BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22955_g6_i1 len=538 path=[1589:0-491 2081:492-537]

Length=538
                                                                      Score     E

ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              228   1e-68   
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        225   1e-67   
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        225   1e-67   Vitis vinifera
emb|CAN65437.1|  hypothetical protein VITISV_038918                     224   3e-67   Vitis vinifera
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              223   5e-67   
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       223   5e-67   
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                223   1e-66   
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                222   1e-66   
ref|NP_001234606.1|  amino acid transporter                             221   2e-66   
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              221   2e-66   
emb|CAH59425.1|  amino acid permease                                    213   3e-66   Plantago major [cart-track plant]
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              220   9e-66   
gb|AII99817.1|  amino acid transporter                                  220   1e-65   
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    220   1e-65   
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    219   1e-65   
gb|AIS71894.1|  amino acid transporter                                  219   1e-65   
gb|AIL30502.1|  amino acid transporter                                  219   2e-65   
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              216   4e-64   
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                216   5e-64   
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   214   1e-63   
emb|CAN61092.1|  hypothetical protein VITISV_005276                     214   1e-63   Vitis vinifera
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   214   1e-63   
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    214   2e-63   
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             213   3e-63   
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        213   3e-63   
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        213   3e-63   
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        213   3e-63   
ref|XP_002520323.1|  amino acid transporter, putative                   213   6e-63   Ricinus communis
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              212   1e-62   
ref|XP_006382883.1|  amino acid permease AAP1 family protein            212   2e-62   
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             212   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   211   2e-62   
ref|XP_006386355.1|  amino acid permease which transports basic a...    210   5e-62   
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             210   7e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              209   1e-61   
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              209   1e-61   
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    209   1e-61   
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    209   2e-61   
ref|XP_004160712.1|  PREDICTED: amino acid permease 3-like              206   2e-61   
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              208   2e-61   
ref|XP_010095435.1|  hypothetical protein L484_013392                   208   3e-61   
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    207   6e-61   
gb|KHN44307.1|  Amino acid permease 3                                   207   6e-61   
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              207   7e-61   
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              207   9e-61   
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              207   9e-61   
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       206   1e-60   
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             207   1e-60   
emb|CDP10973.1|  unnamed protein product                                206   1e-60   
gb|EPS60160.1|  hypothetical protein M569_14643                         202   1e-60   
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              206   1e-60   
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              207   2e-60   
ref|XP_011027691.1|  PREDICTED: amino acid permease 3-like              203   2e-60   
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        206   2e-60   
emb|CAC51425.1|  amino acid permease AAP4                               206   2e-60   Vicia faba var. minor [tick bean]
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        206   2e-60   
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              206   3e-60   
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              205   4e-60   
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    205   6e-60   
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    205   7e-60   
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             205   7e-60   
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             204   8e-60   
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         204   9e-60   
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              204   1e-59   
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    204   1e-59   
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    204   1e-59   
gb|KHN19623.1|  Amino acid permease 3                                   204   1e-59   
gb|KHG20963.1|  Amino acid permease 3 -like protein                     204   2e-59   
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             204   2e-59   
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        203   2e-59   
ref|NP_001233979.1|  amino acid transporter                             202   3e-59   
ref|XP_002520322.1|  amino acid transporter, putative                   202   7e-59   Ricinus communis
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             202   7e-59   
gb|EMT11988.1|  hypothetical protein F775_30582                         200   7e-59   
gb|KDO80515.1|  hypothetical protein CISIN_1g0115802mg                  197   1e-58   
gb|KEH35330.1|  transmembrane amino acid transporter family protein     201   1e-58   
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              201   1e-58   
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              201   1e-58   
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              201   2e-58   
emb|CAA10608.1|  amino acid carrier                                     201   2e-58   Ricinus communis
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             201   2e-58   
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   200   3e-58   
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like              200   3e-58   
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   201   3e-58   
emb|CDY60629.1|  BnaAnng17090D                                          199   4e-58   
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             200   4e-58   
emb|CDY36017.1|  BnaA08g04440D                                          200   4e-58   
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              200   4e-58   
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         200   4e-58   
emb|CDX88365.1|  BnaC06g38090D                                          200   4e-58   
emb|CDX88364.1|  BnaC06g38080D                                          200   4e-58   
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              200   4e-58   
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   199   6e-58   
gb|KDO57534.1|  hypothetical protein CISIN_1g015342mg                   198   6e-58   
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    200   6e-58   
ref|XP_007161468.1|  hypothetical protein PHAVU_001G071500g             197   7e-58   
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             199   9e-58   
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              199   1e-57   
dbj|BAK03497.1|  predicted protein                                      199   1e-57   
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             199   1e-57   
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              199   1e-57   
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             199   1e-57   
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              199   1e-57   
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              199   1e-57   
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   199   1e-57   
emb|CDX78353.1|  BnaA03g02650D                                          199   1e-57   
gb|KEH40510.1|  transmembrane amino acid transporter family protein     198   2e-57   
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    199   2e-57   
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    198   2e-57   
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              198   2e-57   
ref|NP_177862.1|  amino acid permease 3                                 198   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201190.1|  amino acid permease 4                                 198   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62803.1|  amino acid carrier, putative                            198   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             198   2e-57   
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              198   2e-57   
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              198   2e-57   
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              198   2e-57   
gb|AAM13223.1|  amino acid transporter AAP4                             197   2e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO45885.1|  amino acid permease                                    198   2e-57   
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             197   2e-57   
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             197   2e-57   
emb|CDX87522.1|  BnaA07g33510D                                          198   3e-57   
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             198   3e-57   
ref|NP_196484.1|  amino acid permease 2                                 198   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              197   3e-57   
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              197   4e-57   
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              197   4e-57   
gb|AAX56951.1|  amino acid transporter                                  197   4e-57   Pisum sativum [garden pea]
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              197   6e-57   
emb|CDX81121.1|  BnaC03g03750D                                          197   6e-57   
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   196   6e-57   
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    197   7e-57   
ref|NP_001149036.1|  amino acid carrier                                 197   7e-57   Zea mays [maize]
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    197   7e-57   
gb|KEH35328.1|  transmembrane amino acid transporter family protein     197   7e-57   
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           197   7e-57   
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   197   8e-57   
emb|CDY39844.1|  BnaC02g42740D                                          196   9e-57   
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             197   9e-57   
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              196   9e-57   
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             196   9e-57   Populus trichocarpa [western balsam poplar]
gb|KHG16478.1|  Amino acid permease 2 -like protein                     196   1e-56   
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    197   1e-56   
gb|AAM61227.1|  amino acid transport protein AAP2                       196   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    196   1e-56   
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    196   1e-56   
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              197   1e-56   
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   196   1e-56   
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             196   1e-56   
gb|EPS68727.1|  hypothetical protein M569_06043                         187   1e-56   
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    196   1e-56   
ref|XP_009421017.1|  PREDICTED: amino acid permease 3-like              194   1e-56   
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              196   2e-56   
emb|CAA54632.1|  amino acid permease                                    196   2e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31348.1|  BnaA02g33930D                                          196   2e-56   
emb|CAA54631.1|  amino acid transporter                                 196   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          196   2e-56   Sorghum bicolor [broomcorn]
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              196   2e-56   
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              196   2e-56   
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              196   2e-56   
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             196   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              196   2e-56   
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              196   2e-56   
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              195   3e-56   
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             195   3e-56   
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              195   3e-56   
gb|AAM61320.1|  amino acid transporter AAP4                             195   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175076.2|  amino acid permease 5                                 195   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAG50558.1|AC074228_13  amino acid permease, putative                195   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   196   3e-56   Vitis vinifera
emb|CAF22024.1|  amino acid permease                                    195   3e-56   Brassica napus [oilseed rape]
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              195   4e-56   
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    196   4e-56   
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   194   5e-56   
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              195   5e-56   
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             194   5e-56   
ref|XP_010461433.1|  PREDICTED: amino acid permease 5-like              192   6e-56   
gb|KHG27248.1|  Amino acid permease 3 -like protein                     194   7e-56   
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             194   8e-56   
ref|XP_004289864.1|  PREDICTED: amino acid permease 2-like              194   1e-55   
gb|EMS58805.1|  hypothetical protein TRIUR3_05113                       187   1e-55   
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   194   1e-55   
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   194   1e-55   
emb|CDX69918.1|  BnaA10g22670D                                          193   1e-55   
ref|XP_004290905.1|  PREDICTED: amino acid permease 2-like              193   1e-55   
emb|CDY21569.1|  BnaC09g47230D                                          193   1e-55   
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             193   1e-55   
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             193   2e-55   
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        193   2e-55   
ref|XP_007019168.1|  Amino acid permease isoform 2                      193   2e-55   
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    192   2e-55   
ref|XP_007019167.1|  Amino acid permease isoform 1                      193   2e-55   
emb|CDX84450.1|  BnaC03g50500D                                          192   3e-55   
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              192   3e-55   
gb|KHN39882.1|  Amino acid permease 2                                   192   3e-55   
dbj|BAJ95327.1|  predicted protein                                      192   3e-55   
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              192   3e-55   
emb|CDY43761.1|  BnaA06g22970D                                          191   5e-55   
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              192   5e-55   
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   191   5e-55   
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    192   5e-55   
gb|EPS61237.1|  amino acid transporter                                  188   5e-55   
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             192   5e-55   
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              192   6e-55   
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    192   6e-55   
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             192   6e-55   
gb|ACR35411.1|  unknown                                                 188   7e-55   Zea mays [maize]
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              191   7e-55   
gb|KCW82484.1|  hypothetical protein EUGRSUZ_C03879                     191   8e-55   
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   191   8e-55   
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   191   9e-55   
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              192   9e-55   
gb|AAK33098.1|  amino acid transporter                                  192   9e-55   Glycine max [soybeans]
dbj|BAK03421.1|  predicted protein                                      191   1e-54   
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          191   1e-54   Sorghum bicolor [broomcorn]
emb|CAH59424.1|  amino acid permease                                    182   1e-54   Plantago major [cart-track plant]
ref|NP_001055592.1|  Os05g0424000                                       191   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010090330.1|  hypothetical protein L484_024995                   191   2e-54   
ref|XP_010051605.1|  PREDICTED: amino acid permease 3-like              190   2e-54   
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              191   3e-54   
emb|CDM85443.1|  unnamed protein product                                189   4e-54   
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              189   4e-54   
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         190   4e-54   
emb|CDY47793.1|  BnaC06g00580D                                          189   4e-54   
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             189   5e-54   
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              189   6e-54   
emb|CDM85442.1|  unnamed protein product                                189   6e-54   
ref|XP_009342937.1|  PREDICTED: amino acid permease 2-like              187   6e-54   
ref|NP_001142349.1|  hypothetical protein                               189   7e-54   Zea mays [maize]
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              189   1e-53   
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              188   1e-53   
ref|XP_002312967.2|  hypothetical protein POPTR_0009s13610g             187   1e-53   Populus trichocarpa [western balsam poplar]
gb|KHN25477.1|  Amino acid permease 2                                   189   1e-53   
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   189   1e-53   
gb|KDO68036.1|  hypothetical protein CISIN_1g010376mg                   182   2e-53   
ref|XP_010546307.1|  PREDICTED: amino acid permease 2 isoform X2        186   2e-53   
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              187   3e-53   
gb|AFK37021.1|  unknown                                                 187   4e-53   
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    187   4e-53   
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              187   4e-53   
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              187   5e-53   
gb|KEH30492.1|  transmembrane amino acid transporter family protein     187   5e-53   
gb|KEH30491.1|  transmembrane amino acid transporter family protein     187   5e-53   
emb|CDO96925.1|  unnamed protein product                                187   6e-53   
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              187   6e-53   
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        186   6e-53   
ref|NP_001045010.1|  Os01g0882800                                       186   6e-53   Oryza sativa Japonica Group [Japonica rice]
gb|KDO68037.1|  hypothetical protein CISIN_1g010376mg                   184   7e-53   
ref|XP_003630316.1|  Amino acid permease                                186   9e-53   
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                186   1e-52   
ref|XP_009764610.1|  PREDICTED: amino acid permease 3-like isofor...    184   1e-52   
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             186   2e-52   
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              185   2e-52   
emb|CAA70778.1|  amino acid transporter                                 185   2e-52   Vicia faba [broad bean]
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   184   3e-52   
gb|KDO68034.1|  hypothetical protein CISIN_1g010376mg                   183   3e-52   
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              185   4e-52   
gb|KHN31184.1|  Amino acid permease 2                                   180   4e-52   
gb|KCW82488.1|  hypothetical protein EUGRSUZ_C03884                     183   5e-52   
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    184   6e-52   
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   184   7e-52   
ref|XP_010051607.1|  PREDICTED: amino acid permease 3-like              183   1e-51   
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              182   1e-51   
gb|EMT16213.1|  hypothetical protein F775_29086                         181   2e-51   
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              183   2e-51   
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              182   2e-51   
gb|KGN54767.1|  hypothetical protein Csa_4G470690                       178   2e-51   
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    182   2e-51   
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    182   3e-51   
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              182   3e-51   
emb|CAN77083.1|  hypothetical protein VITISV_003992                     182   5e-51   Vitis vinifera
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              181   5e-51   
gb|KCW82485.1|  hypothetical protein EUGRSUZ_C03880                     179   1e-50   
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              179   2e-50   
gb|AAX56952.1|  amino acid transporter                                  179   2e-50   Pisum sativum [garden pea]
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              180   2e-50   
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             179   3e-50   
ref|XP_004151465.1|  PREDICTED: amino acid permease 4-like              178   3e-50   
gb|KCW82236.1|  hypothetical protein EUGRSUZ_C03655                     178   5e-50   
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              178   5e-50   
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          179   6e-50   
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              178   7e-50   
ref|XP_010051542.1|  PREDICTED: amino acid permease 3-like              178   7e-50   
gb|KHN16938.1|  Amino acid permease 2                                   176   1e-49   
gb|AFW65566.1|  hypothetical protein ZEAMMB73_193502                    169   4e-49   
ref|XP_002534252.1|  amino acid transporter, putative                   175   8e-49   
ref|XP_003602666.1|  Amino acid permease                                175   1e-48   
gb|KCW82487.1|  hypothetical protein EUGRSUZ_C03882                     171   3e-48   
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             174   3e-48   
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              173   4e-48   
gb|KCW71228.1|  hypothetical protein EUGRSUZ_F04325                     172   5e-48   
gb|AFW65567.1|  hypothetical protein ZEAMMB73_193502                    169   1e-47   
emb|CAC51423.1|  amino acid permease AAP1                               172   2e-47   
ref|XP_010051606.1|  PREDICTED: amino acid permease 3-like              171   2e-47   
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              171   3e-47   
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              171   4e-47   
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             171   4e-47   
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             171   6e-47   
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             171   7e-47   
gb|EMS65401.1|  hypothetical protein TRIUR3_22906                       167   8e-47   
dbj|BAJ86012.1|  predicted protein                                      170   1e-46   
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    167   5e-46   
ref|NP_001140430.1|  hypothetical protein                               168   5e-46   
ref|XP_010051603.1|  PREDICTED: amino acid permease 3-like              168   5e-46   
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    167   7e-46   
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              167   9e-46   
gb|ABR18002.1|  unknown                                                 166   2e-45   
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    166   2e-45   
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              166   2e-45   
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          166   3e-45   
ref|XP_003602670.1|  Amino acid permease                                166   3e-45   
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          166   4e-45   
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              166   4e-45   
ref|XP_003602671.1|  Amino acid permease                                165   4e-45   
gb|EMT28649.1|  hypothetical protein F775_26310                         166   5e-45   
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    170   5e-45   
gb|AFK43956.1|  unknown                                                 158   6e-45   
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              165   6e-45   
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          165   7e-45   
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              164   8e-45   
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    169   9e-45   
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              164   9e-45   
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          164   1e-44   
ref|NP_001170050.1|  uncharacterized protein LOC100383966               163   1e-44   
ref|XP_003602669.1|  Amino acid permease                                164   1e-44   
ref|XP_010266973.1|  PREDICTED: amino acid permease 3-like              164   1e-44   
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    164   1e-44   
ref|XP_004290906.1|  PREDICTED: amino acid permease 2-like              164   2e-44   
gb|EAY84081.1|  hypothetical protein OsI_05462                          164   2e-44   
ref|XP_010042577.1|  PREDICTED: amino acid permease 3-like              155   2e-44   
ref|NP_001168530.1|  uncharacterized protein LOC100382310 precursor     162   3e-44   
ref|NP_001045595.1|  Os02g0102200                                       164   3e-44   
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              163   3e-44   
ref|XP_003638241.1|  Amino acid permease                                164   4e-44   
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              163   4e-44   
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    163   4e-44   
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              162   4e-44   
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    162   4e-44   
emb|CAC51424.1|  amino acid permease AAP3                               163   4e-44   
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          162   6e-44   
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    162   7e-44   
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              162   9e-44   
gb|KCW62470.1|  hypothetical protein EUGRSUZ_H05110                     162   1e-43   
ref|XP_010025741.1|  PREDICTED: amino acid permease 4-like              162   1e-43   
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              161   1e-43   
gb|KGN60300.1|  hypothetical protein Csa_3G894480                       155   2e-43   
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             161   2e-43   
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          160   3e-43   
ref|XP_006856753.1|  hypothetical protein AMTR_s00055p00034490          152   3e-43   
ref|XP_008466098.1|  PREDICTED: amino acid permease 6-like              157   3e-43   
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             160   3e-43   
gb|KCW62468.1|  hypothetical protein EUGRSUZ_H05108                     160   4e-43   
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              160   4e-43   
ref|XP_010025740.1|  PREDICTED: amino acid permease 4-like              160   6e-43   
gb|KCW71229.1|  hypothetical protein EUGRSUZ_F04327                     158   7e-43   
ref|XP_010027423.1|  PREDICTED: amino acid permease 2-like              160   1e-42   
gb|KHN09641.1|  Amino acid permease 2                                   159   1e-42   
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              159   2e-42   
gb|ADE75660.1|  unknown                                                 158   2e-42   
ref|XP_010063932.1|  PREDICTED: amino acid permease 3-like              157   3e-42   
gb|EEE52230.1|  hypothetical protein OsJ_34158                          157   3e-42   
gb|EMT26484.1|  hypothetical protein F775_32730                         158   3e-42   
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   158   3e-42   
gb|EEC81839.1|  hypothetical protein OsI_25597                          157   3e-42   
ref|NP_001067425.1|  Os11g0195600                                       157   4e-42   
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          157   7e-42   
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              156   8e-42   
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    157   9e-42   
gb|EEC72288.1|  hypothetical protein OsI_05459                          152   1e-41   
gb|KCW82234.1|  hypothetical protein EUGRSUZ_C03653                     154   2e-41   
dbj|BAJ91191.1|  predicted protein                                      150   2e-41   
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              155   3e-41   
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     155   3e-41   
gb|EAY82481.1|  hypothetical protein OsI_37698                          155   3e-41   
ref|NP_001066317.1|  Os12g0181600                                       154   4e-41   
ref|NP_001066316.1|  Os12g0181500                                       154   5e-41   
gb|EEC68963.1|  hypothetical protein OsI_37697                          154   5e-41   
dbj|BAJ91439.1|  predicted protein                                      154   5e-41   
ref|XP_001784036.1|  predicted protein                                  154   6e-41   
ref|XP_008378686.1|  PREDICTED: amino acid permease 6-like              148   6e-41   
dbj|BAJ93107.1|  predicted protein                                      154   9e-41   
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    153   1e-40   
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   153   2e-40   
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                153   2e-40   
gb|KCW62466.1|  hypothetical protein EUGRSUZ_H05106                     149   2e-40   
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             152   2e-40   
gb|ABR16450.1|  unknown                                                 153   2e-40   
gb|EMT07264.1|  hypothetical protein F775_06597                         152   2e-40   
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              152   3e-40   
ref|XP_010058357.1|  PREDICTED: amino acid permease 3-like              152   4e-40   
gb|KCW44734.1|  hypothetical protein EUGRSUZ_L017181                    144   5e-40   
dbj|BAK02045.1|  predicted protein                                      152   5e-40   
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              151   6e-40   
gb|EYU39082.1|  hypothetical protein MIMGU_mgv1a020135mg                151   7e-40   
emb|CAA70969.1|  amino acid transporter                                 149   7e-40   
ref|XP_010040981.1|  PREDICTED: amino acid permease 3-like              150   1e-39   
ref|NP_001057853.1|  Os06g0556000                                       150   1e-39   
ref|NP_176132.1|  amino acid permease 1                                 150   1e-39   
gb|AAB87674.1|  neutral amino acid transport system II                  150   1e-39   
gb|EMT28875.1|  hypothetical protein F775_29828                         149   2e-39   
ref|XP_010229892.1|  PREDICTED: amino acid permease 8-like              150   2e-39   
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              150   2e-39   
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              150   2e-39   
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              149   3e-39   
ref|XP_002301129.2|  amino acid transport protein AAP2                  149   3e-39   
ref|XP_002510013.1|  amino acid transporter, putative                   149   3e-39   
gb|KHG24473.1|  Amino acid permease 6 -like protein                     149   5e-39   
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   149   5e-39   
emb|CDP00979.1|  unnamed protein product                                149   6e-39   
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    148   7e-39   
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              148   8e-39   
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              148   9e-39   
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             148   9e-39   
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              148   1e-38   
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   148   1e-38   
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             148   1e-38   
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              148   1e-38   
gb|KCW62469.1|  hypothetical protein EUGRSUZ_H05109                     147   2e-38   
ref|XP_002964668.1|  hypothetical protein SELMODRAFT_166966             147   2e-38   
ref|XP_002989478.1|  hypothetical protein SELMODRAFT_235790             147   2e-38   
ref|XP_010055975.1|  PREDICTED: amino acid permease 3-like              147   2e-38   
gb|EMS57663.1|  hypothetical protein TRIUR3_25238                       147   2e-38   
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             147   2e-38   
gb|ADB92670.1|  amino acid permease 6                                   147   2e-38   
ref|XP_010027424.1|  PREDICTED: amino acid permease 4-like              149   2e-38   
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              147   4e-38   
gb|EYU39081.1|  hypothetical protein MIMGU_mgv1a023099mg                146   4e-38   
emb|CDY49542.1|  BnaCnng17660D                                          140   4e-38   
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   146   5e-38   
ref|XP_010040982.1|  PREDICTED: amino acid permease 3-like              146   5e-38   
gb|KDO49532.1|  hypothetical protein CISIN_1g046038mg                   142   5e-38   
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              146   5e-38   
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              146   5e-38   
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             146   5e-38   
gb|KEH43993.1|  transmembrane amino acid transporter family protein     146   6e-38   
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              146   6e-38   
emb|CDY53793.1|  BnaCnng25620D                                          146   6e-38   
emb|CDP08191.1|  unnamed protein product                                146   6e-38   
ref|XP_008368120.1|  PREDICTED: amino acid permease 6-like              140   7e-38   
ref|XP_006422746.1|  hypothetical protein CICLE_v100286921mg            142   7e-38   
gb|KEH43996.1|  transmembrane amino acid transporter family protein     145   7e-38   
emb|CAD92449.1|  amino acid permease 1                                  146   7e-38   
ref|NP_001233983.1|  amino acid transporter                             145   8e-38   
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              145   8e-38   
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             145   8e-38   
ref|NP_199774.1|  amino acid permease 6                                 145   8e-38   
gb|AFW86930.1|  hypothetical protein ZEAMMB73_950309                    143   9e-38   
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              145   9e-38   
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   145   1e-37   
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              145   1e-37   
emb|CDP00978.1|  unnamed protein product                                145   1e-37   
gb|KEH43995.1|  transmembrane amino acid transporter family protein     145   1e-37   
emb|CAA70968.2|  amino acid transporter                                 145   1e-37   
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              145   1e-37   
emb|CAD92450.1|  amino acid permease 6                                  145   2e-37   
emb|CDY48843.1|  BnaA09g14700D                                          144   2e-37   
gb|KHG13110.1|  Amino acid permease 6 -like protein                     144   2e-37   
ref|XP_007018375.1|  Amino acid permease 6                              144   2e-37   
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   144   3e-37   
ref|XP_010040983.1|  PREDICTED: amino acid permease 3-like              144   3e-37   
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         144   3e-37   
ref|XP_010027417.1|  PREDICTED: amino acid permease 4-like              141   3e-37   
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    144   4e-37   
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          144   5e-37   
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              143   5e-37   
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              143   6e-37   
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                143   7e-37   
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    143   7e-37   
gb|EMT23821.1|  hypothetical protein F775_31800                         141   7e-37   
gb|KCW62465.1|  hypothetical protein EUGRSUZ_H05105                     139   9e-37   
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             142   1e-36   
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   142   1e-36   
ref|XP_004496860.1|  PREDICTED: amino acid permease 6-like              142   1e-36   
emb|CDY44564.1|  BnaA01g21750D                                          142   1e-36   
ref|XP_002444093.1|  hypothetical protein SORBIDRAFT_07g007570          142   1e-36   
gb|KCW62459.1|  hypothetical protein EUGRSUZ_H050961                    142   1e-36   
emb|CDY46779.1|  BnaCnng14480D                                          142   2e-36   
ref|XP_005648500.1|  amino acid transporter                             142   2e-36   
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              142   2e-36   
gb|AFK46687.1|  unknown                                                 139   2e-36   
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              142   2e-36   
gb|EYU20407.1|  hypothetical protein MIMGU_mgv1a018639mg                142   2e-36   
ref|XP_010104540.1|  hypothetical protein L484_025514                   141   2e-36   
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             141   3e-36   
gb|KCW68582.1|  hypothetical protein EUGRSUZ_F02192                     141   3e-36   
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              141   3e-36   
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    141   3e-36   
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          141   3e-36   
ref|XP_004955421.1|  PREDICTED: amino acid permease 6-like              141   4e-36   
gb|KHN08198.1|  Amino acid permease 6                                   141   4e-36   
ref|XP_003603665.1|  Amino acid permease                                141   4e-36   
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    141   4e-36   
ref|NP_001242816.1|  uncharacterized protein LOC100777963               141   4e-36   
emb|CDY63746.1|  BnaC05g07760D                                          139   4e-36   
ref|XP_004497265.1|  PREDICTED: amino acid permease 6-like              140   5e-36   
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              141   5e-36   
ref|XP_009627462.1|  PREDICTED: amino acid permease 6-like              140   5e-36   
ref|XP_007143143.1|  hypothetical protein PHAVU_007G047400g             140   6e-36   
gb|KCW62461.1|  hypothetical protein EUGRSUZ_H05097                     140   6e-36   
gb|AFK42490.1|  unknown                                                 140   7e-36   



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTAA+WYP S  IT EI VPI G  S FKLNLFR++WRT+FV++
Sbjct  337  VGAYQVYCQPLFAFIEKTAAEWYPESKFITKEISVPIMGYKS-FKLNLFRIIWRTIFVII  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKI KWSTKWICLQ LS ACL+
Sbjct  396  TTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKITKWSTKWICLQMLSVACLI  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GSFAGV SDLQVYKPFKT+Y
Sbjct  456  ISIAAAAGSFAGVVSDLQVYKPFKTTY  482



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF EK AAQ +PHS  IT EI++PIPGC SPF LNLFRLVWR+ FVV+
Sbjct  344  VGAYQVYCQPLFAFTEKWAAQKWPHSDFITKEIKIPIPGC-SPFSLNLFRLVWRSAFVVV  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACL+
Sbjct  403  TTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSVACLI  462

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VY PFKTSY
Sbjct  463  ISIAAAAGSIAGVVLDLKVYHPFKTSY  489



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF EK AAQ +PHS  IT EI++PIPGC SPF LNLFRLVWR+ FVV+
Sbjct  342  VGAYQVYCQPLFAFTEKWAAQKWPHSDFITKEIKIPIPGC-SPFSLNLFRLVWRSAFVVV  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VY PFKTSY
Sbjct  461  ISIAAAAGSIAGVVLDLKVYHPFKTSY  487



>emb|CAN65437.1| hypothetical protein VITISV_038918 [Vitis vinifera]
Length=487

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF EK AAQ +PHS  IT EI++PIPGC SPF LNLFRLVWR+ FVV+
Sbjct  342  VGAYQVYCQPLFAFTEKWAAQKWPHSDFITKEIKIPIPGC-SPFSLNLFRLVWRSAFVVV  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VY PFKTSY
Sbjct  461  ISIAAAAGSIAGVVLDLKVYHPFKTSY  487



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTAA+WYP S  I  EI VPI G  S FKLNLFR++WRT+FV++
Sbjct  337  VGAYQVYCQPLFAFIEKTAAEWYPESKFIAKEISVPIIGYKS-FKLNLFRIIWRTIFVII  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKI KWSTKWICLQ LS ACL+
Sbjct  396  TTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKITKWSTKWICLQMLSVACLI  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            ISIAAA GSFAGV SDLQVYKPFKT+
Sbjct  456  ISIAAAAGSFAGVVSDLQVYKPFKTT  481



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTAA+WYP S +IT EI VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  330  VGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPGFK-PFKLNLFRLVWRTIFVII  388

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQK+I KWS +WICLQ LS ACLV
Sbjct  389  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSARWICLQILSGACLV  448

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PF++
Sbjct  449  ISIAAAAGSFAGVVSDLKVYRPFQS  473



>gb|EYU32509.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=492

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVEKT+A ++P+S  IT EI +PIPG N   KLNLFRLVWRT+FV++
Sbjct  346  IGAYQVYCQPLFAFVEKTSAHYFPNSKFITKEISIPIPGFNRLLKLNLFRLVWRTIFVIV  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQ +IPKWS +WICLQ LS ACL+
Sbjct  406  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQMRIPKWSPRWICLQILSMACLI  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAA VGSFAGV +DL+VYKPFKTSY
Sbjct  466  ISIAAGVGSFAGVVTDLKVYKPFKTSY  492



>gb|EYU32508.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=490

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVEKT+A ++P+S  IT EI +PIPG N   KLNLFRLVWRT+FV++
Sbjct  344  IGAYQVYCQPLFAFVEKTSAHYFPNSKFITKEISIPIPGFNRLLKLNLFRLVWRTIFVIV  403

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQ +IPKWS +WICLQ LS ACL+
Sbjct  404  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQMRIPKWSPRWICLQILSMACLI  463

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAA VGSFAGV +DL+VYKPFKTSY
Sbjct  464  ISIAAGVGSFAGVVTDLKVYKPFKTSY  490



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTAA+WYP S +IT EI VPIPG   PFKLNLFRLVWR +FV++
Sbjct  328  VGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPGFK-PFKLNLFRLVWRAIFVII  386

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQK+I KWS +WICLQ LS ACLV
Sbjct  387  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSARWICLQILSGACLV  446

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PF++
Sbjct  447  ISIAAAAGSFAGVVSDLKVYRPFQS  471



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTA +WYP S +IT EI VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  330  VGAYQVYCQPLFAFVEKTATEWYPDSKIITKEIDVPIPGFK-PFKLNLFRLVWRTIFVII  388

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQK+I KWS +WICLQ LS ACLV
Sbjct  389  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSGRWICLQILSGACLV  448

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGVASDL+VY+PF++
Sbjct  449  ISIAAAAGSFAGVASDLKVYRPFQS  473



>emb|CAH59425.1| amino acid permease [Plantago major]
Length=193

 Score =   213 bits (541),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK A   +P    IT +I++PIPG   P++LN FRLVWRT FV+L
Sbjct  47   VGAYQVYCQPLFAFIEKYANAKWPDREFITNDIEIPIPGLQEPYRLNFFRLVWRTAFVIL  106

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKIPKWSTKWICLQ LS ACLV
Sbjct  107  TTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIPKWSTKWICLQMLSMACLV  166

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VYKPFKTSY
Sbjct  167  ISIAAAAGSVAGVILDLKVYKPFKTSY  193



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTA +WYP +  IT E+ VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  335  VGAYQVYCQPLFAFVEKTAFEWYPSNKFITKELDVPIPGFK-PFKLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWS +WI LQ LS ACLV
Sbjct  394  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PFKT
Sbjct  454  ISIAAAAGSFAGVVSDLKVYRPFKT  478



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTA +WYP +  IT +I VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  334  VGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVII  392

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWS +WI LQ LS ACLV
Sbjct  393  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLV  452

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PFKT
Sbjct  453  ISIAAAAGSFAGVVSDLKVYRPFKT  477



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTA +WYP +  IT +I VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  335  VGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWS +WI LQ LS ACLV
Sbjct  394  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PFKT
Sbjct  454  ISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTA +WYP +  IT +I VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  333  VGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVII  391

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWS +WI LQ LS ACLV
Sbjct  392  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLV  451

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PFKT
Sbjct  452  ISIAAAAGSFAGVVSDLKVYRPFKT  476



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEKTA +WYP +  IT +I VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  335  VGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWS +WI LQ LS ACLV
Sbjct  394  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PFKT
Sbjct  454  ISIAAAAGSFAGVVSDLKVYRPFKT  478



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTA +WYP +  IT +I VPIPG   PFKLNLFRLVWRT+FV++
Sbjct  335  VGAYQVYCQPLFAFIEKTAFEWYPSNKFITKDIDVPIPGYK-PFKLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWS +WI LQ LS ACLV
Sbjct  394  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSGACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAGV SDL+VY+PFKT
Sbjct  454  ISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+CQPLFAF+EKTA +W+P S  IT EI +PIPG  + +KLNLFRLVWRT+FV++
Sbjct  339  IGAYQVFCQPLFAFIEKTALEWFPDSKFITKEIAIPIPGFRA-YKLNLFRLVWRTIFVIV  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QK+IPKWST+W+ LQ LS ACLV
Sbjct  398  TTIISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIKQKRIPKWSTRWVSLQILSVACLV  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+AAA GSFAGV SDL+VYKPFKTSY
Sbjct  458  ISVAAAAGSFAGVVSDLKVYKPFKTSY  484



>gb|EYU23867.1| hypothetical protein MIMGU_mgv1a005496mg [Erythranthe guttata]
Length=481

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVEKTA +W+PHS  IT EI +PIPG  S  KLNLFRLVWRT+FV++
Sbjct  337  IGAYQVYCQPLFAFVEKTAREWFPHSEFITKEIAIPIPGLKS-LKLNLFRLVWRTVFVII  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QK+IPKWS +W+ LQ LS ACL+
Sbjct  396  TTIISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIKQKRIPKWSPRWLSLQILSGACLM  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            ISIAAA GSFAGV SDL+VY+PFKT+
Sbjct  456  ISIAAAAGSFAGVVSDLKVYRPFKTT  481



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  IT EI++PIPG   P+ LNLFRLVWRT+FV++
Sbjct  338  VGAYQVYCQPLFAFIEKWAAEKFPDSQFITKEIKIPIPGFK-PYNLNLFRLVWRTIFVII  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  397  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSFACLI  456

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VYKPFKTSY
Sbjct  457  ISIAAAAGSVAGVILDLKVYKPFKTSY  483



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  IT EI++PIPG   P+ LNLFRLVWRT+FV++
Sbjct  336  VGAYQVYCQPLFAFIEKWAAEKFPDSQFITKEIKIPIPGFK-PYNLNLFRLVWRTIFVII  394

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  395  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSFACLI  454

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VYKPFKTSY
Sbjct  455  ISIAAAAGSVAGVILDLKVYKPFKTSY  481



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK+A++ +  S  IT EI+VPIPG   P+KLNLFRLVWR++FVV 
Sbjct  338  VGAYQVYCQPLFAFIEKSASERWSESKFITKEIKVPIPGFR-PYKLNLFRLVWRSVFVVA  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACLV
Sbjct  397  TTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSFACLV  456

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGVA DL+VYKPFKTSY
Sbjct  457  VSIAAAAGSIAGVALDLKVYKPFKTSY  483



>ref|XP_004498350.1| PREDICTED: amino acid permease 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498351.1| PREDICTED: amino acid permease 3-like isoform X2 [Cicer arietinum]
Length=487

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPL++ VEKTA+Q +P S  I  +I++PIPG  SP K+NLFRLVWR+ FV+L
Sbjct  341  VGAYQVYCQPLYSVVEKTASQRFPDSNFINKDIEIPIPGVISPLKINLFRLVWRSFFVIL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG++GA GFWPLTVYFPVEMYIVQ +IPKWSTKWICL  LSAACLV
Sbjct  401  TTIISMLLPFFNDIVGLIGAIGFWPLTVYFPVEMYIVQMRIPKWSTKWICLHLLSAACLV  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+A+A GS AGV +DLQVYKPF T Y
Sbjct  461  ISLASAAGSVAGVIADLQVYKPFHTVY  487



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK AAQ +P S LIT E QVP+PG  S FKLNLFRLVWRT FV+L
Sbjct  335  VGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPS-FKLNLFRLVWRTKFVML  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IPKWST+WICLQ LS ACLV
Sbjct  394  TTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSIACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AA GS AGV  DL+VY+PFKTSY
Sbjct  454  ISLVAAAGSIAGVMLDLKVYRPFKTSY  480



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK AAQ +P S LIT E QVP+PG  S FKLNLFRLVWRT FV+L
Sbjct  336  VGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPS-FKLNLFRLVWRTKFVML  394

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IPKWST+WICLQ LS ACLV
Sbjct  395  TTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSIACLV  454

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AA GS AGV  DL+VY+PFKTSY
Sbjct  455  ISLVAAAGSIAGVMLDLKVYRPFKTSY  481



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK AAQ +P S LIT E QVP+PG  S FKLNLFRLVWRT FV+L
Sbjct  335  VGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPS-FKLNLFRLVWRTKFVML  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IPKWST+WICLQ LS ACLV
Sbjct  394  TTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSIACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AA GS AGV  DL+VY+PFKTSY
Sbjct  454  ISLVAAAGSIAGVMLDLKVYRPFKTSY  480



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK AAQ +P S LIT E QVP+PG  S FKLNLFRLVWRT FV+L
Sbjct  337  VGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPS-FKLNLFRLVWRTKFVML  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IPKWST+WICLQ LS ACLV
Sbjct  396  TTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSIACLV  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AA GS AGV  DL+VY+PFKTSY
Sbjct  456  ISLVAAAGSIAGVMLDLKVYRPFKTSY  482



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AAQ YP S  IT +I++P+PG   PF LNLFR VWRTLFVV 
Sbjct  341  VGAYQVYCQPLFAFVEKAAAQRYPDSGFITKDIKIPVPGFR-PFNLNLFRSVWRTLFVVF  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LSAACLV
Sbjct  400  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSAACLV  459

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+  KPF+TSY
Sbjct  460  ITIAAAAGSIAGVVGDLKSVKPFQTSY  486



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPL+AF+EK A++ +P+S  IT EI +P+PG   P++LN+FRLVWRT+FV++
Sbjct  348  IGAYQVYCQPLYAFIEKIASENFPNSDFITKEILIPLPGGYKPYRLNMFRLVWRTIFVIV  407

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIPKWSTKWICLQ LS ACL+
Sbjct  408  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYISQKKIPKWSTKWICLQMLSFACLI  467

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+ YKPFKT+Y
Sbjct  468  ITIAAAAGSVAGVILDLKSYKPFKTTY  494



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+CQPLFAF+EK A Q +P +  IT E ++P+PG   P+KLNLFR+VWRT+FV+L
Sbjct  347  IGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPGFR-PYKLNLFRMVWRTIFVLL  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACLV
Sbjct  406  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLV  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A  GS AGV  DL+VYKPFKTSY
Sbjct  466  ISLVAVAGSIAGVVLDLKVYKPFKTSY  492



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+CQPLFAF+EK A Q +P +  IT E ++P+PG   P+KLNLFR+VWRT+FV+L
Sbjct  349  IGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPGFR-PYKLNLFRMVWRTIFVLL  407

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACLV
Sbjct  408  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLV  467

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A  GS AGV  DL+VYKPFKTSY
Sbjct  468  ISLVAVAGSIAGVVLDLKVYKPFKTSY  494



>ref|XP_003527948.1| PREDICTED: amino acid permease 3 [Glycine max]
 gb|KHN46995.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VG+YQVYCQPLFAFVEK AAQ +P S  +  EI++PIPG + P++LNLFRLVWRT++V+L
Sbjct  342  VGSYQVYCQPLFAFVEKHAAQMFPDSDFLNKEIEIPIPGFH-PYRLNLFRLVWRTIYVML  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVISML+PFFNDI G+LGAFGFWPLTVYFPVEMYI+QK+IPKWSTKWICLQ LS  CL+
Sbjct  401  STVISMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYIIQKRIPKWSTKWICLQILSMTCLL  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++I AA GS AG+A DL+ YKPFKT+Y
Sbjct  461  MTIGAAAGSIAGIAIDLRTYKPFKTNY  487



>ref|XP_006386355.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
 gb|ERP64152.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
Length=480

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPL+AF+EK AAQ +P S  IT +I++PIPG   P+ LNLFR++WRTLFVVL
Sbjct  335  VGAYQVYCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPGFR-PYNLNLFRMIWRTLFVVL  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYIVQKKI KWST+W+CLQ LS ACL+
Sbjct  394  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIVQKKIRKWSTRWLCLQILSVACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AG+  DL+  KPF+TSY
Sbjct  454  ISIAAAAGSVAGIVGDLKSIKPFQTSY  480



>ref|XP_002302224.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
 gb|EEE81497.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
Length=485

 Score =   210 bits (534),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV CQPL+AF+EK AAQ +P S  IT +I +PIPG   P+ LNLFR++WRTLFVVL
Sbjct  340  VGAYQVSCQPLYAFIEKEAAQRFPDSEFITKDINIPIPGFR-PYNLNLFRMIWRTLFVVL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYIVQKKIPKWST+W+CLQ LS ACL+
Sbjct  399  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLI  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AG+  DL+  KPF+TSY
Sbjct  459  ITIAAAAGSVAGIVGDLKSIKPFQTSY  485



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVY QPLFAFVEKTAAQ +P S  IT +I++ IPG   P+ LNLFR++WRT FVV+
Sbjct  344  VGAYQVYAQPLFAFVEKTAAQKFPDSEFITKDIKLRIPGIG-PYNLNLFRMIWRTAFVVI  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGAFGFWPLTVYFPVEMYIVQK+IPKWST+W+CLQTLS  CL+
Sbjct  403  TTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQKRIPKWSTRWLCLQTLSVGCLM  462

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL+VYKPF  SY
Sbjct  463  ITIAAAAGSIAGVVSDLKVYKPFTASY  489



>ref|XP_011027477.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=480

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPL+AF+EK AAQ +P S  IT +I++PIPG   P+ LNLFR++WR LFVVL
Sbjct  335  VGAYQVYCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPGFR-PYNLNLFRMIWRALFVVL  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYIVQKKIPKWS +W+CLQ LS ACL+
Sbjct  394  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIVQKKIPKWSKRWLCLQILSVACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++AAA GS AG+  DL+  KPF+TSY
Sbjct  454  ITMAAAAGSVAGIVGDLKSIKPFQTSY  480



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+CQPLFAF+EK A Q +P +  IT E ++P+PG   P+ LNLFRLVWRT+FV+L
Sbjct  348  IGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPGFR-PYNLNLFRLVWRTIFVLL  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACLV
Sbjct  407  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A  GS AGV  DL+ YKPFKTSY
Sbjct  467  ISLVAVAGSIAGVVLDLKAYKPFKTSY  493



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+CQPLFAF+EK A Q +P +  IT E ++P+PG   P+ LNLFRLVWRT+FV+L
Sbjct  349  IGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPGFR-PYNLNLFRLVWRTIFVLL  407

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACLV
Sbjct  408  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLV  467

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A  GS AGV  DL+ YKPFKTSY
Sbjct  468  ISLVAVAGSIAGVVLDLKAYKPFKTSY  494



>ref|XP_004160712.1| PREDICTED: amino acid permease 3-like, partial [Cucumis sativus]
Length=368

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A++  P S  IT +I VPIPG   P+KLNLFRLVWRT FV++
Sbjct  223  VGAYQVYCQPLFAFVEKYASEKSPDSDFITKDIDVPIPGFR-PYKLNLFRLVWRTAFVIV  281

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVY+PVEMYI QKKIPKWS++W+CLQTLS ACL+
Sbjct  282  TTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQKKIPKWSSRWLCLQTLSFACLM  341

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+ YKPFKTS+
Sbjct  342  ISIAAAAGSIAGVVLDLKSYKPFKTSF  368



>ref|XP_006366236.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=468

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFA+VEKTAA+ YP S +I  EI +PIPGC  PFKLN FRLVWRT+FV+ 
Sbjct  323  VGAYQVYCQPLFAYVEKTAAERYPDSIIIMKEIDIPIPGCK-PFKLNFFRLVWRTVFVIF  381

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            T +ISML+PFFNDIVGILGAFGFWPLTVYFPV+MYIV+K I KWS +WICLQ LS ACLV
Sbjct  382  TVLISMLMPFFNDIVGILGAFGFWPLTVYFPVKMYIVEKNITKWSGRWICLQLLSGACLV  441

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            ISIAAA GSFAG+ SDLQV  PFKT
Sbjct  442  ISIAAAAGSFAGLVSDLQVSWPFKT  466



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AAQ +P S  IT +I++P+PG +  + LNLFRLVWRT+FV+L
Sbjct  337  VGAYQVYCQPLFAFVEKQAAQRFPDSEFITRDIRIPLPG-SRFYNLNLFRLVWRTIFVIL  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVY+PVEMYI QK+IPKWSTKW+CLQ LS ACL+
Sbjct  396  TTLISMLLPFFNDIVGLLGALGFWPLTVYYPVEMYIAQKRIPKWSTKWLCLQILSFACLI  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++AAA GS AGV  DL+ YKPFKT Y
Sbjct  456  ITVAAAAGSIAGVILDLKSYKPFKTDY  482



>ref|XP_003522571.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578960.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=487

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VG+YQVYCQPLFAFVEK AA+  P S  +  EI++PIPG +S +K+NLFRLVWRT++V++
Sbjct  342  VGSYQVYCQPLFAFVEKHAARMLPDSDFVNKEIEIPIPGFHS-YKVNLFRLVWRTIYVMV  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVISML+PFFNDI G+LGAFGFWPLTVYFPVEMYI QK+IPKWSTKWICLQ LS ACL+
Sbjct  401  STVISMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYINQKRIPKWSTKWICLQILSMACLL  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++I AA GS AG+A DLQ YKPFKT+Y
Sbjct  461  MTIGAAAGSIAGIAIDLQTYKPFKTNY  487



>gb|KHN44307.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VG+YQVYCQPLFAFVEK AA+  P S  +  EI++PIPG +S +K+NLFRLVWRT++V++
Sbjct  342  VGSYQVYCQPLFAFVEKHAARMLPDSDFVNKEIEIPIPGFHS-YKVNLFRLVWRTIYVMV  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVISML+PFFNDI G+LGAFGFWPLTVYFPVEMYI QK+IPKWSTKWICLQ LS ACL+
Sbjct  401  STVISMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYINQKRIPKWSTKWICLQILSMACLL  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++I AA GS AG+A DLQ YKPFKT+Y
Sbjct  461  MTIGAAAGSIAGIAIDLQTYKPFKTNY  487



>ref|XP_006351135.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=479

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTAA+WYP+S  IT  I VPIPG  S + LNLFRLVWRT+FV++
Sbjct  335  VGAYQVYCQPLFAFIEKTAAEWYPNSKFITKNISVPIPGYKS-YNLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +T ISML+PFF+DIVGILGAFGFWPLTVY+PVEMYI QKKIPKWS KW+ LQ LS  CL+
Sbjct  394  STFISMLLPFFSDIVGILGAFGFWPLTVYYPVEMYIAQKKIPKWSRKWVGLQILSVTCLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            +SIAAA GSFAGV SDL+VYKPFK
Sbjct  454  VSIAAAAGSFAGVVSDLKVYKPFK  477



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQP+FAFVEK AAQ +P S  I  EI++P+PG    + +NLFRLVWRT+FV L
Sbjct  349  VGAYQVYCQPIFAFVEKQAAQRWPDSEFIAREIKIPVPGLGQ-YNMNLFRLVWRTIFVTL  407

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI QK+IP+WST+W+CLQ LS ACLV
Sbjct  408  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQKQIPRWSTRWLCLQVLSMACLV  467

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISI AA GS AGV  DL+ Y+PFKTSY
Sbjct  468  ISIMAAAGSIAGVMLDLKSYQPFKTSY  494



>ref|XP_008466753.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=478

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+  P S  IT +I VPIPG   P+KLNLFRLVWRT FV+ 
Sbjct  333  VGAYQVYCQPLFAFVEKYAAEKSPDSEFITKDIDVPIPGFR-PYKLNLFRLVWRTAFVIT  391

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVY+PVEMYI QKKIPKWS++W+CLQTLS ACL+
Sbjct  392  TTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQKKIPKWSSRWLCLQTLSFACLM  451

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+ YKPFKTS+
Sbjct  452  ISIAAAAGSVAGVVLDLKSYKPFKTSF  478



>gb|KGN47695.1| hypothetical protein Csa_6G381850 [Cucumis sativus]
Length=476

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A++  P S  IT +I VPIPG   P+KLNLFRLVWRT FV++
Sbjct  331  VGAYQVYCQPLFAFVEKYASEKSPDSDFITKDIDVPIPGFR-PYKLNLFRLVWRTAFVIV  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVY+PVEMYI QKKIPKWS++W+CLQTLS ACL+
Sbjct  390  TTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQKKIPKWSSRWLCLQTLSFACLM  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+ YKPFKTS+
Sbjct  450  ISIAAAAGSIAGVVLDLKSYKPFKTSF  476



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A Q +P S  IT E  + +PG    +KLNLFRLVWRT+FV+L
Sbjct  347  VGAYQVFCQPLFAFIEKWANQKWPESYFITKEFNIAVPGLG-LYKLNLFRLVWRTIFVIL  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQ+KIPKWST+WICLQ LS ACLV
Sbjct  406  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQRKIPKWSTRWICLQMLSMACLV  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A  GS AGV  DL+ YKPFKTSY
Sbjct  466  ISLVAVAGSLAGVVLDLKAYKPFKTSY  492



>emb|CDP10973.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTA  W+P S  IT EI++PIPG   P+KLNLFRLVWR++FVV+
Sbjct  342  VGAYQVYCQPLFAFIEKTARSWFPESQFITKEIEIPIPGFK-PYKLNLFRLVWRSIFVVI  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYIVQKKIPKWST+W+CLQ LS ACL
Sbjct  401  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSLACL  459



>gb|EPS60160.1| hypothetical protein M569_14643, partial [Genlisea aurea]
Length=335

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAF+EKT   W+P+S  I AEI +P+PGC  PF+L+LFRLVWR++FVV+
Sbjct  190  VGAYQVFSQPLFAFIEKTLVNWFPNSPFIAAEISIPVPGCR-PFRLSLFRLVWRSIFVVI  248

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVYFPVEMYI Q++IPKW  KWIC+QTLSA CL+
Sbjct  249  TTVISMLMPFFNDVVGFLGALGFWPLTVYFPVEMYIKQRRIPKWGMKWICMQTLSAVCLI  308

Query  176  isiaaavgsfagvaSDLQVYKPF  108
            I++ AAVGS AGV +DL++YKPF
Sbjct  309  ITVVAAVGSVAGVITDLKIYKPF  331



>ref|XP_004149429.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
Length=478

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A++  P S  IT +I VPIPG   P+KLNLFRLVWRT FV++
Sbjct  333  VGAYQVYCQPLFAFVEKYASEKSPDSDFITKDIDVPIPGFR-PYKLNLFRLVWRTAFVIV  391

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVY+PVEMYI QKKIPKWS++W+CLQTLS ACL+
Sbjct  392  TTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQKKIPKWSSRWLCLQTLSFACLM  451

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+ YKPFKTS+
Sbjct  452  ISIAAAAGSIAGVVLDLKSYKPFKTSF  478



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A Q +P S  IT E  + +PG    +KLNLFRLVWRT+FV+L
Sbjct  348  VGAYQVFCQPLFAFIEKWANQKWPGSYFITKEFNIAVPGYG-LYKLNLFRLVWRTIFVIL  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQKKIPKWST+WICLQ LS ACLV
Sbjct  407  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSMACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A  GS AGV  DL+ YKPFKTSY
Sbjct  467  ISLVAVAGSVAGVVLDLKAYKPFKTSY  493



>ref|XP_011027691.1| PREDICTED: amino acid permease 3-like, partial [Populus euphratica]
Length=369

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAY+V CQPL+AF+EK AAQ +P S  IT +I++PIPG   P+ LNLFR++WRTLFVVL
Sbjct  224  VGAYRVSCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPGFR-PYNLNLFRMIWRTLFVVL  282

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIV +LGA GFWPLTVYFPVEMYIVQKKIPKWS +W+CLQ LS ACL+
Sbjct  283  TTVISMLLPFFNDIVRLLGALGFWPLTVYFPVEMYIVQKKIPKWSKRWLCLQILSVACLI  342

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++AAA GS AG+  DL+  KPF+TSY
Sbjct  343  ITMAAAAGSVAGIVGDLKSIKPFQTSY  369



>ref|XP_011102302.1| PREDICTED: amino acid permease 3 isoform X2 [Sesamum indicum]
Length=486

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EKTA +WYP S  ITAEI +PIPG   P+KLNLFRL+WRT+FV++
Sbjct  341  IGAYQVYCQPLFAFIEKTALEWYPDSKFITAEITIPIPGIK-PYKLNLFRLIWRTIFVII  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGA GFWPLTVYFPVEMYI QK+IPKWS +W+CLQ LS ACLV
Sbjct  400  TTIISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAQKRIPKWSARWMCLQILSMACLV  459

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+AA VGSFAGV SDL+VYKPFKTSY
Sbjct  460  ISVAALVGSFAGVVSDLKVYKPFKTSY  486



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVE   A+ +P S  +  ++++PIPG +  +KLNLFRLVWRT++V+L
Sbjct  336  IGAYQVYCQPLFAFVENYTAKRFPDSDFVNKDVKIPIPGLDR-YKLNLFRLVWRTVYVIL  394

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI+QKKIPKWSTKWICLQ LS ACL+
Sbjct  395  TTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYIIQKKIPKWSTKWICLQLLSGACLI  454

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAA +GS AG+  DL+V+KPFKT Y
Sbjct  455  ITIAATIGSIAGLILDLKVFKPFKTIY  481



>ref|XP_011102300.1| PREDICTED: amino acid permease 3 isoform X1 [Sesamum indicum]
Length=491

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EKTA +WYP S  ITAEI +PIPG   P+KLNLFRL+WRT+FV++
Sbjct  346  IGAYQVYCQPLFAFIEKTALEWYPDSKFITAEITIPIPGIK-PYKLNLFRLIWRTIFVII  404

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGA GFWPLTVYFPVEMYI QK+IPKWS +W+CLQ LS ACLV
Sbjct  405  TTIISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAQKRIPKWSARWMCLQILSMACLV  464

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+AA VGSFAGV SDL+VYKPFKTSY
Sbjct  465  ISVAALVGSFAGVVSDLKVYKPFKTSY  491



>ref|XP_008338673.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=489

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVY QPLF+FVEKTAAQ +P S  IT +I++ IPG   P+ LNLFR++WRT FVV+
Sbjct  344  VGAYQVYAQPLFSFVEKTAAQRFPDSEFITKDIKLRIPGIG-PYNLNLFRMIWRTAFVVI  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGAFGFWPLTVYFPVEMYIVQ +IPKWST+W+CLQTLS  CL+
Sbjct  403  TTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQXRIPKWSTRWLCLQTLSVGCLI  462

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL+VYKPF  SY
Sbjct  463  ITIAAAAGSIAGVVSDLKVYKPFTASY  489



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPL+AFVEKTAA+ YPHS  IT +I+  IP C   F LNLFRLVWRT FV+L
Sbjct  339  VGAYQVFVQPLYAFVEKTAAEKYPHSHFITKDIKFRIP-CFGLFNLNLFRLVWRTCFVIL  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGA GFWPLTVYFPVEMYI  K+IPKWST+WICLQ LS ACL+
Sbjct  398  TTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIAAKRIPKWSTRWICLQILSGACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++IAAA GS AGV SDL++YKPFKTSY
Sbjct  458  VTIAAAAGSVAGVISDLKIYKPFKTSY  484



>ref|XP_008219592.1| PREDICTED: amino acid permease 3-like isoform X2 [Prunus mume]
Length=487

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVY QPLFAFVEKTAAQ +P S  IT +I++ IPG   P+ LNLFR++WRT FV++
Sbjct  342  VGAYQVYAQPLFAFVEKTAAQKFPDSDFITKDIRLQIPGIG-PYNLNLFRMIWRTAFVII  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGAFGFWPLTVYFPVEMYIVQKKIPKWST+W+CLQ LS ACL+
Sbjct  401  TTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL+VYKPFKTSY
Sbjct  461  ITIAAAAGSIAGVVSDLKVYKPFKTSY  487



>ref|XP_008219591.1| PREDICTED: amino acid permease 3-like isoform X1 [Prunus mume]
Length=488

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVY QPLFAFVEKTAAQ +P S  IT +I++ IPG   P+ LNLFR++WRT FV++
Sbjct  343  VGAYQVYAQPLFAFVEKTAAQKFPDSDFITKDIRLQIPGIG-PYNLNLFRMIWRTAFVII  401

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGAFGFWPLTVYFPVEMYIVQKKIPKWST+W+CLQ LS ACL+
Sbjct  402  TTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLI  461

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL+VYKPFKTSY
Sbjct  462  ITIAAAAGSIAGVVSDLKVYKPFKTSY  488



>ref|XP_007222588.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
 gb|EMJ23787.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
Length=485

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVY QPLFAFVEKTAAQ +P S  IT +I++ IPG   P+ LNLFR++WRT FV++
Sbjct  340  VGAYQVYAQPLFAFVEKTAAQKFPDSDFITKDIRLQIPGIG-PYNLNLFRMIWRTAFVII  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGAFGFWPLTVYFPVEMYIVQKKIPKWST+W+CLQ LS ACL+
Sbjct  399  TTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQKKIPKWSTRWLCLQILSVACLI  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL+VYKPFKTSY
Sbjct  459  ITIAAAAGSIAGVVSDLKVYKPFKTSY  485



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   204 bits (520),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPL+AFVEKTAA+ YPHS  IT +I+  IPG    F LNLFRLVWRT FV+L
Sbjct  339  VGAYQVFVQPLYAFVEKTAAEKYPHSHFITKDIKFRIPGFG-LFNLNLFRLVWRTCFVIL  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGA GFWPLTVYFPVEMYI  K+IPKWST+WICLQ LS ACL+
Sbjct  398  TTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIATKRIPKWSTRWICLQILSGACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++IAAA GS AGV SDL++YKPFKTSY
Sbjct  458  VTIAAAAGSIAGVISDLKIYKPFKTSY  484



>gb|KDP32819.1| hypothetical protein JCGZ_12111 [Jatropha curcas]
Length=482

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTAAQ YP S  IT EI++PIPG  S + LNLFRLV+RT+FV+ 
Sbjct  336  VGAYQVYCQPLFAFIEKTAAQRYPDSDFITKEIKIPIPGLKSSYNLNLFRLVFRTVFVIF  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LSAACL+
Sbjct  396  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSAACLI  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV +DL+  KPF+++Y
Sbjct  456  ITIAAAAGSIAGVITDLKTVKPFQSTY  482



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPG-CNSPFKLNLFRLVWRTLFVV  360
            VGAYQV+CQPLFAF+EK A+Q +P S  IT EI+VPIPG C  P+KLNLFRLVWR+ FVV
Sbjct  331  VGAYQVFCQPLFAFIEKWASQRWPDSKFITNEIKVPIPGFC--PYKLNLFRLVWRSAFVV  388

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+ISML+PFFND+VGILGAF FWPLTV+FPV+MYI QKKIP+WST+W+ LQ LS ACL
Sbjct  389  ATTIISMLLPFFNDVVGILGAFSFWPLTVFFPVQMYIAQKKIPRWSTRWLSLQILSFACL  448

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            VIS+AAA GS AGV  DL+VYKPFKTSY
Sbjct  449  VISVAAAAGSIAGVILDLKVYKPFKTSY  476



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLF+FVE  AA  +P+S  ++ E +VPIPGC  P++LNLFRLVWRT+FV+L
Sbjct  334  VGAYQVYCQPLFSFVESHAAARFPNSDFMSREFEVPIPGCK-PYRLNLFRLVWRTIFVIL  392

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVI+ML+PFFNDIVG++GA GFWPLTVY PVEMYI Q KIPKW  +WICLQ LSAAC V
Sbjct  393  STVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQTKIPKWGPRWICLQMLSAACFV  452

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ AA GS AGV  DL+VYKPF TSY
Sbjct  453  VTLLAAAGSIAGVIDDLKVYKPFVTSY  479



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAF+EK A Q +  S  IT E ++PIPG + P+KLNLFRLVWRT FV+L
Sbjct  340  VGAYQVFCQPIFAFIEKWATQRWAESNFITKEFKIPIPGYH-PYKLNLFRLVWRTAFVIL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND++GI+GAFGFWPLTVYFP+EMYI QKKI KWST+WICL+ LS ACL+
Sbjct  399  TTVISMLIPFFNDVMGIMGAFGFWPLTVYFPLEMYIQQKKILKWSTRWICLKMLSMACLL  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+I A  GS AGV  DL+VYKPFKT+Y
Sbjct  459  ITIVAGAGSIAGVMLDLKVYKPFKTTY  485



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLF+FVE  AA  +P+S  ++ E +VPIPGC  P++LNLFRLVWRT+FV+L
Sbjct  333  VGAYQVYCQPLFSFVESHAAARFPNSDFMSREFEVPIPGCK-PYRLNLFRLVWRTIFVIL  391

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVI+ML+PFFNDIVG++GA GFWPLTVY PVEMYI Q KIPKW  +WICLQ LSAAC V
Sbjct  392  STVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQTKIPKWGPRWICLQMLSAACFV  451

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ AA GS AGV  DL+VYKPF TSY
Sbjct  452  VTLLAAAGSIAGVIDDLKVYKPFVTSY  478



>gb|KHG20963.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=486

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK+A + +P S  IT +I++PIPG   P+ LNLFRLVWRT+FV++
Sbjct  341  VGAYQVYCQPLFAFIEKSATERFPDSEFITKDIKIPIPGFR-PYNLNLFRLVWRTIFVII  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL 
Sbjct  400  TTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQKKIPKWSTRWVCLQILSIACLF  459

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+ +KPF T Y
Sbjct  460  ITIAAAAGSIAGVVLDLKSFKPFATVY  486



>ref|XP_007137459.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
 gb|ESW09453.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
Length=487

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VG+YQVY QP+FAFVEK  A  +P S  +  EI++ +PG + P++LNLFRL+WRT++VVL
Sbjct  342  VGSYQVYSQPIFAFVEKNVASRFPDSDFVNKEIEIGVPGFH-PYRLNLFRLIWRTIYVVL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVI+ML+PFFNDI G+LGAFGFWPLTVYFPVEMYI+QK+IPKWS+KWICLQTLS ACL+
Sbjct  401  STVIAMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYIIQKRIPKWSSKWICLQTLSIACLL  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++I A VGS AG   DL+ YKPFKT+Y
Sbjct  461  MTIGAGVGSVAGTLIDLKSYKPFKTNY  487



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLF+FVE  AA+ +P+S  ++ E +VPIPGC  P+KLNLFRLVWRTLFV+L
Sbjct  334  VGAYQVYCQPLFSFVESNAAERFPNSDFMSREFEVPIPGCK-PYKLNLFRLVWRTLFVIL  392

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVI+ML+PFFNDIVG++GA GFWPLTVY PVEMYI Q KIPKW  KWI LQ LS AC V
Sbjct  393  STVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQTKIPKWGIKWIGLQMLSVACFV  452

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+I AA GS AGV  DL+VYKPF TSY
Sbjct  453  ITILAAAGSIAGVIDDLKVYKPFVTSY  479



>ref|NP_001233979.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13687.1|AF013278_1 amino acid transporter [Solanum lycopersicum]
Length=476

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EKTAA+WYP+S +IT  I VPIPG  S + + LFRLVWRT+FV++
Sbjct  332  VGAYQVYCQPLFAFIEKTAAEWYPNSKIITKNISVPIPGFKS-YNIYLFRLVWRTIFVII  390

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +T+ISML+PFF+DIVGILGAFGFWPLTVY+PVE+YIVQKKIPKWS KW  LQ LS  CL+
Sbjct  391  STIISMLLPFFSDIVGILGAFGFWPLTVYYPVEIYIVQKKIPKWSRKWFGLQILSVTCLI  450

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            +SIAAAVGSFAGV SDL+VYKPFK
Sbjct  451  VSIAAAVGSFAGVVSDLKVYKPFK  474



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  IT +I++PIPGC  P+ LNLFR+VWRT+FV+ 
Sbjct  340  VGAYQVYCQPLFAFVEKAAVQRFPDSEFITKDIKIPIPGCK-PYNLNLFRMVWRTVFVIF  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LSAACL+
Sbjct  399  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSAACLI  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+  KPF+T+Y
Sbjct  459  ITIAAAAGSIAGVIVDLKTVKPFQTTY  485



>ref|XP_006300985.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
 gb|EOA33883.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
Length=475

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVEK A+  +P S  I  +I++PIPG   PF+LNLFRL+WRT+FV++
Sbjct  330  IGAYQVYCQPLFAFVEKQASIRFPDSEFIAKDIKIPIPGFK-PFRLNLFRLIWRTVFVII  388

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LG+ GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ CLV
Sbjct  389  TTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSSGCLV  448

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  449  VSIAAAAGSIAGVVLDLKSYKPFQSNY  475



>gb|EMT11988.1| hypothetical protein F775_30582 [Aegilops tauschii]
Length=408

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  IT EIQVP+  C   FKLNLFRL WR+ FVV 
Sbjct  264  VGAYQVYCQPLFAFVEKWAQQRWPKSRFITGEIQVPLVSCG--FKLNLFRLTWRSAFVVA  321

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQKKIPKWS++W+CLQ LS ACL+
Sbjct  322  TTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQKKIPKWSSQWVCLQLLSLACLI  381

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+IAAA GS AG+ SDL+VYKPF T+
Sbjct  382  ITIAAAAGSIAGIMSDLKVYKPFSTT  407



>gb|KDO80515.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
 gb|KDO80516.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
 gb|KDO80517.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
 gb|KDO80518.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
Length=335

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A Q +P S  IT +I+VPIPG    + LNLFRLVWRT+FV+L
Sbjct  190  VGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKC-YNLNLFRLVWRTIFVIL  248

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIPKWSTKW+CLQ LS ACL+
Sbjct  249  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLI  308

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV +DL+ YKPF TSY
Sbjct  309  ITIAAAAGSIAGVVTDLKSYKPFSTSY  335



>gb|KEH35330.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=480

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPL+AFVE   A+ +P S L+   I++PIPG     KLNLFRLVWRT+FV+L
Sbjct  335  IGAYQVYCQPLYAFVENYTAKRFPQSDLVNKNIKIPIPG-RQMCKLNLFRLVWRTIFVIL  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT++SML+PFFNDI G+LGA GFWPLTVYFPVEMYI+QK+IPKWS+KWICLQ LS ACL+
Sbjct  394  TTLVSMLLPFFNDIAGLLGALGFWPLTVYFPVEMYIIQKRIPKWSSKWICLQLLSVACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAAVGS AG+  DL+V+KPFKT Y
Sbjct  454  ISIAAAVGSIAGIVLDLKVFKPFKTVY  480



>ref|XP_006654425.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=495

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 126/153 (82%), Gaps = 6/153 (4%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSP------FKLNLFRLVWR  375
            VGAYQVYCQPLFAFVEK A Q +P S  IT EI VP+P  +S       F+LNLFRL WR
Sbjct  343  VGAYQVYCQPLFAFVEKWAQQRWPKSRYITGEIDVPLPLPSSSGAGRRCFRLNLFRLTWR  402

Query  374  TLFVVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTL  195
            + FVV+TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQK+IPKWST+W+CLQ L
Sbjct  403  SAFVVVTTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKRIPKWSTRWVCLQLL  462

Query  194  SAACLvisiaaavgsfagvaSDLQVYKPFKTSY  96
            S ACL+I++A+A GS AG+ SDL+VYKPF T+Y
Sbjct  463  SLACLIITVASAAGSVAGIISDLKVYKPFATTY  495



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  IT  I+VP+ G +  ++LNLFRL WRT+FV+ 
Sbjct  323  VGAYQVYCQPLFAFVEKWALQTWPESKFITKGIEVPL-GPSRSYRLNLFRLTWRTVFVIC  381

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVYFPVEMYIVQKK+PKWSTKW+CLQ LS ACL+
Sbjct  382  TTVISMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSLACLI  441

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+AAA GS AGV +DL+VY+PF TSY
Sbjct  442  ISVAAAAGSIAGVMNDLKVYRPFTTSY  468



>ref|XP_011099674.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
 ref|XP_011099676.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
Length=491

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA  +P S  IT EI + IP    P+ LN+FRLVWR++FVVL
Sbjct  345  VGAYQVYCQPLFAFVEKHAAARWPDSGFITKEISIRIPCLQQPYNLNMFRLVWRSVFVVL  404

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVGILGAFGFWPLTVYFPVEMYI QK+I +WST+WICLQ LS ACL 
Sbjct  405  TTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIAQKRIARWSTRWICLQMLSFACLA  464

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+VY+PFKTSY
Sbjct  465  ISIAAAAGSVAGVVLDLKVYRPFKTSY  491



>emb|CAA10608.1| amino acid carrier [Ricinus communis]
Length=466

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  I  +I++PIPGC  P+ LNLFR+VWRT+FV+ 
Sbjct  321  VGAYQVYCQPLFAFVEKAAVQRFPDSEFILKDIKIPIPGCK-PYNLNLFRMVWRTVFVIF  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LSAACL+
Sbjct  380  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSAACLI  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+  KPF+T+Y
Sbjct  440  ITIAAAAGSIAGVIVDLKTVKPFQTTY  466



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK+AA+ YP +  +T E ++ IPG  SP+K N+FR+V+R  FVV 
Sbjct  347  VGAYQVFAQPIFAFIEKSAAERYPDNDFLTKEFEIRIPGLKSPYKANVFRVVYRCGFVVS  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LSAACLV
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSAACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+E+ A+  +P S  I  EI++P+PG   PF+LN FRL+WRT+FV++
Sbjct  331  VGAYQVYCQPLFAFIERQASTRFPDSDFIAKEIKIPVPGFK-PFRLNFFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ACLV
Sbjct  390  TTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIPRWSTQWVCLQVFSSACLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  450  VSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 7/150 (5%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPG---CNSPFKLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK AA+ YP S  I+ EI++P+PG   CN    LNLFRLVWRT F
Sbjct  339  VGAYQVYCQPLFAFVEKAAAKKYPDSEFISREIKIPVPGLGHCN----LNLFRLVWRTAF  394

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            V++TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IPKWST+W+CLQ LS A
Sbjct  395  VIVTTVISMLLPFFNDVVGLLGAVGFWPLTVYFPVEMYIAQKRIPKWSTRWLCLQILSVA  454

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKTSY  96
            CL+I+IAAA GS AGV SDL+ YKPFKTSY
Sbjct  455  CLIITIAAAAGSIAGVISDLKTYKPFKTSY  484



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK A Q +P ST IT E ++P+    S + LNLFRLVWR+ FVVL
Sbjct  347  VGAYQVFCQPLFAFVEKWARQTWPKSTFITKETRIPLSSARS-YNLNLFRLVWRSAFVVL  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFP+EMYI QKK+PKWST+W+ LQ LS ACL+
Sbjct  406  TTIISMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIAQKKVPKWSTRWVSLQMLSIACLI  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SI+AA GS AGV +DL+VY+PFKTSY
Sbjct  466  VSISAAAGSIAGVVTDLKVYRPFKTSY  492



>emb|CDY60629.1| BnaAnng17090D [Brassica napus]
Length=415

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A++ YP S  IT E ++ +   + PFKLNLFRLVWRT+FV+ 
Sbjct  269  VGAYQVYCQPLFAFVEKEASKRYPESKFITNETKIHLFPGSKPFKLNLFRLVWRTIFVIT  328

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND++G+LGA GFWPLTVYFPVEMYIVQK + +WST+W+CLQ LS ACLV
Sbjct  329  TTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKNVRRWSTRWVCLQVLSLACLV  388

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS  G+ +DL+ Y+PFKT +
Sbjct  389  VSVAAAAGSVVGIVTDLKSYRPFKTDF  415



>ref|XP_006393747.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
 gb|ESQ31033.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
Length=477

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A++ YP S  IT E ++ +   + PF LNLFRLVWRT+FV++
Sbjct  331  VGAYQVYCQPLFAFVEKEASKRYPESKFITKETKIHLFPGSKPFNLNLFRLVWRTVFVII  390

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND++G+LGA GFWPLTVYFPVEMYIVQK +P+W T+W+CLQ LS ACLV
Sbjct  391  TTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKNVPRWGTRWVCLQVLSLACLV  450

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS  G+ +DL+ YKPFKT +
Sbjct  451  VSIAAAAGSVVGIVTDLKSYKPFKTDF  477



>emb|CDY36017.1| BnaA08g04440D [Brassica napus]
Length=481

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVE+ A++ YP S  IT E ++ I   + PF LNLFRLVWRT+FV+ 
Sbjct  335  VGAYQVYCQPLFAFVEREASKRYPESKFITKETKIHIFPGSKPFNLNLFRLVWRTVFVIT  394

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISM++PFFND++G+LGA GFWPLTVYFPVEMYIVQK +P+WST+W+CLQ LS ACLV
Sbjct  395  TTLISMIMPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKNVPRWSTRWVCLQVLSLACLV  454

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS  G+ +DL+ YKPFKT +
Sbjct  455  VSVAAAAGSVVGIVTDLKSYKPFKTDF  481



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A + +P S  I  EIQVP+P   S +KLNLFRL+WRT FVV+
Sbjct  327  VGAYQVYCQPLFAFVEKWALETWPRSQFIGKEIQVPLPARRS-YKLNLFRLIWRTTFVVI  385

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TV+SML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+ +WST+W+CLQ LS ACL 
Sbjct  386  STVVSMLLPFFNDVVGLLGAIGFWPLTVYFPVEMYIVQKKVARWSTRWVCLQLLSLACLA  445

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+IA+A GS AGV SDL+VY+PFK S
Sbjct  446  ITIASAAGSIAGVVSDLKVYRPFKAS  471



>gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLF+F+EKTAAQ YP S  IT +I++PIP C   F LNLFR+V+RT+FV+ 
Sbjct  342  VGAYQVYCQPLFSFIEKTAAQKYPDSDFITRDIKIPIP-CLGTFNLNLFRMVFRTVFVIF  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWLCLQILSGACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV +DL+  KPF+TSY
Sbjct  461  ITIAAAAGSIAGVITDLKTVKPFQTSY  487



>emb|CDX88365.1| BnaC06g38090D [Brassica napus]
Length=476

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+E+ A+  +P S  I  +I++PIPG   PF+LN FRL+WRT+FV++
Sbjct  331  VGAYQVYCQPLFAFIERQASTRFPDSDFIAKDIKIPIPGFK-PFRLNFFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ACLV
Sbjct  390  TTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIPRWSTQWVCLQVFSSACLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  450  VSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+E+ A+  +P S  I  +I++PIPG   PF+LN FRL+WRT+FV++
Sbjct  331  VGAYQVYCQPLFAFIERQASTRFPDSDFIAKDIKIPIPGFK-PFRLNFFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ACLV
Sbjct  390  TTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIPRWSTQWVCLQVFSSACLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  450  VSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A Q +P ST IT E+++P+    S + LNLFRLVWR+ FVVL
Sbjct  347  VGAYQVFCQPLFAFIEKWALQTWPKSTFITKEVRIPLTSTRS-YNLNLFRLVWRSAFVVL  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK++P+WST+W+CLQ LS ACL+
Sbjct  406  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKEVPRWSTRWVCLQMLSIACLI  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV +DL+VY+PFKTSY
Sbjct  466  VSIAAAAGSIAGVVTDLKVYRPFKTSY  492



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPGLKSPYKVNVFRTVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LSA CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKWVCLQMLSAGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ A VGS AGV  DL+VYKPFK++Y
Sbjct  440  VTLVAGVGSIAGVMLDLKVYKPFKSTY  466



>gb|KDO57534.1| hypothetical protein CISIN_1g015342mg [Citrus sinensis]
Length=408

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK  A+ +P S  ++ E ++P+PG   P+KLNLFRLVWR+ FV+L
Sbjct  263  VGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGL-LPYKLNLFRLVWRSCFVIL  321

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI QKKI KWST+W+CLQ LS ACLV
Sbjct  322  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLV  381

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SI A  GS  GV +D++ Y PFKT+Y
Sbjct  382  LSIIAGAGSIVGVVNDVKAYTPFKTTY  408



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSP---FKLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK A Q +P S  IT E+ VP+    S    +KLNLFRL WRT F
Sbjct  345  VGAYQVYCQPLFAFVEKWAKQKWPKSKYITGEVDVPLSLSGSAGRCYKLNLFRLTWRTAF  404

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            VV TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+P+WST+W+CLQ LS A
Sbjct  405  VVATTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTRWVCLQMLSLA  464

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKTSY  96
            CL+I++A+A GS AG+ SDL+VYKPF T+Y
Sbjct  465  CLIITVASAAGSVAGIISDLKVYKPFVTTY  494



>ref|XP_007161468.1| hypothetical protein PHAVU_001G071500g [Phaseolus vulgaris]
 gb|ESW33462.1| hypothetical protein PHAVU_001G071500g [Phaseolus vulgaris]
Length=408

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLF F+E  A++ +P S  ++ E +VP PGC  PFKLNLFRLVWRT+FV+ 
Sbjct  263  VGAYQVYCQPLFQFIENNASKKFPESDFMSKEFEVPFPGCK-PFKLNLFRLVWRTMFVIF  321

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
             TV++ML+PFFNDIVG++GA GFWPLTVYFPVEMYIVQ K+PKWS KWI LQ LS +C +
Sbjct  322  CTVMAMLLPFFNDIVGLIGAIGFWPLTVYFPVEMYIVQTKMPKWSKKWIWLQILSGSCCI  381

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ AAVGS AG+  DL+VYKPF+TSY
Sbjct  382  ITVIAAVGSIAGIVDDLKVYKPFQTSY  408



>ref|XP_006386360.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
 gb|ERP64157.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
Length=485

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VG YQ  CQPL+AF+EK AAQ +P S  IT +I++PIPG   P+ LNLFR++WRTLFVVL
Sbjct  340  VGIYQFSCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPGFR-PYNLNLFRMIWRTLFVVL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIV +LGA GFWPLTVYFPVEMYIVQKKI KWST+W+CLQ LS ACL+
Sbjct  399  TTVISMLLPFFNDIVRLLGALGFWPLTVYFPVEMYIVQKKIRKWSTRWLCLQILSVACLI  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AG+  DL+  KPF+TSY
Sbjct  459  ISIAAAAGSVAGIVGDLKSIKPFQTSY  485



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPGLKSPYKVNVFRTVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LSA CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKWVCLQLLSAGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ A VGS AGV  DL+VYKPFK++Y
Sbjct  440  VTLVAGVGSIAGVMLDLKVYKPFKSTY  466



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  IT EIQVP+   +S FK+NLFRL WR+ FVV 
Sbjct  345  VGAYQVYCQPLFAFVEKWAQQRWPKSRFITGEIQVPL--ISSGFKINLFRLTWRSAFVVA  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQKKIPKWS++W+CLQ LS ACL+
Sbjct  403  TTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQKKIPKWSSQWVCLQLLSLACLI  462

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+IAAA GS AG+ SDL+VYKPF T+
Sbjct  463  ITIAAAAGSIAGIMSDLKVYKPFSTT  488



>ref|XP_002864872.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41131.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGIRSPYKVNVFRAVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERWSMKWVCLQMLSCGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_006473027.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=479

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A Q +P S  IT +I+VPIPG    + LNLFRLVWRT+FV+L
Sbjct  334  VGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKC-YNLNLFRLVWRTIFVIL  392

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIPKWSTKW+CLQ LS ACL+
Sbjct  393  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLI  452

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV +DL+ YKPF TSY
Sbjct  453  ITIAAAAGSIAGVVTDLKSYKPFSTSY  479



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A Q +P S  IT +I+VPIPG    + LNLFRLVWRT+FV+L
Sbjct  335  VGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPGFKC-YNLNLFRLVWRTIFVIL  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIPKWSTKW+CLQ LS ACL+
Sbjct  394  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTKWLCLQILSVACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV +DL+ YKPF TSY
Sbjct  454  ITIAAAAGSIAGVVTDLKSYKPFSTSY  480



>ref|XP_004142635.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 ref|XP_004170719.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 gb|KGN54544.1| Amino acid permease [Cucumis sativus]
Length=480

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A+  +P S  I  +I +PIPG   PFKLNLFRLVWRT+FV++
Sbjct  335  VGAYQVFCQPLFAFIEKNASSRFPDSKFINEDINIPIPGFR-PFKLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT++SML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+WI LQ LS ACL+
Sbjct  394  TTLVSMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWISLQILSMACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  D +  KPF+T+Y
Sbjct  454  ISIAAAAGSVAGVIQDSKSIKPFQTTY  480



>ref|XP_009107481.1| PREDICTED: amino acid permease 5-like [Brassica rapa]
Length=481

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQP+FAFVEK A++ YP S  IT E ++ I   + PF LNLF+LVWRT+FV+ 
Sbjct  335  VGAYQVYCQPVFAFVEKEASKRYPESKFITKETKIHIFPRSKPFNLNLFKLVWRTVFVIT  394

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISM+VPFFND++G+LGA GFWPLTVYFPVEMYIVQK +P+WST+W+CLQ LS ACLV
Sbjct  395  TTLISMIVPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKNVPRWSTRWVCLQVLSLACLV  454

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS  G+ +DL+ YKPFKT +
Sbjct  455  VSVAAAAGSVVGIVTDLKSYKPFKTDF  481



>ref|XP_009145052.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145053.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145054.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 emb|CDY43854.1| BnaA05g18660D [Brassica napus]
Length=487

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A++ YP S  IT E ++ +   + PFKLNLFRLVWRT+FV+ 
Sbjct  341  VGAYQVYCQPLFAFVEKEASKRYPESKFITNETKIHLFPGSKPFKLNLFRLVWRTIFVIT  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND++G+LGA GFWPLTVYFPVEMYIVQK + +WST+W+CLQ LS ACLV
Sbjct  401  TTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKNVRRWSTRWVCLQVLSLACLV  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS  G+ +DL+ Y+PFKT +
Sbjct  461  VSVAAAAGSVVGIVTDLKSYRPFKTDF  487



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAFVEK+ ++ +P S L+T E+Q+ IPG  SP+K N+FR+V+R  FVVL
Sbjct  341  IGAYQVFSQPIFAFVEKSVSERFPDSDLLTKELQIKIPGFRSPYKTNVFRVVFRCCFVVL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  401  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+++Y
Sbjct  461  ISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>gb|KEH40510.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=483

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGA+QVY QPL++ VEKTAA+ +P S  +  +I++ IP   SP K+NLFRLVWR++FV++
Sbjct  337  VGAFQVYVQPLYSVVEKTAAERFPDSDFVNKDIEISIPCVASPLKINLFRLVWRSIFVII  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG++GA GFWPLTVYFPVEMYIVQK+IPKWSTKWICL  LSAACLV
Sbjct  397  TTVISMLLPFFNDIVGLIGAIGFWPLTVYFPVEMYIVQKQIPKWSTKWICLHMLSAACLV  456

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+AAA GS AGV +DL VYKPF   Y
Sbjct  457  ISLAAAAGSVAGVIADLGVYKPFHAMY  483



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  IT E++VP+ G +  ++LN  RL WRTLFV+ 
Sbjct  347  VGAYQVYCQPLFAFVEKWALQTWPDSKFITKEVEVPL-GPSRCYRLNPLRLTWRTLFVIC  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+PKWSTKW+CLQ LS ACL 
Sbjct  406  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSMACLA  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            IS+AAA GS AGV +DL+VY+PFKTS
Sbjct  466  ISVAAAAGSIAGVVNDLKVYQPFKTS  491



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  IT E++VP+ G +  ++LN  RL WRTLFV+ 
Sbjct  344  VGAYQVYCQPLFAFVEKWALQTWPDSKFITKEVEVPL-GPSRCYRLNPLRLTWRTLFVIC  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+PKWSTKW+CLQ LS ACL 
Sbjct  403  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPKWSTKWVCLQLLSMACLA  462

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            IS+AAA GS AGV +DL+VY+PFKTS
Sbjct  463  ISVAAAAGSIAGVVNDLKVYQPFKTS  488



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK AA+ +  S  IT EI++P+PG   PFKLN+FR++WRT+FV+L
Sbjct  333  IGAYQVYCQPLFAFIEKHAAKRFGDSQFITKEIEIPVPGFR-PFKLNVFRMIWRTIFVIL  391

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI Q KIPKWSTKW+ LQ LSAACL+
Sbjct  392  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQMKIPKWSTKWLSLQILSAACLI  451

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+ YKPFKTSY
Sbjct  452  ITIAAAAGSIAGVVLDLKSYKPFKTSY  478



>ref|NP_177862.1| amino acid permease 3 [Arabidopsis thaliana]
 sp|Q39134.2|AAP3_ARATH RecName: Full=Amino acid permease 3; AltName: Full=Amino acid 
transporter AAP3 [Arabidopsis thaliana]
 gb|AAG29203.1|AC078898_13 amino acid carrier, putative [Arabidopsis thaliana]
 emb|CAA54630.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM20639.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AAM91305.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AEE35971.1| amino acid permease 3 [Arabidopsis thaliana]
Length=476

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P S  I  +I++PIPG   P +LN+FRL+WRT+FV++
Sbjct  331  IGAYQVYCQPLFAFIEKQASIQFPDSEFIAKDIKIPIPGFK-PLRLNVFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S  CLV
Sbjct  390  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSLGCLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF++ Y
Sbjct  450  VSIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|NP_201190.1| amino acid permease 4 [Arabidopsis thaliana]
 sp|Q9FN04.1|AAP4_ARATH RecName: Full=Amino acid permease 4; AltName: Full=Amino acid 
transporter AAP4 [Arabidopsis thaliana]
 dbj|BAB11033.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AED97804.1| amino acid permease 4 [Arabidopsis thaliana]
Length=466

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPYKVNVFRAVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERWSMKWVCLQMLSCGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>gb|AAM62803.1| amino acid carrier, putative [Arabidopsis thaliana]
Length=476

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P S  I  +I++PIPG   P +LN+FRL+WRT+FV++
Sbjct  331  IGAYQVYCQPLFAFIEKQASIQFPDSEFIAKDIKIPIPGFK-PLRLNVFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S  CLV
Sbjct  390  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSLGCLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF++ Y
Sbjct  450  VSIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK  A+ +P S  ++ E ++P+PG   P+KLNLFRLVWR+ FV+L
Sbjct  338  VGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGL-LPYKLNLFRLVWRSCFVIL  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI QKKI KWST+W+CLQ LS ACLV
Sbjct  397  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLV  456

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SI A  GS  GV +D++ Y PFKT+Y
Sbjct  457  LSIIAGAGSIVGVVNDVKAYTPFKTTY  483



>ref|XP_010416679.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P S  I  +I++PIPG   P +LNLFRL+WRT+FV++
Sbjct  332  IGAYQVYCQPLFAFIEKQASIRFPDSEFIAKDIEIPIPGFK-PLRLNLFRLIWRTVFVII  390

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LG+ GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S  CLV
Sbjct  391  TTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSLGCLV  450

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  451  VSIAAAAGSIAGVVLDLKSYKPFQSNY  477



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+CQPLFAF+EK A Q +P ST IT E+++ +    S + LNLFRLVWR+ FVVL
Sbjct  343  IGAYQVFCQPLFAFIEKWALQTWPKSTFITKEMRISLTSTKS-YNLNLFRLVWRSAFVVL  401

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA  FWPLTVYFP+EMY+VQKK+P+WST+W+CLQ LS ACL+
Sbjct  402  TTIISMLLPFFNDIVGLLGALSFWPLTVYFPIEMYVVQKKVPRWSTRWVCLQILSVACLI  461

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV +DL+VY+PFKTSY
Sbjct  462  VSIAAATGSIAGVVTDLKVYRPFKTSY  488



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK  A+ +P S  ++ E ++P+PG   P+KLNLFRLVWR+ FV+L
Sbjct  340  VGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGL-LPYKLNLFRLVWRSCFVIL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI QKKI KWST+W+CLQ LS ACLV
Sbjct  399  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLV  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SI A  GS  GV +D++ Y PFKT+Y
Sbjct  459  LSIIAGAGSIVGVVNDVKAYTPFKTTY  485



>gb|AAM13223.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AAO30058.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAASFPDSDLVTKEYEIRIPGFRSPYKVNVFRAVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERWSMKWVCLQMLSCGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>dbj|BAO45885.1| amino acid permease [Acacia mangium]
Length=486

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLF+F+EKTAA  +P S  I  EI+VPIPG  SP++LN FRLVWRT+FV+ 
Sbjct  340  VGAYQVYCQPLFSFIEKTAADRFPGSNFINKEIEVPIPGLRSPYQLNFFRLVWRTIFVIT  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFF  + G+LGA GFWPLTV+FPVEMYI QKKIP+WSTKW+CL  LS ACL 
Sbjct  400  TTVISMLLPFFGGVAGLLGALGFWPLTVFFPVEMYINQKKIPRWSTKWVCLHMLSIACLF  459

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            IS+AAA GS A +   L+ YKPF  +
Sbjct  460  ISLAAAAGSIADIIDQLKSYKPFAVT  485



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPYKVNVFRTVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CL+
Sbjct  380  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKWVCLQMLSCGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_006394236.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 ref|XP_006394237.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31522.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31523.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
Length=466

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFVEK AA  +P + L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVEKQAAARFPDNDLVTKEFEIRIPGIRSPYKVNVFRAVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSLKWVCLQMLSCGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITVVAGVGSLAGVMLDLKVYKPFKTTY  466



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+E+ A+  +P S  I  +I++PIPG   P +LN FRL+WRT+FV++
Sbjct  331  VGAYQVYCQPLFAFIERQASTRFPDSDFIAKDIKIPIPGFK-PLRLNFFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ACLV
Sbjct  390  TTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIPRWSTQWVCLQVFSSACLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  450  VSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_002893978.1| hypothetical protein ARALYDRAFT_473798 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70237.1| hypothetical protein ARALYDRAFT_473798 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPI-PGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLFAFVEK AA+ +P S  +T EI++ + PG   PF LNLFRLVWRT+FV+
Sbjct  335  VGAYQVYCQPLFAFVEKEAARRFPESKFVTNEIKIQLFPG--KPFNLNLFRLVWRTIFVM  392

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+ISML+PFFND++G+LGA GFWPLTVYFPVEMYIVQK +P+W TKW+CLQ LS ACL
Sbjct  393  TTTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKNVPRWGTKWVCLQVLSLACL  452

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
             +S+AAA GS  G+ SDL++YKPF++ +
Sbjct  453  FVSVAAAAGSVVGIVSDLKIYKPFQSDF  480



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK+ A+ YP +  ++ E ++ IPG  SP+K+N+FR+V+R+ FVV 
Sbjct  347  VGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNVFRMVYRSGFVVT  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_011003418.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  +T +I++ IPG   PF +NLFR VWRT FVV+
Sbjct  342  VGAYQVYCQPLFAFIEKEAARRFPDSDFVTKDIKISIPGLR-PFNINLFRTVWRTTFVVI  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGAFGFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDIVGLLGAFGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPFKTSY
Sbjct  461  ITIAAAAGSIAGVIDDVKTIKPFKTSY  487



>ref|XP_008444195.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=480

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A+  +P S  I  +I +PIPG   PFKLNLFRLVWRT+FV++
Sbjct  335  VGAYQVFCQPLFAFIEKYASNRFPDSQFINEDINIPIPGFR-PFKLNLFRLVWRTIFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT++SML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+WI LQ LS ACL+
Sbjct  394  TTLVSMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQKKIPKWSTRWISLQILSMACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D +  KPF+T+Y
Sbjct  454  ITIAAAAGSVAGVIQDSKSIKPFQTTY  480



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK   + +P S  IT +IQVPI      + LNLFRL WRT+FV++
Sbjct  347  VGAYQVYCQPLFAFIEKWTLKTWPKSEFITKDIQVPIA-SGRCYNLNLFRLTWRTMFVIV  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQKKIPKWST+W+CLQ LS ACLV
Sbjct  406  TTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQKKIPKWSTRWVCLQLLSLACLV  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I++A+A GS AGV SDL+VY+PFK+S
Sbjct  466  ITVASAAGSVAGVVSDLKVYRPFKSS  491



>gb|AAX56951.1| amino acid transporter [Pisum sativum]
Length=482

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPL+AFVE    + +P +  +   I++PIPG +  +KLNLF+LVWRT+FV+L
Sbjct  337  IGAYQVYCQPLYAFVENYMVKRFPDNYFLNKNIKIPIPGLDM-YKLNLFKLVWRTVFVIL  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT++SML+PFFNDIVG+LGA GFWPLTVYFPVEMYI+QKKIPKWSTKW CLQ LS ACL+
Sbjct  396  TTLVSMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIIQKKIPKWSTKWTCLQLLSGACLI  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAA+VGS AG+  DL+V+KPFKT Y
Sbjct  456  ITIAASVGSIAGIYLDLKVFKPFKTIY  482



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK+ A+ YP +   T E ++ IPG  SP++ N+FR+V+R +FVV 
Sbjct  347  VGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIRIPGLRSPYRANVFRIVYRCIFVVT  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAFVEK+ ++ +P + L+T E+Q  IPG  SP+K N+FR+V+R  FVVL
Sbjct  341  IGAYQVFSQPIFAFVEKSVSERFPDNDLLTKELQFKIPGIRSPYKTNVFRVVFRCCFVVL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  401  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+++Y
Sbjct  461  ISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>ref|XP_009130275.1| PREDICTED: amino acid permease 4 [Brassica rapa]
 ref|XP_009130276.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFV+K AA  +P S L++ E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPGVRSPYKVNVFRAVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CL+ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKWVCLKMLSGGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_011027479.1| PREDICTED: amino acid permease 3-like isoform X2 [Populus euphratica]
Length=485

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P S  +T +I++ IPG   P+ LNLFR++WRTLFVV 
Sbjct  340  VGAYQVYCQPLFAFVEKAAARRFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVT  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  399  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLI  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPF+TSY
Sbjct  459  ITIAAAAGSIAGVLDDVKTIKPFQTSY  485



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIP---GCNSPFKLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK A Q +P S  IT E+ VP+P        +KL+LFRL WRT F
Sbjct  329  VGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPLGTAGGRCYKLSLFRLTWRTAF  388

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            VV TTV+SML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+P+WST+W+CLQ LS A
Sbjct  389  VVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTRWVCLQLLSVA  448

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKTS  99
            CLVI++A+A GS AG+ SDL+VYKPF T+
Sbjct  449  CLVITVASAAGSVAGIVSDLKVYKPFVTT  477



>ref|XP_011027478.1| PREDICTED: amino acid permease 3-like isoform X1 [Populus euphratica]
Length=486

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P S  +T +I++ IPG   P+ LNLFR++WRTLFVV 
Sbjct  341  VGAYQVYCQPLFAFVEKAAARRFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVT  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  400  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLI  459

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPF+TSY
Sbjct  460  ITIAAAAGSIAGVLDDVKTIKPFQTSY  486



>gb|KEH35328.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=479

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +G+YQVYCQPL+AFVE   A+ +P S  +   I++PIPG    +KLNLFRLVWRT+FV+L
Sbjct  334  IGSYQVYCQPLYAFVESYTAKRFPQSDFVNKNIKIPIPGIQM-YKLNLFRLVWRTIFVIL  392

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +T+++ML+PFFNDIVG+LGA GFWPLTVYFPVEMYIVQK+IPKWS+KWICLQ LS  CL+
Sbjct  393  STLVAMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYIVQKRIPKWSSKWICLQLLSVVCLI  452

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAAVGS AG+  DL+V+KPFK+ Y
Sbjct  453  ISIAAAVGSIAGIVLDLKVFKPFKSVY  479



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIP---GCNSPFKLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK A Q +P S  IT E+ VP+P        +KL+LFRL WRT F
Sbjct  329  VGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPLGTAGGRCYKLSLFRLTWRTAF  388

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            VV TTV+SML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+P+WST+W+CLQ LS A
Sbjct  389  VVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTRWVCLQLLSVA  448

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKTS  99
            CLVI++A+A GS AG+ SDL+VYKPF T+
Sbjct  449  CLVITVASAAGSVAGIVSDLKVYKPFVTT  477



>ref|XP_009131105.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=487

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAFVEK+ ++ +P S L+T E+Q+ IPG  SP+K N+FR+V+R  FVVL
Sbjct  341  IGAYQVFSQPIFAFVEKSVSERFPDSDLLTKELQIKIPGFRSPYKTNVFRVVFRCCFVVL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILG  GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  401  TTVISMLMPFFNDVVGILGVLGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+++Y
Sbjct  461  ISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>emb|CDY39844.1| BnaC02g42740D [Brassica napus]
Length=466

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFV+K AA  +P S L++ E ++ IPG  +P+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPGVRAPYKVNVFRAVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWS KW+CL+ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSMKWVCLKMLSGGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_006386354.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|ERP64151.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=487

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P S  +T +I++ IPG   P+ LNLFR++WRTLFVV 
Sbjct  342  VGAYQVYCQPLFAFVEKEAARRFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVT  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPF+TSY
Sbjct  461  ITIAAAAGSIAGVLDDVKTIKPFQTSY  487



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P++ L+  E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPNNDLVIKEHEIRIPGLKSPYKVNVFRTVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LSA CL+
Sbjct  380  TTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKWVCLQMLSAGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFK++Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVYKPFKSTY  466



>ref|XP_002302223.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|EEE81496.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=485

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P S  +T +I++ IPG   P+ LNLFR++WRTLFVV 
Sbjct  340  VGAYQVYCQPLFAFVEKEAARRFPDSDFVTKDIKISIPGLG-PYNLNLFRMIWRTLFVVT  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  399  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLI  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPF+TSY
Sbjct  459  ITIAAAAGSIAGVLDDVKTIKPFQTSY  485



>gb|KHG16478.1| Amino acid permease 2 -like protein [Gossypium arboreum]
Length=476

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIP-GCNSPFKLNLFRLVWRTLFVV  360
            VGAYQV+CQP+F FVEK A+Q +P S  IT E+++P+P     P+KLNLFR VWRT FV+
Sbjct  329  VGAYQVFCQPIFTFVEKWASQRWPESKTITKELKIPMPIRGYRPYKLNLFRSVWRTAFVM  388

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
            LTTVISML+PFF D+VGILGAFGFWPLTVYFPVEMYI QKKI KWS++WICL+ LS +CL
Sbjct  389  LTTVISMLLPFFGDVVGILGAFGFWPLTVYFPVEMYIEQKKISKWSSRWICLKMLSMSCL  448

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            +ISI A  GS AGV  DL+VYKPFKT+Y
Sbjct  449  MISILAGTGSIAGVIHDLKVYKPFKTTY  476



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A   +P S  IT E+ VP+P     ++L+LFRLVWR+ FVVL
Sbjct  364  VGAYQVFCQPLFAFIEKWALTTWPDSAFITKEVAVPLPSTKR-YRLSLFRLVWRSAFVVL  422

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IP+WST+W+CLQ LS ACLV
Sbjct  423  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKRIPRWSTRWVCLQILSLACLV  482

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++AAA+GS AGV +DL+ Y+PFK+SY
Sbjct  483  ITVAAAIGSVAGVVTDLEAYRPFKSSY  509



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK+ A+ YP +  ++ E ++ IPG  SP+K+N+FR+V+R+ FVV 
Sbjct  347  VGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPGFKSPYKVNVFRMVYRSGFVVT  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ L+ ACLV
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLTVACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A   +P S  IT E+ VP+P     ++L+LFRLVWR+ FVVL
Sbjct  350  VGAYQVFCQPLFAFIEKWALTTWPDSAFITKEVAVPLPSTKR-YRLSLFRLVWRSAFVVL  408

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IP+WST+W+CLQ LS ACLV
Sbjct  409  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKRIPRWSTRWVCLQILSLACLV  468

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++AAA+GS AGV +DL+ Y+PFK+SY
Sbjct  469  ITVAAAIGSVAGVVTDLEAYRPFKSSY  495



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVE  A++ +P S LIT EI++ +     P+ LNLFRLVWRTLFV+L
Sbjct  334  VGAYQVYCQPLFAFVENQASKRFPDSKLITKEIKIRLFPGREPYNLNLFRLVWRTLFVIL  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND++G LGA GFWPLTVYFPVEMYI  K+I +WST+W+CLQ LS ACLV
Sbjct  394  TTLISMLMPFFNDVLGFLGAIGFWPLTVYFPVEMYIEHKRIQRWSTRWVCLQVLSFACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++A+A GS  G+ +DL+ YKPFKT +
Sbjct  454  VTLASAAGSVVGIVTDLKTYKPFKTDF  480



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGA+QV+CQPLFAFVEK +A+ +P+S  +TAE ++PIP     ++LNLFRLVWRT+FV++
Sbjct  369  VGAFQVFCQPLFAFVEKWSAKRWPNSDFVTAEYEIPIP-FYGVYQLNLFRLVWRTIFVII  427

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGAFGFWPLTVYFPVEMYI Q+KI KWS+KW+ LQ LS +CL 
Sbjct  428  TTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQEKIRKWSSKWVGLQMLSVSCLF  487

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAAVGS AGV  DLQ YKPFKTSY
Sbjct  488  VSIAAAVGSVAGVVLDLQTYKPFKTSY  514



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK+ A+ YP +   T E ++ IPG  SP+K N+FR+V+R  FVV 
Sbjct  347  VGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIKIPGLRSPYKANVFRIVYRCGFVVS  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ITVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAF+EK+ A+ YP +  ++ E ++ IPG  SP+K N+FR+V+R+ FVV 
Sbjct  347  IGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIKIPGFKSPYKANVFRVVYRSGFVVT  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>gb|EPS68727.1| hypothetical protein M569_06043, partial [Genlisea aurea]
Length=174

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVEK AA ++P +   T E+ +PIPG +  +K++LFRL+WRT FVV+
Sbjct  29   IGAYQVYCQPLFAFVEKAAAGFFPGNRFFTKEVDIPIPGFSRSYKVSLFRLMWRTAFVVV  88

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT ISM +PFFND+VGILGA GFWPLTVYFPV MY  Q+++ KWS KWICLQ LS ACL+
Sbjct  89   TTSISMALPFFNDVVGILGAIGFWPLTVYFPVAMYTKQERLRKWSRKWICLQILSLACLL  148

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            +SIAAA GS  GV SDL+VYKPF+ +
Sbjct  149  VSIAAAAGSIVGVMSDLKVYKPFEAN  174



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P S  I  +I++P+PG   P +LN FRL+WRT+FV++
Sbjct  331  IGAYQVYCQPLFAFIEKQASLRFPDSDFIAKDIKIPVPGYK-PLRLNFFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKI +WST+W+CLQ  S ACLV
Sbjct  390  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIARWSTRWVCLQVFSLACLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  450  VSIAAAAGSIAGVVLDLKSYKPFRSNY  476



>ref|XP_009421017.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK AA+ +P+S  +T EIQVPI    S +KLNLFRL WR +FV++
Sbjct  276  VGAYQVFCQPLFAFVEKWAARAWPNSEFVTREIQVPIASGTS-YKLNLFRLTWRAVFVIV  334

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG LGA GFWPLTVYFP+EMYIVQ K+PKWST+W+CLQ LS ACL+
Sbjct  335  TTVISMLLPFFNDVVGFLGAIGFWPLTVYFPIEMYIVQTKVPKWSTRWVCLQLLSFACLI  394

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            I+IA+A GS AGV SDL+VY+PF 
Sbjct  395  ITIASAAGSIAGVVSDLKVYRPFN  418



>ref|XP_011002450.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  +T +I++ IPG   PF +NLFR VWRT FVV+
Sbjct  342  VGAYQVYCQPLFAFIEKEAARRFPDSDFVTKDIKISIPGLR-PFNINLFRTVWRTTFVVI  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGAFGFWPLTVYFPVE+YI QKKIPKWST+W+CLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDIVGLLGAFGFWPLTVYFPVEIYISQKKIPKWSTRWLCLQILSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPFKTSY
Sbjct  461  ITIAAAAGSIAGVIDDVKTIKPFKTSY  487



>emb|CAA54632.1| amino acid permease [Arabidopsis thaliana]
Length=480

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPI-PGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLFAFVEK A++ +P S  +T EI++ + PG   PF LNLFRLVWRT FV+
Sbjct  335  VGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPG--KPFNLNLFRLVWRTFFVI  392

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK +P+W TKW+CLQ LS  CL
Sbjct  393  TTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQKNVPRWGTKWVCLQVLSVTCL  452

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
             +S+AAA GS  G+ SDL+VYKPF++ +
Sbjct  453  FVSVAAAAGSVIGIVSDLKVYKPFQSEF  480



>emb|CDY31348.1| BnaA02g33930D [Brassica napus]
Length=466

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFV+K AA  +P S L++ E ++ IPG  +P+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPGVRAPYKVNVFRAVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CL+ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVERWSMKWVCLKMLSGGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ISVVAGVGSVAGVMLDLKVYKPFKTTY  466



>emb|CAA54631.1| amino acid transporter [Arabidopsis thaliana]
Length=466

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK  A  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQLAARFPDSDLVTKEYEIRIPGFRSPYKVNVFRAVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERWSMKWVCLQMLSCGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+VYKPFKT+Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIP---GCNSPFKLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK A Q +P S+ IT E+ VP+         +KLNLFRL WRT F
Sbjct  336  VGAYQVYCQPLFAFVEKWAQQRWPKSSYITGEVDVPLSLAGAAGRCYKLNLFRLTWRTAF  395

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            VV TTV+SML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQKK+P+WST W+CLQ LS  
Sbjct  396  VVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTLWVCLQLLSLG  455

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKTSY  96
            CL+I++A+A GS AG+ SDL+VYKPF T+Y
Sbjct  456  CLIITVASAAGSVAGIISDLKVYKPFVTTY  485



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGA+QVYCQPLFAFVEK +AQ +P S  +TAE  +PIP  +  ++LNLFRLVWRT+FV++
Sbjct  366  VGAFQVYCQPLFAFVEKWSAQRWPKSDFVTAEYDIPIP-FHGVYQLNLFRLVWRTIFVII  424

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGAFGFWPLTVYFPVEMYI Q+KI KWS++W+ L+ LS +CL+
Sbjct  425  TTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIGKWSSRWVGLKMLSISCLL  484

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++IAAAVGS AGV  DL+ YKPFKTSY
Sbjct  485  VTIAAAVGSVAGVVLDLKTYKPFKTSY  511



>ref|XP_010063420.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70648.1| hypothetical protein EUGRSUZ_F03820 [Eucalyptus grandis]
Length=480

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAFVEK A + +P+S  IT +I++P  G  + +KLNLFRLVWRT+FV+ 
Sbjct  338  IGAYQVYCQPLFAFVEKAANKKFPNSQFITRDIEIPTLGLRT-YKLNLFRLVWRTVFVIT  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QK+IPKWSTKW+CLQ LS ACL+
Sbjct  397  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIKQKQIPKWSTKWVCLQILSMACLI  456

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            I+IAAA GS AGV  DL+ YKPF 
Sbjct  457  ITIAAAAGSVAGVVLDLKSYKPFN  480



>ref|XP_008219720.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=483

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 125/146 (86%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FA VEKTAA+++P+S  IT +I++PIPG  + + LNLFRLVWRT +V++
Sbjct  338  VGAYQVFAQPIFALVEKTAAEFFPNSQFITEDIRIPIPGFGA-YNLNLFRLVWRTFYVII  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISM++PFFND+VG LGA G+WPLTVYFPVEMYI QKK+PKWST+WICLQ LS + LV
Sbjct  397  TTLISMILPFFNDVVGFLGALGYWPLTVYFPVEMYIAQKKVPKWSTRWICLQILSLSVLV  456

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I++AAA GS  GV  DL++YKPFKTS
Sbjct  457  IALAAAAGSVIGVVQDLKIYKPFKTS  482



>ref|XP_002306650.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
 gb|ABK95777.1| unknown [Populus trichocarpa]
 gb|EEE93646.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
Length=487

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  +T +I++ IPG  S F +NLFR+V RT+FVVL
Sbjct  342  VGAYQVYCQPLFAFIEKEAARRFPDSDFVTKDIKISIPGL-SAFNINLFRMVSRTIFVVL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGAFGFWPLTVYFPVEMYI QKKIPKWST+W+CLQ LS ACL+
Sbjct  401  TTVISMLLPFFNDIVGLLGAFGFWPLTVYFPVEMYISQKKIPKWSTRWLCLQILSVACLI  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  D++  KPFKTSY
Sbjct  461  ITIAAAAGSIAGVIDDVKTIKPFKTSY  487



>ref|XP_010471931.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P S  I  +I++PIPG   P +LNLFRL+WRT+FV++
Sbjct  332  IGAYQVYCQPLFAFIEKQASICFPDSEFIAKDIKIPIPGFK-PLRLNLFRLIWRTVFVII  390

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT ISML+PFFND+VG+LG+ GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S  CLV
Sbjct  391  TTDISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSLGCLV  450

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF+++Y
Sbjct  451  VSIAAAAGSIAGVVLDLKSYKPFQSNY  477



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAF+EK+ A+ YP +   T E ++ IPG  SP+K N+FR+V+R  FVV 
Sbjct  347  IGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIKIPGLKSPYKANVFRIVYRCGFVVS  406

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACL+
Sbjct  407  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLL  466

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  467  ISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_011003419.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK AA  +P S +IT +I+V  PG   PF +NLFR++WRTLFV+ 
Sbjct  339  VGAYQVFCQPLFAFVEKEAAARFPDSEIITKDIKVAFPGFR-PFNINLFRMIWRTLFVIF  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI Q++IPKWST+W+ L+ LS ACL+
Sbjct  398  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQRRIPKWSTRWLGLRVLSFACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++IAAA GS AGV  DL+  KPF+TSY
Sbjct  458  VTIAAAAGSIAGVVDDLKSIKPFQTSY  484



>ref|XP_002889140.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65399.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P S  I  +I++PIPG      LN+FRL+WRT+FV++
Sbjct  331  IGAYQVYCQPLFAFIEKQASIRFPDSEFIARDIKIPIPGFKH-LHLNVFRLIWRTVFVII  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ CLV
Sbjct  390  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKKIPRWSTRWVCLQVFSSGCLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGV  DL+ YKPF++ Y
Sbjct  450  ISIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_011002449.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK AA  +P S +IT +I+V  PG   PF +NLFR++WRTLFV+ 
Sbjct  339  VGAYQVFCQPLFAFVEKEAAARFPDSEIITKDIKVAFPGFR-PFNINLFRMIWRTLFVIF  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI Q++IPKWST+W+ L+ LS ACL+
Sbjct  398  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQRRIPKWSTRWLGLRVLSFACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++IAAA GS AGV  DL+  KPF+TSY
Sbjct  458  VTIAAAAGSIAGVVDDLKSIKPFQTSY  484



>gb|AAM61320.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAF+EK AA  +P S L+T E ++ IPG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPGFRSPYKVNVFRAVYRSGFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CL+
Sbjct  380  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQRKVERWSMKWVCLQMLSCGCLM  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ A VGS AGV  DL+V KPFKT+Y
Sbjct  440  ITLVAGVGSIAGVMLDLKVXKPFKTTY  466



>ref|NP_175076.2| amino acid permease 5 [Arabidopsis thaliana]
 sp|Q8GUM3.1|AAP5_ARATH RecName: Full=Amino acid permease 5; AltName: Full=Amino acid 
transporter AAP5 [Arabidopsis thaliana]
 gb|AAO00749.1| amino acid permease, putative [Arabidopsis thaliana]
 gb|AAP81798.1| At1g44100 [Arabidopsis thaliana]
 gb|AEE32020.1| amino acid permease 5 [Arabidopsis thaliana]
Length=480

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPI-PGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLFAFVEK A++ +P S  +T EI++ + PG   PF LNLFRLVWRT FV+
Sbjct  335  VGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPG--KPFNLNLFRLVWRTFFVM  392

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK +P+W TKW+CLQ LS  CL
Sbjct  393  TTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQKNVPRWGTKWVCLQVLSVTCL  452

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
             +S+AAA GS  G+ SDL+VYKPF++ +
Sbjct  453  FVSVAAAAGSVIGIVSDLKVYKPFQSEF  480



>gb|AAG50558.1|AC074228_13 amino acid permease, putative [Arabidopsis thaliana]
Length=476

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPI-PGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLFAFVEK A++ +P S  +T EI++ + PG   PF LNLFRLVWRT FV+
Sbjct  331  VGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPG--KPFNLNLFRLVWRTFFVM  388

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK +P+W TKW+CLQ LS  CL
Sbjct  389  TTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQKNVPRWGTKWVCLQVLSVTCL  448

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
             +S+AAA GS  G+ SDL+VYKPF++ +
Sbjct  449  FVSVAAAAGSVIGIVSDLKVYKPFQSEF  476



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +A  +P S  +T E  +PIP C   ++LN FRLVWRT+FVVL
Sbjct  367  VGAYQVYCQPLFAFVEKWSAHKWPKSDFVTEEYDLPIP-CYGVYQLNFFRLVWRTIFVVL  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKI +W+++W+ LQ LS ACL+
Sbjct  426  TTLIAMLLPFFNDVVGILGAFGFWPLTVYFPVEMYISQKKIGRWTSRWVALQILSFACLL  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+AAAVGS AGV  DL+ YKPFKTSY
Sbjct  486  ISLAAAVGSVAGVVLDLKTYKPFKTSY  512



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAF EK+A++ +P + L+T E++  IPG  SP+K N+FR+V+R  FVVL
Sbjct  341  IGAYQVFSQPIFAFAEKSASERFPDNDLLTKELEFKIPGFRSPYKTNVFRVVFRCSFVVL  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  401  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+++Y
Sbjct  461  ISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>ref|XP_010063423.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70652.1| hypothetical protein EUGRSUZ_F03827 [Eucalyptus grandis]
Length=483

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +G YQVYCQPLFAFVEK A + +P+S  IT +I++P  G  + +KLNLFRLVWRT+FV++
Sbjct  341  IGTYQVYCQPLFAFVEKAAIKKFPNSQFITRDIEIPTLGLRT-YKLNLFRLVWRTVFVIM  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI QK+IPKWSTKW+CLQ LS ACL+
Sbjct  400  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIKQKQIPKWSTKWVCLQILSMACLI  459

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            I+IAAA GS AGV  DL+ YKPF 
Sbjct  460  ITIAAAAGSVAGVVLDLKSYKPFN  483



>ref|XP_010527719.1| PREDICTED: amino acid permease 5-like isoform X1 [Tarenaya hassleriana]
Length=525

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVE  A++ +P S LIT EI++ +     P+ LNLFRLVWRTLFV+L
Sbjct  379  VGAYQVYCQPLFAFVENQASKRFPDSKLITKEIKIRLFPGREPYNLNLFRLVWRTLFVIL  438

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND++G LGA GFWPLTVYFPVEMYI  K+I +WST+W+CLQ LS ACLV
Sbjct  439  TTLISMLMPFFNDVLGFLGAIGFWPLTVYFPVEMYIEHKRIQRWSTRWVCLQVLSFACLV  498

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++A+A GS  G+ +DL+ YKPFKT +
Sbjct  499  VTLASAAGSVVGIVTDLKTYKPFKTDF  525



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A+  +P +  I  EI++P+PG   P+ LNLFRL+WRT FV++
Sbjct  335  VGAYQVYCQPLFAFVEKQASARFPGNEFIAKEIKIPVPGFK-PYNLNLFRLIWRTAFVII  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKIP+WST+W+CLQ  S+ACLV
Sbjct  394  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIPRWSTRWVCLQVFSSACLV  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++AAA GS AGV  DL+ YKPF+T Y
Sbjct  454  VTVAAAAGSVAGVVLDLKSYKPFRTDY  480



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAF+EK A + +P +T I+ EI VP+      +KL+LFRLVWR+ FVVL
Sbjct  350  VGAYQVFSQPLFAFIEKWALKTWPDATFISKEIAVPLTPTKR-YKLSLFRLVWRSAFVVL  408

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYIVQK+IP+WST+W+CLQ LS+ACLV
Sbjct  409  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKRIPRWSTRWVCLQMLSSACLV  468

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++AA +GS AG+ +DL+VY+PFKTSY
Sbjct  469  ITVAAVIGSVAGIVTDLKVYRPFKTSY  495



>ref|XP_006390096.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
 gb|ESQ27382.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
Length=476

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P +  I  +I++PIPG   PF+LN FRL+WRT+FV++
Sbjct  331  IGAYQVYCQPLFAFIEKQASIRFPGNKFIAKDIKIPIPGFK-PFRLNFFRLIWRTVFVMI  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QKKI +WST+W+CLQ  S+ACLV
Sbjct  390  TTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQKKIARWSTQWVCLQVFSSACLV  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AGV  DL+ YKPF++ Y
Sbjct  450  VSIAAAAGSIAGVVLDLKSYKPFRSDY  476



>ref|XP_010461433.1| PREDICTED: amino acid permease 5-like [Camelina sativa]
Length=396

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVP-IPGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLF+FVEK A++ YP S+ IT EI++  IPG   PF LNLFRLVWRT+FV+
Sbjct  251  VGAYQVYCQPLFSFVEKEASRRYPESSFITNEIKIHLIPG--KPFNLNLFRLVWRTIFVM  308

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+I+ML+PFFND++G+LGA GFWPLTVYFPVEMYI QK + +W T+W+CL+ LS ACL
Sbjct  309  TTTLIAMLMPFFNDVLGLLGAVGFWPLTVYFPVEMYIAQKNVQRWGTRWVCLKVLSLACL  368

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            V+S+AAA GS  G+ SDL+VYKPF T +
Sbjct  369  VVSVAAAAGSVVGIVSDLKVYKPFHTDF  396



>gb|KHG27248.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=468

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK+AA+ +P S  IT +I++PIPG   P+ LNLFRLVWRT+FV+L
Sbjct  323  VGAYQVYCQPLFAFIEKSAAKRFPDSEFITKDIKIPIPGFR-PYNLNLFRLVWRTIFVML  381

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI Q KI KWST+W+CLQ LS ACL+
Sbjct  382  TTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYISQNKIAKWSTRWLCLQILSIACLI  441

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+ Y PF T+Y
Sbjct  442  ITIAAAAGSIAGVILDLKSYTPFSTAY  468



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAFVEK+ ++ +P + L+T E ++ +PG  SP++ N+FR+V+R  FVVL
Sbjct  346  IGAYQVFSQPIFAFVEKSVSERFPDNDLVTKEFKIKVPGFKSPYRANVFRVVFRCCFVVL  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS ACLV
Sbjct  406  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVACLV  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+++Y
Sbjct  466  ISVVAGVGSIAGVMLDLKVYKPFQSTY  492



>ref|XP_004289864.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGA+QV+CQPLFAFVEK +AQ +P S  +TAE  +PIP     ++LNLFRLVWRTLFV+L
Sbjct  367  VGAFQVFCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIP-FYGVYQLNLFRLVWRTLFVIL  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGAFGFWPLTVYFPVEMYI Q+KI KWS++W+ LQ LS +CLV
Sbjct  426  TTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIEKWSSRWLGLQMLSMSCLV  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SI AAVGSFAGV  DL+ YKPFKT+Y
Sbjct  486  VSIVAAVGSFAGVVLDLKSYKPFKTTY  512



>gb|EMS58805.1| hypothetical protein TRIUR3_05113 [Triticum urartu]
Length=242

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P ST +T E++VP+      +K+N+FR  WRT FV  
Sbjct  101  VGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEVEVPL---FRTYKVNMFRATWRTAFVAT  157

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SM++PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+PKWST+W+CLQ LS  CL 
Sbjct  158  TTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTQWVCLQMLSVGCLA  217

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            IS+AAA GS AG+ SDL+VY PFKT
Sbjct  218  ISLAAAAGSIAGIKSDLKVYHPFKT  242



>ref|XP_010428816.1| PREDICTED: amino acid permease 3 [Camelina sativa]
Length=477

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQVYCQPLFAF+EK A+  +P    I  +I++PIPG   P +LNLFRL+WRT+FV++
Sbjct  332  IGAYQVYCQPLFAFIEKQASIRFPDCEFIAKDIKIPIPGFK-PLRLNLFRLIWRTVFVII  390

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LG+ GFWPLTVYFPVEMYI QKKIP+WST+W+C Q  S  CLV
Sbjct  391  TTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQKKIPRWSTRWVCFQVFSLGCLV  450

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA GS AG+  DL+ YKPF+++Y
Sbjct  451  VSIAAAAGSIAGIVLDLKSYKPFQSNY  477



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAF EK+ ++ +P + L+T E++  IPG  SP+K N+FR+V+R  FVVL
Sbjct  339  IGAYQVFSQPIFAFAEKSVSERFPDNDLLTKELEFKIPGFRSPYKTNVFRVVFRCCFVVL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS +CLV
Sbjct  399  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVSCLV  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+T+Y
Sbjct  459  ISVVAGVGSIAGVMLDLKVYKPFQTTY  485



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAF EK+A++ +P + L+T E+   IPG  SP+K N+FR+V+R  FVVL
Sbjct  339  IGAYQVFSQPIFAFAEKSASERFPDNDLLTKELVFKIPGFRSPYKTNVFRVVFRCCFVVL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWST+W+CLQ LS +CLV
Sbjct  399  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSTRWVCLQMLSVSCLV  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+T+Y
Sbjct  459  ISVVAGVGSIAGVMLDLKVYKPFQTTY  485



>ref|XP_004290905.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAFVEK+AA+ +P S  I+  I++ IP C   + LN+FRLVWRTLFV+ 
Sbjct  335  VGAYQVFVQPLFAFVEKSAAEKFPDSQFISKNIKIQIP-CVGLYNLNMFRLVWRTLFVIT  393

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGA GFWPLTVYFPVEMYIVQK+IPKWSTKW+CLQTLS ACL+
Sbjct  394  TTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKRIPKWSTKWLCLQTLSGACLI  453

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL+ YKPF++SY
Sbjct  454  ITIAAAAGSIAGVISDLKTYKPFQSSY  480



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP+FAF EK+A++ +P + L+T E++  IPG  SP+K N+FR+V+R  FVVL
Sbjct  339  IGAYQVFSQPIFAFAEKSASERFPDNDLLTKELEFKIPGLRSPYKTNVFRVVFRCSFVVL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI Q+K+ KWS +W+CLQ LS +CLV
Sbjct  399  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQRKVEKWSLRWVCLQMLSVSCLV  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPF+T+Y
Sbjct  459  ISVFAGVGSIAGVMLDLKVYKPFQTTY  485



>ref|XP_007224395.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
 gb|EMJ25594.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
Length=483

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FA VEKTAA+++P+S  IT +I++PIPG  + +  NLFR VWRT +V++
Sbjct  338  VGAYQVFAQPIFALVEKTAAEFFPNSQFITEDIRIPIPGFGA-YNFNLFRFVWRTFYVII  396

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISM++PFFND+VG LGA G+WPLTVYFPVEMYI QKK+PKWSTKWICLQ LS + LV
Sbjct  397  TTLISMILPFFNDVVGFLGALGYWPLTVYFPVEMYIAQKKVPKWSTKWICLQILSLSVLV  456

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I++AAA GS  GV  DL++YKPFKTS
Sbjct  457  IALAAAAGSVTGVVQDLKIYKPFKTS  482



>ref|XP_007137460.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
 gb|ESW09454.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
Length=487

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VG+YQV+ QPLFAFVEK  A  +P S  +  EI++ +PG   P+KLNLFRLVWRT++VV+
Sbjct  342  VGSYQVFSQPLFAFVEKIVASRFPDSDFVKKEIEIGVPGLR-PYKLNLFRLVWRTIYVVI  400

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            +TVI+ML+PFFND+ G+LGA GFWPL VYFPVEMYIVQK+IPKWSTKWIC Q L+ +CL+
Sbjct  401  STVIAMLLPFFNDMGGLLGALGFWPLAVYFPVEMYIVQKRIPKWSTKWICFQILNISCLL  460

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ AAVGS AG+  DL+ YKPFKT+Y
Sbjct  461  VTLCAAVGSLAGIVFDLKTYKPFKTNY  487



>ref|XP_010479037.1| PREDICTED: amino acid permease 5 isoform X1 [Camelina sativa]
 ref|XP_010479038.1| PREDICTED: amino acid permease 5 isoform X2 [Camelina sativa]
 ref|XP_010479039.1| PREDICTED: amino acid permease 5 isoform X3 [Camelina sativa]
Length=474

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVP-IPGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLF+FVEK A++ YP S+ IT EI++  IPG   PF LNLFRLVWRT+FV+
Sbjct  329  VGAYQVYCQPLFSFVEKEASRRYPESSFITNEIKIQLIPG--KPFNLNLFRLVWRTIFVM  386

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+I+ML+PFFND++G+LGA GFWPLTVYFPVEMYI QK + +W T+W+CL+ LS ACL
Sbjct  387  TTTLIAMLMPFFNDVLGLLGAVGFWPLTVYFPVEMYIAQKNVQRWGTRWVCLKVLSLACL  446

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            V+S+AAA GS  G+ SDL+VYKPF T +
Sbjct  447  VVSVAAAAGSVVGIVSDLKVYKPFHTDF  474



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  IT +I++ IPG  + + LNLFRLVWRTLFV+ 
Sbjct  343  VGAYQVYCQPLFAFIEKKAAEKFPDSEFITKDIKISIPGFRA-YNLNLFRLVWRTLFVIS  401

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI +KKIPKWST+W+CLQ LS ACL+
Sbjct  402  TTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISKKKIPKWSTRWLCLQILSIACLI  461

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+ YKPF T Y
Sbjct  462  ITIAAAAGSIAGVVLDLKSYKPFSTDY  488



>ref|XP_010500132.1| PREDICTED: amino acid permease 5-like isoform X1 [Camelina sativa]
 ref|XP_010500133.1| PREDICTED: amino acid permease 5-like isoform X2 [Camelina sativa]
Length=474

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVP-IPGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLF+FVEK A++ YP S+ IT EI++  IPG   PF LNLFRLVWRT+FV+
Sbjct  329  VGAYQVYCQPLFSFVEKEASRRYPESSFITNEIKIQLIPG--KPFSLNLFRLVWRTIFVM  386

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+I+ML+PFFND++G+LGA GFWPLTVYFPVEMYI QK + +W T+W+CL+ LS ACL
Sbjct  387  TTTLIAMLMPFFNDVLGLLGAVGFWPLTVYFPVEMYIAQKNVQRWGTRWVCLKVLSLACL  446

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            V+S+AAA GS  G+ SDL+VYKPF T +
Sbjct  447  VVSVAAAAGSVVGIVSDLKVYKPFHTDF  474



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK AA+ +P S  IT +I++ IPG  + + LNLFRLVWRTLFV+ 
Sbjct  341  VGAYQVYCQPLFAFIEKKAAEKFPDSEFITKDIKISIPGFRA-YNLNLFRLVWRTLFVIS  399

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI +KKIPKWST+W+CLQ LS ACL+
Sbjct  400  TTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISKKKIPKWSTRWLCLQILSIACLI  459

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+ YKPF T Y
Sbjct  460  ITIAAAAGSIAGVVLDLKSYKPFSTDY  486



>emb|CDX84450.1| BnaC03g50500D [Brassica napus]
Length=466

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFVEK AA  +P+S L++ E ++  PG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVEKQAAARFPNSDLVSKEFEIRFPGVRSPYKVNVFRTVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA  FWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQRKVERWSMKWVCLQMLSCGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ A VGS  GV  DL+VYKPFKT+Y
Sbjct  440  VTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAF+EK A + +P ST I  EI VP+      + L+LFRLVWR+ FVVL
Sbjct  340  VGAYQVFCQPLFAFIEKWAVKTWPESTFIAKEIAVPLTPTRR-YNLSLFRLVWRSSFVVL  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VG+LGA GFWPLTVYFPVEMYIV+++IP+WST+W+CLQ LS ACL 
Sbjct  399  TTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVRQRIPRWSTRWVCLQMLSLACLA  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAA+GS AGV +DL +Y+PFKTSY
Sbjct  459  VSIAAAIGSVAGVVTDLNLYRPFKTSY  485



>gb|KHN39882.1| Amino acid permease 2 [Glycine soja]
Length=450

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAFVEK +A+ +P S  +TAE  +PIP C   ++LN FRLVWRT+FV+L
Sbjct  305  VGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIP-CFGVYQLNFFRLVWRTIFVLL  363

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFP++MYI QKKI +W+++W+ LQ LSA+CL+
Sbjct  364  TTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWLGLQLLSASCLI  423

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AAVGS AGV  DL+ YKPFKTSY
Sbjct  424  ISLLAAVGSMAGVVLDLKTYKPFKTSY  450



>dbj|BAJ95327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P ST +T E++VP+      +K+N+FR  WRT FVV 
Sbjct  339  VGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEVEVPL---FRTYKVNMFRATWRTAFVVA  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SM++PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+PKWST+W+CLQ LS  CL 
Sbjct  396  TTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTRWVCLQMLSVGCLA  455

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            IS+AAA GS AG+ SDL+VY PFKT
Sbjct  456  ISLAAAAGSIAGIKSDLKVYHPFKT  480



>ref|XP_010232650.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
 ref|XP_010232651.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=487

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S  +T EI++ + G    F++N+FRL WRT FVV 
Sbjct  347  VGAYQVYCQPLFAFVEKYAGQRWPESRYVTREIELSVGG----FRVNMFRLTWRTAFVVA  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SM++PFFND+VG LGA GFWPLTVYFPVEMYIVQ+K+P+WST+W+CLQ LS  CLV
Sbjct  403  TTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQRKVPRWSTRWVCLQMLSGGCLV  462

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            IS+AAA GS AG+ SDL+VY PFK+
Sbjct  463  ISLAAAAGSIAGIKSDLKVYHPFKS  487



>emb|CDY43761.1| BnaA06g22970D [Brassica napus]
Length=466

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFVEK AA  +P S L++ E ++  PG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVEKQAAARFPDSDLVSKEFEIRFPGVRSPYKVNVFRTVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA  FWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQRKVERWSMKWVCLQMLSCGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ A VGS  GV  DL+VYKPFKT+Y
Sbjct  440  VTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +AQ +  S  +TAE  +PIP C   ++LN FRLVWRTLFV+L
Sbjct  367  VGAYQVYCQPLFAFVEKWSAQKWSTSDFVTAEYDIPIPFCGM-YQLNFFRLVWRTLFVIL  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVI+ML+PFFND+VGILGAFGFWPLTVYFPVEMYI  ++I +W+T W+ LQ LS  CL+
Sbjct  426  TTVIAMLMPFFNDVVGILGAFGFWPLTVYFPVEMYISSRRIKRWTTMWVGLQILSMTCLL  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAAVGS AGV  DL+ YKPFKTSY
Sbjct  486  ISIAAAVGSVAGVVLDLKTYKPFKTSY  512



>ref|XP_009150448.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFVEK AA  +P S L++ E ++  PG  SP+K+N+FR V+R+ FVVL
Sbjct  320  VGAYQVFAQPIFAFVEKQAAARFPDSDLVSKEFEIRFPGVRSPYKVNVFRTVFRSCFVVL  379

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA  FWPLTVYFPVEMYI Q+K+ +WS KW+CLQ LS  CLV
Sbjct  380  TTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQRKVERWSMKWVCLQMLSCGCLV  439

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++ A VGS  GV  DL+VYKPFKT+Y
Sbjct  440  VTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S+ I  EI+V        FK+NLFRL WR+ FVV 
Sbjct  347  VGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVSFG-----FKVNLFRLTWRSAFVVA  401

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQKKIP+W ++W+CLQ LS ACLV
Sbjct  402  TTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKKIPRWGSQWVCLQLLSLACLV  461

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I++A+A GS AG+ SDL+VYKPF TS
Sbjct  462  ITVASAAGSVAGIMSDLKVYKPFSTS  487



>gb|EPS61237.1| amino acid transporter, partial [Genlisea aurea]
Length=342

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 122/152 (80%), Gaps = 6/152 (4%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSP-----FKLNL-FRLVWR  375
            VGAYQV+ QPLFAF+EKT + W+P+S  I AEI +PIP    P     +KL + FRLVWR
Sbjct  191  VGAYQVFSQPLFAFIEKTLSSWFPNSRFIAAEISIPIPIPTRPKPHRDYKLAVPFRLVWR  250

Query  374  TLFVVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTL  195
            +LFVVLTTVISML+PFFND+VGILGA GFWPLTVYFPVEMYI QK IPKW  +WICLQTL
Sbjct  251  SLFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQKGIPKWGMRWICLQTL  310

Query  194  SAACLvisiaaavgsfagvaSDLQVYKPFKTS  99
            S  C VIS+ AAVGS AGV +DL+VYKPF+ +
Sbjct  311  SGVCFVISVLAAVGSVAGVVADLKVYKPFQGT  342



>ref|XP_006307383.1| hypothetical protein CARUB_v10009009mg [Capsella rubella]
 gb|EOA40281.1| hypothetical protein CARUB_v10009009mg [Capsella rubella]
Length=480

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVP-IPGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLF+FVEK A++ YP S  IT EI++  +PG   PF LNLFRLVWRT+FV+
Sbjct  335  VGAYQVYCQPLFSFVEKEASKRYPDSKFITNEIKIQLVPG--KPFNLNLFRLVWRTIFVM  392

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TT+I+ML+PFFND++G+LGA GFWPLTVYFPVEMYI QK + +W T+W+CL+ LS ACL
Sbjct  393  TTTLIAMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYISQKNVQRWGTRWVCLKVLSLACL  452

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            V+S+AAA GS  G+ASDL+VYKPF+T +
Sbjct  453  VVSVAAAAGSVVGIASDLKVYKPFQTDF  480



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK +A+ +P S LIT E +  IP   + +KLNLFRLVWRT FVVL
Sbjct  367  VGAYQVFCQPLFAFVEKWSAKRWPKSELITHEYEARIPCTGATYKLNLFRLVWRTAFVVL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKI  WS++W+ LQ LS  CLV
Sbjct  427  TTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIRPWSSRWVGLQLLSFTCLV  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS AGV  DL+ Y+PF+++Y
Sbjct  487  VSLAAACGSMAGVVLDLKSYRPFESTY  513



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK A Q +P S+ I  EI+V        FK+NLFRL WR+ FVV 
Sbjct  341  VGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVSFG-----FKVNLFRLTWRSAFVVA  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQKKIP+W ++W+CLQ LS ACLV
Sbjct  396  TTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKKIPRWGSQWVCLQLLSLACLV  455

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I++A+A GS AG+ SDL+VYKPF TS
Sbjct  456  ITVASAAGSVAGIMSDLKVYKPFSTS  481



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGA+QVYCQPLFAFVEK +AQ +P    +TAE  +PIP     ++LNLFRLVWRT+FV++
Sbjct  366  VGAFQVYCQPLFAFVEKWSAQRWPKRDFVTAEYDIPIP-FYGVYQLNLFRLVWRTIFVMI  424

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGAFGFWPLTVYFPVEMYI Q+KI KWS++W+ L+ LS +CL+
Sbjct  425  TTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIGKWSSRWVGLKMLSISCLL  484

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ++IAAAVGS AGV  DL+ YKPFKTSY
Sbjct  485  VTIAAAVGSVAGVVLDLKTYKPFKTSY  511



>gb|ACR35411.1| unknown [Zea mays]
 tpg|DAA56511.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=341

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPF---KLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK AAQ +P S  IT E++VP+P   S     K+NLFR  WRT F
Sbjct  193  VGAYQVYCQPLFAFVEKWAAQRWPDSAYITGEVEVPLPLPASRRRCCKVNLFRATWRTAF  252

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            VV TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+P+WS++W+CLQ LS  
Sbjct  253  VVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWSSRWVCLQMLSLG  312

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKT  102
            CLVISIAAA GS AG+ASDL+VY+PFK+
Sbjct  313  CLVISIAAAAGSIAGIASDLKVYRPFKS  340



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPL+AFVEKT  + YPHS  IT +I+  +P   S + LNLFRLVWRT FV++
Sbjct  339  VGAYQVFVQPLYAFVEKTVKEKYPHSQFITKDIKFRLPVFGS-YNLNLFRLVWRTSFVIV  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGA GFWPLTVYFPVEMYI QK+IPKWST+W+CLQTLS ACL+
Sbjct  398  TTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKRIPKWSTRWLCLQTLSGACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL++YKPFKTSY
Sbjct  458  ITIAAAAGSIAGVISDLKIYKPFKTSY  484



>gb|KCW82484.1| hypothetical protein EUGRSUZ_C03879 [Eucalyptus grandis]
Length=449

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            V AYQ  CQPLFA+VEKT  + +P+S  IT EI++PIPGC SP+KL LF+LVWRT+FV+ 
Sbjct  304  VCAYQFNCQPLFAYVEKTLVEKFPNSQFITREIELPIPGC-SPYKLKLFQLVWRTVFVIG  362

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT IS L+PFFNDIVG+LGA GFWPLTV+FP+EMYI QKKIPKW TKW+CLQ +S ACL+
Sbjct  363  TTFISRLLPFFNDIVGLLGALGFWPLTVFFPIEMYIKQKKIPKWGTKWVCLQIVSVACLI  422

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS A V  DL+ +KPF T+Y
Sbjct  423  ITIAAAAGSVANVFLDLRSFKPFSTNY  449



>ref|XP_010674405.1| PREDICTED: amino acid permease 4 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AAQ +P S  IT E+++ IPG   P+ LN FRLVWRT FV+ 
Sbjct  340  VGAYQVYCQPLFAFVEKWAAQKWPDSDFITREMKIRIPGIG-PYNLNSFRLVWRTTFVIT  398

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFNDIVG+LGA GFWPLTVYFP+EMYI QKK+PKWSTKW+CLQ LS ACLV
Sbjct  399  TTIISMLLPFFNDIVGLLGALGFWPLTVYFPIEMYIAQKKVPKWSTKWLCLQMLSMACLV  458

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISIAAA GS AGVA DL+VY+PFKTSY
Sbjct  459  ISIAAAAGSIAGVALDLKVYRPFKTSY  485



>ref|XP_010530203.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
 ref|XP_010530205.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
Length=480

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPI-PGCNSPFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLFAFVEK A++ +P S  IT EI++   PG   P+ LNLFRLVWRT FV+
Sbjct  334  VGAYQVYCQPLFAFVEKQASKRFPDSKFITKEIKIRFFPGLK-PYNLNLFRLVWRTFFVI  392

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
            LTT+ISML+PFFND++G+LGA GFWPLTVYFPVEMYI   +I +WST+W+CLQ L+ ACL
Sbjct  393  LTTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYISHNRIQRWSTRWVCLQILNLACL  452

Query  179  visiaaavgsfagvaSDLQVYKPFKTSY  96
            V+++ +A GS  GV +DL  YKPFKT +
Sbjct  453  VVTVVSAAGSVVGVMTDLNTYKPFKTDF  480



>ref|XP_006590854.1| PREDICTED: amino acid permease 2-like [Glycine max]
Length=513

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAFVEK +A+ +P S  +TAE  +PIP C   ++LN FRLVWRT+FV+L
Sbjct  368  VGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIP-CFGVYQLNFFRLVWRTIFVLL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFP++MYI QKKI +W+++W+ LQ LSA+CL+
Sbjct  427  TTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWLGLQLLSASCLI  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AAVGS AGV  DL+ YKPFKTSY
Sbjct  487  ISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>gb|AAK33098.1| amino acid transporter [Glycine max]
Length=513

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAFVEK +A+ +P S  +TAE  +PIP C   ++LN FRLVWRT+FV+L
Sbjct  368  VGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIP-CFGVYQLNFFRLVWRTIFVLL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFP++MYI QKKI +W+++W+ LQ LSA+CL+
Sbjct  427  TTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWLGLQLLSASCLI  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AAVGS AGV  DL+ YKPFKTSY
Sbjct  487  ISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>dbj|BAK03421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P ST +T E++VP+      +K+N+FR  WRT FVV 
Sbjct  339  VGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEVEVPL---FRTYKVNMFRATWRTAFVVA  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SM++PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+PKWST+W+CLQ LS  CL 
Sbjct  396  TTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTRWVCLQMLSVGCLA  455

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            IS+AAA GS AG+ SDL+VY PFK+
Sbjct  456  ISLAAAAGSIAGIKSDLKVYHPFKS  480



>ref|XP_002458869.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
 gb|EES03989.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
Length=491

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNS-PFKLNLFRLVWRTLFVV  360
            VGAYQVYCQPLFAFVEK AAQ +P S  +T E++VP+P       K+NLFR  WRT FVV
Sbjct  345  VGAYQVYCQPLFAFVEKWAAQRWPDSAFVTGEVEVPLPATRRRSCKVNLFRATWRTAFVV  404

Query  359  LTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACL  180
             TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+P+WS +W+CLQ LS  CL
Sbjct  405  ATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWSPRWVCLQMLSLGCL  464

Query  179  visiaaavgsfagvaSDLQVYKPFKT  102
            VIS+AAA GS AG+ASDL+VY+PFK+
Sbjct  465  VISVAAAAGSIAGIASDLKVYRPFKS  490



>emb|CAH59424.1| amino acid permease [Plantago major]
Length=195

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAF+EK + + +  S  +TAE  +PIP C   ++LNLFRLVWRT++VV 
Sbjct  50   VGAYQVYCQPLFAFIEKWSVRKWSRSDFVTAEYDIPIPLCGV-YQLNLFRLVWRTIYVVF  108

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGA GFWPLTVYFPVEMYI Q K+ KW+++WI LQ LS ACL+
Sbjct  109  TTLIAMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQNKVRKWTSQWIGLQLLSIACLL  168

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAAVGS AGV  DL+ +KPFKT Y
Sbjct  169  VSVAAAVGSIAGVILDLRTFKPFKTVY  195



>ref|NP_001055592.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|AAV24773.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF17506.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|EAY98107.1| hypothetical protein OsI_20024 [Oryza sativa Indica Group]
 gb|EEE63778.1| hypothetical protein OsJ_18601 [Oryza sativa Japonica Group]
Length=496

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 122/153 (80%), Gaps = 6/153 (4%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIP------GCNSPFKLNLFRLVWR  375
            VGAYQVYCQPLFAFVEK A Q +P S  IT +I VP+       G    +KLNLFRL WR
Sbjct  344  VGAYQVYCQPLFAFVEKWAQQRWPKSWYITKDIDVPLSLSGGGGGGGRCYKLNLFRLTWR  403

Query  374  TLFVVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTL  195
            + FVV TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMYIVQK+IP+WST+W+CLQ L
Sbjct  404  SAFVVATTVVSMLLPFFNDVVGFLGAVGFWPLTVYFPVEMYIVQKRIPRWSTRWVCLQLL  463

Query  194  SAACLvisiaaavgsfagvaSDLQVYKPFKTSY  96
            S ACL I++A+A GS AG+ SDL+VYKPF T+Y
Sbjct  464  SLACLAITVASAAGSIAGILSDLKVYKPFATTY  496



>ref|XP_010090330.1| hypothetical protein L484_024995 [Morus notabilis]
 gb|EXB39300.1| hypothetical protein L484_024995 [Morus notabilis]
Length=511

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK +AQ +P S  +TAE  +PIP     +++N FRLVWRT+FV+L
Sbjct  366  VGAYQVFCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIP-FYGVYQVNFFRLVWRTIFVML  424

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVI+ML+PFFND+VGILGAFGFWPLTVYFPVEMYI QKKI +W+ +W+ LQ LS  CL 
Sbjct  425  TTVIAMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIGRWTGRWLGLQILSVTCLF  484

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAAVGSFAGV  DL+ YKPFKTSY
Sbjct  485  VSIAAAVGSFAGVVLDLKTYKPFKTSY  511



>ref|XP_010051605.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
Length=484

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            V AYQ  CQPLFA+VEKT  + +P+S  IT EI++PIPGC SP+KL LF+LVWRT+FV+ 
Sbjct  339  VCAYQFNCQPLFAYVEKTLVEKFPNSQFITREIELPIPGC-SPYKLKLFQLVWRTVFVIG  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT IS L+PFFNDIVG+LGA GFWPLTV+FP+EMYI QKKIPKW TKW+CLQ +S ACL+
Sbjct  398  TTFISRLLPFFNDIVGLLGALGFWPLTVFFPIEMYIKQKKIPKWGTKWVCLQIVSVACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS A V  DL+ +KPF T+Y
Sbjct  458  ITIAAAAGSVANVFLDLRSFKPFSTNY  484



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QPLFAFVEK +A+ +P +  +TAE ++ IP C   +KLN FRL+WRT+FV+L
Sbjct  368  IGAYQVFSQPLFAFVEKWSARKWPKNNFVTAEYEIAIP-CTGVYKLNFFRLIWRTIFVLL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFP++MYI QKKI +W+ KWI LQ LS  CL+
Sbjct  427  TTIIAMLLPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTNKWIGLQMLSVCCLI  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AAVGS AGV  DL+ YKPFKTSY
Sbjct  487  ISLLAAVGSIAGVVLDLKTYKPFKTSY  513



>emb|CDM85443.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P ST +T E++VP+      +K+N+FR  WRT FVV 
Sbjct  339  VGAYQVYCQPLFAFVEKWAAKRWPESTYVTGEVEVPL---FRTYKVNMFRAAWRTAFVVA  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SM++PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+PKWST+W+CLQ LS  CL 
Sbjct  396  TTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTQWVCLQMLSLGCLA  455

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            IS+AAA GS AG+ SDL+VY PFK+
Sbjct  456  ISLAAAAGSIAGIKSDLKVYHPFKS  480



>ref|XP_006356925.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=464

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV CQ LFAFVEK A +WYP S +IT EI +PI  C  PFKLN F L+WRT+FV+ 
Sbjct  322  VGAYQVSCQTLFAFVEKKAGEWYPDSNIITTEIDIPIHRCK-PFKLNFFHLIWRTIFVIA  380

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT IS+L+P FN+IV ILGAF FWPLTVYFP++MYIV+K IPKWS +WICLQ LS ACLV
Sbjct  381  TTFISVLMPSFNNIVDILGAFAFWPLTVYFPIKMYIVKKNIPKWSGRWICLQLLSGACLV  440

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            ISIA AVGSFAG+ SDL+ +KPFK
Sbjct  441  ISIAVAVGSFAGLVSDLKAFKPFK  464



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +A  +P +  +TAE ++PIP C   ++LN FR+VWR++FV++
Sbjct  377  VGAYQVYCQPLFAFVEKWSAHKWPKNDFVTAEYEIPIPHCGV-YRLNFFRIVWRSIFVIV  435

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFNDIVG+LGA GFWPLTVYFP+EMYI QKKI +W+++WI LQ LS  CL 
Sbjct  436  TTLIAMLMPFFNDIVGLLGALGFWPLTVYFPIEMYISQKKIGQWTSRWIALQILSVCCLF  495

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAAVGS AGV  DL+ YKPFKTSY
Sbjct  496  ITIAAAVGSVAGVVLDLKTYKPFKTSY  522



>emb|CDY47793.1| BnaC06g00580D [Brassica napus]
Length=476

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVY QP+FAFVEK A++ YP ST +T EI++P+   + PF LN FRLVWRT+FV+ 
Sbjct  330  VGAYQVYAQPIFAFVEKKASKMYPESTFVTKEIEIPLFSGSKPFCLNFFRLVWRTVFVIT  389

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
             T+ISML+PFFND+VG+LGA GFWPLTVYFPVEMYI QK +P WST+W+CLQ LS  CL+
Sbjct  390  ITLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQKNVPSWSTRWLCLQVLSLVCLI  449

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS  G+ S ++ YKPF++ +
Sbjct  450  VSLAAAAGSVVGIVSKIKTYKPFQSDF  476



>ref|XP_006383588.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
 gb|ERP61385.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
Length=484

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK A   +P S +IT +I+V +PG   PF +NLFR++WRTLFV+ 
Sbjct  339  VGAYQVFCQPLFAFVEKEAVARFPDSEIITKDIKVAVPGFR-PFNINLFRMIWRTLFVIF  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG+LGA GFWPLTVYFPVEMYI Q++IPKWST+W+ LQ LS ACL+
Sbjct  398  TTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQRRIPKWSTRWLGLQVLSIACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV  DL+  KPF+TSY
Sbjct  458  ITIAAAAGSIAGVVVDLKSIKPFQTSY  484



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK A + +P ST IT E+ VP+      F+L+LFRLVWR+ FVVL
Sbjct  347  VGAYQVFCQPLFAFVEKWAVRTWPDSTFITKEVAVPLTPTKR-FRLSLFRLVWRSTFVVL  405

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+V +LGA GFWPLTVYFPVEMYIVQK+IP+WS +W+CLQ LS  CLV
Sbjct  406  TTVISMLLPFFNDVVALLGALGFWPLTVYFPVEMYIVQKRIPRWSLRWVCLQMLSLGCLV  465

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+IAAAVGS AG+ +DL+VY PFKT+
Sbjct  466  ITIAAAVGSVAGIFTDLKVYHPFKTT  491



>emb|CDM85442.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK AA+ +P ST +T E++VP+      +K+N+FR  WRT FV  
Sbjct  339  VGAYQVYCQPLFAFVEKWAAKRWPESTYVTGEVEVPL---FRTYKVNMFRATWRTAFVTA  395

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SM++PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+PKWST+W+CLQ LS  CL 
Sbjct  396  TTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPKWSTQWVCLQMLSLGCLA  455

Query  176  isiaaavgsfagvaSDLQVYKPFKT  102
            IS+AAA GS AG+ SDL+VY PFKT
Sbjct  456  ISLAAAAGSIAGIKSDLKVYHPFKT  480



>ref|XP_009342937.1| PREDICTED: amino acid permease 2-like [Pyrus x bretschneideri]
Length=416

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FA VEKTA + +P+S  +T +I++ IPG  S + LNLFRLVWRT+FV+L
Sbjct  271  VGAYQVFAQPIFALVEKTATKNFPNSQFVTKDIKILIPGF-SYYTLNLFRLVWRTIFVIL  329

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFN+IVG LGA GFWPLTVYFPVEMYI QKKIP WST+W+CLQTLS   L+
Sbjct  330  TTVISMILPFFNNIVGFLGALGFWPLTVYFPVEMYIAQKKIPMWSTRWMCLQTLSLCVLI  389

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+++AA GS  GV   L+VY+PFKTS
Sbjct  390  IALSAAAGSVTGVIDSLKVYRPFKTS  415



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIP---GCNSPFKLNLFRLVWRTLF  366
            VGAYQVYCQPLFAFVEK AAQ +P S  IT E++VP+P         K+NLFR  WRT F
Sbjct  346  VGAYQVYCQPLFAFVEKWAAQRWPDSAYITGEVEVPLPLPASRRRCCKVNLFRATWRTAF  405

Query  365  VVLTTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAA  186
            VV TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+P+WS++W+CLQ LS  
Sbjct  406  VVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWSSRWVCLQMLSLG  465

Query  185  CLvisiaaavgsfagvaSDLQVYKPFKT  102
            CLVISIAAA GS AG+ASDL+VY+PFK+
Sbjct  466  CLVISIAAAAGSIAGIASDLKVYRPFKS  493



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK +AQ +  S  IT E +  +P   S +KLNLFRLVWRT+FVV+
Sbjct  368  VGAYQVFCQPLFAFVEKWSAQRWDKSEFITHEYEAHLPLVGSSYKLNLFRLVWRTIFVVV  427

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGA GFWPLTVYFPVEMYIVQKKI +WS +W+ L+ LS  CLV
Sbjct  428  TTLISMLMPFFNDVVGILGAIGFWPLTVYFPVEMYIVQKKIRRWSARWVGLRLLSFTCLV  487

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAA GS AGV  DL+ Y+PFK++Y
Sbjct  488  VSLAAACGSVAGVVLDLKSYRPFKSTY  514



>ref|XP_008368062.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FA VEKT  + +P+S  +T +I++ IPG  S + LNLFRLVWRT+FV+L
Sbjct  339  VGAYQVFAQPIFALVEKTTTKNFPNSQFVTKDIKIQIPGF-SYYTLNLFRLVWRTIFVIL  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM+ PFFNDIVG LGA GFWPLTVYFPVEMYI QKKIP WST+W+CLQTLS   L+
Sbjct  398  TTVISMIFPFFNDIVGFLGALGFWPLTVYFPVEMYIAQKKIPMWSTRWMCLQTLSLCVLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+++AA GS  GV  +L+VY+PFKTS
Sbjct  458  IALSAAAGSVTGVIHNLKVYRPFKTS  483



>ref|XP_002312967.2| hypothetical protein POPTR_0009s13610g [Populus trichocarpa]
 gb|EEE86922.2| hypothetical protein POPTR_0009s13610g [Populus trichocarpa]
Length=414

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +A+ +P S  +TAE +VPIP     ++LN FRLVWRT+FV+L
Sbjct  269  VGAYQVYCQPLFAFVEKWSARKWPKSDFVTAEYEVPIP-FYGVYQLNFFRLVWRTIFVML  327

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VG+LG+ GFWPLTV+FP+EMYI QKKI +W+++WI LQ LS  CL+
Sbjct  328  TTLIAMLMPFFNDVVGLLGSMGFWPLTVFFPIEMYISQKKIGRWTSQWIGLQILSMTCLM  387

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAAVGS AGV  DL+ YKPFKTSY
Sbjct  388  ITIAAAVGSVAGVVLDLKTYKPFKTSY  414



>gb|KHN25477.1| Amino acid permease 2 [Glycine soja]
Length=513

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAFVEK + + +P S  +TAE  +PIP C   ++LN FRLVWRT+FV+L
Sbjct  368  VGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIP-CFGVYQLNFFRLVWRTIFVLL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFP++MYI QKKI +W+++WI LQ LS +CL+
Sbjct  427  TTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWIGLQLLSVSCLI  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AAVGS AGV  DL+ YKPFKTSY
Sbjct  487  ISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_003540867.1| PREDICTED: amino acid permease 2 [Glycine max]
Length=513

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPLFAFVEK + + +P S  +TAE  +PIP C   ++LN FRLVWRT+FV+L
Sbjct  368  VGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIP-CFGVYQLNFFRLVWRTIFVLL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVYFP++MYI QKKI +W+++WI LQ LS +CL+
Sbjct  427  TTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWIGLQLLSVSCLI  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ AAVGS AGV  DL+ YKPFKTSY
Sbjct  487  ISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>gb|KDO68036.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=273

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK +A+ +P S L+TAE ++PIP     ++LNLFRLVWRTLFVVL
Sbjct  128  VGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGV-YQLNLFRLVWRTLFVVL  186

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGA GFWPLTVYFP+EMY  QKKI + +T+W+ LQ L+ +C  
Sbjct  187  TTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFF  246

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ AA+GS AGV  DL+ YKPFKT Y
Sbjct  247  ITLVAAIGSVAGVVLDLKTYKPFKTRY  273



>ref|XP_010546307.1| PREDICTED: amino acid permease 2 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK  ++ +P + L+  E ++ +PG  +P++ N+FR V+R+ FVV 
Sbjct  263  VGAYQVFCQPIFAFVEKWVSERFPGNGLLGKEFEIRVPGFRAPYRANVFRAVFRSGFVVS  322

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMY+ Q+K+ +WS +W+CLQ LS +CLV
Sbjct  323  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYVRQRKVERWSVRWVCLQMLSVSCLV  382

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  383  ISVVAGVGSIAGVMLDLKVYKPFKSTY  409



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QPL+AFVEKT  + YPHS  IT +I+  +P   S + LNLFRLVWRT FV++
Sbjct  339  VGAYQVFVQPLYAFVEKTVKEKYPHSRFITKDIKFRLPVFGS-YBLNLFRLVWRTSFVIV  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFND+VG+LGA GFWPLTVY PVEMYI QK+IPKWST W+CLQTLS ACL+
Sbjct  398  TTVISMILPFFNDVVGLLGALGFWPLTVYXPVEMYIAQKRIPKWSTXWLCLQTLSGACLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAA GS AGV SDL++YKPFKTSY
Sbjct  458  ITIAAAAGSIAGVISDLKIYKPFKTSY  484



>gb|AFK37021.1| unknown [Medicago truncatula]
Length=512

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP FAFVEK +A+ +P +  +TAE ++PIP C   ++LN FRL+WRTLFV+L
Sbjct  367  IGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIP-CIGVYQLNFFRLIWRTLFVLL  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVY+P++MYI QKKI +W+ KW+ LQ LS  CL+
Sbjct  426  TTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQVLSGCCLI  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISI AAVGS AGV  DL+ YKPFKTSY
Sbjct  486  ISILAAVGSIAGVVLDLKTYKPFKTSY  512



>ref|XP_007041865.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007041866.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97696.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97697.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=512

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK  AQ +P S L+TAE  +PIP     ++LNLFRL WRT+FVV+
Sbjct  367  VGAYQVFCQPLFAFVEKWCAQKWPKSDLVTAEYDIPIP-FGGVYQLNLFRLAWRTIFVVM  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVI+ML+PFFND+VG LGA GFWPLTVYFPVEMYI QKKI + +T+W+ LQ +S AC  
Sbjct  426  TTVIAMLMPFFNDVVGFLGAMGFWPLTVYFPVEMYISQKKIGRGTTRWLALQIISVACFF  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +++AAAVGS AGV  DL+ YKPFKTSY
Sbjct  486  VTVAAAVGSVAGVVLDLKTYKPFKTSY  512



>ref|XP_008377310.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FA VEKTAA+++P S  IT +I++ IP   S + LNLF LVWRTLFV+L
Sbjct  339  VGAYQVFAQPIFALVEKTAAKFFPDSQFITKDIKITIPRLGS-YNLNLFSLVWRTLFVIL  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFN++VG LGA G+WPLTVYFPVEMYI QKKIPKWS +WICL+ LS   L 
Sbjct  398  TTVISMILPFFNNVVGFLGALGYWPLTVYFPVEMYIAQKKIPKWSMRWICLEILSFCVLA  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I++ AA GS  GV  DL+VY+PFKTS
Sbjct  458  IALCAAGGSVTGVVHDLKVYRPFKTS  483



>ref|XP_009339433.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=484

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FA VEKTA + +P+S  +T +I++ IPG  S + LNLFRLVWRT+FV++
Sbjct  339  VGAYQVFAQPIFALVEKTATKNFPNSQFVTKDIKILIPGF-SYYTLNLFRLVWRTIFVII  397

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISM++PFFN+IVG LGA GFWPLTVYFPVEMYI QKKIP WST+W+CLQTLS   L+
Sbjct  398  TTVISMILPFFNNIVGFLGALGFWPLTVYFPVEMYIAQKKIPMWSTRWMCLQTLSLCVLI  457

Query  176  isiaaavgsfagvaSDLQVYKPFKTS  99
            I+++AA GS  GV   L+VY+PFKTS
Sbjct  458  IALSAAAGSVTGVIDSLKVYRPFKTS  483



>gb|KEH30492.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP FAFVEK +A+ +P +  +TAE ++PIP C   ++LN FRL+WRTLFV+L
Sbjct  367  IGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIP-CIGVYQLNFFRLIWRTLFVLL  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVY+P++MYI QKKI +W+ KW+ LQ LS  CL+
Sbjct  426  TTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQMLSGCCLI  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISI AAVGS AGV  DL+ YKPFKTSY
Sbjct  486  ISILAAVGSIAGVVLDLKTYKPFKTSY  512



>gb|KEH30491.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            +GAYQV+ QP FAFVEK +A+ +P +  +TAE ++PIP C   ++LN FRL+WRTLFV+L
Sbjct  367  IGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIP-CIGVYQLNFFRLIWRTLFVLL  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGAFGFWPLTVY+P++MYI QKKI +W+ KW+ LQ LS  CL+
Sbjct  426  TTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQMLSGCCLI  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            ISI AAVGS AGV  DL+ YKPFKTSY
Sbjct  486  ISILAAVGSIAGVVLDLKTYKPFKTSY  512



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +AQ + +   +TAE  +PIP     ++LN FRL WRT FV++
Sbjct  367  VGAYQVYCQPLFAFVEKWSAQRWSNGDFVTAEYDIPIP-FYGVYQLNFFRLSWRTAFVIV  425

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+MLVPFFND+VGILGA GFWPLTVYFP+E+Y+ QKKI +W+T+WI LQ LSAACL+
Sbjct  426  TTIIAMLVPFFNDVVGILGALGFWPLTVYFPIEIYVAQKKIGRWTTQWIGLQILSAACLL  485

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S++AA+GS AGV  +L+ YKPFKTSY
Sbjct  486  VSLSAAIGSVAGVVLELKTYKPFKTSY  512



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +A+ +P S  +TAE +VPIP     ++LN FRLVWRT+FV+L
Sbjct  366  VGAYQVYCQPLFAFVEKWSARKWPQSNFVTAEYEVPIP-FYGVYQLNFFRLVWRTIFVML  424

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VG+LGA GFWPLTV+FP+EMYI QKKI +W+ +WI LQ LS  CLV
Sbjct  425  TTLIAMLMPFFNDVVGLLGALGFWPLTVFFPIEMYISQKKIGRWTNQWIGLQILSMTCLV  484

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I+IAAAVGS AGV  DL+ Y+PFKTSY
Sbjct  485  ITIAAAVGSVAGVVLDLKTYRPFKTSY  511



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQP+FAFVEK  ++ +P + L+  E ++ +PG  +P++ N+FR V+R+ FVV 
Sbjct  326  VGAYQVFCQPIFAFVEKWVSERFPGNGLLGKEFEIRVPGFRAPYRANVFRAVFRSGFVVS  385

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFND+VGILGA GFWPLTVYFPVEMY+ Q+K+ +WS +W+CLQ LS +CLV
Sbjct  386  TTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYVRQRKVERWSVRWVCLQMLSVSCLV  445

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            IS+ A VGS AGV  DL+VYKPFK++Y
Sbjct  446  ISVVAGVGSIAGVMLDLKVYKPFKSTY  472



>ref|NP_001045010.1| Os01g0882800 [Oryza sativa Japonica Group]
 dbj|BAB90366.1| putative amino acid carrier [Oryza sativa Japonica Group]
 dbj|BAF06924.1| Os01g0882800 [Oryza sativa Japonica Group]
 gb|EAY76727.1| hypothetical protein OsI_04682 [Oryza sativa Indica Group]
 gb|EAZ14390.1| hypothetical protein OsJ_04310 [Oryza sativa Japonica Group]
Length=488

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK AAQ +P S  IT E+++ +   +   ++NLFR  WRT FVV 
Sbjct  343  VGAYQVFCQPLFAFVEKWAAQRWPESPYITGEVELRLSPSSRRCRVNLFRSTWRTAFVVA  402

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTV+SML+PFFND+VG LGA GFWPLTVYFPVEMY+VQKK+P+WST+W+CLQ LS  CLV
Sbjct  403  TTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQKKVPRWSTRWVCLQMLSVGCLV  462

Query  176  isiaaavgsfagvaSDLQVYKPFK  105
            ISIAAA GS AGV SDL+VY+PFK
Sbjct  463  ISIAAAAGSIAGVMSDLKVYRPFK  486



>gb|KDO68037.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=381

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+CQPLFAFVEK +A+ +P S L+TAE ++PIP     ++LNLFRLVWRTLFVVL
Sbjct  236  VGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIP-FWGVYQLNLFRLVWRTLFVVL  294

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+ISML+PFFND+VGILGA GFWPLTVYFP+EMY  QKKI + +T+W+ LQ L+ +C  
Sbjct  295  TTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFF  354

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            I++ AA+GS AGV  DL+ YKPFKT Y
Sbjct  355  ITLVAAIGSVAGVVLDLKTYKPFKTRY  381



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 122/147 (83%), Gaps = 4/147 (3%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQV+ QP+FAFVEK+A Q +P+   I  E ++ +P C  P+KLNLFR++WRT+FV L
Sbjct  333  VGAYQVFSQPIFAFVEKSATQRWPN---IEKEYKIELP-CLPPYKLNLFRMLWRTVFVTL  388

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TTVISML+PFFNDIVG++GA GFWPLTVYFPVEMYI QKKIPKW+ KWICLQ  S ACLV
Sbjct  389  TTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYIAQKKIPKWNKKWICLQIFSFACLV  448

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +SIAAAVGS AGV  DL+ Y PF++SY
Sbjct  449  VSIAAAVGSIAGVLVDLKKYTPFQSSY  475



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  536  VGAYQVYCQPLFAFVEKTAAQWYPHSTLITAEIQVPIPGCNSPFKLNLFRLVWRTLFVVL  357
            VGAYQVYCQPLFAFVEK +A  +  S  +TAE  +P+P     ++LN FR+VWRT FVVL
Sbjct  368  VGAYQVYCQPLFAFVEKWSAAKWSRSNFVTAEYDIPVP-FFGVYQLNFFRVVWRTCFVVL  426

Query  356  TTVISMLVPFFNDIVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSTKWICLQTLSAACLv  177
            TT+I+ML+PFFND+VGILGA GFWPLTVYFPVEMYI + KI KW+++WI LQ LS ACL+
Sbjct  427  TTLIAMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAKNKIGKWTSRWIGLQMLSMACLL  486

Query  176  isiaaavgsfagvaSDLQVYKPFKTSY  96
            +S+AAAVGS AGV  DLQ YKPFKTSY
Sbjct  487  VSVAAAVGSVAGVVLDLQTYKPFKTSY  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507948461360