + YYQN  + S
Sbjct  129  GVLRINTPHRFRYYQNVCTFS  149



>ref|XP_005369092.1| PREDICTED: alpha-N-acetylglucosaminidase [Microtus ochrogaster]
Length=739

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL+  G + + + G+T V   +GLH YL+ +CG  ++WS   G QL  +P+P  LP V D
Sbjct  64   SLSGGGGAPVRVRGSTGVAAAAGLHRYLRDFCGCQVAWS---GSQL-HLPRP--LPAVHD  117

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  118  E-LTEATPNRYRYYQNVCTHS  137



>ref|XP_010384417.1| PREDICTED: alpha-N-acetylglucosaminidase [Rhinopithecus roxellana]
Length=743

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|WP_031231858.1| alpha-N-acetylglucosaminidase [Streptomyces niveus]
Length=1028

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 7/53 (13%)
 Frame = +1

Query  139  TGSS-EILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLP  294
            TG++  I +SGT A  LL+G+HWYLKY C AH+SWS   G QL     P +LP
Sbjct  72   TGTAGRIEVSGTDAGVLLTGVHWYLKYECRAHLSWS---GSQLD---LPATLP  118



>ref|XP_003733088.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Callithrix jacchus]
Length=830

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 9/82 (11%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKP-GSLPHVQ  303
            SL+  G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  ++P   
Sbjct  159  SLSGGGAARVRVRGSTGVAAAAGLHGYLRDFCGCHVAWS---GSQL-RLPRPLSAVP---  211

Query  304  DAGIIVKRPIPWSYYQNAVSSS  369
               +I   P  + YYQN  + S
Sbjct  212  -GELIEATPNRYRYYQNVCTQS  232



>ref|XP_002827555.2| PREDICTED: alpha-N-acetylglucosaminidase [Pongo abelii]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|NP_000254.2| alpha-N-acetylglucosaminidase precursor [Homo sapiens]
 sp|P54802.2|ANAG_HUMAN RecName: Full=Alpha-N-acetylglucosaminidase; AltName: Full=N-acetyl-alpha-glucosaminidase; 
Short=NAG; Contains: RecName: 
Full=Alpha-N-acetylglucosaminidase 82 kDa form; Contains: RecName: 
Full=Alpha-N-acetylglucosaminidase 77 kDa form; Flags: 
Precursor [Homo sapiens]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>gb|AAC50512.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAC50513.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAB06188.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAB36604.1| alpha-N-acetylglucosaminidase [Homo sapiens]
 gb|AAH53991.1| N-acetylglucosaminidase, alpha- [Homo sapiens]
 gb|EAW60833.1| N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB), isoform 
CRA_b [Homo sapiens]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|XP_005584302.1| PREDICTED: alpha-N-acetylglucosaminidase [Macaca fascicularis]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|XP_004041658.1| PREDICTED: alpha-N-acetylglucosaminidase [Gorilla gorilla gorilla]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|XP_003913130.1| PREDICTED: alpha-N-acetylglucosaminidase [Papio anubis]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|XP_523654.2| PREDICTED: alpha-N-acetylglucosaminidase [Pan troglodytes]
Length=743

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|XP_009859446.1| PREDICTED: alpha-N-acetylglucosaminidase [Ciona intestinalis]
Length=896

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 5/70 (7%)
 Frame = +1

Query  160  ISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPIPW  339
            I+G+ AV +    + YLKY+C   ISW+   G Q++ +P P  LP V   G+ +K  + +
Sbjct  82   ITGSDAVSVAFAFNHYLKYYCRKQISWA---GDQISDIPNP--LPPVPAEGVTIKAGVKY  136

Query  340  SYYQNAVSSS  369
             YYQN  + S
Sbjct  137  RYYQNVCTVS  146



>ref|XP_003279518.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Nomascus leucogenys]
Length=736

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  66   SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  118

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  119  GELTEATPNRYRYYQNVCTQS  139



>ref|XP_008010821.1| PREDICTED: alpha-N-acetylglucosaminidase [Chlorocebus sabaeus]
Length=797

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = +1

Query  127  SLNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQD  306
            SL   G++ + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V  
Sbjct  120  SLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-RLPRP--LPAVP-  172

Query  307  AGIIVKRPIPWSYYQNAVSSS  369
              +    P  + YYQN  + S
Sbjct  173  GELTEATPNRYRYYQNVCTQS  193



>ref|XP_006092419.1| PREDICTED: LOW QUALITY PROTEIN: alpha-N-acetylglucosaminidase 
[Myotis lucifugus]
Length=742

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = +1

Query  130  LNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDA  309
            L+  G + + + G+T V   +GLH YL+ +CG H++WS   G QL  +P+P  LP V D 
Sbjct  67   LSGGGGAPVRVLGSTGVAAAAGLHRYLRDFCGCHVAWS---GSQL-HLPQP--LPAVPDE  120

Query  310  GIIVKRPIPWSYYQNAVSSS  369
             +    P  + YYQN  + S
Sbjct  121  -LTEATPNRYRYYQNGCTHS  139



>ref|WP_007658406.1| hypothetical protein [Parabacteroides goldsteinii]
 gb|EKN08585.1| hypothetical protein HMPREF1076_04689 [Parabacteroides goldsteinii 
CL02T12C30]
Length=739

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 11/76 (14%)
 Frame = +1

Query  19   AVLNRLIHSHSSSFDF-LIIPKEQCDGDACFKINNHPSLNKTGSSEILISGTTAVELLSG  195
            A++ R+I   +SSF   +  PK   DG  CF+I       ++  ++I++ G   V + S 
Sbjct  29   ALIKRVIPEKASSFKVEMFQPK---DGKDCFEI-------ESKGNKIILRGNNGVSVASA  78

Query  196  LHWYLKYWCGAHISWS  243
            L+ YLKY+C AHISW+
Sbjct  79   LYHYLKYYCNAHISWN  94



>gb|ETE58649.1| Alpha-N-acetylglucosaminidase [Ophiophagus hannah]
Length=1435

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 7/72 (10%)
 Frame = +1

Query  154  ILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDAGIIVKRPI  333
            I +SG++ V   SG++ YLK +CG H+SWS   G QL     P  LP V  A IIV  P 
Sbjct  767  INVSGSSGVAAASGIYHYLKDFCGCHVSWS---GTQLR---LPERLPPVS-AEIIVTSPN  819

Query  334  PWSYYQNAVSSS  369
             + +YQN  + S
Sbjct  820  RFRFYQNVCTYS  831



>ref|XP_010899528.1| PREDICTED: alpha-N-acetylglucosaminidase [Esox lucius]
Length=755

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 9/81 (11%)
 Frame = +1

Query  130  LNKTGSSEILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLPHVQDA  309
            L    +++I+ +G+T V + SG++ YLKY+C  HISWS   G QL ++P+P  LP  Q  
Sbjct  76   LRSAKNNKIIATGSTGVAVASGIYNYLKYFCNCHISWS---GNQL-NIPRP--LP--QLT  127

Query  310  GII-VKRPIPWSYYQNAVSSS  369
            G++ +     + YYQN  + S
Sbjct  128  GVLRISTQHRFRYYQNVCTQS  148



>gb|EST22032.1| hypothetical protein M877_30740 [Streptomyces niveus NCIMB 11891]
Length=1051

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 7/53 (13%)
 Frame = +1

Query  139  TGSS-EILISGTTAVELLSGLHWYLKYWCGAHISWSKTGGVQLTSVPKPGSLP  294
            TG++  I +SGT A  LL+G+HWYLKY C AH+SWS   G QL     P +LP
Sbjct  95   TGTAGRIEVSGTDAGVLLTGVHWYLKYECRAHLSWS---GSQLD---LPATLP  141



Lambda      K        H        a         alpha
   0.315    0.131    0.410    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512400555856