BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22955_g3_i1 len=1218 path=[1:0-29 4912:30-156 158:157-183
4652:184-420 425:421-458 8081:459-708 5267:709-740 6730:741-922
6912:923-1217]

Length=1218
                                                                      Score     E

ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              595   0.0      
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              594   0.0      
ref|XP_007019168.1|  Amino acid permease isoform 2                      590   0.0      
ref|XP_007019167.1|  Amino acid permease isoform 1                      585   0.0      
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              582   0.0      
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        582   0.0      
gb|AIS71894.1|  amino acid transporter                                  581   0.0      
gb|KHG20963.1|  Amino acid permease 3 -like protein                     581   0.0      
gb|AIL30502.1|  amino acid transporter                                  581   0.0      
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    579   0.0      
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    579   0.0      
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        579   0.0      
gb|AII99817.1|  amino acid transporter                                  578   0.0      
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             577   0.0      
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              577   0.0      
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              577   0.0      
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              577   0.0      
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             577   0.0      
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    575   0.0      
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    573   0.0      
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like              572   0.0      
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   567   0.0      
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         566   0.0      
ref|XP_010095435.1|  hypothetical protein L484_013392                   564   0.0      
ref|XP_002520323.1|  amino acid transporter, putative                   564   0.0      Ricinus communis
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              564   0.0      
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       563   0.0      
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              563   0.0      
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              562   0.0      
ref|XP_002520322.1|  amino acid transporter, putative                   562   0.0      Ricinus communis
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              562   0.0      
ref|NP_001234606.1|  amino acid transporter                             562   0.0      
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                561   0.0      
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   561   0.0      
emb|CDP10973.1|  unnamed protein product                                560   0.0      
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             560   0.0      
emb|CBI21586.3|  unnamed protein product                                556   0.0      
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       558   0.0      
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        558   0.0      
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              558   0.0      
emb|CAN61092.1|  hypothetical protein VITISV_005276                     556   0.0      Vitis vinifera
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        556   0.0      Vitis vinifera
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              555   0.0      
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              555   0.0      
emb|CDX88364.1|  BnaC06g38080D                                          553   0.0      
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   553   0.0      
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              553   0.0      
emb|CDX88365.1|  BnaC06g38090D                                          553   0.0      
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              553   0.0      
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              553   0.0      
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              552   0.0      
ref|XP_004290905.1|  PREDICTED: amino acid permease 2-like              552   0.0      
emb|CDX87522.1|  BnaA07g33510D                                          551   0.0      
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              551   0.0      
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             551   0.0      
gb|KEH40510.1|  transmembrane amino acid transporter family protein     551   0.0      
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             550   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             550   0.0      
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   549   0.0      
ref|NP_001233979.1|  amino acid transporter                             549   0.0      
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    549   0.0      
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    548   0.0      
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             548   0.0      
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              548   0.0      
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    548   0.0      
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             548   0.0      
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             548   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                548   0.0      
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             548   0.0      
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             547   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              546   0.0      
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                546   0.0      
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    546   0.0      
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             545   0.0      
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   545   0.0      
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   544   0.0      
ref|XP_006382883.1|  amino acid permease AAP1 family protein            545   0.0      
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        544   0.0      
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              544   0.0      
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    544   0.0      
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             543   0.0      
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              543   0.0      
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              543   0.0      
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              542   0.0      
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              541   0.0      
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              541   0.0      
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              541   0.0      
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        541   0.0      
gb|AAM62803.1|  amino acid carrier, putative                            541   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_177862.1|  amino acid permease 3                                 540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              540   0.0      
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              540   0.0      
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              540   0.0      
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             540   0.0      
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    540   0.0      
emb|CAA54631.1|  amino acid transporter                                 539   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        539   0.0      
emb|CDY21569.1|  BnaC09g47230D                                          540   0.0      
gb|AAM13223.1|  amino acid transporter AAP4                             538   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_201190.1|  amino acid permease 4                                 538   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        539   0.0      
emb|CDX81121.1|  BnaC03g03750D                                          539   0.0      
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    538   0.0      
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         538   0.0      
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   538   0.0      
ref|XP_006386355.1|  amino acid permease which transports basic a...    538   0.0      
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             537   0.0      
emb|CDX69918.1|  BnaA10g22670D                                          537   0.0      
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             537   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    537   0.0      
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             537   0.0      
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             536   0.0      
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             536   0.0      
gb|AAM61320.1|  amino acid transporter AAP4                             535   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   536   0.0      
emb|CDX78353.1|  BnaA03g02650D                                          535   0.0      
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   535   0.0      
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              535   0.0      
ref|NP_196484.1|  amino acid permease 2                                 535   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   535   0.0      
emb|CAF22024.1|  amino acid permease                                    535   0.0      Brassica napus [oilseed rape]
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              535   0.0      
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             534   0.0      
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             533   0.0      
gb|KHN44307.1|  Amino acid permease 3                                   533   0.0      
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             533   0.0      
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              532   0.0      
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              533   0.0      
gb|KHG27248.1|  Amino acid permease 3 -like protein                     532   0.0      
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             532   0.0      
gb|AAM61227.1|  amino acid transport protein AAP2                       532   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   531   0.0      
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    532   0.0      
emb|CDY39844.1|  BnaC02g42740D                                          530   0.0      
emb|CDY31348.1|  BnaA02g33930D                                          530   0.0      
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              531   0.0      
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    530   0.0      
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              530   0.0      
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              528   0.0      
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   528   0.0      
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              528   0.0      
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              528   0.0      
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    527   0.0      
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              528   0.0      
dbj|BAO45885.1|  amino acid permease                                    528   0.0      
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   528   0.0      
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    527   0.0      
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              526   0.0      
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              526   0.0      
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          526   0.0      
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              526   0.0      
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        525   0.0      
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    525   0.0      
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              523   4e-180   
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    523   4e-180   
emb|CDO96925.1|  unnamed protein product                                523   8e-180   
emb|CDY43761.1|  BnaA06g22970D                                          521   1e-179   
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              521   2e-179   
gb|KHG16478.1|  Amino acid permease 2 -like protein                     521   2e-179   
gb|KHN19623.1|  Amino acid permease 3                                   521   2e-179   
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    521   3e-179   
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              520   6e-179   
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     519   7e-179   
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   518   1e-178   
gb|AAX56951.1|  amino acid transporter                                  518   2e-178   Pisum sativum [garden pea]
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         520   3e-178   
ref|NP_001067425.1|  Os11g0195600                                       517   4e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              518   5e-178   
gb|KEH35329.1|  transmembrane amino acid transporter family protein     514   9e-178   
emb|CDX84450.1|  BnaC03g50500D                                          514   6e-177   
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              514   6e-177   
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          514   8e-177   Sorghum bicolor [broomcorn]
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   515   1e-176   Vitis vinifera
emb|CAA70969.1|  amino acid transporter                                 509   2e-176   Solanum tuberosum [potatoes]
gb|KEH35328.1|  transmembrane amino acid transporter family protein     513   4e-176   
emb|CAC51425.1|  amino acid permease AAP4                               512   5e-176   Vicia faba var. minor [tick bean]
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                513   6e-176   
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    512   2e-175   
ref|XP_003630316.1|  Amino acid permease                                510   2e-175   
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    510   7e-175   
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    509   9e-175   
emb|CAN65437.1|  hypothetical protein VITISV_038918                     509   1e-174   Vitis vinifera
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    509   1e-174   
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    508   2e-174   
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   508   2e-174   
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              509   2e-174   
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             508   3e-174   
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              508   3e-174   
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              509   4e-174   
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              508   8e-174   
gb|KHN25477.1|  Amino acid permease 2                                   508   1e-173   
ref|XP_004289864.1|  PREDICTED: amino acid permease 2-like              507   1e-173   
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              506   4e-173   
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              506   5e-173   
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   505   9e-173   
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             504   2e-172   
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             503   3e-172   
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              502   3e-172   
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              504   3e-172   
gb|KEH35330.1|  transmembrane amino acid transporter family protein     503   3e-172   
emb|CAA10608.1|  amino acid carrier                                     501   7e-172   Ricinus communis
emb|CBI21597.3|  unnamed protein product                                496   9e-172   
gb|AAK33098.1|  amino acid transporter                                  502   1e-171   Glycine max [soybeans]
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           500   2e-171   
ref|NP_001055592.1|  Os05g0424000                                       501   3e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              501   6e-171   
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             499   6e-171   
dbj|BAK03497.1|  predicted protein                                      499   1e-170   
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              498   1e-170   
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              498   2e-170   
ref|XP_010266973.1|  PREDICTED: amino acid permease 3-like              498   2e-170   
ref|NP_001149036.1|  amino acid carrier                                 498   3e-170   Zea mays [maize]
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              498   3e-170   
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              497   3e-170   
ref|XP_002534252.1|  amino acid transporter, putative                   497   5e-170   Ricinus communis
emb|CDY36017.1|  BnaA08g04440D                                          497   5e-170   
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    498   6e-170   
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   498   7e-170   
ref|NP_001142349.1|  hypothetical protein                               497   7e-170   Zea mays [maize]
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             498   8e-170   
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              496   1e-169   
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             495   2e-169   
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              495   3e-169   
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          495   3e-169   Sorghum bicolor [broomcorn]
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              496   3e-169   
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              496   5e-169   
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              494   6e-169   
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              494   7e-169   
ref|XP_010090330.1|  hypothetical protein L484_024995                   495   8e-169   
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        493   1e-168   
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              493   2e-168   
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          493   2e-168   Sorghum bicolor [broomcorn]
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   493   3e-168   
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              492   3e-168   
gb|KEH30491.1|  transmembrane amino acid transporter family protein     493   4e-168   
gb|KEH30492.1|  transmembrane amino acid transporter family protein     493   5e-168   
gb|EEC68963.1|  hypothetical protein OsI_37697                          492   5e-168   Oryza sativa Indica Group [Indian rice]
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             491   1e-167   
gb|AFK37021.1|  unknown                                                 491   3e-167   
emb|CAN77083.1|  hypothetical protein VITISV_003992                     492   4e-167   Vitis vinifera
ref|NP_001066316.1|  Os12g0181500                                       489   5e-167   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82481.1|  hypothetical protein OsI_37698                          489   5e-167   Oryza sativa Indica Group [Indian rice]
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          489   9e-167   Sorghum bicolor [broomcorn]
gb|AAX56952.1|  amino acid transporter                                  488   1e-166   Pisum sativum [garden pea]
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              488   1e-166   
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             488   1e-166   
ref|NP_001066317.1|  Os12g0181600                                       488   1e-166   Oryza sativa Japonica Group [Japonica rice]
emb|CAA92992.1|  amino acid carrier                                     480   2e-166   Ricinus communis
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    487   3e-166   
emb|CAC51423.1|  amino acid permease AAP1                               486   5e-166   Vicia faba var. minor [tick bean]
emb|CDM85443.1|  unnamed protein product                                486   6e-166   
emb|CAA70778.1|  amino acid transporter                                 488   6e-166   Vicia faba [broad bean]
emb|CDM85442.1|  unnamed protein product                                486   7e-166   
dbj|BAJ86012.1|  predicted protein                                      486   8e-166   
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              486   1e-165   
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          486   1e-165   Sorghum bicolor [broomcorn]
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    488   1e-165   
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              486   1e-165   
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              485   2e-165   
dbj|BAJ95327.1|  predicted protein                                      484   4e-165   
dbj|BAK03421.1|  predicted protein                                      484   4e-165   
gb|AAD16014.1|  amino acid transporter                                  480   7e-165   Nepenthes alata
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    483   8e-165   
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    484   1e-164   
ref|NP_175076.2|  amino acid permease 5                                 483   1e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              483   1e-164   
emb|CAA54632.1|  amino acid permease                                    483   1e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              482   2e-164   
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    481   4e-164   
ref|NP_001140430.1|  hypothetical protein                               482   4e-164   Zea mays [maize]
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          482   5e-164   Sorghum bicolor [broomcorn]
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    481   1e-163   
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    481   1e-163   
dbj|BAK02045.1|  predicted protein                                      480   3e-163   
gb|AFK39617.1|  unknown                                                 476   3e-163   
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              479   5e-163   
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              479   1e-162   
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              478   2e-162   
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    478   2e-162   
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          478   2e-162   
ref|XP_003602669.1|  Amino acid permease                                477   3e-162   
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              477   4e-162   
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              476   5e-162   
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              477   9e-162   
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              476   9e-162   
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   476   9e-162   
emb|CDY47793.1|  BnaC06g00580D                                          476   1e-161   
gb|AAD16015.1|  amino acid transporter                                  471   1e-161   
gb|ABR18002.1|  unknown                                                 473   2e-160   
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              471   7e-160   
gb|AAG50558.1|AC074228_13  amino acid permease, putative                471   7e-160   
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              470   2e-159   
ref|XP_010051542.1|  PREDICTED: amino acid permease 3-like              470   2e-159   
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              471   2e-159   
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             469   2e-159   
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             469   4e-159   
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             470   6e-159   
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    468   1e-158   
ref|NP_001045595.1|  Os02g0102200                                       468   3e-158   
ref|NP_001045010.1|  Os01g0882800                                       466   6e-158   
gb|EEE52230.1|  hypothetical protein OsJ_34158                          464   1e-157   
gb|EEC81839.1|  hypothetical protein OsI_25597                          464   1e-157   
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             465   2e-157   
gb|EAY84081.1|  hypothetical protein OsI_05462                          464   4e-157   
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              461   7e-156   
ref|XP_010051604.1|  PREDICTED: amino acid permease 3-like              457   6e-155   
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    458   1e-154   
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              458   1e-154   
gb|KHN09641.1|  Amino acid permease 2                                   457   2e-154   
ref|XP_010051607.1|  PREDICTED: amino acid permease 3-like              456   4e-154   
gb|EMT28481.1|  hypothetical protein F775_18207                         455   6e-154   
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          457   9e-154   
ref|XP_010051603.1|  PREDICTED: amino acid permease 3-like              455   1e-153   
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    476   9e-153   
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    476   1e-152   
ref|XP_010051605.1|  PREDICTED: amino acid permease 3-like              452   3e-152   
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          451   6e-152   
ref|XP_010546307.1|  PREDICTED: amino acid permease 2 isoform X2        445   1e-150   
ref|NP_001170050.1|  uncharacterized protein LOC100383966               446   2e-150   
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    445   2e-149   
gb|KCW82236.1|  hypothetical protein EUGRSUZ_C03655                     443   2e-149   
ref|XP_003602666.1|  Amino acid permease                                443   6e-149   
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   443   9e-149   
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              441   3e-148   
gb|AAF15945.1|AF061435_1  amino acid transporter b                      433   4e-148   
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              441   6e-148   
gb|ACJ84392.1|  unknown                                                 436   7e-148   
gb|KDO57534.1|  hypothetical protein CISIN_1g015342mg                   437   1e-147   
ref|XP_003602671.1|  Amino acid permease                                439   2e-147   
ref|XP_006856752.1|  hypothetical protein AMTR_s00055p00034230          432   4e-147   
gb|KCW82488.1|  hypothetical protein EUGRSUZ_C03884                     437   4e-147   
ref|XP_003602670.1|  Amino acid permease                                439   5e-147   
ref|XP_004290906.1|  PREDICTED: amino acid permease 2-like              436   5e-146   
emb|CAC51424.1|  amino acid permease AAP3                               435   9e-146   
gb|ABR16450.1|  unknown                                                 435   1e-145   
ref|XP_003638241.1|  Amino acid permease                                438   2e-145   
gb|EMT28649.1|  hypothetical protein F775_26310                         434   4e-145   
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                432   2e-144   
ref|XP_009421017.1|  PREDICTED: amino acid permease 3-like              429   3e-144   
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         431   4e-144   
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              430   7e-144   
ref|XP_002510013.1|  amino acid transporter, putative                   430   8e-144   
gb|KCW82484.1|  hypothetical protein EUGRSUZ_C03879                     427   4e-143   
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             428   4e-143   
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             429   5e-143   
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              428   7e-143   
gb|KHN37208.1|  Amino acid permease 6                                   427   8e-143   
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              427   9e-143   
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              427   1e-142   
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             425   2e-142   
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              426   3e-142   
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              426   3e-142   
gb|ADB92670.1|  amino acid permease 6                                   426   6e-142   
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              425   8e-142   
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             425   1e-141   
ref|NP_001242816.1|  uncharacterized protein LOC100777963               425   1e-141   
gb|KHN08198.1|  Amino acid permease 6                                   424   1e-141   
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              423   3e-141   
ref|XP_010063932.1|  PREDICTED: amino acid permease 3-like              423   3e-141   
emb|CDP00979.1|  unnamed protein product                                423   5e-141   
ref|XP_010051606.1|  PREDICTED: amino acid permease 3-like              422   6e-141   
gb|EAY82539.1|  hypothetical protein OsI_37761                          422   7e-141   
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   423   7e-141   
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   422   7e-141   
ref|XP_008678533.1|  PREDICTED: amino acid permease 4-like              422   1e-140   
ref|XP_002312967.2|  hypothetical protein POPTR_0009s13610g             419   1e-140   
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              422   1e-140   
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   422   2e-140   
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   422   2e-140   
gb|ADE75660.1|  unknown                                                 422   2e-140   
ref|NP_001066354.2|  Os12g0195100                                       421   2e-140   
gb|EMT28875.1|  hypothetical protein F775_29828                         420   2e-140   
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    421   2e-140   
gb|KEH36106.1|  transmembrane amino acid transporter family protein     417   3e-140   
ref|XP_007018375.1|  Amino acid permease 6                              421   4e-140   
ref|XP_001784036.1|  predicted protein                                  419   9e-140   
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              419   1e-139   
ref|XP_003588450.1|  Amino acid transporter                             419   1e-139   
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              419   4e-139   
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              418   4e-139   
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             418   4e-139   
ref|XP_010240058.1|  PREDICTED: amino acid permease 3-like              419   5e-139   
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   418   5e-139   
ref|NP_001057853.1|  Os06g0556000                                       418   6e-139   
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              420   6e-139   
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              418   6e-139   
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              417   1e-138   
ref|XP_003603665.1|  Amino acid permease                                417   1e-138   
gb|AFK42490.1|  unknown                                                 417   2e-138   
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   416   2e-138   
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             416   3e-138   
ref|XP_002444093.1|  hypothetical protein SORBIDRAFT_07g007570          416   3e-138   
emb|CAD92450.1|  amino acid permease 6                                  416   4e-138   
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          416   5e-138   
emb|CDP00978.1|  unnamed protein product                                415   5e-138   
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              414   1e-137   
ref|XP_004973184.1|  PREDICTED: amino acid permease 3-like              415   1e-137   
emb|CAA70968.2|  amino acid transporter                                 414   1e-137   
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                414   1e-137   
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   414   2e-137   
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              413   3e-137   
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    413   4e-137   
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          414   4e-137   
gb|EPS59884.1|  hypothetical protein M569_14923                         403   7e-137   
ref|XP_010252953.1|  PREDICTED: probable amino acid permease 7          411   8e-137   
ref|XP_004151465.1|  PREDICTED: amino acid permease 4-like              409   1e-136   
ref|XP_010252955.1|  PREDICTED: probable amino acid permease 7 is...    411   1e-136   
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              410   3e-136   
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             410   4e-136   
emb|CAE01664.2|  OSJNBa0084K20.15                                       410   4e-136   
emb|CAH67344.1|  OSIGBa0130B08.4                                        410   5e-136   
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              410   5e-136   
ref|XP_010943299.1|  PREDICTED: amino acid permease 6                   410   5e-136   
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              409   5e-136   
ref|XP_010927999.1|  PREDICTED: probable amino acid permease 7 is...    409   5e-136   
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             410   5e-136   
ref|XP_009401329.1|  PREDICTED: probable amino acid permease 7          410   6e-136   
gb|EMT11988.1|  hypothetical protein F775_30582                         407   8e-136   
emb|CDY60629.1|  BnaAnng17090D                                          407   1e-135   
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              409   1e-135   
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    409   1e-135   
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             409   2e-135   
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   408   3e-135   
gb|KDP32643.1|  hypothetical protein JCGZ_13193                         407   4e-135   
ref|XP_006377989.1|  hypothetical protein POPTR_0011s16990g             407   6e-135   
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              407   1e-134   
ref|XP_011000347.1|  PREDICTED: probable amino acid permease 7 is...    406   1e-134   
ref|XP_009764610.1|  PREDICTED: amino acid permease 3-like isofor...    404   1e-134   
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              407   1e-134   
ref|XP_002533728.1|  amino acid transporter, putative                   405   2e-134   
ref|XP_010058357.1|  PREDICTED: amino acid permease 3-like              406   2e-134   
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   405   2e-134   
ref|NP_176132.1|  amino acid permease 1                                 406   3e-134   
dbj|BAJ91439.1|  predicted protein                                      406   3e-134   
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              405   3e-134   
gb|AAB87674.1|  neutral amino acid transport system II                  405   3e-134   
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              405   6e-134   
ref|XP_002301129.2|  amino acid transport protein AAP2                  405   7e-134   
gb|KHG24473.1|  Amino acid permease 6 -like protein                     405   7e-134   
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              404   1e-133   
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              404   1e-133   
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              404   1e-133   
dbj|BAJ93107.1|  predicted protein                                      406   1e-133   
emb|CDY04349.1|  BnaC04g18440D                                          404   1e-133   
gb|EEC81471.1|  hypothetical protein OsI_24794                          404   2e-133   
ref|XP_006657428.1|  PREDICTED: amino acid permease 6-like              404   3e-133   
ref|NP_001149517.1|  amino acid permease 1                              403   3e-133   
ref|XP_007161468.1|  hypothetical protein PHAVU_001G071500g             400   3e-133   
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              402   6e-133   
ref|NP_199774.1|  amino acid permease 6                                 402   8e-133   
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             402   1e-132   
ref|XP_010668714.1|  PREDICTED: amino acid permease 8-like              402   1e-132   
emb|CDY04448.1|  BnaA03g59400D                                          404   1e-132   
ref|XP_010644646.1|  PREDICTED: probable amino acid permease 7 is...    400   1e-132   
gb|EMT26484.1|  hypothetical protein F775_32730                         401   2e-132   
ref|XP_003579945.1|  PREDICTED: probable amino acid permease 7 is...    400   2e-132   
ref|XP_003557617.1|  PREDICTED: amino acid permease 6                   400   5e-132   
gb|KCW70428.1|  hypothetical protein EUGRSUZ_F03657                     396   5e-132   
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    400   5e-132   
gb|KDO81357.1|  hypothetical protein CISIN_1g011548mg                   395   6e-132   
ref|XP_004975924.1|  PREDICTED: probable amino acid permease 7-li...    399   6e-132   
ref|XP_004965607.1|  PREDICTED: amino acid permease 3-like              399   6e-132   
ref|XP_006852747.1|  hypothetical protein AMTR_s00033p00113090          400   6e-132   
ref|NP_001233983.1|  amino acid transporter                             399   8e-132   
ref|XP_011039848.1|  PREDICTED: probable amino acid permease 7          399   8e-132   
ref|XP_010104540.1|  hypothetical protein L484_025514                   400   8e-132   
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              399   9e-132   
gb|EAZ19918.1|  hypothetical protein OsJ_35512                          399   1e-131   
gb|EEE66520.1|  hypothetical protein OsJ_22995                          399   1e-131   
ref|XP_008384621.1|  PREDICTED: probable amino acid permease 7          398   2e-131   
ref|XP_010055975.1|  PREDICTED: amino acid permease 3-like              398   2e-131   
ref|NP_001058839.1|  Os07g0134000                                       399   2e-131   
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             398   3e-131   
dbj|BAJ85485.1|  predicted protein                                      398   3e-131   
emb|CDY46779.1|  BnaCnng14480D                                          398   3e-131   
ref|XP_006452734.1|  hypothetical protein CICLE_v10008202mg             392   4e-131   
ref|XP_007142464.1|  hypothetical protein PHAVU_008G282800g             397   4e-131   
ref|XP_003519647.1|  PREDICTED: probable amino acid permease 7-li...    397   4e-131   
ref|XP_002437148.1|  hypothetical protein SORBIDRAFT_10g022010          397   6e-131   
ref|XP_002300581.2|  hypothetical protein POPTR_0001s47410g             394   7e-131   
gb|KHN43925.1|  Putative amino acid permease 7                          396   9e-131   
ref|XP_010063222.1|  PREDICTED: probable amino acid permease 7 is...    396   9e-131   
emb|CDP08191.1|  unnamed protein product                                397   1e-130   
gb|EYU39084.1|  hypothetical protein MIMGU_mgv1a018317mg                396   1e-130   
ref|XP_010063220.1|  PREDICTED: probable amino acid permease 7 is...    397   2e-130   
dbj|BAK07020.1|  predicted protein                                      395   2e-130   
ref|NP_001168530.1|  uncharacterized protein LOC100382310 precursor     393   2e-130   
ref|XP_008801682.1|  PREDICTED: amino acid permease 6                   395   2e-130   
gb|KHN23814.1|  Putative amino acid permease 7                          395   4e-130   
gb|EMT14141.1|  hypothetical protein F775_19210                         392   4e-130   
emb|CDO97307.1|  unnamed protein product                                392   4e-130   
dbj|BAD53557.1|  putative amino acid carrier                            394   6e-130   
gb|EEC80807.1|  hypothetical protein OsI_23357                          394   6e-130   
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              395   6e-130   
gb|ABK95562.1|  unknown                                                 394   6e-130   
emb|CDY60248.1|  BnaC01g42990D                                          395   7e-130   
ref|XP_006474785.1|  PREDICTED: probable amino acid permease 7-li...    394   7e-130   
ref|XP_009348784.1|  PREDICTED: probable amino acid permease 7 is...    394   7e-130   
emb|CDY44564.1|  BnaA01g21750D                                          395   8e-130   
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   394   9e-130   



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/335 (86%), Positives = 311/335 (93%), Gaps = 1/335 (0%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  826
             MKMGEN   A+ HQ VFDVSINV ESKCFDDDGRLKRTG+VWTASAHIITAVIGSGVLSL
Sbjct  1     MKMGENNNVASKHQ-VFDVSINVTESKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSL  59

Query  825   AWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQ  646
             AWA AQLGW+AGP VM+LFSFVTYYTS LL++CYRSGD V GKRNYTYMDAV++NLG LQ
Sbjct  60    AWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQ  119

Query  645   VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
             VKICG IQYANLFGVA+GYTIASSISM+AIKRSNCFH  G + PCQ++S PYMIMFG+VE
Sbjct  120   VKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFGIVE  179

Query  465   IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQ  286
             IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAE GK+ GSLTGISIGTVSEMQ
Sbjct  180   IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIGTVSEMQ  239

Query  285   KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
             KIW++ QALGAIAFAYSYSLILIEIQDT+KSPP+ESKTMK ATLISVAVTT+FYM+CGCF
Sbjct  240   KIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCF  299

Query  105   GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  300   GYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVV  334



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/335 (85%), Positives = 311/335 (93%), Gaps = 1/335 (0%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  826
             MKMGEN   A+ HQ VFDVSINV ESKCFDDDGRLKRTG+VWTASAHIITAVIGSGVLSL
Sbjct  1     MKMGENNNVASKHQ-VFDVSINVTESKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSL  59

Query  825   AWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQ  646
             AWA AQLGW+AGP VM+LFSFVTYYTS LL++CYRSGD V GKRNYTYMDAV++NLG LQ
Sbjct  60    AWAVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQ  119

Query  645   VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
             VKICG IQYANLFGVA+GYTIASSISM+AIKRSNCFH  G + PCQ++S PYMIMFG++E
Sbjct  120   VKICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMIMFGIIE  179

Query  465   IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQ  286
             IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAE GK+ GSLTGISIGTV+EMQ
Sbjct  180   IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIGTVTEMQ  239

Query  285   KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
             KIW++ QALGAIAFAYSYSLILIEIQDT+KSPP+ESKTMK ATLISVAVTT+FYM+CGCF
Sbjct  240   KIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCF  299

Query  105   GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  300   GYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVV  334



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/340 (84%), Positives = 309/340 (91%), Gaps = 5/340 (1%)
 Frame = -1

Query  1005  MKMGENAAAA--AMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGS  841
             MKM EN A      H +VFD+SI+V   G SKCFD+DGRLKRTGTVWTASAHIITAVIGS
Sbjct  1     MKMAENGAGKNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIGS  60

Query  840   GVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSN  661
             GVLSLAWATAQLGWVAGP VM LFSFVTYYTS LL+ CYRSGDP++GKRNYTYMDAVRSN
Sbjct  61    GVLSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRSN  120

Query  660   LGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIM  481
             LG  +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFHASGGKNPC +NSNPYMI 
Sbjct  121   LGGFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMIA  180

Query  480   FGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT  301
             FG+VEIIFSQIP FDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAE GKV GSLTGIS+GT
Sbjct  181   FGIVEIIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKVRGSLTGISVGT  240

Query  300   VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYM  121
             V++ QKIWR+ QALG IAFAYSYSLILIEIQDT+K+PP+ESKTMKKA+LISVAVTTLFYM
Sbjct  241   VTQTQKIWRSFQALGDIAFAYSYSLILIEIQDTLKAPPSESKTMKKASLISVAVTTLFYM  300

Query  120   MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             +CGC GYAAFGD SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301   LCGCMGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVI  340



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/338 (84%), Positives = 307/338 (91%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAAA--AMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            M EN A      H +VFD+SI+V   G SKCFD+DGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1    MAENGAGKNHLQHNQVFDLSIDVLPQGGSKCFDEDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWATAQLGWVAGP VM LFSFVTYYTS LL+ CYRSGDP++GKRNYTYMDAVRSNLG
Sbjct  61   LSLAWATAQLGWVAGPAVMFLFSFVTYYTSTLLAACYRSGDPINGKRNYTYMDAVRSNLG  120

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFHASGGKNPC +NSNPYMI FG
Sbjct  121  GFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHLNSNPYMIAFG  180

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
            +VEIIFSQIP FDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAE GKV GSLTGIS+GTV+
Sbjct  181  IVEIIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKVRGSLTGISVGTVT  240

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
            + QKIWR+ QALG IAFAYSYSLILIEIQDT+K+PP+ESKTMKKA+LISVAVTTLFYM+C
Sbjct  241  QTQKIWRSFQALGDIAFAYSYSLILIEIQDTLKAPPSESKTMKKASLISVAVTTLFYMLC  300

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301  GCMGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVI  338



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/341 (82%), Positives = 308/341 (90%), Gaps = 6/341 (2%)
 Frame = -1

Query  1005  MKMGENAAAAAM---HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIG  844
             M MG+N A       H +VFD S+++   G SKCFDDDGRLKRTGTVWT+SAHIITAVIG
Sbjct  1     MTMGDNTATKNQQLHHDQVFDFSVDMPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  843   SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
             SGVLSLAWATAQLGWVAGP+VMLLFSFVTYYTS LLS CYRSGD + GKRNYTYMDAVRS
Sbjct  61    SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSITGKRNYTYMDAVRS  120

Query  663   NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
             NLG  +VKICG +QY NLFGV++GYTIASSISMMAIKRSNCFH SGGKNPC+INSNPYMI
Sbjct  121   NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  483   MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
              FGV EIIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VAENGK++GS+TGISIG
Sbjct  181   AFGVTEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAENGKIMGSMTGISIG  240

Query  303   TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFY  124
             TV+  QK+WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMKKAT ISVAVTTLFY
Sbjct  241   TVTATQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKATQISVAVTTLFY  300

Query  123   MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             M+CGC GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301   MLCGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  341



>ref|XP_011102302.1| PREDICTED: amino acid permease 3 isoform X2 [Sesamum indicum]
Length=486

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/338 (82%), Positives = 305/338 (90%), Gaps = 3/338 (1%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             M M E+  +     +VFDVSINV   G SKC+DDDGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1     MTMSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWA AQLGW+AGPTVM LFSFVTYYTS LLS CYRSGDP  GKRNYTYMDAVR+NLG
Sbjct  61    LSLAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLG  120

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
               +VK+CG IQY NLFGVA+GYTIASSISMMAI+RSNCFH+ G  +PC+++SNPYMI FG
Sbjct  121   GFKVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFG  180

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             V+EIIFSQIPDFDQIWWLSIVAA+MSFTYSTIGLGLGVAKVAENGK+ GSLTGISIGTV+
Sbjct  181   VIEIIFSQIPDFDQIWWLSIVAAIMSFTYSTIGLGLGVAKVAENGKIRGSLTGISIGTVT  240

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
             E QKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPP+E KTMKKATL+SVAVTT+FYM+C
Sbjct  241   ETQKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVAVTTVFYMLC  300

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GCFGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301   GCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANVAIVV  338



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/333 (84%), Positives = 307/333 (92%), Gaps = 1/333 (0%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MGEN   A+ HQ VFDVSINV ESKCFDDDGRLKRTG+VWTASAHIITAVIGSGVLSLAW
Sbjct  1    MGENNNVASKHQ-VFDVSINVTESKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAW  59

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGW+AGP VM+LFSFVTYYTS LL++CYRSGD V GKRNYTYMDAV++NLG LQVK
Sbjct  60   AVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVK  119

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            ICG IQYANLFGVA+GYTIASSISM+AIKRSNCFH  G + PCQ++S PYM+MFG++ II
Sbjct  120  ICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGIIAII  179

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
            FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAE G++ GSLTGISIGTV+EMQKI
Sbjct  180  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGRIGGSLTGISIGTVTEMQKI  239

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            W++ QALGAIAFAYSYSLILIEIQDT+KSPP+ESKTMK ATLISVAVTT+FYM+CGCF Y
Sbjct  240  WKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFXY  299

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  300  AAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVV  332



>gb|KHG20963.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=486

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/338 (83%), Positives = 311/338 (92%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAAA-AMHQ-KVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            MG++ AA   +H  +VFD+SI+V   G +KC+DDDGRLKR+GTVWTASAHIITAVIGSGV
Sbjct  1    MGDDGAARNHLHNNQVFDLSIDVLPQGGTKCYDDDGRLKRSGTVWTASAHIITAVIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWATAQLGW+AGP VM+LFSFVTYYTS LL+ CYRSGDPV+GKRNYTYMDAVRSNLG
Sbjct  61   LSLAWATAQLGWIAGPIVMILFSFVTYYTSTLLAACYRSGDPVNGKRNYTYMDAVRSNLG  120

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFHASGGKNPC +NSNPYMI FG
Sbjct  121  GFKVKICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASGGKNPCHMNSNPYMIAFG  180

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
            +VEIIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAE GK+ GSLTGIS+GTV+
Sbjct  181  IVEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKIRGSLTGISVGTVT  240

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
            + QKIWR+ QALG IAFAYSYSLILIEIQDT+K+PP+ESKTMKKATLISV VTTLFYM+C
Sbjct  241  QTQKIWRSFQALGDIAFAYSYSLILIEIQDTLKAPPSESKTMKKATLISVGVTTLFYMLC  300

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301  GCMGYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVI  338



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/333 (84%), Positives = 307/333 (92%), Gaps = 1/333 (0%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MGEN   A+ HQ VFDVSINV ESKCFDDDGRLKRTG+VWTASAHIITAVIGSGVLSLAW
Sbjct  1    MGENNNVASKHQ-VFDVSINVTESKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAW  59

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGW+AGP VM+LFSFVTYYTS LL++CYRSGD V GKRNYTYMDAV++NLG LQVK
Sbjct  60   AVAQLGWIAGPIVMILFSFVTYYTSALLADCYRSGDSVSGKRNYTYMDAVQANLGGLQVK  119

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            ICG IQYANLFGVA+GYTIASSISM+AIKRSNCFH  G + PCQ++S PYM+MFG++ II
Sbjct  120  ICGWIQYANLFGVAIGYTIASSISMIAIKRSNCFHKHGDQAPCQVSSTPYMVMFGIIAII  179

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
            FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAE G++ GSLTGISIGTV+EMQKI
Sbjct  180  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGRIGGSLTGISIGTVTEMQKI  239

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            W++ QALGAIAFAYSYSLILIEIQDT+KSPP+ESKTMK ATLISVAVTT+FYM+CGCF Y
Sbjct  240  WKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGCFXY  299

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  300  AAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVV  332



>ref|XP_008219591.1| PREDICTED: amino acid permease 3-like isoform X1 [Prunus mume]
Length=488

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/338 (82%), Positives = 307/338 (91%), Gaps = 4/338 (1%)
 Frame = -1

Query  1002  KMGENAAAAAMHQ-KVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             KMG+N     +H  ++FDVS++V   G SKCFDDDGRLKRTGTVWT+SAHIITAVIGSGV
Sbjct  3     KMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGV  62

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWATAQLGWVAGP+VMLLFSFVTYYTS LLS CYRSGD V GKRNYTYMDAVRSNLG
Sbjct  63    LSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLG  122

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
               +VKICG +QY NLFGV++GYTIASSISMMAIKRSNCFH SGGKNPC INSNPYMI FG
Sbjct  123   GAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFG  182

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             + EIIFSQIP+FDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VA NG ++GS+TGISIGTV+
Sbjct  183   ITEIIFSQIPNFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAANGNIMGSMTGISIGTVT  242

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
              MQK+WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMK+AT ISVAVTTLFYM+C
Sbjct  243   PMQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKRATQISVAVTTLFYMLC  302

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GC GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  303   GCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVV  340



>ref|XP_008219592.1| PREDICTED: amino acid permease 3-like isoform X2 [Prunus mume]
Length=487

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/339 (82%), Positives = 307/339 (91%), Gaps = 4/339 (1%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQ-KVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             M MG+N     +H  ++FDVS++V   G SKCFDDDGRLKRTGTVWT+SAHIITAVIGSG
Sbjct  1     MTMGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSG  60

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWATAQLGWVAGP+VMLLFSFVTYYTS LLS CYRSGD V GKRNYTYMDAVRSNL
Sbjct  61    VLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNL  120

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G  +VKICG +QY NLFGV++GYTIASSISMMAIKRSNCFH SGGKNPC INSNPYMI F
Sbjct  121   GGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAF  180

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             G+ EIIFSQIP+FDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VA NG ++GS+TGISIGTV
Sbjct  181   GITEIIFSQIPNFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAANGNIMGSMTGISIGTV  240

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
             + MQK+WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMK+AT ISVAVTTLFYM+
Sbjct  241   TPMQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKRATQISVAVTTLFYML  300

Query  117   CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGC GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  301   CGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVV  339



>ref|XP_011102300.1| PREDICTED: amino acid permease 3 isoform X1 [Sesamum indicum]
Length=491

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/336 (82%), Positives = 304/336 (90%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            M E+  +     +VFDVSINV   G SKC+DDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  8    MSESTGSRQYQHQVFDVSINVPNQGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLS  67

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGW+AGPTVM LFSFVTYYTS LLS CYRSGDP  GKRNYTYMDAVR+NLG  
Sbjct  68   LAWAVAQLGWIAGPTVMFLFSFVTYYTSALLSTCYRSGDPDTGKRNYTYMDAVRANLGGF  127

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VK+CG IQY NLFGVA+GYTIASSISMMAI+RSNCFH+ G  +PC+++SNPYMI FGV+
Sbjct  128  KVKLCGAIQYVNLFGVAIGYTIASSISMMAIERSNCFHSKGDSSPCRVSSNPYMIAFGVI  187

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EIIFSQIPDFDQIWWLSIVAA+MSFTYSTIGLGLGVAKVAENGK+ GSLTGISIGTV+E 
Sbjct  188  EIIFSQIPDFDQIWWLSIVAAIMSFTYSTIGLGLGVAKVAENGKIRGSLTGISIGTVTET  247

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPP+E KTMKKATL+SVAVTT+FYM+CGC
Sbjct  248  QKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVAVTTVFYMLCGC  307

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  308  FGYAAFGDLSPGNLLTGFGFYNPYWLLDIANVAIVV  343



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/336 (83%), Positives = 307/336 (91%), Gaps = 6/336 (2%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSIN-VGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
             M MG+N      H +VFDVS N  GESKCFDDDGRLKR+G+VWTASAHIITAVIGSGVLS
Sbjct  1     MTMGDNN-----HHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLS  55

Query  828   LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
             LAWATAQLGW+AGPTV+LLFSFVTYYTS LL++CYRSGD V GKRNYTYMDAVR+NLG L
Sbjct  56    LAWATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGL  115

Query  648   QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
             QVKICG+IQY NLFGVAVGYTIASSISMMA+KRS+CFH  G +  C ++S PYMIMFG++
Sbjct  116   QVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGII  175

Query  468   EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
             EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAE GK+ GSLTGISIGTV+EM
Sbjct  176   EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAETGKIGGSLTGISIGTVTEM  235

Query  288   QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
             QKIW++ QALGAIAFAYSYSLILIEIQDT+KSPP+ESKTMK ATLISVAVTT+FYM+CGC
Sbjct  236   QKIWKSFQALGAIAFAYSYSLILIEIQDTLKSPPSESKTMKNATLISVAVTTVFYMLCGC  295

Query  108   FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FGYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  296   FGYAAFGDLAPGNLLTGFGFYNPYWLLDIANIAIVV  331



>ref|XP_007222588.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
 gb|EMJ23787.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
Length=485

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/337 (82%), Positives = 306/337 (91%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQ-KVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MG+N     +H  ++FDVS++V   G SKCFDDDGRLKRTGTVWT+SAHIITAVIGSGVL
Sbjct  1    MGDNTKNQQLHHHQIFDVSVDVPPQGGSKCFDDDGRLKRTGTVWTSSAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWATAQLGWVAGP+VMLLFSFVTYYTS LLS CYRSGD V GKRNYTYMDAVRSNLG 
Sbjct  61   SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDAVRSNLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VKICG +QY NLFGV++GYTIASSISMMAIKRSNCFH SGGKNPC INSNPYMI FG+
Sbjct  121  AKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCHINSNPYMIAFGI  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EIIFSQIP+FDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VA NG ++GS+TGISIGTV+ 
Sbjct  181  TEIIFSQIPNFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAANGNIMGSMTGISIGTVTP  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
            MQK+WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMK+AT ISVAVTTLFYM+CG
Sbjct  241  MQKMWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKRATQISVAVTTLFYMLCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  301  CMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVV  337



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/336 (82%), Positives = 304/336 (90%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            M E+A +   H +VFD+S+NV   G SKCFDDDGRLKR+GT+WTASAHIITAVIGSGVLS
Sbjct  1    MSESAGSRQAHNQVFDISVNVPNQGGSKCFDDDGRLKRSGTLWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWATAQLGWVAGP+VM +FS VTYYTS LL+ CYRSGDP  GKRNYTYMDAVR+NLG  
Sbjct  61   LAWATAQLGWVAGPSVMFMFSIVTYYTSTLLAACYRSGDPDTGKRNYTYMDAVRANLGGF  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            QVK+CG IQY NLFGVA+GYTIASSISMMAI+RSNCFH+ G  +PC+++SNPYMI FGVV
Sbjct  121  QVKLCGAIQYLNLFGVAIGYTIASSISMMAIERSNCFHSKGDDSPCRVSSNPYMIAFGVV  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EII SQIPDFDQIWWLSIVAAVMSFTYSTIGLGLG+AKVAENGK++GSLTGISIG V+E 
Sbjct  181  EIILSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAKVAENGKIMGSLTGISIGKVTET  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPP+E KTMKKATL+SVAVTT+FYM CGC
Sbjct  241  QKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVAVTTIFYMSCGC  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  301  FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVI  336



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/337 (83%), Positives = 308/337 (91%), Gaps = 7/337 (2%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSIN-VGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
             M MG+N      H +VFDVS N  GESKCFDDDGRLKR+G+VWTASAHIITAVIGSGVLS
Sbjct  1     MTMGDNN-----HHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLS  55

Query  828   LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
             LAWATAQLGWVAGP V+LLFSFVTYYTS LL++CYRSGD V GKRNYTYMDAVR+NLG L
Sbjct  56    LAWATAQLGWVAGPAVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGL  115

Query  648   QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
             QVKICG+IQY NLFGVAVGYTIASSISMMA+KRS+CFH  G +  C ++S PYMIMFGV+
Sbjct  116   QVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGVM  175

Query  468   EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSE  292
             EI+FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ GSLTGISIGT V+E
Sbjct  176   EILFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGTEVTE  235

Query  291   MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             MQKIWR+ QALGAIAFAYSYSLILIEIQDT+K+PP+E+KTMKKATL+SVAVTT+FYM+CG
Sbjct  236   MQKIWRSFQALGAIAFAYSYSLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCG  295

Query  111   CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CFGYAAFGDQSPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  296   CFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANVAIVV  332



>ref|XP_008338673.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=489

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/341 (82%), Positives = 306/341 (90%), Gaps = 6/341 (2%)
 Frame = -1

Query  1005  MKMGENAAAAAM---HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIG  844
             M MG+N A       H +VFD S+++   G SK FDDDGRLKRTGTVWT+SAHIITAVIG
Sbjct  1     MTMGDNTATKNQQLHHHQVFDFSVDMPPQGGSKXFDDDGRLKRTGTVWTSSAHIITAVIG  60

Query  843   SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
             SGVLSLAWATAQLGWVAGP+VMLLFSFVTYYTS LLS CYRSGD V GKRNYTYMDAVRS
Sbjct  61    SGVLSLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLSACYRSGDSVXGKRNYTYMDAVRS  120

Query  663   NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
             NLG  +VKICG +QY NLFGV++GYTIASSISMMAIKRSNCFH SGGKNPC+INSNPYMI
Sbjct  121   NLGGAKVKICGYVQYLNLFGVSIGYTIASSISMMAIKRSNCFHKSGGKNPCRINSNPYMI  180

Query  483   MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
              FGV EIIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VAENGK++GS+TGI+IG
Sbjct  181   AFGVTEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAQVAENGKIMGSMTGINIG  240

Query  303   TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFY  124
             TV+  QK WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMKKAT ISVAVTTLFY
Sbjct  241   TVTATQKXWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKATQISVAVTTLFY  300

Query  123   MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             M+CGC GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301   MLCGCMGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  341



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/327 (84%), Positives = 298/327 (91%), Gaps = 0/327 (0%)
 Frame = -1

Query  981  AAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLG  802
            AA    +VFDVS+     KCFDDDGRLKRTGT+WTASAHIITAVIGSGVLSLAWATAQLG
Sbjct  6    AAKNQHQVFDVSLPESGPKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATAQLG  65

Query  801  WVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQ  622
            W+AGP+VM LFSFVTYYTS LL+ CYRSGDPV GKRNYTY+DAVRSNLG  QVKICG++Q
Sbjct  66   WIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICGLVQ  125

Query  621  YANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPD  442
            Y NLFGVA+GYTIASSISMMAI+RSNCFH+ G KNPC +NSNPYMI FG+VEI+ SQIPD
Sbjct  126  YLNLFGVAIGYTIASSISMMAIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIPD  185

Query  441  FDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQA  262
            FDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAE GK  GSLTGISIGTVSE QKIWR+ QA
Sbjct  186  FDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVSETQKIWRSFQA  245

Query  261  LGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQ  82
            LG IAFAYSYS+ILIEIQDTVKSPP+ESKTMKKA+LISV VTTLFYM+CGCFGYAAFGD 
Sbjct  246  LGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYAAFGDL  305

Query  81   SPGNLLTGFGFYNPFWLLDIANAAIVI  1
            SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  306  SPGNLLTGFGFYNPYWLLDIANAAIVI  332



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/337 (82%), Positives = 308/337 (91%), Gaps = 7/337 (2%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSIN-VGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
             M MG+N      H +VFDVS N  GESKCFDDDGRLKR+G+VWTASAHIITAVIGSGVLS
Sbjct  1     MTMGDNN-----HHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLS  55

Query  828   LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
             LAWATAQLGW+AGPTV+LLFSFVTYYTS LL++CYRSGD V GKRNYTYMDAVR+NLG L
Sbjct  56    LAWATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGL  115

Query  648   QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
             QVKICG+IQY NLFGVAVGYTIASSISMMA+KRS+CFH  G +  C ++S PYMIMFG++
Sbjct  116   QVKICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIM  175

Query  468   EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSE  292
             EI+FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ GSLTGISIG  V+E
Sbjct  176   EILFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGAEVTE  235

Query  291   MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             MQKIWR+ QALGAIAFAYSYSLILIEIQDT+K+PP+E+KTMKKATL+SVAVTT+FYM+CG
Sbjct  236   MQKIWRSFQALGAIAFAYSYSLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCG  295

Query  111   CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CFGYAAFGDQSPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  296   CFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANVAIVV  332



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/335 (82%), Positives = 307/335 (92%), Gaps = 7/335 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSIN-VGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLA  823
            MG+N      H +VFDVS N  GESKCFDDDGRLKR+G+VWTASAHIITAVIGSGVLSLA
Sbjct  1    MGDNN-----HHQVFDVSANGYGESKCFDDDGRLKRSGSVWTASAHIITAVIGSGVLSLA  55

Query  822  WATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQV  643
            WATAQLGW+AGPTV+LLFSFVTYYTS LL++CYRSGD V GKRNYTYMDAVR+NLG LQV
Sbjct  56   WATAQLGWIAGPTVLLLFSFVTYYTSALLADCYRSGDQVSGKRNYTYMDAVRANLGGLQV  115

Query  642  KICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEI  463
            KICG+IQY NLFGVAVGYTIASSISMMA+KRS+CFH  G +  C ++S PYMIMFG++EI
Sbjct  116  KICGVIQYVNLFGVAVGYTIASSISMMAVKRSDCFHKHGHRAACNVSSTPYMIMFGIMEI  175

Query  462  IFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQ  286
            +FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ GSLTGISIG  V+EMQ
Sbjct  176  LFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIQGSLTGISIGAEVTEMQ  235

Query  285  KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
            KIWR+ QALGAIAFAYSYSLILIEIQDT+K+PP+E+KTMKKATL+SVAVTT+FYM+CGCF
Sbjct  236  KIWRSFQALGAIAFAYSYSLILIEIQDTLKAPPSEAKTMKKATLLSVAVTTVFYMLCGCF  295

Query  105  GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GYAAFGDQSPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  296  GYAAFGDQSPGNLLTGFGFYNPYWLLDIANVAIVV  330



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/336 (82%), Positives = 301/336 (90%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MG+N      H +VFDVS+N+   G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGDNKNQMLQHNQVFDVSVNMPPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGWVAGP VM LFS VTYYTS LLS CYRSGD   GKRNYTYMDAV+SNLG +
Sbjct  61   LAWAIAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRSGDSDTGKRNYTYMDAVQSNLGGV  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VKICG +QY NLFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC INSNPYMI FG+V
Sbjct  121  KVKICGYVQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHINSNPYMIAFGIV  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EIIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAE G ++GS+TGISIGTVSE 
Sbjct  181  EIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGTIMGSMTGISIGTVSET  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            +K+WR+ QALG IAFAYSYSLILIEIQDTV+SPP+E+KTMKKAT ISVAVTTLFYM+CGC
Sbjct  241  EKMWRSFQALGDIAFAYSYSLILIEIQDTVRSPPSEAKTMKKATTISVAVTTLFYMLCGC  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301  MGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  336



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/335 (81%), Positives = 298/335 (89%), Gaps = 0/335 (0%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  826
             M MGE+A     +Q +    +  G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL
Sbjct  1     MTMGEDAVTRNNNQHLSIDMLPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  60

Query  825   AWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQ  646
             AWA AQLGW+AGP VM LFSFV YYTS LL++CYRSGDPV GKRNYTY DAVRSNLG ++
Sbjct  61    AWAIAQLGWIAGPAVMFLFSFVIYYTSSLLTDCYRSGDPVSGKRNYTYTDAVRSNLGGVK  120

Query  645   VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
             VKICGIIQY NLFGVA+GYTIA+SISMMAIKRSNCFH SGG NPC I+SNPYMI+FGV E
Sbjct  121   VKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESGGDNPCHISSNPYMIIFGVTE  180

Query  465   IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQ  286
             I+FSQIPDFDQIWWLSIVAAVMSFTYS+IGLGLG+AKVAE G   GSLTGISIG V+E Q
Sbjct  181   ILFSQIPDFDQIWWLSIVAAVMSFTYSSIGLGLGIAKVAETGSFKGSLTGISIGAVTETQ  240

Query  285   KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
             KIWR+ QALG IAFAYSYS+ILIEIQDT+KSPP+E+KTMKKATL+SVAVTTLFYM+CGC 
Sbjct  241   KIWRSFQALGDIAFAYSYSIILIEIQDTIKSPPSEAKTMKKATLLSVAVTTLFYMLCGCM  300

Query  105   GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301   GYAAFGDLAPGNLLTGFGFYNPFWLLDIANAAIVI  335



>gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/339 (80%), Positives = 300/339 (88%), Gaps = 6/339 (2%)
 Frame = -1

Query  999  MGENAAAAAM-HQKVFDVSINVGE-----SKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
            M EN +  +  H +VFDVSIN+       SK  DDDGRLKRTGTVWTASAHIITAVIGSG
Sbjct  1    MVENTSGRSHSHHQVFDVSINMHTQMSNGSKLLDDDGRLKRTGTVWTASAHIITAVIGSG  60

Query  837  VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
            VLSLAWA AQLGW+AGP VM LFSFVTYYTS LLS CYRSGD V GKRNYTYMD +RSNL
Sbjct  61   VLSLAWAIAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRSGDSVTGKRNYTYMDVIRSNL  120

Query  657  GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
            G  +VKICGI+QY NLFGVA+GYTIASSISMMA+KRSNCFH SGGKNPC++N+NPYMI F
Sbjct  121  GGAKVKICGIVQYLNLFGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCKMNANPYMIAF  180

Query  477  GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
            G+ EIIFSQIPDFDQ+WWLSI+AAVMSFTYSTIGLGLG+AKVAE+GK++GSLTGIS+  V
Sbjct  181  GIAEIIFSQIPDFDQLWWLSILAAVMSFTYSTIGLGLGIAKVAESGKIMGSLTGISLNNV  240

Query  297  SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
            +  QKIWR+ QALG IAFAYSYS+ILIEIQDTVKSPP+E+KTMKKATLISVAVTT FYM+
Sbjct  241  TPTQKIWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSEAKTMKKATLISVAVTTFFYML  300

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGCFGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301  CGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVV  339



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/337 (81%), Positives = 304/337 (90%), Gaps = 7/337 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MGE       H++VFDVS++V +   SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEQQL---QHRQVFDVSLDVPQQPGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  57

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWATAQLGW+AGP VM LFSFVTYYTS LLS CYR+GDPV GKRNYTYMDAVRSNLG L
Sbjct  58   LAWATAQLGWIAGPAVMFLFSFVTYYTSTLLSACYRTGDPVTGKRNYTYMDAVRSNLGGL  117

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +V+ICG+ QY NLFGVA+GYTIAS+ISMMAIKRSNCFH SG K+PC ++SNPYMI FGV 
Sbjct  118  RVRICGLFQYLNLFGVAIGYTIASAISMMAIKRSNCFHKSGRKDPCHMSSNPYMIAFGVT  177

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EIIFSQIP+FDQ+WWLS+VAAVMSFTYSTIGLGLG+A+VA NGKV GSLTGISIGTV++ 
Sbjct  178  EIIFSQIPNFDQLWWLSLVAAVMSFTYSTIGLGLGIAQVAANGKVAGSLTGISIGTVTQT  237

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVK-SPPAESKTMKKATLISVAVTTLFYMMCG  112
            +KIWR+ QALG IAFAYSYS+ILIEIQDT+K  PP+E+KTMKKATLISV+VTTLFYM+CG
Sbjct  238  EKIWRSFQALGDIAFAYSYSIILIEIQDTIKCPPPSEAKTMKKATLISVSVTTLFYMLCG  297

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  298  CMGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVI  334



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 298/338 (88%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSIN----VGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            M EN AA     +VFDVSIN    V  SK  DDDGR KRTGTVWTASAHIITAVIGSGVL
Sbjct  1    MVENTAAKNHPHQVFDVSINMQTQVVGSKWLDDDGRTKRTGTVWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP VM LFS VTYYTS LLS CYRSGDPV+GKRNYTYMDAVR+NLG 
Sbjct  61   SLAWAIAQLGWIAGPAVMFLFSLVTYYTSTLLSACYRSGDPVNGKRNYTYMDAVRTNLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VK+CG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGKNPC IN+NPYMI FG+
Sbjct  121  AKVKLCGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHINANPYMIAFGI  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG-TVS  295
             EIIFSQIPDFDQ+WWLSI+AAVMSFTYSTIGLGLG+A+V ENGK +GS+TGISIG  V+
Sbjct  181  AEIIFSQIPDFDQLWWLSILAAVMSFTYSTIGLGLGIAQVVENGKAMGSVTGISIGANVT  240

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
              QKIWR+ QALG IAFAYSYS+ILIEIQDTV+SPP+ESKTMKKATLISVAVTTLFYM+C
Sbjct  241  PTQKIWRSFQALGDIAFAYSYSIILIEIQDTVRSPPSESKTMKKATLISVAVTTLFYMLC  300

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GCFGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301  GCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVV  338



>ref|XP_006351135.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=479

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/333 (80%), Positives = 303/333 (91%), Gaps = 1/333 (0%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MG++   A+ HQ +FDVS+NV ESK FDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAW
Sbjct  1    MGDSTNFASKHQ-LFDVSVNVTESKRFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAW  59

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGW+AGP VMLLFSFVTYYTS LLS+CYRSGDP+ GKRNYTYMDAV++NLG LQVK
Sbjct  60   AVAQLGWIAGPIVMLLFSFVTYYTSSLLSDCYRSGDPLSGKRNYTYMDAVQANLGGLQVK  119

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            ICG IQY NLFGVA+GYTIASSISMMA+KRS+CFH  G K PC   + PYMI+FGV+EI+
Sbjct  120  ICGWIQYVNLFGVAIGYTIASSISMMAVKRSDCFHKHGHKAPCLEPNTPYMIIFGVIEIV  179

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
            FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLG+A+VAE  K+ GSLTG+SIGTV+EMQK+
Sbjct  180  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAQVAETRKIGGSLTGVSIGTVTEMQKV  239

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            WRT QALGAIAFAYSYSLILIEIQDT+KSPP+E+KTMK ATLISV+VTT+FYM+CGCFGY
Sbjct  240  WRTFQALGAIAFAYSYSLILIEIQDTIKSPPSEAKTMKNATLISVSVTTVFYMLCGCFGY  299

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +P NLLTGFGFY+P+WLLDIAN AIV+
Sbjct  300  AAFGDHAPDNLLTGFGFYDPYWLLDIANIAIVV  332



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 299/323 (93%), Gaps = 4/323 (1%)
 Frame = -1

Query  966  QKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
             +VF+V    GESKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGWVAGP
Sbjct  8    HQVFEV---YGESKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  64

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
            TV+LLFSFVTYYTS LLS+CYR+GDPV GKRNYTYMDAVR+NLG  QVKICG+IQYANLF
Sbjct  65   TVLLLFSFVTYYTSALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLF  124

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            GVA+GYTIASSISM+A+ RSNCFH  G    C ++S PYMIMFGV+EIIFSQIPDFDQI 
Sbjct  125  GVAIGYTIASSISMVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFDQIS  184

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALGAI  250
            WLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ GSLTGISIGT V+EMQKIWR+ QALGAI
Sbjct  185  WLSIVAAVMSFTYSTIGLGLGVAQVAETGKIEGSLTGISIGTEVTEMQKIWRSFQALGAI  244

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYSYSLILIEIQDT+KSPPAE+KTMK+ATLISVAVTT+FYM+CGCFGYAAFGDQSPGN
Sbjct  245  AFAYSYSLILIEIQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGN  304

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN AIV+
Sbjct  305  LLTGFGFYNPYWLLDIANIAIVV  327



>ref|XP_008466753.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=478

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/338 (81%), Positives = 304/338 (90%), Gaps = 11/338 (3%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             MKMGEN A        F +S +V   G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1     MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWATAQLGWVAGP VM LFS VTYYTSVLLS CYRSGDPV GKRNYTYMDAV++NLG
Sbjct  53    LSLAWATAQLGWVAGPAVMFLFSLVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
                VK+CG++QYAN+ GVA+GYTIAS+ISMMAIKRSNCFHASGGK+PCQINSNPYMI FG
Sbjct  113   GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIGFG  172

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             +VEIIFSQI DFDQ+WWLSIVA+VMSFTYSTIGLGLGVA++A NGK+ GSLTGISIGTV+
Sbjct  173   IVEIIFSQIKDFDQLWWLSIVASVMSFTYSTIGLGLGVAQIAANGKIGGSLTGISIGTVT  232

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
             + QK+WR+ QALG IAFAYSYS+ILIEIQDTVKSPP+E+KTMKKATL+SV+VTTLFYM+C
Sbjct  233   QTQKVWRSFQALGDIAFAYSYSIILIEIQDTVKSPPSEAKTMKKATLVSVSVTTLFYMLC  292

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             G  GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  293   GAAGYAAFGDMAPGNLLTGFGFYNPYWLLDIANAAIVI  330



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 305/336 (91%), Gaps = 10/336 (3%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  826
             M M + A     HQ VF+V    GESKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSL
Sbjct  1     MTMADKA-----HQ-VFEV---YGESKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSL  51

Query  825   AWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQ  646
             AWATAQLGWVAGPTV+LLFSFVTYYTS LLS+CYR+GDPV GKRNYTYMDAVR+NLG  Q
Sbjct  52    AWATAQLGWVAGPTVLLLFSFVTYYTSALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQ  111

Query  645   VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
             VKICG+IQYANLFGVA+GYTIA+SISM+A+ RSNCFH  G +  C ++S PYMI+FGV+E
Sbjct  112   VKICGVIQYANLFGVAIGYTIAASISMVAVNRSNCFHKQGHRAACNVSSTPYMIIFGVME  171

Query  465   IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEM  289
             IIFSQIPDFDQI WLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ GSLTGISIGT V+EM
Sbjct  172   IIFSQIPDFDQISWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIEGSLTGISIGTEVTEM  231

Query  288   QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
             QKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPPAE+KTMK+ATLISVAVTT+FYM+CGC
Sbjct  232   QKIWRSFQALGAIAFAYSYSLILIEIQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGC  291

Query  108   FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FGYAAFGDQSPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  292   FGYAAFGDQSPGNLLTGFGFYNPYWLLDIANVAIVV  327



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/337 (80%), Positives = 300/337 (89%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAA-AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGEN A       +VF V++++     SK +DDDG+LKRTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTATKNHFPPQVFSVNVDMPPQAGSKWYDDDGKLKRTGTVWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGWVAGP VM LFS VTYYTS LLS CYR+GDPV+GKRNYTYMDAVRSNLG 
Sbjct  61   SLAWAVAQLGWVAGPAVMFLFSLVTYYTSTLLSACYRTGDPVNGKRNYTYMDAVRSNLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             + KICG +QY NL GVA+GYTIASSISMMA+KRSNCFH SGGKNPC +N+NPYMI FGV
Sbjct  121  AKFKICGYVQYVNLIGVAIGYTIASSISMMAVKRSNCFHKSGGKNPCHMNANPYMIAFGV  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
            VEIIFSQIPDFDQ+WWLSIVAA+MSFTYSTIGLGLG+A+V +NGK +GS+TGISIGTV+E
Sbjct  181  VEIIFSQIPDFDQLWWLSIVAAIMSFTYSTIGLGLGIAEVTKNGKAMGSMTGISIGTVTE  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALG IAFAYSYSLILIEIQDT++SPPAESKTM+KATLISV+VTTLFYM+CG
Sbjct  241  TQKIWRSFQALGDIAFAYSYSLILIEIQDTIRSPPAESKTMRKATLISVSVTTLFYMLCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CFGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301  CFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVV  337



>ref|XP_004149429.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
Length=478

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 304/338 (90%), Gaps = 11/338 (3%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             MKMGEN A        F +S +V   G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1     MKMGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  52

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWATAQLGWVAGP VM LFS VTYYTSVLLS CYRSGDPV GKRNYTYMDAV++NLG
Sbjct  53    LSLAWATAQLGWVAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLG  112

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
                VK+CG++QYAN+ GVA+GYTIAS+ISMMAIKRSNCFHASGGK+PCQINSNPYMI FG
Sbjct  113   GWNVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFG  172

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             VVEI+FSQI DFDQ+WWLSIVA+VMSFTYSTIGLGLGVA++A NGK+ GSLTGISIGTV+
Sbjct  173   VVEIVFSQIKDFDQLWWLSIVASVMSFTYSTIGLGLGVAQIAANGKIGGSLTGISIGTVT  232

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
             + QK+WR+ QALG IAFAYSYS+ILIEIQDT+KSPP+E+KTMKKATL+SV+VTTLFYM+C
Sbjct  233   QTQKVWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSEAKTMKKATLVSVSVTTLFYMLC  292

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             G  GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  293   GAAGYAAFGDMAPGNLLTGFGFYNPYWLLDIANAAIVI  330



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/323 (84%), Positives = 299/323 (93%), Gaps = 4/323 (1%)
 Frame = -1

Query  966  QKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
             +VF+V    GESKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGWVAGP
Sbjct  6    HQVFEV---YGESKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  62

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
            TV+LLFSFVTYYTS LLS+CYR+GDPV GKRNYTYMDAVR+NLG  QVKICG+IQYANLF
Sbjct  63   TVLLLFSFVTYYTSALLSDCYRTGDPVTGKRNYTYMDAVRANLGGFQVKICGVIQYANLF  122

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            GVA+GYTIASSISM+A+ RSNCFH  G    C ++S PYMIMFGV+EIIFSQIPDFDQI 
Sbjct  123  GVAIGYTIASSISMVAVNRSNCFHKQGHHAACNVSSTPYMIMFGVMEIIFSQIPDFDQIS  182

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALGAI  250
            WLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ GSLTGISIGT V+EMQKIWR+ QALGAI
Sbjct  183  WLSIVAAVMSFTYSTIGLGLGVAQVAETGKIEGSLTGISIGTEVTEMQKIWRSFQALGAI  242

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYSYSLILIEIQDT+KSPPAE+KTMK+ATLISVAVTT+FYM+CGCFGYAAFGDQSPGN
Sbjct  243  AFAYSYSLILIEIQDTLKSPPAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGN  302

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN A+V+
Sbjct  303  LLTGFGFYNPYWLLDIANIAMVV  325



>gb|EYU23867.1| hypothetical protein MIMGU_mgv1a005496mg [Erythranthe guttata]
Length=481

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/321 (85%), Positives = 293/321 (91%), Gaps = 3/321 (1%)
 Frame = -1

Query  954  DVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPT  784
             VSINV     SKCFDDDGRLKRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+AGPT
Sbjct  14   QVSINVPPQLPSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPT  73

Query  783  VMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFG  604
            VM LFSFVTYYTS LL+ CYRSGDP  GKRNYTYMDAVRSNLG  QVK+CG IQY NLFG
Sbjct  74   VMFLFSFVTYYTSTLLAACYRSGDPDSGKRNYTYMDAVRSNLGGFQVKLCGAIQYLNLFG  133

Query  603  VAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWW  424
            VA+GYTIASSISMMAI RSNCFH+ G ++PC+++SNPYMI FGVVEI+FSQIPDFDQI W
Sbjct  134  VAIGYTIASSISMMAIDRSNCFHSKGHESPCRVSSNPYMIAFGVVEIVFSQIPDFDQISW  193

Query  423  LSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAF  244
            LSIVAAVMSFTYSTIGLGLG+AKVAENGK+ GSLTGISIGTV+E QKIWR+ QALGAIAF
Sbjct  194  LSIVAAVMSFTYSTIGLGLGIAKVAENGKIKGSLTGISIGTVTETQKIWRSFQALGAIAF  253

Query  243  AYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLL  64
            AYSYSLILIEIQDT+KSPP+E KTMKKATL+SV VTT FYM CGCFGYAAFGD SPGNLL
Sbjct  254  AYSYSLILIEIQDTIKSPPSEYKTMKKATLLSVVVTTAFYMSCGCFGYAAFGDSSPGNLL  313

Query  63   TGFGFYNPFWLLDIANAAIVI  1
            TGFGFYNP+WLLDIANAAIVI
Sbjct  314  TGFGFYNPYWLLDIANAAIVI  334



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/336 (81%), Positives = 296/336 (88%), Gaps = 2/336 (1%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVS-INVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
             MKM         HQ VFD+  +  G SKCFDDDGRLKRTGT WTASAHIITAVIGSGVLS
Sbjct  1     MKMSSAPKDLQPHQ-VFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLS  59

Query  828   LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
             LAWATAQLGW+AGP V+ LFSFVTYYTSVLLS CYR+GD V GKRNYTYMDAVRSNLG  
Sbjct  60    LAWATAQLGWIAGPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGA  119

Query  648   QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
             ++KICG+IQY NLFGVA+GYTIA+SISMMAIKRSNCFH S  KNPC I+SNPYMIMFG+ 
Sbjct  120   KMKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIF  179

Query  468   EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
             EII SQIPDFDQIWWLSIVAA+MSF YSTIGLGLGVAKVAE+GK  GSLTGISIGTV++ 
Sbjct  180   EIILSQIPDFDQIWWLSIVAAIMSFAYSTIGLGLGVAKVAESGKFRGSLTGISIGTVTQT  239

Query  288   QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
             QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPP+E KTMKKATL+SV VTTLFYM+CGC
Sbjct  240   QKIWRSFQALGNIAFAYSYSIILIEIQDTIKSPPSEKKTMKKATLLSVIVTTLFYMLCGC  299

Query  108   FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
              GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  300   MGYAAFGDLAPGNLLTGFGFYNPYWLLDIANAAIVI  335



>emb|CDP10973.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/326 (82%), Positives = 298/326 (91%), Gaps = 3/326 (1%)
 Frame = -1

Query  969  HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  799
            H +VF VS+NV   G SKCFDDDG+LKRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW
Sbjct  14   HHQVFGVSVNVPPQGGSKCFDDDGKLKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGW  73

Query  798  VAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQY  619
            +AGPTV+LLF+FVTYYTSVLL+ CYRSGDP  GKRNYTYMDAVR+NLG  QVK+CG IQY
Sbjct  74   IAGPTVLLLFAFVTYYTSVLLAACYRSGDPDGGKRNYTYMDAVRANLGGFQVKVCGAIQY  133

Query  618  ANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDF  439
             NLFGVA+GYTIA+SISM AIK+SNCFH+SGGK+PC+++S PYMI+FGVVEI+FSQIPDF
Sbjct  134  MNLFGVAIGYTIAASISMTAIKKSNCFHSSGGKDPCKVSSTPYMIIFGVVEILFSQIPDF  193

Query  438  DQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQAL  259
            DQIWWLS VAAVMSFTYSTIGLGLG+ KVAE GK  GSLTGISIGTV++  KIWR+ QAL
Sbjct  194  DQIWWLSFVAAVMSFTYSTIGLGLGIGKVAETGKFRGSLTGISIGTVTQTDKIWRSFQAL  253

Query  258  GAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
            GAIAFAYSYSLILIEIQDT+K+PP+E KTMKKATL+SVAVTT+FYM CGCFGYAAFGD +
Sbjct  254  GAIAFAYSYSLILIEIQDTIKAPPSEYKTMKKATLLSVAVTTIFYMSCGCFGYAAFGDLA  313

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            PGNLLTGFGFYNP+WLLDIAN AI I
Sbjct  314  PGNLLTGFGFYNPYWLLDIANIAIAI  339



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/337 (80%), Positives = 299/337 (89%), Gaps = 6/337 (2%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
             KMG+N      H +VFDVS++V   G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQLT---HHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  831   SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
             SLAWATAQLGWVAGP+VMLLFSFVTYYTS LL+ CYR+GDPV GKRNYTY DAVRSNLG 
Sbjct  60    SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPVTGKRNYTYTDAVRSNLGG  119

Query  651   LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
              + KICG +QY NLFGVA+GYTIASSISM+AIKRSNCF+ +G   PC +NSNPYMI FG+
Sbjct  120   FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  471   VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
              EIIFSQIP+FDQ+WWLSIVAAVMSFTYS+IGLGLG+AKV E G + GS+TGISIG V+E
Sbjct  180   AEIIFSQIPNFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIRGSMTGISIGNVTE  239

Query  291   MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
              QKIWR+ QALG IAFAYSYSLILIEIQDTVKSPP+E+KTMKKAT++SVA TTLFYM+CG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTVKSPPSEAKTMKKATIVSVATTTLFYMLCG  299

Query  111   CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             C GYAAFGD SPGNLLTGFGF+NP+WL+DIANAAIVI
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVI  336



>emb|CBI21586.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/339 (79%), Positives = 297/339 (88%), Gaps = 6/339 (2%)
 Frame = -1

Query  999  MGENAAAA--AMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
            MGENAA      H +VFD+SI+V      SKCFDDDGRLKRTGTVWTASAHIITAVIGSG
Sbjct  1    MGENAATKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGSG  60

Query  837  VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
            VLSLAWA AQLGW+AGP VM LFSFV YYTS LL++CYRSGD V GKRNYTYMDAVRSNL
Sbjct  61   VLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSNL  120

Query  657  GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
            G ++VK+CG+IQY N+FGVA+GYTIA+SISMMA+KRSNCFH SG KNPC I+S PYMIMF
Sbjct  121  GGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIMF  180

Query  477  GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
            G+ EI FSQIPDFDQIWWLSIVAAVMSFTYS+IGL LGVAKV   G   GSLTGISIGTV
Sbjct  181  GIAEIAFSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGVAKVVAAGGFKGSLTGISIGTV  240

Query  297  SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
            ++ QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATL+S+AVTT FYM+
Sbjct  241  TQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAFYML  300

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301  CGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  339



>gb|KGN47695.1| hypothetical protein Csa_6G381850 [Cucumis sativus]
Length=476

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/336 (81%), Positives = 302/336 (90%), Gaps = 11/336 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MGEN A        F +S +V   G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGENQA--------FGISNDVVPQGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  52

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWATAQLGWVAGP VM LFS VTYYTSVLLS CYRSGDPV GKRNYTYMDAV++NLG  
Sbjct  53   LAWATAQLGWVAGPAVMFLFSMVTYYTSVLLSACYRSGDPVSGKRNYTYMDAVQANLGGW  112

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
             VK+CG++QYAN+ GVA+GYTIAS+ISMMAIKRSNCFHASGGK+PCQINSNPYMI FGVV
Sbjct  113  NVKLCGVVQYANIVGVAIGYTIASAISMMAIKRSNCFHASGGKDPCQINSNPYMIAFGVV  172

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI+FSQI DFDQ+WWLSIVA+VMSFTYSTIGLGLGVA++A NGK+ GSLTGISIGTV++ 
Sbjct  173  EIVFSQIKDFDQLWWLSIVASVMSFTYSTIGLGLGVAQIAANGKIGGSLTGISIGTVTQT  232

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QK+WR+ QALG IAFAYSYS+ILIEIQDT+KSPP+E+KTMKKATL+SV+VTTLFYM+CG 
Sbjct  233  QKVWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSEAKTMKKATLVSVSVTTLFYMLCGA  292

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  293  AGYAAFGDMAPGNLLTGFGFYNPYWLLDIANAAIVI  328



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/341 (79%), Positives = 299/341 (88%), Gaps = 6/341 (2%)
 Frame = -1

Query  1005  MKMGENAAAA--AMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIG  844
             M+MGENAA      H +VFD+SI+V      SKCFDDDGRLKRTGTVWTASAHIITAVIG
Sbjct  1     MQMGENAATKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIG  60

Query  843   SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
             SGVLSLAWA AQLGW+AGP VM LFSFV YYTS LL++CYRSGD V GKRNYTYMDAVRS
Sbjct  61    SGVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRS  120

Query  663   NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
             NLG ++VK+CG+IQY N+FGVA+GYTIA+SISMMA+KRSNCFH SG KNPC I+S PYMI
Sbjct  121   NLGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMI  180

Query  483   MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
             MFG+ EI FSQIPDFDQIWWLSIVAAVMSFTYS+IGL LGVAKV   G   GSLTGISIG
Sbjct  181   MFGIAEIAFSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGVAKVVAAGGFKGSLTGISIG  240

Query  303   TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFY  124
             TV++ QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATL+S+AVTT FY
Sbjct  241   TVTQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAFY  300

Query  123   MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             M+CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301   MLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  341



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/337 (79%), Positives = 299/337 (89%), Gaps = 6/337 (2%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
             KMG+N      H +VFDVS++V   G SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQLN---HHQVFDVSVDVPPEGGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  831   SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
             SLAWATAQLGWVAGP+VMLLFSFVTYYTS LL+ CYR+GDP+ GKRNYTY DAVRSNLG 
Sbjct  60    SLAWATAQLGWVAGPSVMLLFSFVTYYTSTLLAACYRTGDPLTGKRNYTYTDAVRSNLGG  119

Query  651   LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
              + KICG +QY NLFGVA+GYTIASSISM+AIKRSNCF+ +G   PC +NSNPYMI FG+
Sbjct  120   FKEKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGI  179

Query  471   VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
              EIIFSQIP+FDQ+WWLSIVAAVMSFTYS+IGLGLG+AKV E G + GS+TGISIG V+E
Sbjct  180   AEIIFSQIPNFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIRGSMTGISIGNVTE  239

Query  291   MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
              QKIWR+ QALG IAFAYSYSLILIEIQDTVKSPP+E+KTMKKAT++SVA TTLFYM+CG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTVKSPPSEAKTMKKATIVSVATTTLFYMLCG  299

Query  111   CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             C GYAAFGD SPGNLLTGFGF+NP+WL+DIANAAIVI
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVI  336



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/324 (83%), Positives = 293/324 (90%), Gaps = 2/324 (1%)
 Frame = -1

Query  969  HQKVFDVS-INVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            HQ VFD+  +  G SKCFDDDGRLKRTGT WTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  11   HQ-VFDIDGVPQGASKCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAWATAQLGWIA  69

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP V+ LFSFVTYYTSVLLS CYR+GD V GKRNYTYMDAVRSNLG  ++KICG+IQY N
Sbjct  70   GPAVLFLFSFVTYYTSVLLSSCYRTGDSVTGKRNYTYMDAVRSNLGGAKMKICGLIQYLN  129

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIA+SISMMAIKRSNCFH S  KNPC I+SNPYMIMFG+ EII SQIPDFDQ
Sbjct  130  LFGVAIGYTIAASISMMAIKRSNCFHESHDKNPCHISSNPYMIMFGIFEIILSQIPDFDQ  189

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            IWWLSIVAA+MSF YSTIGLGLGVAKVAE+GK  GSLTGISIGTV++ QKIWR+ QALG 
Sbjct  190  IWWLSIVAAIMSFAYSTIGLGLGVAKVAESGKFRGSLTGISIGTVTQTQKIWRSFQALGN  249

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDT+KSPP+E KTMKKATL+SV VTTLFYM+CGC GYAAFGD +PG
Sbjct  250  IAFAYSYSIILIEIQDTIKSPPSEKKTMKKATLLSVIVTTLFYMLCGCMGYAAFGDLAPG  309

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIVI
Sbjct  310  NLLTGFGFYNPYWLLDIANAAIVI  333



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/339 (79%), Positives = 297/339 (88%), Gaps = 6/339 (2%)
 Frame = -1

Query  999  MGENAAAA--AMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
            MGENAA      H +VFD+SI+V      SKCFDDDGRLKRTGTVWTASAHIITAVIGSG
Sbjct  1    MGENAATKNHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGSG  60

Query  837  VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
            VLSLAWA AQLGW+AGP VM LFSFV YYTS LL++CYRSGD V GKRNYTYMDAVRSNL
Sbjct  61   VLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSNL  120

Query  657  GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
            G ++VK+CG+IQY N+FGVA+GYTIA+SISMMA+KRSNCFH SG KNPC I+S PYMIMF
Sbjct  121  GGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGRKNPCHISSYPYMIMF  180

Query  477  GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
            G+ EI FSQIPDFDQIWWLSIVAAVMSFTYS+IGL LGVAKV   G   GSLTGISIGTV
Sbjct  181  GIAEIAFSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGVAKVVAAGGFKGSLTGISIGTV  240

Query  297  SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
            ++ QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATL+S+AVTT FYM+
Sbjct  241  TQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAFYML  300

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  301  CGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  339



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/345 (78%), Positives = 300/345 (87%), Gaps = 10/345 (3%)
 Frame = -1

Query  1005  MKMGENAAAA-------AMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIIT  856
             M+MGENAA+          H +VFD+SI+V     SKCFD+DGRLKRTGT+WTASAHIIT
Sbjct  1     MQMGENAASKNCHNNHLHSHHQVFDISIDVLPQNGSKCFDEDGRLKRTGTLWTASAHIIT  60

Query  855   AVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMD  676
             AVIGSGVLSLAWA AQLGWVAGP VM LFS VTYYTS LL++CYR+GDP  GKRNYTYMD
Sbjct  61    AVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMD  120

Query  675   AVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSN  496
             AVRS LG ++VK+CG IQY  LFG+A+GYTIASSISMMAIKRSNCFH SGG+NPC ++SN
Sbjct  121   AVRSILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSN  180

Query  495   PYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTG  316
             PYMIMFG+ EI+ SQIPDFDQ+WWLSIVAAVMSFTYS+IGLGLG+ KVA NG   GSLTG
Sbjct  181   PYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLTG  240

Query  315   ISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVT  136
             ISIGTV+E +KIWR+ QALGAIAFAYSYS+ILIEIQDTVKSPPAESKTMKKA  IS+ VT
Sbjct  241   ISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTVKSPPAESKTMKKAARISIVVT  300

Query  135   TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             T FYM+CGC GYAAFGD +PGNLLTGFGFYNP+WL+DIANAAIVI
Sbjct  301   TTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLIDIANAAIVI  345



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/345 (79%), Positives = 296/345 (86%), Gaps = 5/345 (1%)
 Frame = -1

Query  1032  SSQRKES*NMKMGENAAAAAMHQKVFDVSINVGE-SKCFDDDGRLKRTGTVWTASAHIIT  856
             S Q K   N   G  +     H   FDV    G  SK FDDDGRLKR GT+WTASAHIIT
Sbjct  5     SKQLKNEYNFDNGNQS----FHLTTFDVDSATGSGSKLFDDDGRLKRRGTMWTASAHIIT  60

Query  855   AVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMD  676
             AVIGSGVLSLAWATAQLGWVAGP VMLLFS VTYYTSVLL++CYRSGDPV GKRNYTYMD
Sbjct  61    AVIGSGVLSLAWATAQLGWVAGPIVMLLFSIVTYYTSVLLADCYRSGDPVSGKRNYTYMD  120

Query  675   AVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSN  496
             AV++NLG LQVKICG+IQY NLFGVA+GYTIA+SISM AIKRSNCFH  G K+ C I++N
Sbjct  121   AVQANLGGLQVKICGLIQYLNLFGVAIGYTIAASISMTAIKRSNCFHEKGEKSKCDISTN  180

Query  495   PYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTG  316
             PYMI FGV EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLG+AKVA NG+V GSLTG
Sbjct  181   PYMIAFGVAEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAKVAVNGQVKGSLTG  240

Query  315   ISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVT  136
             ISIG V++  KIWR+ QALG IAFAYSYS+ILIEIQDTV+SPP+ESKTM+KATLISV VT
Sbjct  241   ISIGVVTQTDKIWRSFQALGDIAFAYSYSMILIEIQDTVRSPPSESKTMRKATLISVVVT  300

Query  135   TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             T FYM+CGCFGYAAFGD SPGNLLTGFGFYNPFWL+DIANAAIVI
Sbjct  301   TFFYMLCGCFGYAAFGDLSPGNLLTGFGFYNPFWLVDIANAAIVI  345



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 293/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
             Q+ F V +   G SKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    QQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CGI+QY N
Sbjct  65   GPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+IIFSQIPDFDQ
Sbjct  125  LFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG 
Sbjct  185  LWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIV+
Sbjct  305  NLLTGFGFYNPYWLLDIANAAIVV  328



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 293/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
             Q+ F V +   G SKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    QQEAFAVDMPQTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CGI+QY N
Sbjct  65   GPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+IIFSQIPDFDQ
Sbjct  125  LFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG 
Sbjct  185  LWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIV+
Sbjct  305  NLLTGFGFYNPYWLLDIANAAIVV  328



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/338 (79%), Positives = 296/338 (88%), Gaps = 4/338 (1%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             M+MG+N AA   HQ VFDVSI+V     SKCFDDDGRL RTGTVWTASAHIITAVIGSGV
Sbjct  1     MQMGDNIAATNHHQ-VFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGV  59

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWA AQLGWVAGP VM LFSF+TYYTS LL++CYR+ DPV GKRNYTYMDAVRS LG
Sbjct  60    LSLAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILG  119

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
               +VK CG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGG NPC ++SNPYMI+FG
Sbjct  120   GAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFG  179

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             V+EI  SQIPDFDQIWWLSIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIGTV+
Sbjct  180   VMEIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVT  239

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
             + QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPPAESKTMKKA  +S+AVTT FYM+C
Sbjct  240   QTQKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLC  299

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GC GYAAFGD +PGNLLTGFGFYNPFWLLDIAN+AIV+
Sbjct  300   GCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANSAIVV  337



>emb|CDX88365.1| BnaC06g38090D [Brassica napus]
Length=476

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 293/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
             Q+ F V +   G SKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    QQEAFSVDMPRTGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CGI+QY N
Sbjct  65   GPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+IIFSQIPDFDQ
Sbjct  125  LFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG 
Sbjct  185  LWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAA+V+
Sbjct  305  NLLTGFGFYNPYWLLDIANAAVVV  328



>ref|XP_010063420.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70648.1| hypothetical protein EUGRSUZ_F03820 [Eucalyptus grandis]
Length=480

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/338 (78%), Positives = 299/338 (88%), Gaps = 8/338 (2%)
 Frame = -1

Query  999  MGENAAAAAMH--QKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            MG N+A    H   +VFDVSIN+   G SKCFDDDGRLKRTGTVWTAS+HIITAVIGSGV
Sbjct  1    MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWATAQLGW+AGP VMLLF+ VTYYTS LL+ CYRSGD   GKRNYTYMDAV +NLG
Sbjct  61   LSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSANLG  117

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              +VK+CG++QY NLFGVA+GYTIASSISMMAI RSNCFH +G K+PC  NS PYMI FG
Sbjct  118  GFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMIAFG  177

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
            ++EIIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VAE G  +GSLTGISIGTV+
Sbjct  178  IIEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIARVAETGNFMGSLTGISIGTVT  237

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
              QK+WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMKKA+L+S+AVTTLFYM+C
Sbjct  238  STQKLWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKASLVSIAVTTLFYMLC  297

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD +PGNLLTGFGFYNP+W++DIANAAIVI
Sbjct  298  GCMGYAAFGDMAPGNLLTGFGFYNPYWMVDIANAAIVI  335



>ref|XP_011002450.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/339 (78%), Positives = 298/339 (88%), Gaps = 4/339 (1%)
 Frame = -1

Query  1005  MKMGENAAAA-AMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             MKMGEN A    +  + F VS++     +SK FDDDGR KRTG VWTASAH+ITAVIGSG
Sbjct  1     MKMGENTATKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGSG  60

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA  QLGW+AGP VMLLFSFVTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NL
Sbjct  61    VLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  120

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G ++VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGK+PC++N+NPYMI F
Sbjct  121   GGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGF  180

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             G+ EI+ SQIP FDQ+ WLS+VAAVMSFTYSTIGLGLG+ KV EN +V GSLTGISIGTV
Sbjct  181   GIAEILLSQIPGFDQLHWLSLVAAVMSFTYSTIGLGLGIGKVIENKRVRGSLTGISIGTV  240

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
             ++ QKIWR+ QALG +AFAYSYS+ILIEIQDTVK+PP+E+KTMKKATLISV VTTLFYM 
Sbjct  241   TQTQKIWRSFQALGDVAFAYSYSIILIEIQDTVKAPPSEAKTMKKATLISVVVTTLFYMF  300

Query  117   CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGCFGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  301   CGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANTAIVI  339



>ref|XP_011003418.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/339 (78%), Positives = 298/339 (88%), Gaps = 4/339 (1%)
 Frame = -1

Query  1005  MKMGENAAAA-AMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             MKMGEN A    +  + F VS++     +SK FDDDGR KRTG VWTASAH+ITAVIGSG
Sbjct  1     MKMGENTATKNHLPPQAFSVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHVITAVIGSG  60

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA  QLGW+AGP VMLLFSFVTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NL
Sbjct  61    VLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  120

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G ++VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGK+PC++N+NPYMI F
Sbjct  121   GGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGF  180

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             G+ EI+ SQIP FDQ+ WLS+VAAVMSFTYSTIGLGLG+ KV EN +V GSLTGISIGTV
Sbjct  181   GIAEILLSQIPGFDQLHWLSLVAAVMSFTYSTIGLGLGIGKVIENKRVRGSLTGISIGTV  240

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
             ++ QKIWR+ QALG +AFAYSYS+ILIEIQDTVK+PP+E+KTMKKATLISV VTTLFYM 
Sbjct  241   TQTQKIWRSFQALGDVAFAYSYSIILIEIQDTVKAPPSEAKTMKKATLISVVVTTLFYMF  300

Query  117   CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGCFGYAAFGD SPGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  301   CGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANTAIVI  339



>ref|XP_004290905.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/326 (81%), Positives = 291/326 (89%), Gaps = 3/326 (1%)
 Frame = -1

Query  969  HQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  799
              + FDVS++V     SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL+LAWATAQLGW
Sbjct  7    QHQAFDVSVDVQPQSGSKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLALAWATAQLGW  66

Query  798  VAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQY  619
            VAGP VMLLF+FVTYYTS LLS CYR+GDPV GKRNYTY DAVRSNLG  +VKICG +QY
Sbjct  67   VAGPAVMLLFAFVTYYTSTLLSFCYRTGDPVTGKRNYTYTDAVRSNLGGYKVKICGFVQY  126

Query  618  ANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDF  439
             NLFGVA+GYTIASSISM+AIKRSNCFH+S GK+ C +NSNPYMI FG+ EIIFSQI +F
Sbjct  127  LNLFGVAIGYTIASSISMVAIKRSNCFHSSDGKDECHVNSNPYMIAFGIAEIIFSQIENF  186

Query  438  DQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQAL  259
            DQ+WWLSIVAAVMSFTYSTIGLGLG+ KV E G + GS+TG+ IGTV+E QKIWR+ QAL
Sbjct  187  DQLWWLSIVAAVMSFTYSTIGLGLGIGKVVETGTIRGSMTGVDIGTVTEAQKIWRSFQAL  246

Query  258  GAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
            G IAFAYSYSLILIEIQDTVKSPP+E+KTM+KATLISVA TTLFYM+CGC GYAAFGD S
Sbjct  247  GDIAFAYSYSLILIEIQDTVKSPPSEAKTMRKATLISVATTTLFYMLCGCMGYAAFGDAS  306

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            PGNLLTGFGFYNP+WL+DIANAAIVI
Sbjct  307  PGNLLTGFGFYNPYWLIDIANAAIVI  332



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 293/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
             Q+ F V +   G SKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    QQEAFAVDMPQSGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CGI+QY N
Sbjct  65   GPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+IIFSQIPDFDQ
Sbjct  125  LFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLS++AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG 
Sbjct  185  LWWLSVLAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIV+
Sbjct  305  NLLTGFGFYNPYWLLDIANAAIVV  328



>ref|XP_006473027.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=479

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/328 (81%), Positives = 292/328 (89%), Gaps = 3/328 (1%)
 Frame = -1

Query  981  AAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLG  802
            AA    +VFDVS+    SKCFDDDGRLKRTGT+WTASAHIITAVIGSGVLSLAWATAQLG
Sbjct  6    AAKNQHQVFDVSLPQSGSKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWATAQLG  65

Query  801  WVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQ  622
            W+AGP+VM LFSFVTYYTS LL+ CYRSGDPV GKRNYTY+DAVRSNLG  QVKICG++Q
Sbjct  66   WIAGPSVMFLFSFVTYYTSTLLAACYRSGDPVTGKRNYTYVDAVRSNLGGFQVKICGLVQ  125

Query  621  YANLFGVA-VGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIP  445
            Y NLFGVA   Y+  SSI   AI+RSNCFH+ G KNPC +NSNPYMI FG+VEI+ SQIP
Sbjct  126  YLNLFGVAFTRYSFFSSIR--AIERSNCFHSKGDKNPCHMNSNPYMIAFGIVEIVLSQIP  183

Query  444  DFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQ  265
            DFDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAE GK  GSLTGISIGTV+E QKIWR+ Q
Sbjct  184  DFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAETGKFRGSLTGISIGTVTETQKIWRSFQ  243

Query  264  ALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGD  85
            ALG IAFAYSYS+ILIEIQDTVKSPP+ESKTMKKA+LISV VTTLFYM+CGCFGYA+FGD
Sbjct  244  ALGDIAFAYSYSIILIEIQDTVKSPPSESKTMKKASLISVGVTTLFYMLCGCFGYASFGD  303

Query  84   QSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  304  LSPGNLLTGFGFYNPYWLLDIANAAIVI  331



>ref|XP_006390096.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
 gb|ESQ27382.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
Length=476

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/324 (81%), Positives = 292/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
             Q  F V +   G SKCFDDDGR+KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    QQAAFAVDMPQPGGSKCFDDDGRIKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CGI+QY N
Sbjct  65   GPVVMLLFSVVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+IIFSQIPDFDQ
Sbjct  125  LFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG 
Sbjct  185  LWWLSILAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGAVTETQKIWRSFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDMSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIV+
Sbjct  305  NLLTGFGFYNPYWLLDIANAAIVV  328



>gb|KEH40510.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=483

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/331 (79%), Positives = 292/331 (88%), Gaps = 0/331 (0%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAT  814
            E  +     Q+ F+VSI+   SKCFDDDGRLKRTG  WTASAHIITAVIGSGVLSLAWA 
Sbjct  4    EKGSNMNHQQQPFEVSIDTAGSKCFDDDGRLKRTGNEWTASAHIITAVIGSGVLSLAWAI  63

Query  813  AQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKIC  634
            AQLGW+AGP++MLLFSFVTYYTS LLS CYR+GD ++GKRNYTY DAVR+ LG  + KIC
Sbjct  64   AQLGWIAGPSMMLLFSFVTYYTSTLLSVCYRTGDQLNGKRNYTYTDAVRAYLGGFKYKIC  123

Query  633  GIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFS  454
            G++QYANLFGVA+GYTIA+SISMMAIKRSNCFH+SGGKNPC +N N YMI FG+VEI FS
Sbjct  124  GVVQYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNGNIYMISFGIVEIFFS  183

Query  453  QIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWR  274
            QIPDFDQ+WWLS +AAVMSFTYSTIGLGLG+ KV EN    GSLTGI++GTV+E QK+WR
Sbjct  184  QIPDFDQLWWLSALAAVMSFTYSTIGLGLGIGKVIENKGFKGSLTGITVGTVTETQKVWR  243

Query  273  TSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAA  94
            + QALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATLISV VTT+FYMMCGCFGYAA
Sbjct  244  SFQALGNIAFAYSYSMILIEIQDTIKSPPSESKTMKKATLISVIVTTIFYMMCGCFGYAA  303

Query  93   FGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGD SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  304  FGDSSPGNLLTGFGFYNPFWLLDIANAAIVI  334



>ref|XP_002306650.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
 gb|ABK95777.1| unknown [Populus trichocarpa]
 gb|EEE93646.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
Length=487

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/339 (78%), Positives = 298/339 (88%), Gaps = 4/339 (1%)
 Frame = -1

Query  1005  MKMGENAAAA-AMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             MKMGEN A    +  + F VS++     +SK FDDDGR KRTG VWTASAHIITAVIGSG
Sbjct  1     MKMGENTATKNHLPPQAFGVSVDTDPQSDSKWFDDDGRPKRTGNVWTASAHIITAVIGSG  60

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA  QLGW+AGP VMLLFSFVTYYTS+LLS CYRSGDP +GKRNYTYM+AVR+NL
Sbjct  61    VLSLAWAIGQLGWIAGPAVMLLFSFVTYYTSILLSACYRSGDPDNGKRNYTYMEAVRANL  120

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G ++VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGK+PC++N+NPYMI F
Sbjct  121   GGVKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGF  180

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             G+ EI+ SQIP FDQ+ WLS+VAAVMSFTYSTIGLGLG+ KV EN +V GSLTGIS+GTV
Sbjct  181   GIAEILLSQIPGFDQLHWLSLVAAVMSFTYSTIGLGLGIGKVIENKRVRGSLTGISVGTV  240

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
             ++ QKIWR+ QALG +AFAYSYS+ILIEIQDTVK+PP+E+KTMKKATLISV VTTLFYM 
Sbjct  241   TQTQKIWRSFQALGDVAFAYSYSVILIEIQDTVKAPPSEAKTMKKATLISVVVTTLFYMF  300

Query  117   CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGCFGYAAFGDQSPGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  301   CGCFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANTAIVI  339



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/336 (79%), Positives = 294/336 (88%), Gaps = 4/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MG+N AA   HQ VFDVSI+V     SKCFDDDGRL RTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGDNIAATNHHQ-VFDVSIDVPSQNGSKCFDDDGRLNRTGTVWTASAHIITAVIGSGVLS  59

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGWVAGP VM LFSF+TYYTS LL++CYR+ DPV GKRNYTYMDAVRS LG  
Sbjct  60   LAWAIAQLGWVAGPAVMFLFSFLTYYTSSLLTDCYRTADPVSGKRNYTYMDAVRSILGGA  119

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VK CG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGG NPC ++SNPYMI+FGV+
Sbjct  120  KVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVM  179

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI  SQIPDFDQIWWLSIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIGTV++ 
Sbjct  180  EIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVTQT  239

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPPAESKTMKKA  +S+AVTT FYM+CGC
Sbjct  240  QKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGC  299

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNPFWLLDIAN+AIV+
Sbjct  300  MGYAAFGDFAPGNLLTGFGFYNPFWLLDIANSAIVV  335



>ref|XP_010674405.1| PREDICTED: amino acid permease 4 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/338 (79%), Positives = 293/338 (87%), Gaps = 4/338 (1%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             M MG+ AA    H  VFDVS +V     SKCFDDDGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1     MTMGDGAAKINNHH-VFDVSFDVLGQNPSKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  59

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWA AQLGW+AGP VM LFSFV YYTS LL++CYRSGDP  GKRNYTYMDAVRSNLG
Sbjct  60    LSLAWAIAQLGWIAGPAVMFLFSFVIYYTSTLLADCYRSGDPDSGKRNYTYMDAVRSNLG  119

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
               +VK CG+IQY NLFGVA+GYTIA+SISMMAIKRSNCFH SGGKNPC ++SNPYMI FG
Sbjct  120   GGKVKFCGMIQYLNLFGVAIGYTIAASISMMAIKRSNCFHDSGGKNPCHMSSNPYMIAFG  179

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             + EI+FSQIPDFDQIWWLSIVAAVMSFTYS IGL LG+ +VA N    GS TGISIG+V+
Sbjct  180   IAEILFSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANKTFKGSFTGISIGSVT  239

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
             E QKIWR+ QALG IAFAYS+S+ILIEIQDTV+SPPAESKTMKKA+ IS+AVTT+FYM+C
Sbjct  240   ETQKIWRSFQALGDIAFAYSFSIILIEIQDTVRSPPAESKTMKKASFISIAVTTVFYMLC  299

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  300   GCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVI  337



>ref|NP_001233979.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13687.1|AF013278_1 amino acid transporter [Solanum lycopersicum]
Length=476

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/333 (79%), Positives = 296/333 (89%), Gaps = 4/333 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MG++   AA H     VSIN+ ESK FDDDGR+KR+G+VWTASAHIITAVIGSGVLSLAW
Sbjct  1    MGDSTNFAAKHP----VSINITESKLFDDDGRIKRSGSVWTASAHIITAVIGSGVLSLAW  56

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGW+AGP VMLLFSFVTYYTS LLS+CYRSGDP+ GKRNYTYMD V++NL  LQVK
Sbjct  57   AVAQLGWIAGPIVMLLFSFVTYYTSSLLSDCYRSGDPLFGKRNYTYMDVVQANLSGLQVK  116

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            ICG IQY NLFGVA+GYTIASSIS+MA+KRS+CFH  G K PC   + PYMI+FGV+EII
Sbjct  117  ICGWIQYVNLFGVAIGYTIASSISLMAVKRSDCFHKHGHKAPCLQPNTPYMIIFGVIEII  176

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
            FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLG+A VAE GK+ GSLTG+SIGTV+EMQK+
Sbjct  177  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGIAHVAETGKIGGSLTGVSIGTVTEMQKV  236

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            WRT QALGAIAFAYSYSLILIEIQDT+KSPP+E+KTMK AT+ISV+VTT+FYM+CGCFGY
Sbjct  237  WRTFQALGAIAFAYSYSLILIEIQDTIKSPPSEAKTMKNATIISVSVTTVFYMLCGCFGY  296

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +P NLLTGFGFY+P+WLLDIAN AI +
Sbjct  297  AAFGDHAPDNLLTGFGFYDPYWLLDIANIAIFV  329



>ref|XP_004498350.1| PREDICTED: amino acid permease 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498351.1| PREDICTED: amino acid permease 3-like isoform X2 [Cicer arietinum]
Length=487

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/328 (80%), Positives = 294/328 (90%), Gaps = 5/328 (2%)
 Frame = -1

Query  969  HQKVFDVSINVGE-----SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQL  805
            HQ+ F+ SI+  +     SKCFDDDGRLKR+G  WTASAHIITAVIGSGVLSLAWA AQL
Sbjct  11   HQQPFEFSIDNLQQGPAGSKCFDDDGRLKRSGNTWTASAHIITAVIGSGVLSLAWAIAQL  70

Query  804  GWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGII  625
            GWVAGP++MLLFSFVTYYTS LLS CYRSGD ++GKRNYTY DAVR+ LG  +VKICG +
Sbjct  71   GWVAGPSMMLLFSFVTYYTSTLLSVCYRSGDQLNGKRNYTYTDAVRAYLGGFKVKICGFV  130

Query  624  QYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIP  445
            QYANLFGVA+GYTIA+SISMMAIKRSNCFH+SGGKNPC +NSN YMI FG+VEIIFSQIP
Sbjct  131  QYANLFGVAIGYTIAASISMMAIKRSNCFHSSGGKNPCHMNSNVYMISFGIVEIIFSQIP  190

Query  444  DFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQ  265
            DFDQ+WWLS +AAVMSFTYSTIGLGLGV KV EN  + GSLTGI++GTV++ QK+WR+ Q
Sbjct  191  DFDQLWWLSTLAAVMSFTYSTIGLGLGVGKVIENKGIKGSLTGITVGTVTQTQKVWRSFQ  250

Query  264  ALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGD  85
            ALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATLISV VTT+FYM+CGCFGYAAFGD
Sbjct  251  ALGNIAFAYSYSMILIEIQDTIKSPPSESKTMKKATLISVIVTTIFYMLCGCFGYAAFGD  310

Query  84   QSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  311  LSPGNLLTGFGFYNPFWLLDIANAAIVI  338



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/327 (80%), Positives = 295/327 (90%), Gaps = 3/327 (1%)
 Frame = -1

Query  972  MHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLG  802
            +H K    ++++   G+SKC+DDDGR KRTG+VWTASAHIITAVIGSGVLSLAWATAQLG
Sbjct  2    VHNKQTSFAVDLPQTGDSKCYDDDGRTKRTGSVWTASAHIITAVIGSGVLSLAWATAQLG  61

Query  801  WVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQ  622
            W+AGP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CGI+Q
Sbjct  62   WLAGPVVMLLFSIVTYFTSTLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVKLCGIVQ  121

Query  621  YANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPD  442
            Y NLFGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+IIFSQIPD
Sbjct  122  YLNLFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQIIFSQIPD  181

Query  441  FDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQA  262
            FDQ+ WLSIVAAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIGTV+E QKIWR+ QA
Sbjct  182  FDQLSWLSIVAAVMSFTYSSAGLALGIAQVVANGKVKGSLTGISIGTVTETQKIWRSFQA  241

Query  261  LGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQ  82
            LG IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD 
Sbjct  242  LGDIAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTMFYMLCGCMGYAAFGDL  301

Query  81   SPGNLLTGFGFYNPFWLLDIANAAIVI  1
            SPGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  302  SPGNLLTGFGFYNPYWLLDIANAAIVV  328



>ref|XP_006386354.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|ERP64151.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=487

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/339 (78%), Positives = 296/339 (87%), Gaps = 4/339 (1%)
 Frame = -1

Query  1005  MKMGENAAAA-AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             M MGEN +A   +  +VF VSI+      SK FDDDGR KRTG VWTASAHIITAVIGSG
Sbjct  1     MTMGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSG  60

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA  QLGW+AGP VMLLFS VTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NL
Sbjct  61    VLSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANL  120

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G  +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGG++PC +N+ PYMI F
Sbjct  121   GGGKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAF  180

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             G+ EI+ SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV EN +V+GSLTGISIGTV
Sbjct  181   GIAEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENKRVMGSLTGISIGTV  240

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
             ++ QKIWR+ QALG IAFAYSYS+ILIEIQDTVK+PP E+KTMKKATLISVAVTTLFYM 
Sbjct  241   TQTQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMF  300

Query  117   CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGCFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301   CGCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  339



>ref|XP_010063423.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70652.1| hypothetical protein EUGRSUZ_F03827 [Eucalyptus grandis]
Length=483

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/341 (77%), Positives = 299/341 (88%), Gaps = 11/341 (3%)
 Frame = -1

Query  999  MGENAAAAAMH--QKVFDVSINV---GESKCFDDDGRLKR---TGTVWTASAHIITAVIG  844
            MG N+A    H   +VFDVSIN+   G SKCFDDDGRLKR   TGTVWTAS+HIITAVIG
Sbjct  1    MGVNSAVKNQHPNNQVFDVSINIPPQGGSKCFDDDGRLKRLKRTGTVWTASSHIITAVIG  60

Query  843  SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
            SGVLSLAWATAQLGW+AGP VMLLF+ VTYYTS LL+ CYRSGD   GKRNYTYMDAV +
Sbjct  61   SGVLSLAWATAQLGWIAGPAVMLLFALVTYYTSTLLAACYRSGD---GKRNYTYMDAVSA  117

Query  663  NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
            NLG  +VK+CG++QY NLFGVA+GYTIASSISMMAI RSNCFH +G K+PC  NS PYMI
Sbjct  118  NLGGFKVKLCGLVQYVNLFGVAIGYTIASSISMMAISRSNCFHKNGEKSPCHFNSTPYMI  177

Query  483  MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
             FG++EIIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+A+VAE G  +GSLTGISIG
Sbjct  178  AFGIIEIIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIARVAETGNFMGSLTGISIG  237

Query  303  TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFY  124
            TV+  QK+WR+ QALG IAFAYSYSLILIEIQDT++SPP+ESKTMKKA+L+S+AVTTLFY
Sbjct  238  TVTSTQKLWRSFQALGDIAFAYSYSLILIEIQDTIRSPPSESKTMKKASLVSIAVTTLFY  297

Query  123  MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            M+CGC GYAAFGD +PGNLLTGFGFYNP+W++DIANAAIVI
Sbjct  298  MLCGCMGYAAFGDMAPGNLLTGFGFYNPYWMVDIANAAIVI  338



>ref|XP_011027479.1| PREDICTED: amino acid permease 3-like isoform X2 [Populus euphratica]
Length=485

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/337 (79%), Positives = 296/337 (88%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAA-AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGEN +A   +  +VF VSI+      S+ FDDDGR KRTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAENQLPHQVFSVSIDTHPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA  QLGW+AGP VMLLFS VTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NLG 
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGK+PC +N+ PYMI FG+
Sbjct  121  GKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAFGI  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV EN +V+GSLTGISIGTV++
Sbjct  181  AEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENRRVMGSLTGISIGTVTQ  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALG IAFAYSYS+ILIEIQDTVK+PP E+KTMKKATLISVAVTTLFYM CG
Sbjct  241  TQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301  CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  337



>ref|XP_006386360.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
 gb|ERP64157.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
Length=485

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/337 (79%), Positives = 296/337 (88%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAA-AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGEN +A   +  +VF VSI+      SK FDDDGR KRTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA  QLGW+AGP VMLLFS VTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NLG 
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGG++PC +N+ PYMI FG+
Sbjct  121  GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV EN +V+GSLTGISIGTV++
Sbjct  181  AEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENKRVMGSLTGISIGTVTQ  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALG IAFAYSYS+ILIEIQDTVK+PP E+KTMKKATLISVAVTTLFYM CG
Sbjct  241  TQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAA+VI
Sbjct  301  CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAMVI  337



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/346 (76%), Positives = 300/346 (87%), Gaps = 11/346 (3%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQ--------KVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHII  859
             M+MGENAA+   H         +VFDVS++V     SKCFDDDGRLKRTGT+WTAS+HII
Sbjct  1     MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHII  60

Query  858   TAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYM  679
             TAVIGSGVLSLAWA AQLGW+AGP VM LFS VTYYTS LL++CYR+GDP  GKRNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYM  120

Query  678   DAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINS  499
             DAV+S LG ++V +CG++QY  LFG+A+GYTIASSISMMAIKRSNCFH SGG+NPC I+S
Sbjct  121   DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  498   NPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLT  319
             NPYMI+FG+ EI+ SQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+ KVA NG   GSLT
Sbjct  181   NPYMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVAANGTFKGSLT  240

Query  318   GISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAV  139
             GISIGTV+E +KIWR+ QALGAIAFAYSYS+ILIEIQDT+KSPPAESKTMKKA  IS+ V
Sbjct  241   GISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVV  300

Query  138   TTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             TT FYM+CGC GYAAFGDQ+PGNLLTGFGFYNP+WL+DIAN AIVI
Sbjct  301   TTTFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLIDIANVAIVI  346



>gb|EYU32509.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=492

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/345 (78%), Positives = 303/345 (88%), Gaps = 12/345 (3%)
 Frame = -1

Query  1005  MKMGENAAAAAMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             M M E+AA      +VFDVS+N+    G SKC+DDDGRLKRTGTVWTASAHIITAVIGSG
Sbjct  1     MTMSESAAGT--RHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSG  58

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWATAQLGWVAGPT++ LFSFVTYYTS LL+ CYR+GDP  GKRNYTYMDAVR+NL
Sbjct  59    VLSLAWATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRANL  118

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G  QVK+CG IQY NLFGVA+GYTIA+SIS+MAI+RSNCFH+ G  +PC+++SNPYMI F
Sbjct  119   GGFQVKVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIAF  178

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISI---  307
             GVVEI+FSQIPDFDQI WLS++AAVMSFTYS+IGLGLGVAKVAENGK+ GS+TGISI   
Sbjct  179   GVVEIVFSQIPDFDQISWLSMLAAVMSFTYSSIGLGLGVAKVAENGKIRGSMTGISIGTV  238

Query  306   ---GTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVT  136
                  V+E QKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPP+E KTMKKATL+SV VT
Sbjct  239   TGTTRVTETQKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEHKTMKKATLLSVIVT  298

Query  135   TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             T+FYM CGCFGYAAFGD SPGNLLTGFGF+NP+WLLDIANAAIVI
Sbjct  299   TIFYMFCGCFGYAAFGDLSPGNLLTGFGFFNPYWLLDIANAAIVI  343



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/344 (78%), Positives = 297/344 (86%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA--------AAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGENAA+           H +VFD+SI+V     SKCFDDDGRLKRTGT+WTASAHIITA
Sbjct  1    MGENAASKNCHNNHHLHNHHQVFDISIDVLPQNGSKCFDDDGRLKRTGTLWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGWVAGP VM LFS VTYYTS LL++CYR+GDP  GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            V S LG ++VK+CG IQY  LFG+A+GYTIASSISMMAIKRSNCFH SGG+NPC ++SNP
Sbjct  121  VESILGGVKVKLCGFIQYLGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHLSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMIMFG+ EI+ SQIPDFDQ+WWLSIVAAVMSFTYS+IGLGLG+ KVA NG   GSLTGI
Sbjct  181  YMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV+E +KIWR+ QALGAIAFAYSYS+ILIEIQDTVKSPPAESKTMKKA  IS+ VTT
Sbjct  241  SIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTVKSPPAESKTMKKAARISIVVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FYM+CGC GYAAFGD +PGNLLTGFGFYNP+WL+DIANAAIVI
Sbjct  301  TFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLIDIANAAIVI  344



>ref|XP_002302223.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|EEE81496.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=485

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/337 (79%), Positives = 295/337 (88%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAA-AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGEN +A   +  +VF VSI+      SK FDDDGR KRTG VWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAKNQLPHQVFSVSIDTNPQSGSKWFDDDGRPKRTGNVWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA  QLGW+AGP VMLLFS VTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NLG 
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGG++PC +N+ PYMI FG+
Sbjct  121  GKVKICGFVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGQDPCHMNAYPYMIAFGI  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV EN +V+GSLTGISIGTV++
Sbjct  181  AEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENKRVMGSLTGISIGTVTQ  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALG IAFAYSYS+ILIEIQDTVK+PP E+KTMKKATLISVAVTTLFYM CG
Sbjct  241  TQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301  CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  337



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/337 (78%), Positives = 294/337 (87%), Gaps = 6/337 (2%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
             KMG+N       ++ F++S+ +     SKC+DDDGRLKRTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQINP---RQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  831   SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
             SLAWA AQLGWVAGP VMLLFSFVTYYTS LLS CYRSGDPV GKRNYTY +AVRSNLG 
Sbjct  60    SLAWAVAQLGWVAGPAVMLLFSFVTYYTSTLLSACYRSGDPVTGKRNYTYTNAVRSNLGG  119

Query  651   LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
              +VKICG +QY NLFGVA+GYTIASSISM+AIKRSNCF+ +G   PC +NSNPYMI FGV
Sbjct  120   FKVKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGV  179

Query  471   VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
              EIIFSQIPDFDQ+WWLSIVAAVMSFTYS+IGLGLG+AKV E G + GS+TGI IG V+E
Sbjct  180   AEIIFSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIKGSMTGIDIGAVTE  239

Query  291   MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
              QKIWR+ QALG IAFAYSYSLILIEIQDTVKSPP+E+KTMKKATL+SVA TTLFYM+CG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTVKSPPSEAKTMKKATLVSVATTTLFYMLCG  299

Query  111   CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             C GYAAFGD SPGNLLTGFGF+NP+WL+DIANAAIVI
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVI  336



>gb|EYU32508.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=490

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/340 (78%), Positives = 301/340 (89%), Gaps = 10/340 (3%)
 Frame = -1

Query  990  NAAAAAMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLA  823
            + +AA    +VFDVS+N+    G SKC+DDDGRLKRTGTVWTASAHIITAVIGSGVLSLA
Sbjct  2    SESAAGTRHQVFDVSVNMPSQTGGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLA  61

Query  822  WATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQV  643
            WATAQLGWVAGPT++ LFSFVTYYTS LL+ CYR+GDP  GKRNYTYMDAVR+NLG  QV
Sbjct  62   WATAQLGWVAGPTMLFLFSFVTYYTSSLLATCYRTGDPDTGKRNYTYMDAVRANLGGFQV  121

Query  642  KICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEI  463
            K+CG IQY NLFGVA+GYTIA+SIS+MAI+RSNCFH+ G  +PC+++SNPYMI FGVVEI
Sbjct  122  KVCGAIQYMNLFGVAIGYTIAASISLMAIERSNCFHSKGDNSPCRVSSNPYMIAFGVVEI  181

Query  462  IFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISI------GT  301
            +FSQIPDFDQI WLS++AAVMSFTYS+IGLGLGVAKVAENGK+ GS+TGISI        
Sbjct  182  VFSQIPDFDQISWLSMLAAVMSFTYSSIGLGLGVAKVAENGKIRGSMTGISIGTVTGTTR  241

Query  300  VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYM  121
            V+E QKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPP+E KTMKKATL+SV VTT+FYM
Sbjct  242  VTETQKIWRSFQALGAIAFAYSYSLILIEIQDTIKSPPSEHKTMKKATLLSVIVTTIFYM  301

Query  120  MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGCFGYAAFGD SPGNLLTGFGF+NP+WLLDIANAAIVI
Sbjct  302  FCGCFGYAAFGDLSPGNLLTGFGFFNPYWLLDIANAAIVI  341



>ref|XP_011027478.1| PREDICTED: amino acid permease 3-like isoform X1 [Populus euphratica]
Length=486

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/338 (78%), Positives = 295/338 (87%), Gaps = 3/338 (1%)
 Frame = -1

Query  1005  MKMGENAAAA-AMHQKVFDVSI--NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             M MGEN +A   +  ++F VSI  N    K FD+D R KRTGTVWTASAHIITAVIGSGV
Sbjct  1     MTMGENTSAKNQLPHQIFSVSIDTNPQSGKWFDEDHRPKRTGTVWTASAHIITAVIGSGV  60

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSLAWA  QLGW+AGP VMLLFS VTYYTS+LLS CYRSGDPV+GKRNYTYMDAVR+NLG
Sbjct  61    LSLAWAIGQLGWIAGPAVMLLFSLVTYYTSILLSACYRSGDPVNGKRNYTYMDAVRANLG  120

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
               +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGK+PC +N+ PYMI FG
Sbjct  121   GGKVKICGYVQYVNLFGVAIGYTIASSISMMAIKRSNCFHQSGGKDPCHMNAYPYMIAFG  180

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
             + EI+ SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV EN +V+GSLTGISIGTV+
Sbjct  181   IAEILLSQIPGFDQLHWLSLVAAVMSFTYSSIGLGLGIGKVVENRRVMGSLTGISIGTVT  240

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
             + QKIWR+ QALG IAFAYSYS+ILIEIQDTVK+PP E+KTMKKATLISVAVTTLFYM C
Sbjct  241   QTQKIWRSFQALGDIAFAYSYSMILIEIQDTVKAPPTEAKTMKKATLISVAVTTLFYMFC  300

Query  114   GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GCFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301   GCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  338



>ref|XP_006383588.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
 gb|ERP61385.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
Length=484

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/336 (79%), Positives = 293/336 (87%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MGE    +A   +VFDVSI +   G SK FDDDGR KR GTVWTASAHIITAVIGSGVLS
Sbjct  1    MGETENTSAERHQVFDVSIGMHQQGSSKWFDDDGRQKRAGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGW+AGP  M LFS VT YTS LLS CYRSGDP+ GKRNYTYMDAVRSNLG +
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPITGKRNYTYMDAVRSNLGGV  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VKICG +QY NLFGVAVGYTIASSISMMAIKRSNCFH SGGK+PC++N+NPYMI FG+ 
Sbjct  121  KVKICGFVQYLNLFGVAVGYTIASSISMMAIKRSNCFHQSGGKDPCRMNANPYMIGFGIA  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI+ SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV ENGK+ GSLTGI IGTV+  
Sbjct  181  EILLSQIPGFDQLQWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGIGIGTVTPT  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QK+WR+ QALG IAFAYSYS+ILIEIQDTVKSPP+E+KT++KATL+SVAVTTLFYM CGC
Sbjct  241  QKVWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSEAKTIRKATLLSVAVTTLFYMFCGC  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301  FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVI  336



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/329 (79%), Positives = 293/329 (89%), Gaps = 1/329 (0%)
 Frame = -1

Query  984  AAAAMHQKVFDVSINV-GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQ  808
            +A +  ++ F V +   G S+ FDDDGR KRTG+VWTASAHIITAVIGSGVLSLAWATAQ
Sbjct  4    SAKSHDRQAFAVDMPPSGGSEIFDDDGRHKRTGSVWTASAHIITAVIGSGVLSLAWATAQ  63

Query  807  LGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGI  628
            LGWVAGP  MLLFS VTY+TS LLS CYRSGDP+ GKRNYTYMDAVRSNLG ++VK+CG+
Sbjct  64   LGWVAGPAAMLLFSAVTYFTSTLLSSCYRSGDPLSGKRNYTYMDAVRSNLGGVKVKLCGL  123

Query  627  IQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQI  448
            +QY NLFGVA+GYTIAS+ SMMAIKRSNCFH S GKNPC++NSNPYMI FGVVEIIFSQI
Sbjct  124  VQYLNLFGVAIGYTIASATSMMAIKRSNCFHKSRGKNPCRMNSNPYMIAFGVVEIIFSQI  183

Query  447  PDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTS  268
            PDFDQ+WWLSI+AAVMSFTYS++GL LG+AKVAENGK  GSLTGIS+G V+E QK+WR+ 
Sbjct  184  PDFDQLWWLSILAAVMSFTYSSVGLALGIAKVAENGKWRGSLTGISVGRVTETQKVWRSF  243

Query  267  QALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFG  88
            QALG IAFAYSYS+ILIEIQDT+KSPPAE KTMKKATL+SV VTTLFYM+CGC GYAAFG
Sbjct  244  QALGDIAFAYSYSIILIEIQDTLKSPPAEEKTMKKATLVSVGVTTLFYMLCGCMGYAAFG  303

Query  87   DQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            D SP NLLTGFG+YNPFWLLD+ANAAIV+
Sbjct  304  DMSPANLLTGFGYYNPFWLLDVANAAIVV  332



>ref|XP_010428816.1| PREDICTED: amino acid permease 3 [Camelina sativa]
Length=477

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/318 (81%), Positives = 289/318 (91%), Gaps = 0/318 (0%)
 Frame = -1

Query  954  DVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVML  775
            D+    G SKCFDDDG++KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+AGP VML
Sbjct  12   DMPQQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVVML  71

Query  774  LFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAV  595
            LFS VTY+TS LL+ CYRSGDP+ GKRNYTYM AVRSNLG ++V +CGI+QY N+FGVA+
Sbjct  72   LFSVVTYFTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFGVAI  131

Query  594  GYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSI  415
            GYTIAS+ISMMAIKRSNCFH SGGK+PCQ+NS PYMI FG+V+I+FSQIPDFDQ+WWLSI
Sbjct  132  GYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFDQLWWLSI  191

Query  414  VAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYS  235
            +AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIGTV+E QKIWRT QALG IAFAYS
Sbjct  192  LAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGTVTETQKIWRTFQALGNIAFAYS  251

Query  234  YSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGF  55
            YS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPGNLLTGF
Sbjct  252  YSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTIFYMLCGCMGYAAFGDLSPGNLLTGF  311

Query  54   GFYNPFWLLDIANAAIVI  1
            GFYNP+WLLDIANAAIVI
Sbjct  312  GFYNPYWLLDIANAAIVI  329



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/344 (76%), Positives = 298/344 (87%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQ--------KVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGENAA+   H         +VFDVS++V     SKCFDDDGRLKRTGT+WTAS+HIITA
Sbjct  1    MGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCFDDDGRLKRTGTLWTASSHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VM LFS VTYYTS LL++CYR+GDP  GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPDTGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            V+S LG ++V +CG++QY  LFG+A+GYTIASSISMMAIKRSNCFH SGG+NPC I+SNP
Sbjct  121  VQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FG+ EI+ SQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+ KVA NG   GSLTGI
Sbjct  181  YMIIFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVAANGTFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV+E +KIWR+ QALGAIAFAYSYS+ILIEIQDT+KSPPAESKTMKKA  IS+ VTT
Sbjct  241  SIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FYM+CGC GYAAFGDQ+PGNLLTGFGFYNP+WL+DIAN AIVI
Sbjct  301  TFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLIDIANVAIVI  344



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 297/337 (88%), Gaps = 9/337 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            M EN      +Q+VFD+SI+V      SKCFDDDGRLKRTG+VWTASAHIITAVIGSGVL
Sbjct  1    MSENN-----NQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVL  55

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP+VM LFSFV+YYTS LLS+CYRSGDP+ GKRNYTY+DAVRS LG 
Sbjct  56   SLAWAIAQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGG  115

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VK CG+IQY NLFG+A+GYTIA+S+SMMAIKRSNCFH SGGK PC ++SNPYMI+FGV
Sbjct  116  ARVKACGLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGV  175

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             E++ SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ KVA  G   GSLTGISIGTV+E
Sbjct  176  TEVLLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVATTGTFRGSLTGISIGTVTE  235

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QK+WR+ QALG IAFAYSYS+ILIEIQDT+K+PP+E+KTMKKAT++S+AVTT FYM+CG
Sbjct  236  TQKMWRSFQALGDIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCG  295

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  296  CMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVV  332



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/337 (78%), Positives = 293/337 (87%), Gaps = 6/337 (2%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
             KMG+N       ++ F++S+ +     SKC+DDDGRLKRTGTVWTASAHIITAVIGSGVL
Sbjct  3     KMGDNQINP---RQGFELSVPMPPEVGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVL  59

Query  831   SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
             SLAWA AQLGWVAGP VMLLFSFVT YTS LLS CYRSGDPV GKRNYTY DAVRSNLG 
Sbjct  60    SLAWAVAQLGWVAGPAVMLLFSFVTXYTSTLLSACYRSGDPVIGKRNYTYTDAVRSNLGG  119

Query  651   LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
              +VKICG +QY NLFGVA+GYTIASSISM+AIKRSNCF+ +G   PC +NSNPYMI FGV
Sbjct  120   FKVKICGFVQYLNLFGVAIGYTIASSISMVAIKRSNCFYKNGDTAPCHVNSNPYMIAFGV  179

Query  471   VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
              EIIFSQIPDFDQ+WWLSIVAAVMSFTYS+IGLGLG+AKV E G + GS+TGI IG V+E
Sbjct  180   AEIIFSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIAKVVETGTIKGSMTGIDIGAVTE  239

Query  291   MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
              QKIWR+ QALG IAFAYSYSLILIEIQDT+KSPP+E+KTMKKATL+SVA TTLFYM+CG
Sbjct  240   TQKIWRSFQALGDIAFAYSYSLILIEIQDTIKSPPSEAKTMKKATLVSVATTTLFYMLCG  299

Query  111   CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             C GYAAFGD SPGNLLTGFGF+NP+WL+DIANAAIVI
Sbjct  300   CMGYAAFGDSSPGNLLTGFGFFNPYWLIDIANAAIVI  336



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/346 (75%), Positives = 300/346 (87%), Gaps = 11/346 (3%)
 Frame = -1

Query  1005  MKMGENAAA--------AAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHII  859
             M+MGENAA+           H +VFDVS++V     SKC+DDDGRLKRTGT+WTAS+HII
Sbjct  1     MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  858   TAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYM  679
             TAVIGSGVLSLAWA AQLGW+AGP VM LFS VTYYTS LL++CYR+GDP  G+RNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  678   DAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINS  499
             DAV+S LG ++V +CG++QY  LFG+A+GYTIASSISMMAIKRSNCFH SGG+NPC I+S
Sbjct  121   DAVQSILGGVKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  180

Query  498   NPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLT  319
             NPYMIMFG+ EI+ SQIPDFDQ+WWLSIVAAVMSFTYS+IGLGLG+ KVA NG   GSLT
Sbjct  181   NPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLT  240

Query  318   GISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAV  139
             GISIGTV+E +KIWR+ QALGAIAFAYSYS+ILIEIQDT+KSPPAESKTMKKA  IS+ V
Sbjct  241   GISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVV  300

Query  138   TTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             TT FYM+CGC GYAAFG+Q+PGNLLTGFGFYNP+WL+DIAN AIVI
Sbjct  301   TTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYWLIDIANVAIVI  346



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 297/337 (88%), Gaps = 9/337 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            M EN      +Q+VFD+SI+V      SKCFDDDGRLKRTG+VWTASAHIITAVIGSGVL
Sbjct  1    MSENN-----NQQVFDISIDVVPKINGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVL  55

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP+VM LFSFV+YYTS LLS+CYRSGDP+ GKRNYTY+DAVRS LG 
Sbjct  56   SLAWAIAQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGG  115

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VK CG+IQY NLFG+A+GYTIA+S+SMMAIKRSNCFH SGGK PC ++SNPYMI+FGV
Sbjct  116  ARVKACGLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGV  175

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             E++ SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ KVA  G   GSLTGISIGTV+E
Sbjct  176  TEVLLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVATAGTFRGSLTGISIGTVTE  235

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QK+WR+ QALG IAFAYSYS+ILIEIQDT+K+PP+E+KTMKKAT++S+AVTT FYM+CG
Sbjct  236  TQKMWRSFQALGNIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLCG  295

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  296  CMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVV  332



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/326 (78%), Positives = 293/326 (90%), Gaps = 3/326 (1%)
 Frame = -1

Query  969  HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  799
             ++VFD+SI+V   G S+CFDDDGRLKRTGT WTASAHI+TAVIGSGVLSLAWA AQLGW
Sbjct  3    EKQVFDLSIDVSPQGGSECFDDDGRLKRTGTFWTASAHIVTAVIGSGVLSLAWAIAQLGW  62

Query  798  VAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQY  619
            +AGP +M+LFSFV YYTS LL++CYRSGDPV GKRNYTYMDAVRSNLG ++VKICG+IQY
Sbjct  63   IAGPAMMILFSFVIYYTSSLLADCYRSGDPVSGKRNYTYMDAVRSNLGGVKVKICGVIQY  122

Query  618  ANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDF  439
             NLFGV++GYTIA+SISMMAI+RSNCFH SGGKN C ++SNPYMI+FGV EI+ SQIPDF
Sbjct  123  LNLFGVSIGYTIAASISMMAIRRSNCFHESGGKNSCHVSSNPYMIIFGVTEILLSQIPDF  182

Query  438  DQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQAL  259
            DQIWWLSIVAA+MS TYS IGLGLG++KVAE G   GSLTGI+IG V+E QKIWR+ QAL
Sbjct  183  DQIWWLSIVAAIMSLTYSVIGLGLGISKVAETGSFRGSLTGITIGAVTETQKIWRSFQAL  242

Query  258  GAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
            G IAFAYSYS+IL EIQ+T+KSPP+E+KTMKKATL SV VTTLFYM+CGC GYAAFGD +
Sbjct  243  GDIAFAYSYSIILXEIQNTLKSPPSEAKTMKKATLFSVFVTTLFYMLCGCMGYAAFGDLA  302

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            PGNLLTGFGFYNPFW++DIANAA+VI
Sbjct  303  PGNLLTGFGFYNPFWVIDIANAAVVI  328



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/344 (77%), Positives = 293/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA------AAMHQKVFDVSINVGES-----KCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV+ N         KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAANRHHHTHHHGHQVFDVASNDAVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FGV EI+FSQIPDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIIFGVTEILFSQIPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS +LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSAVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301  MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVI  344



>ref|XP_011002449.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/336 (78%), Positives = 292/336 (87%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MGE    +A   +VFDVSI +   G S+ FDDDGR KRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGW+AGP  M LFS VT YTS LLS CYRSGDP+ GKRNYTYMDAVRSNLG +
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VKICG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGKN C++N+NPYMI FG+ 
Sbjct  121  KVKICGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            E + SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV ENGK+ GSLTG++IG V+  
Sbjct  181  ETLLSQIPGFDQLQWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGVAIGIVTPT  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QK+WR+ QALG IAFAYSYS+ILIEIQDTVKSPP+ESKTM+KATLISVAVTTLFYM CGC
Sbjct  241  QKVWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSESKTMRKATLISVAVTTLFYMFCGC  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301  FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVI  336



>ref|XP_010416679.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/318 (80%), Positives = 288/318 (91%), Gaps = 0/318 (0%)
 Frame = -1

Query  954  DVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVML  775
            D+    G SKCFDDDG++KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+AGP  ML
Sbjct  12   DMPPQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVAML  71

Query  774  LFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAV  595
            LFS VTY+TS LL+ CYRSGDP+ GKRNYTYM AVRSNLG ++V +CGI+QY N+FGVA+
Sbjct  72   LFSVVTYFTSSLLATCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFGVAI  131

Query  594  GYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSI  415
            GYTIAS+ISMMAIKRSNCFH SGGK+PCQ+NS PYMI FG+V+I+FSQIPDFDQ+WWLSI
Sbjct  132  GYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFDQLWWLSI  191

Query  414  VAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYS  235
            +AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIGTV+E QKIWR+ QALG IAFAYS
Sbjct  192  LAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGTVTETQKIWRSFQALGNIAFAYS  251

Query  234  YSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGF  55
            YS+ILIEIQDTVKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPGNLLTGF
Sbjct  252  YSIILIEIQDTVKSPPSEEKTMKKATLVSVGVTTIFYMLCGCMGYAAFGDLSPGNLLTGF  311

Query  54   GFYNPFWLLDIANAAIVI  1
            GFYNP+WLLDIANAAIVI
Sbjct  312  GFYNPYWLLDIANAAIVI  329



>ref|XP_011027477.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=480

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/326 (79%), Positives = 292/326 (90%), Gaps = 3/326 (1%)
 Frame = -1

Query  969  HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  799
            + +V D+SI+    G SK FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  7    NHQVLDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  66

Query  798  VAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQY  619
            +AGP VM LFSFVT YTS LLS CYRSGDP+ GKRNYTYMDAVRSNLG ++VKICG +QY
Sbjct  67   IAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFVQY  126

Query  618  ANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDF  439
             NLFGVA+GYTIASSISMMAIKRSNCF+ SGGKNPC++N+NPYMI FG+ EI+ SQIP F
Sbjct  127  LNLFGVAIGYTIASSISMMAIKRSNCFYKSGGKNPCRMNANPYMIGFGIAEILLSQIPGF  186

Query  438  DQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQAL  259
            DQ+ WLS+VAAVMSFTYS+IGLGLG+ KV ENGK+ GSLTGIS+GTV++ QKIW++ QAL
Sbjct  187  DQLHWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGISVGTVTQTQKIWKSFQAL  246

Query  258  GAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
            G IAFAYS+S+IL+EIQDT+KSPP+E+KTMKKATLISV VTTLFYM CGCFGYAAFGD S
Sbjct  247  GDIAFAYSFSMILVEIQDTIKSPPSEAKTMKKATLISVVVTTLFYMFCGCFGYAAFGDLS  306

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            PGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  307  PGNLLTGFGFYNPYWLLDIANAAIVI  332



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/333 (78%), Positives = 290/333 (87%), Gaps = 3/333 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MG++ A     +   D+    G SKCFDDDGRLKRTGTVWTAS+HIITAVIGSGVLSLAW
Sbjct  1    MGQDKAG---FEVALDLPQQGGGSKCFDDDGRLKRTGTVWTASSHIITAVIGSGVLSLAW  57

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            ATAQLGW+AGP VM LFSFVTYYTS LL+ CYRSGDPV GKRNYTYMDAV SNLG  +VK
Sbjct  58   ATAQLGWIAGPAVMFLFSFVTYYTSSLLAACYRSGDPVTGKRNYTYMDAVHSNLGGAKVK  117

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG++QY NLFGVA+GYTIASSISMMAI RSNCFH +G  +PC  +SNPYMI FGV+EI 
Sbjct  118  LCGMVQYLNLFGVAIGYTIASSISMMAIARSNCFHKNGDDSPCHTSSNPYMIAFGVIEIF  177

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
             SQIPDFDQ+WWLSIVAAVMSFTYS IGL LG+AKVAENGKV GSLTGISI TVS+ QKI
Sbjct  178  LSQIPDFDQLWWLSIVAAVMSFTYSIIGLALGIAKVAENGKVGGSLTGISINTVSQTQKI  237

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            WR+ QALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATL+SV VTTLFYM+CG  GY
Sbjct  238  WRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSVGVTTLFYMLCGTMGY  297

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +PGNLLTGFGF+NP+WL+DIANAAIVI
Sbjct  298  AAFGDMAPGNLLTGFGFFNPYWLIDIANAAIVI  330



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/309 (83%), Positives = 281/309 (91%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA AQLGW+AGP VMLLFSFVTYY+
Sbjct  15   KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTYYS  74

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+AVGYTIA+SIS
Sbjct  75   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLFGIAVGYTIAASIS  134

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFG+ EI+ SQIPDFDQIWWLSIVAAVMSFTY
Sbjct  135  MMAIKRSNCFHKSGGKNPCHMSSNPYMIMFGLTEILLSQIPDFDQIWWLSIVAAVMSFTY  194

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +V  NG   GSLTGISIGTV+E QKIWR+ QALG IAFAYSYS++LIEIQ
Sbjct  195  SAIGLSLGILQVTANGFFKGSLTGISIGTVTETQKIWRSFQALGDIAFAYSYSVVLIEIQ  254

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMKKAT IS+AVTT+FYM+CGC GYAAFGD +PGNLLTGFG+Y PFWLL
Sbjct  255  DTVRSPPAESKTMKKATRISIAVTTMFYMLCGCMGYAAFGDFAPGNLLTGFGYYEPFWLL  314

Query  27   DIANAAIVI  1
            D+ANAAIVI
Sbjct  315  DVANAAIVI  323



>gb|AAM62803.1| amino acid carrier, putative [Arabidopsis thaliana]
Length=476

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/324 (80%), Positives = 290/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            HQ V  V +   G SK  DDDG+ KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    HQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++V +CGI+QY N
Sbjct  65   GPVVMLLFSVVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            +FGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+I+FSQIPDFDQ
Sbjct  125  IFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWRT QALG 
Sbjct  185  LWWLSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRTFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV+VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVSVTTMFYMLCGCMGYAAFGDLSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIVI
Sbjct  305  NLLTGFGFYNPYWLLDIANAAIVI  328



>ref|NP_177862.1| amino acid permease 3 [Arabidopsis thaliana]
 sp|Q39134.2|AAP3_ARATH RecName: Full=Amino acid permease 3; AltName: Full=Amino acid 
transporter AAP3 [Arabidopsis thaliana]
 gb|AAG29203.1|AC078898_13 amino acid carrier, putative [Arabidopsis thaliana]
 emb|CAA54630.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM20639.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AAM91305.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AEE35971.1| amino acid permease 3 [Arabidopsis thaliana]
Length=476

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/324 (80%), Positives = 290/324 (90%), Gaps = 1/324 (0%)
 Frame = -1

Query  969  HQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            HQ V  V +   G SK  DDDG+ KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+A
Sbjct  5    HQTVLAVDMPQTGGSKYLDDDGKNKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWLA  64

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLFS VTY+TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++V +CGI+QY N
Sbjct  65   GPVVMLLFSAVTYFTSSLLAACYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLN  124

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            +FGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+I+FSQIPDFDQ
Sbjct  125  IFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDFDQ  184

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWRT QALG 
Sbjct  185  LWWLSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRTFQALGD  244

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAYSYS+ILIEIQDTVKSPP+E KTMKKATL+SV+VTT+FYM+CGC GYAAFGD SPG
Sbjct  245  IAFAYSYSIILIEIQDTVKSPPSEEKTMKKATLVSVSVTTMFYMLCGCMGYAAFGDLSPG  304

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNP+WLLDIANAAIVI
Sbjct  305  NLLTGFGFYNPYWLLDIANAAIVI  328



>ref|XP_011099674.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
 ref|XP_011099676.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
Length=491

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/342 (77%), Positives = 295/342 (86%), Gaps = 9/342 (3%)
 Frame = -1

Query  999  MGENAAAA------AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVI  847
            MGE+ A            +VFDVS+NV     SK  DDDGR +RTGTVWTASAHIITAVI
Sbjct  1    MGESTATTNHHHHHHHGSQVFDVSVNVPPHFCSKVVDDDGRPQRTGTVWTASAHIITAVI  60

Query  846  GSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVR  667
            GSGVLSLAWA AQLGW+AGPTVM +FSFV YYTS LL++CYRSGD + GKRNYTYMDAVR
Sbjct  61   GSGVLSLAWAIAQLGWIAGPTVMFMFSFVIYYTSTLLADCYRSGDSLFGKRNYTYMDAVR  120

Query  666  SNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYM  487
            SNLG  +VKICGIIQY NLFGVA+GYTIA+SISMMAIKRSNCFHASG K+PC ++SNPYM
Sbjct  121  SNLGGSKVKICGIIQYLNLFGVAIGYTIAASISMMAIKRSNCFHASGEKDPCHMSSNPYM  180

Query  486  IMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISI  307
            I FG+ +I+FSQIPDFDQIWWLSIVAAVMSFTYS+IGLGLG+AKVA  G   GSLTGISI
Sbjct  181  IAFGITQILFSQIPDFDQIWWLSIVAAVMSFTYSSIGLGLGIAKVAATGTFKGSLTGISI  240

Query  306  GTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLF  127
            GTV+E QKIWR+ QALG IAFAYS+S+ILIEIQDT+KSPP+E+KTMKKAT+IS  VTT F
Sbjct  241  GTVTETQKIWRSFQALGDIAFAYSFSIILIEIQDTIKSPPSEAKTMKKATMISTIVTTAF  300

Query  126  YMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            YM+CGC GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301  YMLCGCMGYAAFGDLAPGNLLTGFGFYNPFWLLDIANAAIVI  342



>ref|XP_011003419.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/336 (78%), Positives = 291/336 (87%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MGE    +A   +VFDVSI +   G S+ FDDDGR KRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGEPENTSAEKHQVFDVSIAMHQQGSSEWFDDDGRQKRTGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGW+AGP  M LFS VT YTS LLS CYRSGDP+ GKRNYTYMDAVRSNLG +
Sbjct  61   LAWAIAQLGWIAGPAFMFLFSIVTCYTSSLLSVCYRSGDPLTGKRNYTYMDAVRSNLGGV  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VKICG +QY NLFGVA GYTIASSISMMAIKRSNCFH SGGKN C++N+NPYMI FG+ 
Sbjct  121  KVKICGFVQYLNLFGVAFGYTIASSISMMAIKRSNCFHKSGGKNSCRMNANPYMIGFGIA  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            E + SQIP FDQ+ WLS+VAAVMSFTYS+IGLGLG+ KV ENGK+ GSLTG++IG V+  
Sbjct  181  ETLLSQIPGFDQLQWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGVAIGIVTPT  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QK+WR+ QALG IAFAYSYS+ILIEIQDTVKSPP+ESKTM+KATLISVAVTTLFYM CGC
Sbjct  241  QKVWRSFQALGDIAFAYSYSMILIEIQDTVKSPPSESKTMRKATLISVAVTTLFYMFCGC  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301  FGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAAIVI  336



>ref|XP_010471931.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/318 (80%), Positives = 288/318 (91%), Gaps = 0/318 (0%)
 Frame = -1

Query  954  DVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVML  775
            D+    G SKCFDDDG++KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+AGP VML
Sbjct  12   DMLSQTGGSKCFDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVVML  71

Query  774  LFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAV  595
            LFS VTY+TS LL+ CYRSGDP+ GKRNYTYM AVRSNLG ++V +CGI+QY N+FGVA+
Sbjct  72   LFSVVTYFTSSLLASCYRSGDPISGKRNYTYMGAVRSNLGGVKVTLCGIVQYLNIFGVAI  131

Query  594  GYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSI  415
            GYTIAS+ISMMAIKRSNCFH SGGK+PCQ+NS PYMI FG+V+I+FSQIPDFDQ+WWLSI
Sbjct  132  GYTIASAISMMAIKRSNCFHKSGGKDPCQMNSTPYMIAFGLVQILFSQIPDFDQLWWLSI  191

Query  414  VAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYS  235
            +AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG IAFAYS
Sbjct  192  LAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRSFQALGNIAFAYS  251

Query  234  YSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGF  55
            YS+ILIEIQD+VKSPP+E KTMKKATL+SV VTT+FYM+CGC GYAAFGD SPGNLLTGF
Sbjct  252  YSIILIEIQDSVKSPPSEEKTMKKATLVSVGVTTIFYMLCGCMGYAAFGDLSPGNLLTGF  311

Query  54   GFYNPFWLLDIANAAIVI  1
            GFYNP+WLLDIANAAIVI
Sbjct  312  GFYNPYWLLDIANAAIVI  329



>ref|XP_002889140.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65399.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/325 (79%), Positives = 291/325 (90%), Gaps = 1/325 (0%)
 Frame = -1

Query  972  MHQKVFDVSI-NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
            +HQ V  V +   G SK  DDDG++KRTG+VWTASAHIITAVIGSGVLSLAWATAQLGW+
Sbjct  4    LHQTVLAVDMPQTGGSKYLDDDGKVKRTGSVWTASAHIITAVIGSGVLSLAWATAQLGWL  63

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYA  616
            AGP VMLLFS VTY+TS LL+ CYRSG+P+ GKRNYTYMDAVRSNLG ++V +CGI+QY 
Sbjct  64   AGPVVMLLFSAVTYFTSSLLAACYRSGNPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYL  123

Query  615  NLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFD  436
            N+FGVA+GYTIAS+ISMMAIKRSNCFH SGGK+PC +NSNPYMI FG+V+I+FSQIPDFD
Sbjct  124  NIFGVAIGYTIASAISMMAIKRSNCFHKSGGKDPCHMNSNPYMIAFGLVQILFSQIPDFD  183

Query  435  QIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALG  256
            Q+WWLSI+AAVMSFTYS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWRT QALG
Sbjct  184  QLWWLSILAAVMSFTYSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRTFQALG  243

Query  255  AIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
             IAFAYSYS+ILIEIQDTVKSPP+E KTMKK TL+SV+VTT+FYM+CGC GYAAFGD SP
Sbjct  244  DIAFAYSYSIILIEIQDTVKSPPSEEKTMKKPTLVSVSVTTMFYMLCGCMGYAAFGDLSP  303

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  304  GNLLTGFGFYNPYWLLDIANAAIVI  328



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/346 (75%), Positives = 300/346 (87%), Gaps = 12/346 (3%)
 Frame = -1

Query  1005  MKMGENAAA--------AAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHII  859
             M+MGENAA+           H +VFDVS++V     SKC+DDDGRLKRTGT+WTAS+HII
Sbjct  1     MQMGENAASKNYHNNHHLHNHHQVFDVSVDVLPQNGSKCYDDDGRLKRTGTLWTASSHII  60

Query  858   TAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYM  679
             TAVIGSGVLSLAWA AQLGW+AGP VM LFS VTYYTS LL++CYR+GDP  G+RNYTYM
Sbjct  61    TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSLVTYYTSSLLTDCYRTGDPYTGERNYTYM  120

Query  678   DAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINS  499
             DAV+S LG ++V +CG++QY  LFG+A+GYTIASSISMMAIKRSNCFH SGG+NPC I+S
Sbjct  121   DAVQSILG-VKVNLCGLVQYIGLFGIAIGYTIASSISMMAIKRSNCFHQSGGQNPCHISS  179

Query  498   NPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLT  319
             NPYMIMFG+ EI+ SQIPDFDQ+WWLSIVAAVMSFTYS+IGLGLG+ KVA NG   GSLT
Sbjct  180   NPYMIMFGITEILLSQIPDFDQLWWLSIVAAVMSFTYSSIGLGLGIGKVAVNGTFKGSLT  239

Query  318   GISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAV  139
             GISIGTV+E +KIWR+ QALGAIAFAYSYS+ILIEIQDT+KSPPAESKTMKKA  IS+ V
Sbjct  240   GISIGTVTETEKIWRSFQALGAIAFAYSYSVILIEIQDTIKSPPAESKTMKKAAKISIVV  299

Query  138   TTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             TT FYM+CGC GYAAFG+Q+PGNLLTGFGFYNP+WL+DIAN AIVI
Sbjct  300   TTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYWLIDIANVAIVI  345



>emb|CAA54631.1| amino acid transporter [Arabidopsis thaliana]
Length=466

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/309 (83%), Positives = 280/309 (91%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGPTVMLLFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD++PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIVI
Sbjct  309  DVANAAIVI  317



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/338 (77%), Positives = 297/338 (88%), Gaps = 10/338 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            M EN      +Q+VFD+SI+V      SKCFDDDGRLKRTG+VWTASAHIITAVIGSGVL
Sbjct  1    MSENN-----NQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVL  55

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP+VM LFSFV+YYTS LLS+CYRSGDP+ GKRNYTY+DAVRS LG 
Sbjct  56   SLAWAIAQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGG  115

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VK CG+IQY NLFG+A+GYTIA+S+SMMAIKRSNCFH SGGK PC ++SNPYMI+FGV
Sbjct  116  ARVKACGLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGV  175

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVA-ENGKVLGSLTGISIGTVS  295
             E++ SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ KVA   G   GSLTGISIGTV+
Sbjct  176  TEVLLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVATATGTFRGSLTGISIGTVT  235

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
            E QK+WR+ QALG IAFAYSYS+ILIEIQDT+K+PP+E+KTMKKAT++S+AVTT FYM+C
Sbjct  236  ETQKMWRSFQALGDIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYMLC  295

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  296  GCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVV  333



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/336 (77%), Positives = 293/336 (87%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQ--KVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MG  AAA   HQ  +VFD+++    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAANNHHQHHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGWVAGP VMLLFS VT Y+S LLS+CYR+GD V GKRNYTYMDAVRS LG  
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            + KICG+IQY NLFGVA+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FGV 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIG V++ 
Sbjct  181  EILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGSLTGISIGAVTQT  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QKIWRT QALG IAFAYSYS++LIEIQDTV+SPP+ESKTMKKAT +S+A+TT+FYM+CG 
Sbjct  241  QKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGS  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  MGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  336



>gb|AAM13223.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AAO30058.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/309 (83%), Positives = 280/309 (91%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGPTVMLLFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD++PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIVI
Sbjct  309  DVANAAIVI  317



>ref|NP_201190.1| amino acid permease 4 [Arabidopsis thaliana]
 sp|Q9FN04.1|AAP4_ARATH RecName: Full=Amino acid permease 4; AltName: Full=Amino acid 
transporter AAP4 [Arabidopsis thaliana]
 dbj|BAB11033.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AED97804.1| amino acid permease 4 [Arabidopsis thaliana]
Length=466

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/309 (83%), Positives = 280/309 (91%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGPTVMLLFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMLLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD++PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIVI
Sbjct  309  DVANAAIVI  317



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/339 (76%), Positives = 297/339 (88%), Gaps = 11/339 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            M EN      +Q+VFD+SI+V      SKCFDDDGRLKRTG+VWTASAHIITAVIGSGVL
Sbjct  1    MSENN-----NQQVFDISIDVVPKNNGSKCFDDDGRLKRTGSVWTASAHIITAVIGSGVL  55

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP+VM LFSFV+YYTS LLS+CYRSGDP+ GKRNYTY+DAVRS LG 
Sbjct  56   SLAWAIAQLGWIAGPSVMFLFSFVSYYTSCLLSDCYRSGDPLTGKRNYTYIDAVRSILGG  115

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VK CG+IQY NLFG+A+GYTIA+S+SMMAIKRSNCFH SGGK PC ++SNPYMI+FGV
Sbjct  116  ARVKACGLIQYLNLFGIAIGYTIAASVSMMAIKRSNCFHESGGKKPCHMSSNPYMILFGV  175

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAEN--GKVLGSLTGISIGTV  298
             E++ SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ KVA    G   GSLTGISIGTV
Sbjct  176  TEVLLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVKVASQSTGTFRGSLTGISIGTV  235

Query  297  SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
            +E QK+WR+ QALG IAFAYSYS+ILIEIQDT+K+PP+E+KTMKKAT++S+AVTT FYM+
Sbjct  236  TETQKMWRSFQALGDIAFAYSYSVILIEIQDTIKAPPSEAKTMKKATVLSIAVTTTFYML  295

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGC GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  296  CGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVV  334



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/338 (77%), Positives = 292/338 (86%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAA----AAMHQKVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            MGE AAA         +VFD S+    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANHHHHHHGHQVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWA AQLGW+AGP VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              + KICG+IQY NLFG+AVGYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FG
Sbjct  121  GFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
            V EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIGTV+
Sbjct  181  VTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVT  240

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
            + QKIWRT QALG IAFAYSYS++LIEIQDTV+SPP+ES TMKKAT IS+AVTT+FYM+C
Sbjct  241  QTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLC  300

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            G  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  GSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  338



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/337 (77%), Positives = 294/337 (87%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAAAM-HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGENAA     + +VFDVS+ +   G S+CFDDDGR+KRTGT+WTASAHIITAVIGSGVL
Sbjct  1    MGENAATKNHDNHQVFDVSLGIPSKGGSECFDDDGRIKRTGTLWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP VM LFS VT YTS LL++CYR+GDPV GKRNYTYMDAVRS LG 
Sbjct  61   SLAWAIAQLGWIAGPAVMFLFSLVTCYTSSLLTDCYRTGDPVSGKRNYTYMDAVRSILGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +VK CG+IQY NL G++VGYTIA+S+SMMAIKRSNCFH SGGKNPC ++S PYMIMFGV
Sbjct  121  YKVKACGLIQYLNLCGISVGYTIAASVSMMAIKRSNCFHESGGKNPCHMSSTPYMIMFGV  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIPDFDQIWWLSIVAAVMSFTYS IGLGLG+AKVA  G   GSLTGIS+GT ++
Sbjct  181  TEILLSQIPDFDQIWWLSIVAAVMSFTYSGIGLGLGIAKVAATGTFKGSLTGISVGTETQ  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALG IAFAYSYS++LIEIQDTVKSPPAE+KTMKKAT +S+A+TT FYM+CG
Sbjct  241  AQKIWRSFQALGDIAFAYSYSIVLIEIQDTVKSPPAEAKTMKKATKLSIAITTAFYMLCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYA+FGD +PGNLLTGFGFYNPFWLLD+ANAAIVI
Sbjct  301  CMGYASFGDFAPGNLLTGFGFYNPFWLLDVANAAIVI  337



>gb|KDP32819.1| hypothetical protein JCGZ_12111 [Jatropha curcas]
Length=482

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/322 (80%), Positives = 289/322 (90%), Gaps = 3/322 (1%)
 Frame = -1

Query  957  FDVSI---NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
            F+VS+   N   SK +DDDGRLKRTG+VWTASAHIITAVIGSGVLSLAWA AQLGW+AGP
Sbjct  12   FNVSVDMPNQAGSKWYDDDGRLKRTGSVWTASAHIITAVIGSGVLSLAWAVAQLGWIAGP  71

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
             VM LFS VTYYTS LLS CYR+GD V+GKRNYTYMDAVRSNLG  +VKICG +QY NL 
Sbjct  72   AVMFLFSIVTYYTSTLLSACYRTGDSVNGKRNYTYMDAVRSNLGGAKVKICGYVQYLNLL  131

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            GVA+GYTIASSISMMA+KRSNCFH +GGK+PC +N+NPYMI FG+ EIIFSQI DF+++W
Sbjct  132  GVAIGYTIASSISMMAVKRSNCFHKTGGKDPCHMNANPYMIAFGIAEIIFSQIQDFEKLW  191

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIA  247
            WLSI+AAVMSFTYSTIGLGLG+AKVAE+GK+ GS TGI+IGTV+E QKIWR+ QALG IA
Sbjct  192  WLSILAAVMSFTYSTIGLGLGIAKVAESGKIRGSFTGITIGTVTETQKIWRSFQALGDIA  251

Query  246  FAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNL  67
            FAYSYS+ILIEIQDT+KSPP+E+KTMKKATLISVAVTT FYM+CGCFGYAAFGD SPGNL
Sbjct  252  FAYSYSIILIEIQDTIKSPPSEAKTMKKATLISVAVTTFFYMLCGCFGYAAFGDMSPGNL  311

Query  66   LTGFGFYNPFWLLDIANAAIVI  1
            LTGFGFYNP+WL DIAN AIV+
Sbjct  312  LTGFGFYNPYWLPDIANVAIVV  333



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/344 (77%), Positives = 294/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA------AAMHQKVFDV-SINVGES----KCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV S +V       KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAANRHHHNHHHGHQVFDVASSDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FGV EI+ SQIPDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIIFGVTEILLSQIPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS++LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  344



>ref|XP_006386355.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
 gb|ERP64152.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
Length=480

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/326 (79%), Positives = 290/326 (89%), Gaps = 3/326 (1%)
 Frame = -1

Query  969  HQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  799
            + +VFD+SI+    G SK FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  QLGW
Sbjct  7    NHQVFDISIDTHQQGGSKWFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGW  66

Query  798  VAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQY  619
            +AGP VM LFSFVT YTS LLS CYRSGDP+ GKRNYTYMDAVRSNLG ++VKICG +QY
Sbjct  67   IAGPAVMFLFSFVTCYTSTLLSACYRSGDPITGKRNYTYMDAVRSNLGGVKVKICGFVQY  126

Query  618  ANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDF  439
             NLFGVA+GYTIASSISMMAIKRSNCFH SGG++PC +N+ PYMI FG+ EI+ SQIP F
Sbjct  127  LNLFGVAIGYTIASSISMMAIKRSNCFHKSGGQDPCHMNAYPYMIGFGIAEILLSQIPGF  186

Query  438  DQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQAL  259
            DQ+ WLS+VAAVMSFTYS+IGLGLG+ KV ENGK+ GSLTGISIGTV++ QKIW++ QAL
Sbjct  187  DQLHWLSLVAAVMSFTYSSIGLGLGIGKVIENGKISGSLTGISIGTVTQTQKIWKSFQAL  246

Query  258  GAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
            G IAFAYS+S+IL+EIQDT+K+PP+E+KTMKKATLISV VTT FYM CGCFGYAAFGD S
Sbjct  247  GDIAFAYSFSMILVEIQDTIKAPPSEAKTMKKATLISVVVTTFFYMFCGCFGYAAFGDLS  306

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            PGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  307  PGNLLTGFGFYNPYWLLDIANAAIVI  332



>ref|XP_006300985.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
 gb|EOA33883.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
Length=475

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/310 (81%), Positives = 284/310 (92%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKCFDDDG++KRTG+ WTASAHIITAVIGSGVLSLAWATAQLGW+AGP VMLLFS VTY+
Sbjct  18   SKCFDDDGKIKRTGSAWTASAHIITAVIGSGVLSLAWATAQLGWIAGPVVMLLFSIVTYF  77

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG ++V +CGI+QY N+FGVA+GYTIAS+I
Sbjct  78   TSSLLASCYRSGDPISGKRNYTYMDAVRSNLGGVKVTLCGIVQYLNIFGVAIGYTIASAI  137

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCFH SGGK+ C +NSNPYMI FG+V+I+FSQIPDFDQ+WWLSI+AAVMSFT
Sbjct  138  SMMAIKRSNCFHKSGGKDACHMNSNPYMIAFGLVQILFSQIPDFDQLWWLSILAAVMSFT  197

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YS+ GL LG+A+V  NGKV GSLTGISIG V+E QKIWR+ QALG IAFAYSYS+ILIEI
Sbjct  198  YSSAGLALGIAQVVVNGKVKGSLTGISIGAVTETQKIWRSFQALGNIAFAYSYSIILIEI  257

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDTVKSPP+E KTMKKATL+SV VTT+FY++CGC GYAAFGD SPGNLLTGFGFYNP+WL
Sbjct  258  QDTVKSPPSEEKTMKKATLVSVGVTTMFYLLCGCMGYAAFGDLSPGNLLTGFGFYNPYWL  317

Query  30   LDIANAAIVI  1
            LDIANAAIVI
Sbjct  318  LDIANAAIVI  327



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/336 (77%), Positives = 292/336 (87%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQ--KVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MG  AAA   H   +VFD+++    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAANNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGWVAGP VMLLFS VT Y+S LLS+CYR+GD V GKRNYTYMDAVRS LG  
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGF  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            + KICG+IQY NLFGVA+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FGV 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIG V++ 
Sbjct  181  EILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGSLTGISIGAVTQT  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QKIWRT QALG IAFAYSYS++LIEIQDTV+SPP+ESKTMKKAT +S+A+TT+FYM+CG 
Sbjct  241  QKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGS  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  MGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  336



>ref|XP_002302224.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
 gb|EEE81497.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
Length=485

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/337 (77%), Positives = 292/337 (87%), Gaps = 4/337 (1%)
 Frame = -1

Query  999  MGENAAAA-AMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGEN +A   +  +VF VSI+      S+ FDDDGR KRTGTVWTASAHIITAVIGSGVL
Sbjct  1    MGENTSAENQLPHQVFSVSIDTNPRSGSEWFDDDGRPKRTGTVWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA  QLGW+AGP VMLLFS VTYYTS LLS CYRSGDP+ GKRNYTYMD VR+NLG 
Sbjct  61   SLAWAIGQLGWIAGPAVMLLFSLVTYYTSTLLSACYRSGDPITGKRNYTYMDVVRANLGD  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
            ++VKICG + Y N FGVA GYTIASSISMMAIKRSNCFH SGGKNPC++N+NPYMI FG+
Sbjct  121  VKVKICGFVLYLNPFGVATGYTIASSISMMAIKRSNCFHKSGGKNPCRMNANPYMIGFGI  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP FDQ+ WLS+VAAVMSFTY++IGLGLG+ KV ENGK+ GSLTGISIGTV++
Sbjct  181  TEILLSQIPGFDQLHWLSLVAAVMSFTYASIGLGLGIGKVIENGKISGSLTGISIGTVTQ  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIW + QALG IAFAYS+S+IL+EIQDT+KSPP+E+KTMKKATLISV VTTLFYM CG
Sbjct  241  TQKIWISFQALGNIAFAYSFSMILVEIQDTIKSPPSEAKTMKKATLISVVVTTLFYMFCG  300

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  301  CFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  337



>ref|XP_003522571.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578960.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=487

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/335 (77%), Positives = 295/335 (88%), Gaps = 5/335 (1%)
 Frame = -1

Query  990  NAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            +   +  HQ+  + SI++   G SKCFDDDGR KRTGTVWTASAHIITAVIGSGVLSLAW
Sbjct  5    DGVGSKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAW  64

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS--LQ  646
            A AQLGW+AGP VM+LFS +TYYTS LLS+CYR+GDPV GKRNYTYMDA++SN G    +
Sbjct  65   AIAQLGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMDAIQSNFGGNGFK  124

Query  645  VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
            VK+CG++QY NLFGVA+GYTIA+S SMMAI+RSNC+H SGGK+PC +NSN YMI FG+VE
Sbjct  125  VKLCGLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVE  184

Query  465  IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQ  286
            IIFSQIP FDQ+WWLSIVAAVMSFTYSTIGLGLG+ KV EN  V GSLTGI+IGTV++ +
Sbjct  185  IIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVIENRGVGGSLTGITIGTVTQTE  244

Query  285  KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
            K+WRT QALG IAFAYSYSLIL+EIQDTVKSPP+ESKTMKKA+ ISVAVT++FYM+CGCF
Sbjct  245  KVWRTMQALGDIAFAYSYSLILVEIQDTVKSPPSESKTMKKASFISVAVTSIFYMLCGCF  304

Query  105  GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  305  GYAAFGDASPGNLLTGFGFYNPYWLLDIANAAIVI  339



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/344 (76%), Positives = 292/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA------AAMHQKVFDVSIN-----VGESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV+ +         KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI FGV EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIAFGVAEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS++LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  IFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  344



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/343 (76%), Positives = 292/343 (85%), Gaps = 10/343 (3%)
 Frame = -1

Query  999  MGENAAA-----AAMHQKVFDVSIN-----VGESKCFDDDGRLKRTGTVWTASAHIITAV  850
            MGE AAA          +VFD +I+         KCFDDDGRLKRTGTVWTASAHI+TAV
Sbjct  1    MGETAAAKNHHHHHHGHQVFDAAIHDVVPPQPAFKCFDDDGRLKRTGTVWTASAHIVTAV  60

Query  849  IGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAV  670
            IGSGVLSLAWA AQLGW+AGP VMLLFS VT Y+S LLS+CYR+GD V GKRNYTYMDAV
Sbjct  61   IGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAV  120

Query  669  RSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPY  490
            RS LG  + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPY
Sbjct  121  RSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPY  180

Query  489  MIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGIS  310
            MI+FGV EI+ SQIPDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGIS
Sbjct  181  MIIFGVTEILLSQIPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGIS  240

Query  309  IGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTL  130
            IGTV++ QKIWRT QALG IAFAYSYS++LIEIQDTV+SPPAESKTMKKAT IS+AVTT+
Sbjct  241  IGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTTV  300

Query  129  FYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLD+ANAAIV+
Sbjct  301  FYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDVANAAIVV  343



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/344 (76%), Positives = 292/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA------AAMHQKVFDVSIN-----VGESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV+ N         KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAANHHRHQHHHGHQVFDVASNDVVPTQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLFG+AVGYTIA+SISMMAIKRSNCFH SGGK+PC ++SN 
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNS  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FGV EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIVFGVTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS++LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  344



>gb|AAM61320.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/309 (82%), Positives = 278/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGPTVM LFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPTVMXLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V+  QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTXTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD++PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKIATRISIAVTTTFYMLCGCMGYAAFGDKAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIVI
Sbjct  309  DVANAAIVI  317



>ref|XP_003527948.1| PREDICTED: amino acid permease 3 [Glycine max]
 gb|KHN46995.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/336 (76%), Positives = 296/336 (88%), Gaps = 5/336 (1%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLA  823
            ++   +   Q+  +VSI++   G SKCFDDDGR KRTGTVWT+SAHIITAVIGSGVLSLA
Sbjct  4    KDGVGSKYLQQTLNVSIDMHQHGISKCFDDDGRPKRTGTVWTSSAHIITAVIGSGVLSLA  63

Query  822  WATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS--L  649
            WA AQLGW+AGP VM++FS +TYYTS LL++CYR+GDPV GKRNYTYMDA++SN G    
Sbjct  64   WAIAQLGWIAGPIVMVIFSAITYYTSTLLADCYRTGDPVTGKRNYTYMDAIQSNFGGNGF  123

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VK+CG++QY NLFGVA+GYTIA+S SMMAI+RSNCFH SGGK+PC INSN YMI FG+V
Sbjct  124  KVKLCGLVQYVNLFGVAIGYTIAASTSMMAIERSNCFHKSGGKDPCHINSNMYMISFGIV  183

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI+FSQIP FDQ+WWLSIVAAVMSFTYSTIGLGLG+ KV ENG V GSLTGI+IGTV++ 
Sbjct  184  EILFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVIENGGVGGSLTGITIGTVTQT  243

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
             K+WRT QALG IAFAYSYSLILIEIQDTVKSPP+ESKTMKKA+ ISVAVT++FYM+CGC
Sbjct  244  DKVWRTMQALGDIAFAYSYSLILIEIQDTVKSPPSESKTMKKASFISVAVTSIFYMLCGC  303

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  304  FGYAAFGDASPGNLLTGFGFYNPYWLLDIANAAIVI  339



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/322 (79%), Positives = 286/322 (89%), Gaps = 1/322 (0%)
 Frame = -1

Query  963  KVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
            +VFD S+    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA AQLGW+AGP
Sbjct  17   QVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGP  76

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
             VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDAVRS LG  + KICG+IQY NLF
Sbjct  77   AVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLF  136

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            G+AVGYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FGV EI+ SQ+PDFDQIW
Sbjct  137  GIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQVPDFDQIW  196

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIA  247
            W+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIGTV++ QKIWRT QALG IA
Sbjct  197  WISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIA  256

Query  246  FAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNL  67
            FAYSYS++LIEIQDTV+SPP+ES TMKKAT IS+AVTT+FYM+CG  GYAAFGD +PGNL
Sbjct  257  FAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNL  316

Query  66   LTGFGFYNPFWLLDIANAAIVI  1
            LTGFGFYNPFWLLDIANAAIV+
Sbjct  317  LTGFGFYNPFWLLDIANAAIVV  338



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/336 (76%), Positives = 291/336 (87%), Gaps = 3/336 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQ--KVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            MG  AA    H   +VFD+++    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MGATAAVNNHHHGHQVFDMAVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  60

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQLGWVAGP VMLLFS VT Y+S LLS+CYR+GD + GKRNYTYMDAVRS LG  
Sbjct  61   LAWAIAQLGWVAGPAVMLLFSLVTLYSSTLLSDCYRTGDAISGKRNYTYMDAVRSILGGF  120

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            + KICG+IQY NLFGVA+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FGV 
Sbjct  121  KFKICGLIQYLNLFGVAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVT  180

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIG V++ 
Sbjct  181  EILLSQVPDFDQIWWISIVAAVMSFTYSAIGLSLGIVQVAANGVFKGSLTGISIGAVTQT  240

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            QKIWRT QALG IAFAYSYS++LIEIQDTV+SPP+ESKTMKKAT +S+A+TT+FYM+CG 
Sbjct  241  QKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLCGS  300

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  MGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  336



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/344 (76%), Positives = 290/344 (84%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAAA------AMHQKVFDVSINV-----GESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV+ N         KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAATRHHHNHHHGHQVFDVASNEVVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VM+LFS VT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMILFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FGV EI  SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIIFGVTEIFLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS +LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSAVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  MFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  344



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/344 (76%), Positives = 292/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA------AAMHQKVFDVSIN-----VGESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV+ +         KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDFVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VMLLFS VT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FGV EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS++LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  IFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  344



>ref|XP_009131105.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=487

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/322 (79%), Positives = 286/322 (89%), Gaps = 1/322 (0%)
 Frame = -1

Query  963  KVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
            +VFD S+    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA AQLGW+AGP
Sbjct  17   QVFDASVPQQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGP  76

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
             VMLLFSFVT Y+S LLS+CYR+GD V GKRNYTYMDAVRS LG  + KICG+IQY NLF
Sbjct  77   AVMLLFSFVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILGGFKFKICGLIQYLNLF  136

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            G+AVGYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FGV EI+ SQ+PDFDQIW
Sbjct  137  GIAVGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFGVTEILLSQVPDFDQIW  196

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIA  247
            W+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIGTV++ QKIWRT QALG IA
Sbjct  197  WISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIA  256

Query  246  FAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNL  67
            FAYSYS++LIEIQDTV+SPP+ES TMKKAT IS+AVTT+FYM+CG  GYAAFGD +PGNL
Sbjct  257  FAYSYSVVLIEIQDTVRSPPSESTTMKKATKISIAVTTIFYMLCGSMGYAAFGDAAPGNL  316

Query  66   LTGFGFYNPFWLLDIANAAIVI  1
            LTGFGFYNPFWLLDIANAAIV+
Sbjct  317  LTGFGFYNPFWLLDIANAAIVV  338



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/338 (76%), Positives = 291/338 (86%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAA----AAMHQKVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            MGE AAA         +VFD  +    + KCFDDDGRLKRTGTVWTASAHIITAVIGSGV
Sbjct  1    MGETAAANHHHHHHGHQVFDAYVPPQPAFKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWA AQLGWVAGP VML+FS VT Y+S LLS+CYR+GD V GKRNYTYMDAVRS LG
Sbjct  61   LSLAWAIAQLGWVAGPAVMLVFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDAVRSILG  120

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              + KICG+IQY NLFG+A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNPYMI+FG
Sbjct  121  GFKFKICGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNPYMIIFG  180

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
            V EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGISIGTV+
Sbjct  181  VTEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGISIGTVT  240

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
            + QKIWRT QALG IAFAYSYS++LIEIQDTV+SPP+ESKTMKKAT +S+A+TT+FYM+C
Sbjct  241  QTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPSESKTMKKATKLSIAITTIFYMLC  300

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            G  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  GSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  338



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/330 (77%), Positives = 288/330 (87%), Gaps = 6/330 (2%)
 Frame = -1

Query  972  MHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            + +    ++  V  SKCFDDDGRLKRTGTVWTA++HIITAVIGSGVLSLAWA AQLGW+A
Sbjct  35   IQEDTESLNPQVAHSKCFDDDGRLKRTGTVWTATSHIITAVIGSGVLSLAWAIAQLGWIA  94

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VM+LF+FV YYTS LLS+CYRSGDPV G+RNYTY DAVRSNLG  +VKICG IQY N
Sbjct  95   GPIVMILFAFVIYYTSNLLSDCYRSGDPVTGRRNYTYTDAVRSNLGGAKVKICGAIQYVN  154

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIA+SISMMAIKRSNCFHASGGK+PC ++SN YMI+FG+ EI+FSQIPDFDQ
Sbjct  155  LFGVAIGYTIAASISMMAIKRSNCFHASGGKDPCHMSSNMYMIIFGITEIVFSQIPDFDQ  214

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRT  271
            +WWLSIVAAVMSFTYST+GLGLGV K AENG   GSL GISIGTV++       QKIWR 
Sbjct  215  VWWLSIVAAVMSFTYSTVGLGLGVTKTAENGSFRGSLMGISIGTVTKAGTVTATQKIWRN  274

Query  270  SQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAF  91
             QALG IAFAYSYS+ILIEIQDT+KSPPAE+KTM+KATL+S+ VTT+FYM+CGC GYAAF
Sbjct  275  LQALGDIAFAYSYSIILIEIQDTIKSPPAENKTMRKATLLSIVVTTVFYMLCGCMGYAAF  334

Query  90   GDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  335  GDDAPGNLLTGFGFYNPYWLLDIANLAIVV  364



>ref|XP_007137459.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
 gb|ESW09453.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
Length=487

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/338 (75%), Positives = 295/338 (87%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            +G +   +   Q+ F+VS+++   G+SKCFDDDGR KRTGTVWTASAHIITAVIGSGVLS
Sbjct  2    VGMDGHGSRYDQQTFNVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLS  61

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS-  652
            LAWA AQLGW+AGP VMLLFS +TY+TS+LL++CYR+GDP+ GKRNYTYMDA+RSN G  
Sbjct  62   LAWAIAQLGWIAGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGN  121

Query  651  -LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              +VK+CG++QY NLFG+++GYTIA+SISMMAI+RSNCFH SGGKNPC++NSN YMI FG
Sbjct  122  GFKVKMCGLVQYVNLFGISIGYTIAASISMMAIERSNCFHKSGGKNPCRMNSNMYMISFG  181

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
            +VEIIFSQIP FDQ+WWLS VAAVMSFTYSTIGLGLGV KV EN KV GSLTGI++G V+
Sbjct  182  IVEIIFSQIPGFDQLWWLSFVAAVMSFTYSTIGLGLGVGKVIENRKVGGSLTGITVGHVT  241

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
            +  K+WRT QALG IAFA+SYS +LIEIQDTVKSPP+ SKTMKKA L  VAVTT FYM+C
Sbjct  242  QTNKVWRTMQALGDIAFAFSYSFVLIEIQDTVKSPPSASKTMKKAALNGVAVTTFFYMLC  301

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GCFGYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  302  GCFGYAAFGDLSPGNLLTGFGFYNPYWLLDIANAAIVI  339



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/309 (81%), Positives = 277/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ +GYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMI+FGV EI+ SQI DFDQIWWLSIVAAVMSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMILFGVTEILLSQIKDFDQIWWLSIVAAVMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGAVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FY++CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKNATRISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>gb|KHN44307.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/335 (76%), Positives = 293/335 (87%), Gaps = 5/335 (1%)
 Frame = -1

Query  990  NAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            +   +  HQ+  + SI++   G SKCFDDDGR KRTGTVWTASAHIITAVIGSGVLSLAW
Sbjct  5    DGVGSKYHQQTLNFSIDIHQQGISKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAW  64

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS--LQ  646
            A AQLGW+AGP VM+LFS +TYYTS LLS+CYR+GDPV GKRNYTYM A++SN G    +
Sbjct  65   AIAQLGWIAGPIVMVLFSAITYYTSTLLSDCYRTGDPVTGKRNYTYMGAIQSNFGGNGFK  124

Query  645  VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
            VK+CG++QY NLFGVA+GYTIA+S SMMAI+RSNC+H SGGK+PC +NSN YMI FG+VE
Sbjct  125  VKLCGLVQYINLFGVAIGYTIAASTSMMAIERSNCYHKSGGKDPCHMNSNMYMISFGIVE  184

Query  465  IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQ  286
            IIFSQIP FDQ+WWLSIVAAVMSFTYSTIGLGLG+ KV EN  V GSLTGI+IGTV++  
Sbjct  185  IIFSQIPGFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVIENRGVGGSLTGITIGTVTQTD  244

Query  285  KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
            K+WRT QALG IAFAYSYSLIL+EIQDTVKSPP+ESKTMKKA+ ISVAVT++FYM+CGCF
Sbjct  245  KVWRTMQALGDIAFAYSYSLILVEIQDTVKSPPSESKTMKKASFISVAVTSIFYMLCGCF  304

Query  105  GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GYAAFGD SPGNLLTGFGFYNP+WLLDIANAAIVI
Sbjct  305  GYAAFGDASPGNLLTGFGFYNPYWLLDIANAAIVI  339



>ref|XP_002864872.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41131.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/309 (81%), Positives = 277/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GT+WTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTIWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTVKSPPAESKTMK AT IS+AVTT FY++CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVKSPPAESKTMKIATRISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/309 (81%), Positives = 276/309 (89%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFGV +GYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGVTIGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DT++SPPAESKTMK AT IS+AVTT FY++CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTIRSPPAESKTMKNATKISIAVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+AN AIVI
Sbjct  309  DVANVAIVI  317



>ref|XP_004142635.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 ref|XP_004170719.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 gb|KGN54544.1| Amino acid permease [Cucumis sativus]
Length=480

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/307 (81%), Positives = 281/307 (92%), Gaps = 0/307 (0%)
 Frame = -1

Query  921  FDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSV  742
            FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP VM+LFSFVTYYTS 
Sbjct  26   FDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPVVMMLFSFVTYYTST  85

Query  741  LLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMM  562
            LL+ CYRSGD V+GKRNYTYMDAVR+NLG  +VK+CG++QY NLFGVA+GYTIASSISMM
Sbjct  86   LLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCGLVQYVNLFGVAIGYTIASSISMM  145

Query  561  AIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYST  382
            AIKRSNCFH SGGKNPC +NSNPYMI FG++EI  SQIPDFDQ+WWLSIVAAVMSFTYS 
Sbjct  146  AIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQIPDFDQLWWLSIVAAVMSFTYSI  205

Query  381  IGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDT  202
            IGL LG+ +V +NGK  GSLTG+SIG+V+E QKIWR+ QALG +AFAYS+S+ILIEIQDT
Sbjct  206  IGLVLGIIQVTDNGKFKGSLTGVSIGSVTESQKIWRSFQALGDMAFAYSFSIILIEIQDT  265

Query  201  VKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDI  22
            +K+PP+E+KTMKKAT +SVAVTT+FYM+CGC GYAAFGD +PGNLLTGFGFYNP+WLLDI
Sbjct  266  IKAPPSEAKTMKKATFLSVAVTTVFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDI  325

Query  21   ANAAIVI  1
            AN AIV+
Sbjct  326  ANVAIVV  332



>gb|KHG27248.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=468

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/335 (79%), Positives = 286/335 (85%), Gaps = 17/335 (5%)
 Frame = -1

Query  999  MGENAAAA-AMHQK-VFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  826
            MGE  A    +H   VFD  I       FDDDGRLKRTGTVWTASAHIITAVIGSGVLSL
Sbjct  1    MGEKGAVKNHLHNNLVFDHPIG------FDDDGRLKRTGTVWTASAHIITAVIGSGVLSL  54

Query  825  AWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQ  646
            AWATAQLGW+A P VM LFSFVT YTS LL+ CYR  DPV+GKRNYTYMDAV        
Sbjct  55   AWATAQLGWIASPAVMFLFSFVTDYTSTLLAACYRCDDPVNGKRNYTYMDAV--------  106

Query  645  VKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVE  466
             KICG +QY NLFGVA+GYTIASSISMMAIKRSNCFHAS GKNPC +NSNPYMI FG+ E
Sbjct  107  -KICGWVQYLNLFGVAIGYTIASSISMMAIKRSNCFHASRGKNPCHMNSNPYMIGFGIAE  165

Query  465  IIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQ  286
            IIFSQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+AKVAENGK+ GSLTGIS+GTV++ Q
Sbjct  166  IIFSQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIAKVAENGKIRGSLTGISVGTVTQTQ  225

Query  285  KIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCF  106
            KIWR+ QALG +AFAYSYSLILIEIQDT+K+PP+ESKTM KATL+SV VTTLFYM+CGC 
Sbjct  226  KIWRSFQALGDMAFAYSYSLILIEIQDTLKAPPSESKTMSKATLLSVGVTTLFYMLCGCM  285

Query  105  GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GYAAFGD SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  286  GYAAFGDLSPGNLLTGFGFYNPFWLLDIANAAIVI  320



>ref|XP_006394236.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 ref|XP_006394237.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31522.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31523.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
Length=466

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/309 (81%), Positives = 277/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GD V GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ VGYTIA++IS
Sbjct  69   STLLSDCYRTGDHVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITVGYTIAAAIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG   GSLTGISIGTV++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMKKAT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKKATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/344 (76%), Positives = 291/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAA------AAMHQKVFDVSIN-----VGESKCFDDDGRLKRTGTVWTASAHIITA  853
            MGE AAA           +VFDV+ +         KCFDDDGRLKRTGTVWTASAHIITA
Sbjct  1    MGETAAANNHRHHHHHGHQVFDVASHDFVPPQPAFKCFDDDGRLKRTGTVWTASAHIITA  60

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGW+AGP VMLLFS VT Y+S LLS+CYR+GD V GKRNYTYMDA
Sbjct  61   VIGSGVLSLAWAIAQLGWIAGPAVMLLFSLVTLYSSTLLSDCYRTGDAVSGKRNYTYMDA  120

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            VRS LG  + KICG+IQY NLF +A+GYTIA+SISMMAIKRSNCFH SGGK+PC ++SNP
Sbjct  121  VRSILGGFKFKICGLIQYLNLFVIAIGYTIAASISMMAIKRSNCFHKSGGKDPCHMSSNP  180

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI+FGV EI+ SQ+PDFDQIWW+SIVAAVMSFTYS IGL LG+ +VA NG   GSLTGI
Sbjct  181  YMIVFGVAEILLSQVPDFDQIWWISIVAAVMSFTYSAIGLALGIVQVAANGVFKGSLTGI  240

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTT  133
            SIGTV++ QKIWRT QALG IAFAYSYS++LIEIQDTV+SPPAESKTMKKAT IS+AVTT
Sbjct  241  SIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQDTVRSPPAESKTMKKATKISIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +FYM+CG  GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIV+
Sbjct  301  IFYMLCGSMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVV  344



>ref|XP_009130275.1| PREDICTED: amino acid permease 4 [Brassica rapa]
 ref|XP_009130276.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/309 (81%), Positives = 278/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTY++
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYFS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAV+S LG  + KICG+IQ+ NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG + GSLTGISIGTV++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVLKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK+AT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKQATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+AN AIVI
Sbjct  309  DVANVAIVI  317



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 292/342 (85%), Gaps = 8/342 (2%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVF---DVSINVGE----SKCFDDDGRLKRTGTVWTASAHIITAVIG  844
             KMGEN AA       F   +V+I +G     SKCFD+DGRLKRTGTVWTAS+HIITAVIG
Sbjct  3     KMGENGAAKYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVIG  62

Query  843   SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
             SGVLSLAWA  QLGWVAGP  MLLFS+VTYYTS LLS+CYRSGDP+ GKRNYTYMDAV +
Sbjct  63    SGVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHA  122

Query  663   NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
             NL   +VKICG +QYAN+FGV++GYTIA+SISM+AIKRSNCFH  G KNPCQ +SNPYMI
Sbjct  123   NLNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYMI  182

Query  483   MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
             MFGV EI+FSQIPDFDQIWWLSI+AA+MSFTYS+IGL LG+ +V +NG + GSLTGISI 
Sbjct  183   MFGVAEILFSQIPDFDQIWWLSILAAIMSFTYSSIGLALGIVQVIQNGGIKGSLTGISIA  242

Query  303   TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVK-SPPAESKTMKKATLISVAVTTLF  127
              VS   K+WR+ QA G IAFAYSYSLILIEIQDT+K +PP+E+K MK+ATL+SVAVTT+F
Sbjct  243   VVSPTDKVWRSLQAFGDIAFAYSYSLILIEIQDTIKEAPPSEAKVMKRATLLSVAVTTIF  302

Query  126   YMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             YM+CGC GYAAFGD +PGNLLTGFGFY+P+WLLDIANAAIVI
Sbjct  303   YMLCGCMGYAAFGDMAPGNLLTGFGFYDPYWLLDIANAAIVI  344



>emb|CDY39844.1| BnaC02g42740D [Brassica napus]
Length=466

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/309 (81%), Positives = 277/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTY++
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYFS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAV+S LG  + KICG+IQ+ NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG   GSLTGISIGTV++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK+AT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKQATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+AN AIVI
Sbjct  309  DVANVAIVI  317



>emb|CDY31348.1| BnaA02g33930D [Brassica napus]
Length=466

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/309 (81%), Positives = 277/309 (90%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTY++
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYFS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAV+S LG  + KICG+IQ+ NLFG+ VGYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLIQFLNLFGITVGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG   GSLTGISIGTV++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVFKGSLTGISIGTVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK+AT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKQATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+AN AIVI
Sbjct  309  DVANVAIVI  317



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/345 (75%), Positives = 293/345 (85%), Gaps = 13/345 (4%)
 Frame = -1

Query  999  MGENAAAAAMHQKV----FDVSINVGE-------SKCFDDDGRLKRTGTVWTASAHIITA  853
            MGEN A    HQ+      +VSI +G        SKC+DDDGRLKRTGT+WTASAHIITA
Sbjct  1    MGENGATK-YHQQAGIPPMEVSIELGHQKQLQGGSKCYDDDGRLKRTGTLWTASAHIITA  59

Query  852  VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
            VIGSGVLSLAWA AQLGWVAGP VM LFSFV +YTS LL++CYRSGDP+ GKRNYTYMDA
Sbjct  60   VIGSGVLSLAWAIAQLGWVAGPAVMFLFSFVIFYTSTLLADCYRSGDPITGKRNYTYMDA  119

Query  672  VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
            V + LG L+VK+CG IQYANLFGVA+GYTIA+SISMMAI+RSNCFH  G K+PC ++SNP
Sbjct  120  VHAYLGGLKVKMCGYIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKSPCHVSSNP  179

Query  492  YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
            YMI FGV+EIIFSQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +   N +  GSLTGI
Sbjct  180  YMIAFGVLEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLILGIVQTIGNKRFKGSLTGI  239

Query  312  SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVT  136
            SIG V+E QKIWRT QALG IAFAYS+S+ILIEIQDTVK+ PP+E+K MKKA ++S+AVT
Sbjct  240  SIGAVTETQKIWRTLQALGDIAFAYSFSIILIEIQDTVKAPPPSEAKVMKKAAVLSIAVT  299

Query  135  TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            T FYM+CGC GYAAFGD++PGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  300  TFFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPFWLLDIANAAIVI  344



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/341 (74%), Positives = 291/341 (85%), Gaps = 8/341 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVF---DVSINVGE----SKCFDDDGRLKRTGTVWTASAHIITAVIGS  841
            MGEN AA       F   +V+I +G     SKCFD+DGRLKRTGTVWTAS+HIITAVIGS
Sbjct  1    MGENGAAKYHQHANFTPMEVAIELGHQQGSSKCFDNDGRLKRTGTVWTASSHIITAVIGS  60

Query  840  GVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSN  661
            GVLSLAWA  QLGWVAGP  MLLFS+VTYYTS LLS+CYRSGDP+ GKRNYTYMDAV +N
Sbjct  61   GVLSLAWAIGQLGWVAGPAAMLLFSYVTYYTSALLSDCYRSGDPMTGKRNYTYMDAVHAN  120

Query  660  LGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIM  481
            L   +VKICG +QYAN+FGV++GYTIA+SISM+AIKRSNCFH  G KNPCQ +SNPYMIM
Sbjct  121  LNGFKVKICGFLQYANIFGVSIGYTIAASISMLAIKRSNCFHEKGHKNPCQASSNPYMIM  180

Query  480  FGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT  301
            FGV EI+FSQIPDFDQIWWLSI+AA+MSFTYS+IGL LG+ +V +NG + GSLTGISI  
Sbjct  181  FGVAEILFSQIPDFDQIWWLSILAAIMSFTYSSIGLALGIVQVIQNGGIKGSLTGISIAV  240

Query  300  VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVK-SPPAESKTMKKATLISVAVTTLFY  124
            VS   K+WR+ QA G IAFAYSYSLILIEIQDT+K +PP+E+K MK+ATL+SVAVTT+FY
Sbjct  241  VSPTDKVWRSLQAFGDIAFAYSYSLILIEIQDTIKEAPPSEAKVMKRATLLSVAVTTIFY  300

Query  123  MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            M+CGC GYAAFGD +PGNLLTGFGFY+P+WLLDIANAAIVI
Sbjct  301  MLCGCMGYAAFGDMAPGNLLTGFGFYDPYWLLDIANAAIVI  341



>ref|XP_003524313.1| PREDICTED: amino acid permease 2-like [Glycine max]
 gb|KHN17398.1| Amino acid permease 2 [Glycine soja]
Length=484

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/339 (75%), Positives = 286/339 (84%), Gaps = 6/339 (2%)
 Frame = -1

Query  999  MGENAAAAAM-HQKVFDVSINV-----GESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
            M ENAA   + H +VF +  +V       SKC+DDDGRLKRTG VWTAS+HIITAVIGSG
Sbjct  1    MPENAATTNLNHLQVFGIEDDVPSHSQNNSKCYDDDGRLKRTGNVWTASSHIITAVIGSG  60

Query  837  VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
            VLSLAWA AQLGW+AGPTVM LFS VT+YTS LL++CYR+GDP  GKRNYTYMDAVRS L
Sbjct  61   VLSLAWAIAQLGWIAGPTVMFLFSLVTFYTSSLLADCYRAGDPNSGKRNYTYMDAVRSIL  120

Query  657  GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
            G   V +CGI QY NL G+ +GYTIA+SISMMAIKRSNCFH SGGKNPC ++SN YMI+F
Sbjct  121  GGANVTLCGIFQYLNLLGIVIGYTIAASISMMAIKRSNCFHKSGGKNPCHMSSNVYMIIF  180

Query  477  GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
            G  EI  SQIPDFDQ+WWLS VAA+MSFTYS IGL LG+AKVAE G   G LTGISIG V
Sbjct  181  GATEIFLSQIPDFDQLWWLSTVAAIMSFTYSIIGLSLGIAKVAETGTFKGGLTGISIGPV  240

Query  297  SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
            SE QKIWRTSQALG IAFAYSY+++LIEIQDT+KSPP+E+KTMKKATLIS+AVTT FYM+
Sbjct  241  SETQKIWRTSQALGDIAFAYSYAVVLIEIQDTIKSPPSEAKTMKKATLISIAVTTTFYML  300

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGC GYAAFGD +PGNLLTGFGFYNP+WL+DIANAAIVI
Sbjct  301  CGCMGYAAFGDAAPGNLLTGFGFYNPYWLIDIANAAIVI  339



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/309 (80%), Positives = 274/309 (89%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDG+LKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY 
Sbjct  9    KCFDDDGKLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPVVMFLFSFVTYYC  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ +GYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS +LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSAVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+ VTT FY++CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKNATRISITVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/309 (80%), Positives = 273/309 (88%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKR+GTVWTASAHIITAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRLKRSGTVWTASAHIITAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LLS+CYR+GDPV GKRNYTYMDAVRS LG  + KICG+IQY NLFG+ +GYTIA+SIS
Sbjct  69   STLLSDCYRTGDPVSGKRNYTYMDAVRSILGGFRFKICGLIQYLNLFGITIGYTIAASIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ SQI DFDQIWWLSIVA +MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSQIKDFDQIWWLSIVATIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S IGL LG+ +VA NG V GSLTGISIG V++ QKIWRT QALG IAFAYSYS +LIEIQ
Sbjct  189  SAIGLALGIIQVAANGVVKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSAVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+ VTT FY++CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKNATRISITVTTTFYLLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+AN AIV+
Sbjct  309  DVANVAIVV  317



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/346 (75%), Positives = 292/346 (84%), Gaps = 13/346 (4%)
 Frame = -1

Query  999  MGENAAA-------AAMHQKVFDVSINV---GESKCFD---DDGRLKRTGTVWTASAHII  859
            MGE+AA           H +V D+SI +     S CFD   DDGRLKRTGT+WTASAHII
Sbjct  1    MGESAATKNNQNHHHHHHHQVRDMSIEMLPQSASNCFDSFDDDGRLKRTGTLWTASAHII  60

Query  858  TAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYM  679
            TAVIGSGVLSLAWA AQLGW+AGP VM LFSFV+YYTS LLS+CYR+GDPV GKRNYTYM
Sbjct  61   TAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVSYYTSCLLSDCYRAGDPVSGKRNYTYM  120

Query  678  DAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINS  499
            D+VRS LG  +VK CG IQY NLFG+A+GYTIA+SISMMAIKRSNCFH S G+NPC ++S
Sbjct  121  DSVRSILGGAKVKACGFIQYFNLFGIAIGYTIAASISMMAIKRSNCFHESNGENPCHMSS  180

Query  498  NPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLT  319
             PYMIMFG+ EI+ SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+A+VA NG   GSLT
Sbjct  181  TPYMIMFGITEILLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIAQVAANGSFKGSLT  240

Query  318  GISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAV  139
            GIS+G V+E QKIWR+ QALG IAFAYS+S+ILIEIQDTV+SPP+E+KTMKKAT +S AV
Sbjct  241  GISVGAVTETQKIWRSFQALGDIAFAYSFSVILIEIQDTVRSPPSEAKTMKKATFLSTAV  300

Query  138  TTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            TT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301  TTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAAIVI  346



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/345 (74%), Positives = 289/345 (84%), Gaps = 11/345 (3%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVF---DVSINV-------GESKCFDDDGRLKRTGTVWTASAHIITA  853
             KMGEN AA    +  F   +VS+ +       G  KC+DDDGRLKR+GT WTASAHI+TA
Sbjct  3     KMGENGAAKYNQRPTFTPMEVSVELSHGNQLQGLGKCYDDDGRLKRSGTFWTASAHIVTA  62

Query  852   VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
             VIGSGVLSLAWA AQLGWVAGP VMLLFSFVTYYTS LL++CYRSGDP  GKRNY YMDA
Sbjct  63    VIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPDTGKRNYNYMDA  122

Query  672   VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
             V + LG L+VK+CG IQYANLFGVAVGYTIA+SISMMAI+RSNCFH  G KNPC  +SNP
Sbjct  123   VHAYLGGLKVKLCGCIQYANLFGVAVGYTIAASISMMAIRRSNCFHEKGHKNPCHTSSNP  182

Query  492   YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
             YMIMFGVVEI  SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +  +N    GSLTGI
Sbjct  183   YMIMFGVVEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQAIDNKGFKGSLTGI  242

Query  312   SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVT  136
             SIG +S  QKIWR+ QA G IAFAYS+SL+LIEIQDT+KS PP+E+K MKKA+L+S+ VT
Sbjct  243   SIGVISPTQKIWRSLQAFGDIAFAYSFSLVLIEIQDTIKSPPPSEAKVMKKASLLSIIVT  302

Query  135   TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             TLFYM+CGC GYAAFGD++PGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  303   TLFYMLCGCMGYAAFGDKAPGNLLTGFGFYNPYWLLDIANAAIVV  347



>ref|XP_009411898.1| PREDICTED: amino acid permease 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/320 (77%), Positives = 286/320 (89%), Gaps = 1/320 (0%)
 Frame = -1

Query  957  FDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVM  778
             ++ +  G SKCFDDDGRLKRTGT+WTASAHIITAVIGSGVLSLAWA  QLGWVAGP VM
Sbjct  5    LELGLPQGASKCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAVM  64

Query  777  LLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVA  598
            +LFSFVTYYTS LL++CYRSGDPV GKRNYTYMDAVR+NL   +V++CG +QY N+ GVA
Sbjct  65   ILFSFVTYYTSALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGYLQYLNIVGVA  124

Query  597  VGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLS  418
            +GYTIA+SISM+AIKRSNCFH +G  +PCQ+NSNPY+IMFGV EI+FSQIPDFDQIWWLS
Sbjct  125  IGYTIAASISMVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQIPDFDQIWWLS  184

Query  417  IVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAY  238
            IVAAVMSFTYS+IGL LG+ +V +NG + GSLTGISIGTVS+M+K+WR+ QA G IAFAY
Sbjct  185  IVAAVMSFTYSSIGLALGIVQVIKNGGMRGSLTGISIGTVSQMEKVWRSLQAFGDIAFAY  244

Query  237  SYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLT  61
            SYS+ILIEIQDT+++ PP+E+K MKKATLISVAVTT FYM+CGC GYAAFGD +PGNLLT
Sbjct  245  SYSIILIEIQDTIRAPPPSEAKVMKKATLISVAVTTTFYMLCGCMGYAAFGDLAPGNLLT  304

Query  60   GFGFYNPFWLLDIANAAIVI  1
            GFGFYNP+WLLDIAN AIVI
Sbjct  305  GFGFYNPYWLLDIANVAIVI  324



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/341 (74%), Positives = 287/341 (84%), Gaps = 9/341 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGE-------SKCFDDDGRLKRTGTVWTASAHIITAVIGS  841
            MGEN AA   +Q   +VSI +G        SK  DDDGRLKRTGT WTASAHIITAVIGS
Sbjct  1    MGENGAAK-YYQHPMEVSIELGHQQQQQGGSKFHDDDGRLKRTGTFWTASAHIITAVIGS  59

Query  840  GVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSN  661
            GVLSLAWA AQLGWVAGP VMLLF+FV YYTS LL++CYRS DP+ G RNYTYMDAV + 
Sbjct  60   GVLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLADCYRSEDPITGPRNYTYMDAVHAY  119

Query  660  LGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIM  481
            LG L+VK+CG IQYANLFGVA+GYTIA+SISMMAI+RSNCFH  G KNPC +NSNPYMI 
Sbjct  120  LGGLKVKMCGFIQYANLFGVAIGYTIAASISMMAIRRSNCFHEKGHKNPCHVNSNPYMIA  179

Query  480  FGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT  301
            FGV+EIIFSQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +  EN    GSLTGISIG 
Sbjct  180  FGVLEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLTLGIVQTIENKGFKGSLTGISIGA  239

Query  300  VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFY  124
            V+E QK+W + QALG IAFAYS+S+ILIEIQDT+K+ PP+E+K MKKATL+S+ VTT FY
Sbjct  240  VTETQKVWHSLQALGDIAFAYSFSIILIEIQDTIKAPPPSEAKVMKKATLLSIVVTTFFY  299

Query  123  MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            M+CGC GYAAFGD++PGNLLTGFGFYNPFWLLDIAN AIV+
Sbjct  300  MLCGCMGYAAFGDEAPGNLLTGFGFYNPFWLLDIANTAIVV  340



>dbj|BAO45885.1| amino acid permease [Acacia mangium]
Length=486

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/328 (77%), Positives = 287/328 (88%), Gaps = 9/328 (3%)
 Frame = -1

Query  957  FDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
            F V I V   GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA AQLGW+AGP
Sbjct  10   FQVDIEVAPQGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWIAGP  69

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
             VM+LFS VTYYTS LL+ CYRSGDP+ GKRNYTYMDAVRSNLG  +VKICG+IQY NLF
Sbjct  70   AVMILFSLVTYYTSSLLAACYRSGDPLTGKRNYTYMDAVRSNLGGFKVKICGLIQYVNLF  129

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            GVA+GYTIA+SISMMA+++SNC H +G K+ C++N + Y+I FG+VEIIFSQIPDFDQ+W
Sbjct  130  GVAIGYTIAASISMMAVQKSNCIHKTGSKDECKMNGDIYIIAFGIVEIIFSQIPDFDQLW  189

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV------SEMQKIWRTSQ  265
            WLSI+AAVMSFTYSTIGLGLGVA+  EN K+ GSLTGIS+G V      +E QKIWR+ Q
Sbjct  190  WLSILAAVMSFTYSTIGLGLGVAQTIENKKIGGSLTGISVGAVIDSLVITETQKIWRSFQ  249

Query  264  ALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGD  85
            ALG IAFAYSYS+ILIEIQDT+K+PP+E+KTM++AT ISVAVTT FYM+CGCFGYAAFGD
Sbjct  250  ALGDIAFAYSYSMILIEIQDTLKAPPSEAKTMRRATFISVAVTTFFYMLCGCFGYAAFGD  309

Query  84   QSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             SPGNLLTGFGFY P+WLLDIAN AIV+
Sbjct  310  ASPGNLLTGFGFYKPYWLLDIANVAIVV  337



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/344 (75%), Positives = 291/344 (85%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVF---DVSINVGE-------SKCFDDDGRLKRTGTVWTASAHIITAV  850
            MGEN A     Q  F   +VSI +G        SK +DDD RLKRTGT+WTASAHIITAV
Sbjct  1    MGENGAEKHNQQASFPAMEVSIELGHHQQPQGGSKFYDDDQRLKRTGTLWTASAHIITAV  60

Query  849  IGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAV  670
            IGSGVLSLAWA AQLGWVAGP VMLLFSFV YYTS LL++CYR GDP+ GKRNYTYMDAV
Sbjct  61   IGSGVLSLAWAIAQLGWVAGPAVMLLFSFVIYYTSSLLADCYRFGDPITGKRNYTYMDAV  120

Query  669  RSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPY  490
             + LG  +VK CG+IQYANLFGVA+GYTIA+SISMMAI+RS+CFH  G K+PC I+SNPY
Sbjct  121  HAYLGGFKVKFCGVIQYANLFGVAIGYTIAASISMMAIRRSDCFHEKGDKSPCHISSNPY  180

Query  489  MIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGIS  310
            MI+FGV EIIFSQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +  ENG   GSL+GIS
Sbjct  181  MIIFGVSEIIFSQIPDFDQIWWLSIVAAVMSFTYSSIGLVLGIVQTIENGGFKGSLSGIS  240

Query  309  IGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTT  133
            IGTV+E QKIWR+ QALG IAFAYS+S+ILIEIQDT+K+ PP+E+K MKKAT++S+AVTT
Sbjct  241  IGTVTETQKIWRSLQALGDIAFAYSFSIILIEIQDTIKAPPPSEAKVMKKATMLSLAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  301  FFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAAIVI  344



>ref|XP_009411897.1| PREDICTED: amino acid permease 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=478

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/330 (76%), Positives = 291/330 (88%), Gaps = 8/330 (2%)
 Frame = -1

Query  966  QKVF---DVSINVG----ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQ  808
            QK F   +VS+ +G     SKCFDDDGRLKRTGT+WTASAHIITAVIGSGVLSLAWA  Q
Sbjct  2    QKAFPSMEVSLELGLPQGASKCFDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAWAIGQ  61

Query  807  LGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGI  628
            LGWVAGP VM+LFSFVTYYTS LL++CYRSGDPV GKRNYTYMDAVR+NL   +V++CG 
Sbjct  62   LGWVAGPAVMILFSFVTYYTSALLADCYRSGDPVAGKRNYTYMDAVRANLNGFKVELCGY  121

Query  627  IQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQI  448
            +QY N+ GVA+GYTIA+SISM+AIKRSNCFH +G  +PCQ+NSNPY+IMFGV EI+FSQI
Sbjct  122  LQYLNIVGVAIGYTIAASISMVAIKRSNCFHENGDDSPCQVNSNPYIIMFGVAEIVFSQI  181

Query  447  PDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTS  268
            PDFDQIWWLSIVAAVMSFTYS+IGL LG+ +V +NG + GSLTGISIGTVS+M+K+WR+ 
Sbjct  182  PDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIKNGGMRGSLTGISIGTVSQMEKVWRSL  241

Query  267  QALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAF  91
            QA G IAFAYSYS+ILIEIQDT+++ PP+E+K MKKATLISVAVTT FYM+CGC GYAAF
Sbjct  242  QAFGDIAFAYSYSIILIEIQDTIRAPPPSEAKVMKKATLISVAVTTTFYMLCGCMGYAAF  301

Query  90   GDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GD +PGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  302  GDLAPGNLLTGFGFYNPYWLLDIANVAIVI  331



>ref|XP_008444195.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=480

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = -1

Query  939  VGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFV  760
            VG    FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP VM+LFSFV
Sbjct  20   VGADTAFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPVVMMLFSFV  79

Query  759  TYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIA  580
            TYYTS LL+ CYRSGD V+GKRNYTYMDAVR+NLG  +VK+CG++QY NLFGVA+GYTIA
Sbjct  80   TYYTSTLLAACYRSGDSVNGKRNYTYMDAVRNNLGGFKVKLCGLVQYVNLFGVAIGYTIA  139

Query  579  SSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVM  400
            SSISMMAIKRSNCFH SGGKNPC +NSNPYMI FG++EI  SQIPDFDQ+WWLSIVAAVM
Sbjct  140  SSISMMAIKRSNCFHKSGGKNPCHMNSNPYMISFGIMEIFLSQIPDFDQLWWLSIVAAVM  199

Query  399  SFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLIL  220
            SFTYS IGL LG+ +VA+NGK  GSLTG+SIG+V+E QKIWR+ QALG +AFAYS+S+IL
Sbjct  200  SFTYSIIGLILGIIQVADNGKFKGSLTGVSIGSVTESQKIWRSFQALGDMAFAYSFSIIL  259

Query  219  IEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNP  40
            IEIQDT+K+PP+E+KTMKKAT +SVAVTT+FYM+CGC GYAAFGD +PGNLLTGFGFYNP
Sbjct  260  IEIQDTIKAPPSEAKTMKKATFLSVAVTTIFYMLCGCMGYAAFGDLAPGNLLTGFGFYNP  319

Query  39   FWLLDIANAAIVI  1
            +WLLDIAN AIV+
Sbjct  320  YWLLDIANVAIVV  332



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = -1

Query  936  GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVT  757
            G SKCFDDDGRLKRTGT+WTASAHIITAVIGSGVLSLAWA  QLGWVAGP  MLLFSFVT
Sbjct  12   GASKCFDDDGRLKRTGTLWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPIAMLLFSFVT  71

Query  756  YYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIAS  577
            YYTS LL++CYRSGDP  GKRNYTYMD VR+NL   +VK+CG +QY N+ GVA+GYTIA+
Sbjct  72   YYTSALLADCYRSGDPNTGKRNYTYMDTVRANLDGFKVKLCGYLQYLNIVGVAIGYTIAA  131

Query  576  SISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMS  397
            SISM+AI+RSNCFH +G  +PCQ+NSNPYMIMFGV EIIFSQIPDFDQIWWLSIVAAVMS
Sbjct  132  SISMVAIERSNCFHKNGDDSPCQVNSNPYMIMFGVAEIIFSQIPDFDQIWWLSIVAAVMS  191

Query  396  FTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILI  217
            FTYS+IGL LG+ +V +NG V GSLTGISIGTVSEM KIWR+ QA G IAFAYSYS+ILI
Sbjct  192  FTYSSIGLSLGIVQVIKNGGVRGSLTGISIGTVSEMDKIWRSLQAFGDIAFAYSYSIILI  251

Query  216  EIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNP  40
            EIQDT+++ PP+E+K MK+ATLISVAVTT+FYM+CGC GYAAFGD +PGNLLTGFGFYNP
Sbjct  252  EIQDTIRAPPPSEAKVMKRATLISVAVTTVFYMLCGCMGYAAFGDMAPGNLLTGFGFYNP  311

Query  39   FWLLDIANAAIVI  1
            +WLLDIAN AIV+
Sbjct  312  YWLLDIANVAIVV  324



>ref|XP_006847199.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
 gb|ERN08780.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
Length=497

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/347 (72%), Positives = 297/347 (86%), Gaps = 14/347 (4%)
 Frame = -1

Query  999  MGENAAAAAMHQ-----KVF-DVSINVGE--SKCFDDDGRLKRTGTVWTASAHIITAVIG  844
            MGEN       Q     +V+ D++I++    SKC+DDDGRLKRTGTVWTASAHIITAVIG
Sbjct  1    MGENGVRKQYLQVESQTRVYGDMAIDMQHQGSKCYDDDGRLKRTGTVWTASAHIITAVIG  60

Query  843  SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
            SGVLSLA+A  QLGWVAGPTVM+LFSFVTYYTS LLS+CYRSGDP+ GKRNYTY+DAVR+
Sbjct  61   SGVLSLAFAIGQLGWVAGPTVMVLFSFVTYYTSTLLSDCYRSGDPLTGKRNYTYVDAVRA  120

Query  663  NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
            N+    V++CG +QYA L GVA+GYTIASSISMMAIKRSNCFH + GKNPC ++SNPYMI
Sbjct  121  NMSEFNVRLCGWLQYAGLVGVAIGYTIASSISMMAIKRSNCFHETRGKNPCHVSSNPYMI  180

Query  483  MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
            MFG+ EI+ SQIPDFDQIWWLS +AAVMSFTYS+IGLG+G+ KVA NG + GS+TGISIG
Sbjct  181  MFGITEIVLSQIPDFDQIWWLSFLAAVMSFTYSSIGLGMGIGKVAVNGTIKGSMTGISIG  240

Query  303  TVSE------MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVA  142
             ++       MQK+WRT QA+G IAFAYSYS++LIEIQD++KSPP+E+KTM+KAT+ISV 
Sbjct  241  AMTHAGPITAMQKVWRTFQAMGDIAFAYSYSIVLIEIQDSLKSPPSEAKTMRKATMISVT  300

Query  141  VTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            VTT+FYM+CGC GYAAFGDQ+PGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  301  VTTIFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLLDIANAAIVV  347



>ref|XP_010920126.1| PREDICTED: amino acid permease 4-like [Elaeis guineensis]
Length=513

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 282/316 (89%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SK FDDDGRLKRTGTVWTAS+HIITAVIGSGVLSLAWA  QLGW+AGP VM+LF+FV YY
Sbjct  49   SKLFDDDGRLKRTGTVWTASSHIITAVIGSGVLSLAWAIGQLGWIAGPAVMILFAFVIYY  108

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LLS+CYR GDPV GKRNYTYMDAV +NLG  +VKICG IQY NLFGVA+GYTIA+SI
Sbjct  109  TSNLLSDCYRIGDPVTGKRNYTYMDAVGANLGGAKVKICGAIQYVNLFGVAIGYTIAASI  168

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SM AIKRSNCFHASGGK+PC I+SN YMI+FG++E+IFSQIPDFDQIWWLSIVAAVMSFT
Sbjct  169  SMTAIKRSNCFHASGGKDPCHISSNMYMIIFGIMEVIFSQIPDFDQIWWLSIVAAVMSFT  228

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYS  229
            YST+GL LG+ KVAENG+  GSL GISIGTV++       QK+WR  QALG IAFAYSYS
Sbjct  229  YSTVGLSLGIGKVAENGRFRGSLMGISIGTVTKAGTVTPTQKVWRNLQALGDIAFAYSYS  288

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +ILIEIQDT+KSPPAE+KTM+KATL+S+AVTTLFY++CGC GYAAFGD +PGNLLTGFGF
Sbjct  289  IILIEIQDTLKSPPAENKTMRKATLLSIAVTTLFYLLCGCMGYAAFGDDAPGNLLTGFGF  348

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WLLDIAN AIV+
Sbjct  349  YNPYWLLDIANLAIVV  364



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/325 (78%), Positives = 286/325 (88%), Gaps = 3/325 (1%)
 Frame = -1

Query  966  QKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
            ++ F+VS +  +   SK FDDDGRLKRTGT+WTASAHIITAVIGSGVLSLAWA AQLGW+
Sbjct  7    KQTFEVSNDTLQRVGSKSFDDDGRLKRTGTIWTASAHIITAVIGSGVLSLAWAIAQLGWI  66

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYA  616
            AGP VM+LFS VTYYTS LL+ CYRSGD + GKRNYTY  AVRS LG   VK CG +QYA
Sbjct  67   AGPVVMILFSIVTYYTSTLLATCYRSGDQLSGKRNYTYTQAVRSYLGGFSVKFCGWVQYA  126

Query  615  NLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFD  436
            NLFGVA+GYTIA+SISMMAIKRSNC+H+SGGKNPC++NSN YMI +GV EIIFSQIPDF 
Sbjct  127  NLFGVAIGYTIAASISMMAIKRSNCYHSSGGKNPCKMNSNWYMISYGVSEIIFSQIPDFH  186

Query  435  QIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALG  256
            ++WWLSIVAAVMSFTYS IGLGLG+ KV  NG++ GSLTG++IGTV+E QKIWRT QALG
Sbjct  187  ELWWLSIVAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTIGTVTESQKIWRTFQALG  246

Query  255  AIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
             IAFAYSYS+ILIEIQDT+KSPPAES+TM KATLISV VTT+FYM+CGCFGYA+FGD SP
Sbjct  247  NIAFAYSYSMILIEIQDTIKSPPAESETMSKATLISVLVTTVFYMLCGCFGYASFGDASP  306

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNPFWL+DIANA IVI
Sbjct  307  GNLLTGFGFYNPFWLIDIANAGIVI  331



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/345 (73%), Positives = 286/345 (83%), Gaps = 11/345 (3%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKV---FDVSINVGES-------KCFDDDGRLKRTGTVWTASAHIITA  853
             KMGE   A    Q      +VSI +G +       +C+DDDGRLKRTGTVWTASAHI+TA
Sbjct  17    KMGETGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAHIVTA  76

Query  852   VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
             VIGSGVLSLAWA AQLGWVAGP VMLLFSFVTYYTS LL++CYRSGDP+ GKRNY Y DA
Sbjct  77    VIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYKYTDA  136

Query  672   VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
             V S LG L+VK+CG IQYANLFGVAVGYTIA+SISMMAI+RSNCFH  G  NPC  +SNP
Sbjct  137   VHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPCHTSSNP  196

Query  492   YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
             YMIMFGV EI  SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +V  N    GSLTGI
Sbjct  197   YMIMFGVAEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKGFKGSLTGI  256

Query  312   SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVT  136
             SIG VS  QK+WR+ QA G IAFAYS+SLILIEIQDT+K+ PP+E+K MKKA+L S+AVT
Sbjct  257   SIGVVSPTQKVWRSLQAFGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASLTSIAVT  316

Query  135   TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             T+FYM+CGC GYAAFGD++PGNLLTGFGFYNP+WLLD+ANAAIV+
Sbjct  317   TIFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPYWLLDVANAAIVV  361



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   523 bits (1347),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 255/343 (74%), Positives = 293/343 (85%), Gaps = 10/343 (3%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKV----FDVSINVG----ESKCFDDDGRLKRTGTVWTASAHIITAVI  847
             KMGEN AA   HQ V     +VS+ +G     SKCFDDDGRLKRTGTVWTASAHIITAVI
Sbjct  3     KMGENGAANC-HQHVALAPVEVSVELGFQHGASKCFDDDGRLKRTGTVWTASAHIITAVI  61

Query  846   GSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVR  667
             GSGVLSLAWA  QLGWVAGP VMLLFSFVT+YTS LL++CYRSGDPV G+RNYTYMDAV+
Sbjct  62    GSGVLSLAWAIGQLGWVAGPAVMLLFSFVTFYTSALLADCYRSGDPVTGRRNYTYMDAVQ  121

Query  666   SNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYM  487
             +NL  ++VKICG +QY N+ GVA+GYTIA+SISM+AIKRSNCF+  G  +PC +NSNPYM
Sbjct  122   ANLNGIKVKICGYLQYLNIVGVAIGYTIAASISMVAIKRSNCFNKEGDDSPCHVNSNPYM  181

Query  486   IMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISI  307
             IMFGV EI+ SQIPDFDQI WLSI+AA+MSFTYS+IGL LG+ +V +NG + GSLTGISI
Sbjct  182   IMFGVAEIVLSQIPDFDQISWLSILAAIMSFTYSSIGLVLGIVQVIQNGGIKGSLTGISI  241

Query  306   GTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVK-SPPAESKTMKKATLISVAVTTL  130
             GTVS+M KIWR+ QA G IAFAYSYS+ILIEIQDT+K SP +E+K MKKATL SV VTT+
Sbjct  242   GTVSQMDKIWRSLQAFGDIAFAYSYSIILIEIQDTIKSSPSSEAKVMKKATLTSVTVTTI  301

Query  129   FYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FYM+CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  302   FYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANAAIVV  344



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   523 bits (1348),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 252/345 (73%), Positives = 286/345 (83%), Gaps = 11/345 (3%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKV---FDVSINVGES-------KCFDDDGRLKRTGTVWTASAHIITA  853
             +MGE   A    Q      +VSI +G +       +C+DDDGRLKRTGTVWTASAHI+TA
Sbjct  3     QMGETGNAKHYQQPAVVPMNVSIELGHAHRLEKAFECYDDDGRLKRTGTVWTASAHIVTA  62

Query  852   VIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDA  673
             VIGSGVLSLAWA AQLGWVAGP VMLLFSFVTYYTS LL++CYRSGDP+ GKRNY Y DA
Sbjct  63    VIGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTYYTSTLLADCYRSGDPISGKRNYKYTDA  122

Query  672   VRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNP  493
             V S LG L+VK+CG IQYANLFGVAVGYTIA+SISMMAI+RSNCFH  G  NPC  +SNP
Sbjct  123   VHSYLGGLKVKLCGFIQYANLFGVAVGYTIAASISMMAIRRSNCFHERGHDNPCHTSSNP  182

Query  492   YMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGI  313
             YMIMFGV EI  SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +V  N    GSLTGI
Sbjct  183   YMIMFGVAEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKGFKGSLTGI  242

Query  312   SIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVT  136
             SIG VS  QK+WR+ QA G IAFAYS+SLILIEIQDT+K+ PP+E+K MKKA+L S+AVT
Sbjct  243   SIGVVSPTQKVWRSLQAFGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASLTSIAVT  302

Query  135   TLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             T+FYM+CGC GYAAFGD++PGNLLTGFGFYNP+WLLD+ANAAIV+
Sbjct  303   TIFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPYWLLDVANAAIVV  347



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   523 bits (1347),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 246/329 (75%), Positives = 284/329 (86%), Gaps = 6/329 (2%)
 Frame = -1

Query  969  HQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAG  790
             Q+   +++    SKCFDDDGRLKRTGT+WTA++HIITAVIGSGVLSLAWA  QLGWVAG
Sbjct  36   QQEAEAINLQANYSKCFDDDGRLKRTGTLWTATSHIITAVIGSGVLSLAWAIGQLGWVAG  95

Query  789  PTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANL  610
            PTVMLLF+FV  YTS LLS+CYRSG+PV G RNYTYMDAV++ LG  +VKICG+IQY NL
Sbjct  96   PTVMLLFAFVILYTSNLLSQCYRSGNPVTGPRNYTYMDAVKATLGGRKVKICGLIQYINL  155

Query  609  FGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQI  430
            FGVA+GYTIA+S+SMMA+KRSNCFH S GK+PC + SN YMI FG++EIIFSQIPDFDQ+
Sbjct  156  FGVAIGYTIAASVSMMAVKRSNCFHESNGKDPCHMTSNGYMITFGIIEIIFSQIPDFDQV  215

Query  429  WWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTS  268
            WWLSIVAAVMSFTYST+GL LG+AKVAEN    GSL GISIGT++        QK+WR+ 
Sbjct  216  WWLSIVAAVMSFTYSTVGLSLGIAKVAENKSFRGSLIGISIGTITHAGTVTATQKLWRSL  275

Query  267  QALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFG  88
            QALGAIAFAYSYS+ILIEIQDT+K+PPAE KTMKKATLIS+A TT+FY++CGC GYAAFG
Sbjct  276  QALGAIAFAYSYSIILIEIQDTIKAPPAEYKTMKKATLISIATTTVFYLLCGCMGYAAFG  335

Query  87   DQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            D +PGNLLTGFGFYNP+WLLDIAN AIVI
Sbjct  336  DDAPGNLLTGFGFYNPYWLLDIANVAIVI  364



>emb|CDY43761.1| BnaA06g22970D [Brassica napus]
Length=466

 Score =   521 bits (1342),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 244/309 (79%), Positives = 274/309 (89%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGR KR+GTVWTASAHI+TAVIGSGVLSLAWA AQLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            + LLS+CYR+GDPV GKRNYTYMDAV+S LG  + KICG++Q+ NLFG  +GYTIASSIS
Sbjct  69   TTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTIASSIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ S I DFDQIWWLS VAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTIKDFDQIWWLSTVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S+IGL LG+ +VA NG   GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SSIGLALGIIQVAANGVFKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKNATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>ref|XP_004503904.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=486

 Score =   521 bits (1342),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 249/341 (73%), Positives = 286/341 (84%), Gaps = 8/341 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV--------GESKCFDDDGRLKRTGTVWTASAHIITAVIG  844
            M  N+  +  H + FD+  ++          SK +DDDGRLKRTG+VWTAS+HIITAVIG
Sbjct  1    MPGNSTTSLGHHQAFDIEGSMDGVVSHLDSTSKSYDDDGRLKRTGSVWTASSHIITAVIG  60

Query  843  SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
            SGVLSLAWA AQLGW+AGP VM+LFS VT YTS  L++CYRSGD   GKRNYTYMDAVRS
Sbjct  61   SGVLSLAWAIAQLGWIAGPAVMILFSMVTIYTSSFLADCYRSGDLNSGKRNYTYMDAVRS  120

Query  663  NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
             LG + V  CGI QY NLFG+ +GYTIA+SISM AIKRSNCFH SGGKNPC ++SN YMI
Sbjct  121  ILGGVNVTFCGIFQYLNLFGIVIGYTIAASISMTAIKRSNCFHQSGGKNPCHMSSNQYMI  180

Query  483  MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
            +FG+ EI  SQIPDFDQIWWLS VAA+MSFTYS IGL LG+AKVAENG ++GSLTGISIG
Sbjct  181  IFGITEIFLSQIPDFDQIWWLSSVAAIMSFTYSIIGLALGIAKVAENGSIMGSLTGISIG  240

Query  303  TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFY  124
            TVSE QKIWRTSQALG IAFAYSY+++LIEIQDT+KSPP+E+K+MKKAT IS+AVTT FY
Sbjct  241  TVSETQKIWRTSQALGDIAFAYSYAVVLIEIQDTLKSPPSEAKSMKKATKISIAVTTTFY  300

Query  123  MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            M+CGC GYAAFGD SPGNLLTGFGFYNP+WL+DIANAAIV+
Sbjct  301  MLCGCMGYAAFGDASPGNLLTGFGFYNPYWLIDIANAAIVV  341



>gb|KHG16478.1| Amino acid permease 2 -like protein [Gossypium arboreum]
Length=476

 Score =   521 bits (1341),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 249/333 (75%), Positives = 287/333 (86%), Gaps = 7/333 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MGEN        +VF  + ++ +S+CFDDDGRLKRTGT WTASAHIITAVIGSGVLSLAW
Sbjct  1    MGEN-------HRVFIDNPSLNDSQCFDDDGRLKRTGTFWTASAHIITAVIGSGVLSLAW  53

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGW+AGP VMLLFS +T+YTS LL++CYR+GDPV GKRNYTY  AV S LG  +VK
Sbjct  54   AIAQLGWIAGPAVMLLFSIITFYTSCLLTDCYRTGDPVSGKRNYTYTQAVGSLLGGYKVK  113

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG IQY NLFGV++GYTIA+SISMMAIKRSNCFH SGGKNPC ++S+PYM+MFGV EI+
Sbjct  114  VCGFIQYVNLFGVSIGYTIAASISMMAIKRSNCFHNSGGKNPCHMSSSPYMMMFGVAEIL  173

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
             SQIPDFDQIWWLSI+AAVMSFTYS IGL LG+AKV   G + GSLTGIS+GTV+  QKI
Sbjct  174  LSQIPDFDQIWWLSILAAVMSFTYSGIGLALGIAKVIGIGTIRGSLTGISLGTVTPAQKI  233

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            WR+ +ALG IAFAYS+S+ILIEIQDTVKSPPAE+KTMKKAT +S+A+TT FYM+CGC GY
Sbjct  234  WRSFRALGDIAFAYSFSMILIEIQDTVKSPPAEAKTMKKATKLSIAITTAFYMLCGCMGY  293

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            A+FGD +P NLLTGFGFYNPFWLLDIANAAIVI
Sbjct  294  ASFGDLAPDNLLTGFGFYNPFWLLDIANAAIVI  326



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   521 bits (1341),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/325 (76%), Positives = 286/325 (88%), Gaps = 3/325 (1%)
 Frame = -1

Query  966  QKVFDVS---INVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
            ++ F+VS   +  G SK FDDDGRLKRTGT+WTASAHI+TAVIGSGVLSLAWA AQLGW+
Sbjct  6    KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  65

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYA  616
            AGP VM+LFS VTYYTS LL+ CYRSGD + GKRNYTY  AVRSNLG L V  CG +QYA
Sbjct  66   AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  125

Query  615  NLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFD  436
            NLFGVA+GYTIA+SISMMA+KRSNC+H+SGGKNPC++NSN YMI +GV EIIFSQIPDF 
Sbjct  126  NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIPDFH  185

Query  435  QIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALG  256
            ++WWLSIVAAVMSFTYS IGLGLG+ KV  NG++ GSLTG+++GTV+E QKIWR+ QALG
Sbjct  186  ELWWLSIVAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTVGTVTESQKIWRSFQALG  245

Query  255  AIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
             IAFAYSYS+ILIEIQDT+KSPPAES+TM KATLISV +TT+FYM+CGCFGYA+FGD SP
Sbjct  246  NIAFAYSYSMILIEIQDTIKSPPAESQTMSKATLISVLITTVFYMLCGCFGYASFGDASP  305

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNP+WL+DIAN  IVI
Sbjct  306  GNLLTGFGFYNPYWLIDIANVGIVI  330



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   521 bits (1341),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 248/325 (76%), Positives = 286/325 (88%), Gaps = 3/325 (1%)
 Frame = -1

Query  966  QKVFDVS---INVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
            ++ F+VS   +  G SK FDDDGRLKRTGT+WTASAHI+TAVIGSGVLSLAWA AQLGW+
Sbjct  7    KQTFEVSNDTLQQGGSKSFDDDGRLKRTGTIWTASAHIVTAVIGSGVLSLAWAIAQLGWL  66

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYA  616
            AGP VM+LFS VTYYTS LL+ CYRSGD + GKRNYTY  AVRSNLG L V  CG +QYA
Sbjct  67   AGPIVMILFSIVTYYTSTLLACCYRSGDQLSGKRNYTYTQAVRSNLGGLAVMFCGWVQYA  126

Query  615  NLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFD  436
            NLFGVA+GYTIA+SISMMA+KRSNC+H+SGGKNPC++NSN YMI +GV EIIFSQIPDF 
Sbjct  127  NLFGVAIGYTIAASISMMAVKRSNCYHSSGGKNPCKMNSNWYMISYGVAEIIFSQIPDFH  186

Query  435  QIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALG  256
            ++WWLSIVAAVMSFTYS IGLGLG+ KV  NG++ GSLTG+++GTV+E QKIWR+ QALG
Sbjct  187  ELWWLSIVAAVMSFTYSFIGLGLGIGKVIGNGRIKGSLTGVTVGTVTESQKIWRSFQALG  246

Query  255  AIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
             IAFAYSYS+ILIEIQDT+KSPPAES+TM KATLISV +TT+FYM+CGCFGYA+FGD SP
Sbjct  247  NIAFAYSYSMILIEIQDTIKSPPAESQTMSKATLISVLITTVFYMLCGCFGYASFGDASP  306

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNP+WL+DIAN  IVI
Sbjct  307  GNLLTGFGFYNPYWLIDIANVGIVI  331



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   520 bits (1340),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 251/344 (73%), Positives = 286/344 (83%), Gaps = 11/344 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVF---DVSINVGES-------KCFDDDGRLKRTGTVWTASAHIITAV  850
            MGEN  A    Q  F    VS+ V  +       +C+DDDGR KRTGT+WTASAHI+TAV
Sbjct  1    MGENGGANCYQQLAFTPASVSVEVSHAHKLQEAFECYDDDGRAKRTGTLWTASAHIVTAV  60

Query  849  IGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAV  670
            IGSGVLSLAWA AQLGWVAGP VMLLFSFVT+YTS LL++CYRSGDP+ GKRNY+Y DAV
Sbjct  61   IGSGVLSLAWAIAQLGWVAGPVVMLLFSFVTHYTSTLLADCYRSGDPIAGKRNYSYTDAV  120

Query  669  RSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPY  490
             + LG L+VK+CG IQYANLFGVA+GYTIASSISMMAIKRSNCFH  G +NPC  +SNPY
Sbjct  121  HAYLGGLKVKLCGFIQYANLFGVAIGYTIASSISMMAIKRSNCFHERGHENPCHASSNPY  180

Query  489  MIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGIS  310
            MIMFG+ EI  SQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+ +V  N    GSLTGIS
Sbjct  181  MIMFGIAEIFLSQIPDFDQIWWLSIVAAVMSFTYSSIGLALGIVQVIANKGFKGSLTGIS  240

Query  309  IGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTT  133
            IG VS  QKIWR+ QALG IAFAYS+SLILIEIQDT+K+ PP+E+K MKKA+++S+AVTT
Sbjct  241  IGAVSPTQKIWRSLQALGDIAFAYSFSLILIEIQDTIKAPPPSEAKVMKKASVVSIAVTT  300

Query  132  LFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             FYM+CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  301  FFYMLCGCMGYAAFGDGAPGNLLTGFGFYNPYWLLDIANAAIVV  344



>gb|KCW70650.1| hypothetical protein EUGRSUZ_F03824 [Eucalyptus grandis]
Length=464

 Score =   519 bits (1337),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 282/325 (87%), Gaps = 3/325 (1%)
 Frame = -1

Query  966  QKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
             + F +S+++   G SK  DDDGR+KRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW+
Sbjct  8    NQAFGLSLDIPRQGSSKSLDDDGRVKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWI  67

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYA  616
            AGP VM LF+ VTYYTS LL+ CYRSGDP+ G+RNYTYMDAV +NLG  +VK+CG++QY 
Sbjct  68   AGPIVMFLFASVTYYTSTLLAACYRSGDPITGRRNYTYMDAVNANLGGFKVKLCGLVQYL  127

Query  615  NLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFD  436
            NLFGVA+GYT+ASS SMMAI RSNCFH  G KNPC  N  PYMI FG+ EIIFSQIP FD
Sbjct  128  NLFGVAIGYTMASSFSMMAIDRSNCFHKKGEKNPCHANGYPYMIAFGITEIIFSQIPSFD  187

Query  435  QIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALG  256
            Q+WWLSIVAA+MSFTYSTIGLGLG+AKVAE G++ GSLTGIS+G V+ MQK+WR+  ALG
Sbjct  188  QLWWLSIVAAIMSFTYSTIGLGLGIAKVAETGEIRGSLTGISVGNVTSMQKVWRSFMALG  247

Query  255  AIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
             IAFA SYSLILIEIQDTV+SPP+ES+TMK A+L+S+A+TTLFY++CGC GYAAFGD  P
Sbjct  248  DIAFANSYSLILIEIQDTVRSPPSESQTMKMASLVSIAITTLFYLLCGCMGYAAFGDMPP  307

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNP+W++DIANAA+VI
Sbjct  308  GNLLTGFGFYNPYWMVDIANAAVVI  332



>ref|XP_009150448.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   518 bits (1335),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 243/309 (79%), Positives = 273/309 (88%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGR KR+GTVWTASAHI+TAVIGSGVLSLAWA AQLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIAQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            + LLS+CYR+GDPV GKRNYTYMDAV+S LG  + KICG++Q+ NLFG  +GYTIASSIS
Sbjct  69   TTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTIASSIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKNPC ++SNPYMIMFGV EI+ S I DF QIWWLS VAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNPCHMSSNPYMIMFGVTEILLSTIKDFHQIWWLSTVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S+IGL LG+ +VA NG   GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SSIGLALGIIQVAANGVFKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKNATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>gb|AAX56951.1| amino acid transporter [Pisum sativum]
Length=482

 Score =   518 bits (1335),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 250/333 (75%), Positives = 288/333 (86%), Gaps = 4/333 (1%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVG-ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  817
            E  A+   H + FDVSI+   +SK FDDDGR+KRTGT WTASAH+ITAVIGSGVLSLAWA
Sbjct  4    EKNASKNHHHQTFDVSIDQQLDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWA  63

Query  816  TAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKI  637
             AQLGW+AGP VM+LF++VTYYTSVLL+ECYR+GDPV+GKRNYTYM+ V SNLG LQV+ 
Sbjct  64   IAQLGWIAGPVVMILFAWVTYYTSVLLAECYRNGDPVNGKRNYTYMEVVHSNLGGLQVQF  123

Query  636  CGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIF  457
            CG IQY NL GVA+GYT+AS+ISMMAI+RSNC+H SGGK+PC +NSN YMI FG V+II 
Sbjct  124  CGFIQYLNLIGVAIGYTVASAISMMAIERSNCYHRSGGKDPCHMNSNAYMIAFGAVQIIV  183

Query  456  SQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIW  277
            SQIPDFDQ+WWLSIVAAVMSFTYSTIGLGLG+ KV EN K  G++TG++   V++ QK W
Sbjct  184  SQIPDFDQLWWLSIVAAVMSFTYSTIGLGLGIGKVMENKKFAGTITGVN--DVTKAQKTW  241

Query  276  RTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
             + QALG IAFAYS+S+ILIEIQDTVK+ PP+ESKTMKKATLISV VTT FYM+CGC GY
Sbjct  242  GSLQALGDIAFAYSFSMILIEIQDTVKAPPPSESKTMKKATLISVIVTTFFYMLCGCLGY  301

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFG+ SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  302  AAFGNSSPGNLLTGFGFYNPFWLLDIANAAIVI  334



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   520 bits (1338),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 246/316 (78%), Positives = 279/316 (88%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKCFDDDGRLKRTGT WTA++HIITAVIGSGVLSLAWA  QLGWVAGP VMLLF+FV  Y
Sbjct  59   SKCFDDDGRLKRTGTFWTAASHIITAVIGSGVLSLAWAIGQLGWVAGPAVMLLFAFVNLY  118

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYR+GDPV G RNYTYMDAV++NLG  +V  CG+IQY NLFGVA+GYTIA+S+
Sbjct  119  TSNLLAQCYRTGDPVKGHRNYTYMDAVKANLGGKKVFFCGLIQYLNLFGVAIGYTIAASV  178

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCFHASGGK+PC ++SN YMI FG+ E+IFSQIPDFDQIWWLSIVAA+MSFT
Sbjct  179  SMMAIKRSNCFHASGGKDPCHMSSNGYMIAFGITEVIFSQIPDFDQIWWLSIVAAIMSFT  238

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYS  229
            YST+GLGLG+ KVA NG V GSLTGISIGTV+        QK+WR+ QALGAIAFAYSYS
Sbjct  239  YSTVGLGLGIGKVAGNGAVKGSLTGISIGTVTHAGLVTATQKLWRSFQALGAIAFAYSYS  298

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +ILIEIQDTVKSPPAE KTMKKAT  S+AVTT+FY++CGC GYAAFGD +PGNLLTGFGF
Sbjct  299  VILIEIQDTVKSPPAEYKTMKKATTFSIAVTTIFYLLCGCMGYAAFGDSAPGNLLTGFGF  358

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WLLDIAN AI++
Sbjct  359  YNPYWLLDIANIAIIV  374



>ref|NP_001067425.1| Os11g0195600 [Oryza sativa Japonica Group]
 gb|AAX96051.1| Transmembrane amino acid transporter protein [Oryza sativa Japonica 
Group]
 gb|ABA91874.1| amino acid carrier, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27788.1| Os11g0195600 [Oryza sativa Japonica Group]
 dbj|BAG90706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96629.1| unnamed protein product [Oryza sativa Japonica Group]
Length=476

 Score =   517 bits (1332),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 244/335 (73%), Positives = 287/335 (86%), Gaps = 2/335 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MG+ AA         +  + VG  +  DDDGR +R GTVWTASAHIITAVIGSGVLSLAW
Sbjct  1    MGKAAAMEVSASAAAEAGMMVGHGEWRDDDGRARRMGTVWTASAHIITAVIGSGVLSLAW  60

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGWVAGP VMLLF+FV YYTS LL+ECYRSGDP  GKRNYTYMDAVR+NLG  +V+
Sbjct  61   AIAQLGWVAGPAVMLLFAFVIYYTSTLLAECYRSGDPCTGKRNYTYMDAVRANLGGSKVR  120

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG+IQYANLFGVA+GYTIA+SISM+AIKR++CFH  G KNPC+ +SNPYMI+FGVV+I+
Sbjct  121  LCGVIQYANLFGVAIGYTIAASISMLAIKRADCFHEKGHKNPCRSSSNPYMILFGVVQIV  180

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQK  283
            FSQIPDFDQIWWLSIVAA+MSFTYSTIGL LG+A+   NG  +GSLTGIS+GT V+ MQK
Sbjct  181  FSQIPDFDQIWWLSIVAAIMSFTYSTIGLSLGIAQTVANGGFMGSLTGISVGTGVTSMQK  240

Query  282  IWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCF  106
            +WR+ QA G IAFAYSYS+ILIEIQDT+K+ PP+E+K MK+AT++SVA TT+FYM+CGC 
Sbjct  241  VWRSLQAFGDIAFAYSYSIILIEIQDTIKAPPPSEAKVMKRATMVSVATTTVFYMLCGCM  300

Query  105  GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GYAAFGD+SP NLLTGFGFY PFWLLD+ANAAIV+
Sbjct  301  GYAAFGDKSPDNLLTGFGFYEPFWLLDVANAAIVV  335



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   518 bits (1335),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 286/337 (85%), Gaps = 6/337 (2%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAT  814
            E  A    H     ++     SKCFDDDGRLKRTGT WTAS+HIITAVIGSGVLSLAWA 
Sbjct  28   EVEAQPKPHADSEAINPQTNYSKCFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWAI  87

Query  813  AQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKIC  634
             QLGWVAGPTVM+LF+FV +YT+ LLS+CYRSGDP+ G+RNYTYMD V++NLG  +V +C
Sbjct  88   GQLGWVAGPTVMVLFAFVNFYTTNLLSQCYRSGDPITGQRNYTYMDVVKANLGGKRVMLC  147

Query  633  GIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFS  454
            G+IQY NLFGVA+GYTIA+S+SMMAIKRSNCFH SGGK+PC ++SN +MI FGV+EI  S
Sbjct  148  GLIQYLNLFGVAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGFMITFGVMEIFLS  207

Query  453  QIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT------VSE  292
            QIPDFDQ+WWLSIVAA+MSFTYST+GLGLG+ KVAENG   GSLTGI IGT      V+ 
Sbjct  208  QIPDFDQVWWLSIVAAIMSFTYSTVGLGLGIDKVAENGNFKGSLTGIKIGTPTAAGVVTS  267

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             +K+WR+ QALGAIAFAYSYS+ILIEIQDTV+SPPAE KTMKKATL+S+ VTT+FYM+CG
Sbjct  268  TEKLWRSFQALGAIAFAYSYSVILIEIQDTVRSPPAEHKTMKKATLLSITVTTVFYMLCG  327

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD +PGN+LTGFGFY+P+WLLDIANAAIVI
Sbjct  328  CMGYAAFGDLAPGNILTGFGFYDPYWLLDIANAAIVI  364



>gb|KEH35329.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=409

 Score =   514 bits (1323),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 246/325 (76%), Positives = 283/325 (87%), Gaps = 4/325 (1%)
 Frame = -1

Query  969  HQKVFDVSINVG-ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            H + FDVSI+   +SK FDDDGR+KRTGT WTASAH+ITAVIGSGVLSLAWA AQLGW+A
Sbjct  10   HHQTFDVSIDQQRDSKFFDDDGRVKRTGTAWTASAHVITAVIGSGVLSLAWAIAQLGWIA  69

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VM+LF++VTYYTS+LL ECYR+GDP+ GKRNYTYMD V SNLG  QV +CGI+QY N
Sbjct  70   GPIVMILFAWVTYYTSILLCECYRTGDPISGKRNYTYMDVVHSNLGGFQVTLCGIVQYLN  129

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            L GVA+GYTIAS+ISMMAI+RSNCFH SGGK+PC +NSN YMI FG V+IIFSQIPDFDQ
Sbjct  130  LVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQIPDFDQ  189

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            IWWLS +A VMSF YSTIGLGLG+ KV EN K+ G++TG++   V++ QK+W + QALG 
Sbjct  190  IWWLSSLATVMSFIYSTIGLGLGIGKVIENKKIDGTVTGVT--DVTKAQKVWGSFQALGD  247

Query  252  IAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
            IAFAYSYS+ILIEIQDTVK+ PP E+KTMKKAT+ISVA TT FYM+CGCFGYAAFG+ SP
Sbjct  248  IAFAYSYSMILIEIQDTVKAPPPTEAKTMKKATIISVASTTFFYMLCGCFGYAAFGNSSP  307

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  308  GNLLTGFGFYNPFWLLDIANAAIVI  332



>emb|CDX84450.1| BnaC03g50500D [Brassica napus]
Length=466

 Score =   514 bits (1324),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 241/309 (78%), Positives = 272/309 (88%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGR KR+GTVWTASAHI+TAVIGSGVLSLAWA  QLGW+AGP VM LFSFVTYY+
Sbjct  9    KCFDDDGRPKRSGTVWTASAHILTAVIGSGVLSLAWAIGQLGWIAGPAVMFLFSFVTYYS  68

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            + LLS+CYR+GDPV GKRNYTYMDAV+S LG  + KICG++Q+ NLFG  +GYTIASSIS
Sbjct  69   TTLLSDCYRTGDPVSGKRNYTYMDAVQSILGGFRFKICGLMQFLNLFGTTIGYTIASSIS  128

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNCFH SGGKN C ++SNPYMIMFGV+EI+ S I DF QIWWLS VAA+MSFTY
Sbjct  129  MMAIKRSNCFHESGGKNLCHMSSNPYMIMFGVIEILLSTIKDFHQIWWLSTVAAIMSFTY  188

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEIQ  208
            S+IGL LG+ +VA NG   GSLTGISIG V++ QKIWRT QALG IAFAYSYS++LIEIQ
Sbjct  189  SSIGLALGIIQVAANGVFKGSLTGISIGAVTQTQKIWRTFQALGDIAFAYSYSVVLIEIQ  248

Query  207  DTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLL  28
            DTV+SPPAESKTMK AT IS+AVTT FYM+CGC GYAAFGD +PGNLLTGFGFYNPFWLL
Sbjct  249  DTVRSPPAESKTMKNATRISIAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLL  308

Query  27   DIANAAIVI  1
            D+ANAAIV+
Sbjct  309  DVANAAIVV  317



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   514 bits (1324),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 277/313 (88%), Gaps = 1/313 (0%)
 Frame = -1

Query  936  GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVT  757
            G SKC+DDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  QLGWVAGP  MLLFS+VT
Sbjct  8    GGSKCYDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAIGQLGWVAGPAAMLLFSYVT  67

Query  756  YYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIAS  577
            YYTS LL++CYRS DP++GKRNYTYMDAV++NL   +VK+CG IQYAN+FGV++GYTIA+
Sbjct  68   YYTSALLADCYRSCDPINGKRNYTYMDAVQANLNGFKVKLCGFIQYANIFGVSIGYTIAA  127

Query  576  SISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMS  397
            +ISM AIKRSNCFH  G  NPCQ++SNPYMI+FGV EI  SQIPDFDQIWWLSI+AAVMS
Sbjct  128  AISMTAIKRSNCFHEKGHSNPCQVSSNPYMIIFGVAEIFLSQIPDFDQIWWLSILAAVMS  187

Query  396  FTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILI  217
            FTYS+IGL LG+ +V +NG + GSLTGISI  VS   K+WR+ QA G IAFAYSYSLILI
Sbjct  188  FTYSSIGLTLGIVQVIKNGGIKGSLTGISIAVVSPADKVWRSLQAFGDIAFAYSYSLILI  247

Query  216  EIQDTVK-SPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNP  40
            EIQDT+K SPP+E+K MKKATL+SVAVTT+FYM+CGC GYAAFGD +PGNLLTGFGFY+P
Sbjct  248  EIQDTIKESPPSEAKVMKKATLLSVAVTTIFYMLCGCMGYAAFGDMAPGNLLTGFGFYDP  307

Query  39   FWLLDIANAAIVI  1
            +WLLDIANAAIVI
Sbjct  308  YWLLDIANAAIVI  320



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   514 bits (1325),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 242/334 (72%), Positives = 285/334 (85%), Gaps = 2/334 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            MGE+   A M +   ++  +   SKC+DDDGRLKRTGT+WTASAHIITAVIGSGVLSLAW
Sbjct  1    MGEHCYPATMEESSIELG-HTAASKCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLAW  59

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGWVAGP VMLLFSFVTYYTS LL++CYRSGDP  GKRNYTYMDAV +NL  ++V+
Sbjct  60   AIAQLGWVAGPAVMLLFSFVTYYTSALLADCYRSGDPCTGKRNYTYMDAVNANLSGIKVQ  119

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG +QYAN+ GVA+GYTIA+SISM+AIKR+NCFH  G  +PC I+S PYMI+FGV EI 
Sbjct  120  LCGFLQYANIVGVAIGYTIAASISMLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIF  179

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
            FSQIPDFDQI WLSI+AAVMSFTYSTIGLGLG+ +V  N  V GSLTGIS+G V+ + K+
Sbjct  180  FSQIPDFDQISWLSILAAVMSFTYSTIGLGLGIVQVVANKGVQGSLTGISVGAVTPLDKV  239

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFG  103
            WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVAVTTLFYM+CGC G
Sbjct  240  WRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATIVSVAVTTLFYMLCGCMG  299

Query  102  YAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            YAAFGD +PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  300  YAAFGDNAPGNLLTGFGFYEPFWLLDVANAAIVV  333



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   515 bits (1326),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 243/329 (74%), Positives = 285/329 (87%), Gaps = 6/329 (2%)
 Frame = -1

Query  969  HQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAG  790
            H +   ++     SKCFDDDGRLKRTGT WTAS+HIITAVIGSGVLSLAWA  QLGWVAG
Sbjct  36   HGESEAINPQANYSKCFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWAIGQLGWVAG  95

Query  789  PTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANL  610
            P VM+LF+FV  Y+S LL++CYRSGDP+ G+RNYTYM+AV++NLG  +V  CG IQY NL
Sbjct  96   PIVMILFAFVNLYSSNLLAQCYRSGDPLTGQRNYTYMEAVKANLGGKKVLACGWIQYLNL  155

Query  609  FGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQI  430
            FG A+GYTIA+S+SMMAIKRSNCFH SGGK+PC ++SN YMI FG++EIIFSQIPDFDQ+
Sbjct  156  FGTAIGYTIAASVSMMAIKRSNCFHKSGGKDPCHMSSNGYMITFGIIEIIFSQIPDFDQV  215

Query  429  WWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTS  268
            WWLSIVAA+MSFTYS++GLGLGVAKVAENG   GSLTGISIGTV+        QK+WR+ 
Sbjct  216  WWLSIVAAIMSFTYSSVGLGLGVAKVAENGSFKGSLTGISIGTVTHAGVVTSTQKLWRSL  275

Query  267  QALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFG  88
            QALGAIAFAYS+SLILIEIQDT+KSPPAE KTM+KAT++S+AVTT FYM+CGCFGYAAFG
Sbjct  276  QALGAIAFAYSFSLILIEIQDTIKSPPAEYKTMRKATVLSIAVTTAFYMLCGCFGYAAFG  335

Query  87   DQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            D +PGNLLTGFGFY+P+WLLDIAN AI++
Sbjct  336  DLAPGNLLTGFGFYDPYWLLDIANIAIIV  364



>emb|CAA70969.1| amino acid transporter [Solanum tuberosum]
Length=376

 Score =   509 bits (1312),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 271/290 (93%), Gaps = 1/290 (0%)
 Frame = -1

Query  867  HIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNY  688
            HIITAVIGSGVLSLAWATAQLGWVAGPTV+LLF FVTYYTS LLS+CYR+GDPV GKRNY
Sbjct  1    HIITAVIGSGVLSLAWATAQLGWVAGPTVLLLFFFVTYYTSALLSDCYRTGDPVTGKRNY  60

Query  687  TYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQ  508
            TYMDAVR+NLG  QVKICG+IQYANLFGVA+GYTIA+SISM+A+ RSNCFH  G +  C 
Sbjct  61   TYMDAVRANLGGFQVKICGVIQYANLFGVAIGYTIAASISMVAVNRSNCFHKQGHRAACN  120

Query  507  INSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLG  328
            ++S PYMI+FGV+EIIFSQIPDFDQI WLSIVAAVMSFTYSTIGLGLGVA+VAE GK+ G
Sbjct  121  VSSTPYMIIFGVMEIIFSQIPDFDQISWLSIVAAVMSFTYSTIGLGLGVAQVAETGKIEG  180

Query  327  SLTGISIGT-VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLI  151
            SLTGISIGT V+EMQKIWR+ QALGAIAFAYSYSLILIEIQDT+KSPPAE+KTMK+ATLI
Sbjct  181  SLTGISIGTEVTEMQKIWRSFQALGAIAFAYSYSLILIEIQDTLKSPPAEAKTMKRATLI  240

Query  150  SVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            SVAVTT+FYM+CGCFGYAAFGDQSPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  241  SVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANVAIVV  290



>gb|KEH35328.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=479

 Score =   513 bits (1320),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 241/324 (74%), Positives = 285/324 (88%), Gaps = 3/324 (1%)
 Frame = -1

Query  969  HQKVFDVSINVG-ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            H + FDVSI+   +SK FDDDGR+KRTGT WTASAH+ITAV+GSGVLSL+WA AQLGW+A
Sbjct  10   HHQTFDVSIDQQRDSKYFDDDGRIKRTGTAWTASAHVITAVVGSGVLSLSWAIAQLGWIA  69

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VM+LF++VTYYTS+LL ECYR+ DP++GKRNYTYMDAV SNLG  QV +CGI+QY N
Sbjct  70   GPIVMILFAWVTYYTSILLCECYRNDDPINGKRNYTYMDAVHSNLGGFQVTLCGIVQYLN  129

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            L G A+GYTIAS+ISMMAI+RSNCFH SGGK+PC +NSN YMI FG V+IIFSQIPDFDQ
Sbjct  130  LAGAAIGYTIASAISMMAIERSNCFHRSGGKDPCHMNSNIYMISFGAVQIIFSQIPDFDQ  189

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLS +AAVMSFTYSTIGLGLG+ KV  N K+ G++ G++   V++ QK+W + QALG 
Sbjct  190  LWWLSSLAAVMSFTYSTIGLGLGIGKVIGNKKIDGTMAGVT--DVTKAQKVWGSLQALGD  247

Query  252  IAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPG  73
            IAFAY+YS+ILIEIQDTVK+PP+E+KTMKKAT+ISVA TT+FYM+CGCFGYAAFG+ SPG
Sbjct  248  IAFAYAYSMILIEIQDTVKAPPSEAKTMKKATIISVAATTIFYMLCGCFGYAAFGNSSPG  307

Query  72   NLLTGFGFYNPFWLLDIANAAIVI  1
            NLLTGFGFYNPFWLLDIANAAIVI
Sbjct  308  NLLTGFGFYNPFWLLDIANAAIVI  331



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   512 bits (1319),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 249/329 (76%), Positives = 285/329 (87%), Gaps = 4/329 (1%)
 Frame = -1

Query  981  AAAMHQKVFDVSINVG-ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQL  805
            A+  H + F VSI+   +SK FDDDGR+KRTGT WTASAH+ITAVIGSGVLSLAWA AQL
Sbjct  7    ASNNHHQTFYVSIDQQIDSKFFDDDGRVKRTGTSWTASAHVITAVIGSGVLSLAWAIAQL  66

Query  804  GWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGII  625
            GW+AGP VM LF++VTYYTSVLL ECYR+GDPV+GKRNYTYM+ V SNLG  QV++CG+I
Sbjct  67   GWIAGPIVMFLFAWVTYYTSVLLCECYRNGDPVNGKRNYTYMEVVHSNLGGFQVQLCGLI  126

Query  624  QYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIP  445
            QY NL GVA+GYT+AS+ISMMAI RSNCFH SGGK+PC +NSN YMI FG V+IIFSQIP
Sbjct  127  QYLNLVGVAIGYTVASAISMMAIVRSNCFHRSGGKDPCHMNSNIYMIAFGAVQIIFSQIP  186

Query  444  DFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQ  265
            DFDQ+WWLSIVA VMSFTYSTIGLGLG+ KV EN K  G++TGI+   V++ QK W + Q
Sbjct  187  DFDQLWWLSIVAVVMSFTYSTIGLGLGIGKVIENKKFAGTITGIN--DVTKAQKTWGSLQ  244

Query  264  ALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFG  88
            ALG IAFAYS+S+ILIEIQDT+K+ PP+ESKTMKKATLISV VTT FYM+CGCFGYAAFG
Sbjct  245  ALGDIAFAYSFSMILIEIQDTIKAPPPSESKTMKKATLISVIVTTFFYMLCGCFGYAAFG  304

Query  87   DQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            + SPGNLLTGFGFYNPFWLLDIANAAIVI
Sbjct  305  NSSPGNLLTGFGFYNPFWLLDIANAAIVI  333



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   513 bits (1322),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 241/330 (73%), Positives = 289/330 (88%), Gaps = 8/330 (2%)
 Frame = -1

Query  966  QKVFDVSINVGE--SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            Q+    +IN+ E  SKCFDDDGRLKRTGT+WTA++HIITAVIGSGVLSLAWA  QLGWVA
Sbjct  36   QETESRAINLQENYSKCFDDDGRLKRTGTLWTATSHIITAVIGSGVLSLAWAVGQLGWVA  95

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VM+LF+FV  YTS LLS+CYRSGDPV G+RNYTYMDAV++NLG ++VKICG+IQY N
Sbjct  96   GPIVMILFAFVNLYTSDLLSKCYRSGDPVVGQRNYTYMDAVKANLGGVKVKICGLIQYIN  155

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIA+S+SM+AIKRSNCFH +  K+ C ++SN YMI FG++EI+FSQIPDFDQ
Sbjct  156  LFGVAIGYTIAASVSMLAIKRSNCFHKTHKKSRCHMSSNGYMITFGIIEILFSQIPDFDQ  215

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRT  271
            +WWLSIVAA+MSFTYSTIGL LG+ +VAEN  + GSLTGI+IGT++        QK+WR+
Sbjct  216  VWWLSIVAAIMSFTYSTIGLALGIVQVAENKSIKGSLTGITIGTITHAGTVTPTQKMWRS  275

Query  270  SQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAF  91
             QALGAIAFAYSYS+ILIEIQDT+KSPPAE KTMKKAT IS+AVTT+FY++CGC GYAAF
Sbjct  276  LQALGAIAFAYSYSIILIEIQDTIKSPPAEHKTMKKATSISIAVTTIFYLLCGCMGYAAF  335

Query  90   GDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GDQ+PGNLLTGFGF++P+WLLDIAN +IV+
Sbjct  336  GDQAPGNLLTGFGFFDPYWLLDIANVSIVV  365



>ref|XP_007041865.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007041866.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97696.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97697.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=512

 Score =   512 bits (1318),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/349 (70%), Positives = 286/349 (82%), Gaps = 8/349 (2%)
 Frame = -1

Query  1029  SQRKES*NMKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAV  850
              +R +  +    E    A    +  D   N   SKCFDDDGRLKRTGT WTA++HIITAV
Sbjct  18    EERHDIRHYLQVEVQPKAQNESEAMDPQAN--HSKCFDDDGRLKRTGTFWTATSHIITAV  75

Query  849   IGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAV  670
             IGSGVLSLAWA AQLGWVAGPTV++LF+FV  YTS LL+ECYRSGDP+ G+RNYTYM+AV
Sbjct  76    IGSGVLSLAWAIAQLGWVAGPTVLVLFAFVNLYTSNLLTECYRSGDPITGQRNYTYMEAV  135

Query  669   RSNLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPY  490
             +++LG  +VK+CG IQY NLFGVAVGYTIA+S+SMMAIKR+NC H SGG +PC ++SN Y
Sbjct  136   KAHLGGWKVKLCGWIQYLNLFGVAVGYTIAASVSMMAIKRANCLHKSGGTDPCHMSSNGY  195

Query  489   MIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGIS  310
             MI FG+ E+IFSQIPDF  +WWLSIVAA+MSFTYS +GL LG+ KVAE+GK+ GSL GIS
Sbjct  196   MISFGIAEVIFSQIPDFSHVWWLSIVAAIMSFTYSAVGLALGIGKVAEHGKIDGSLLGIS  255

Query  309   IGTVSE------MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLIS  148
             IGTV+       MQKIWRT QALGAIAFAYSYS+ILIEIQDTVKSPPAE KTMKKATL S
Sbjct  256   IGTVTHAGTVTGMQKIWRTLQALGAIAFAYSYSIILIEIQDTVKSPPAEYKTMKKATLFS  315

Query  147   VAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             + VTT+FY+ CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  316   ITVTTVFYLFCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANLAIVV  364



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   510 bits (1314),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/333 (73%), Positives = 279/333 (84%), Gaps = 3/333 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            M   A       + FD+    GE    DDDGRLKRTG+VWTAS+HIITAVIGSGVLSLAW
Sbjct  1    MTVKATPTTTSLRTFDIE---GELISHDDDGRLKRTGSVWTASSHIITAVIGSGVLSLAW  57

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGW+AGP VM+LFS VT  TS  L++CYR+GDP  GKRNYTYMDAVRS LG  +V 
Sbjct  58   AIAQLGWIAGPAVMILFSLVTVSTSSFLADCYRAGDPHSGKRNYTYMDAVRSILGGAKVT  117

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
             CGI QY NLFG+ +GYTIA+SISM AIK+SNCFH  G K+PC ++SN YMIMFGV++I 
Sbjct  118  FCGIFQYLNLFGIVIGYTIAASISMTAIKKSNCFHQHGDKSPCHMSSNLYMIMFGVIQIF  177

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKI  280
             SQIPDFDQIWWLS VAAVMSFTYS IGL LG+AKVAENG +LGSLTGISIG VSE QKI
Sbjct  178  LSQIPDFDQIWWLSSVAAVMSFTYSLIGLALGIAKVAENGTILGSLTGISIGAVSETQKI  237

Query  279  WRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            WRTSQALG IAFAYSY+++LIEIQDT+KSPP+E+K+MKKAT IS+AVTT+FYM+CGC GY
Sbjct  238  WRTSQALGNIAFAYSYAVVLIEIQDTLKSPPSEAKSMKKATKISIAVTTVFYMLCGCMGY  297

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +PGNLLTGFGFYNP+WL+DIANAAIV+
Sbjct  298  AAFGDDAPGNLLTGFGFYNPYWLIDIANAAIVV  330



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   510 bits (1313),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 244/342 (71%), Positives = 284/342 (83%), Gaps = 9/342 (3%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV--------GESKCFDDDGRLKRTGTVWTASAHIITAVIG  844
            MGEN      +      ++ V          SKC+DDDGRLKRTGT+WTASAHIITAVIG
Sbjct  1    MGENVVPKHCYPAAAAAAMEVTSVELGHTAASKCYDDDGRLKRTGTMWTASAHIITAVIG  60

Query  843  SGVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRS  664
            SGVLSLAWA AQLGWVAGPTVMLLFSFVTYYTS LL++CYRSGDP  GKRNYTYMDAV +
Sbjct  61   SGVLSLAWAIAQLGWVAGPTVMLLFSFVTYYTSALLADCYRSGDPCTGKRNYTYMDAVNA  120

Query  663  NLGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMI  484
            NL  ++V+ICG +QYAN+ GVA+GYTIA+SISM+AIK++NCFH  G  +PC I+S PYMI
Sbjct  121  NLSGIKVQICGFLQYANIVGVAIGYTIAASISMLAIKKANCFHVEGHGDPCSISSTPYMI  180

Query  483  MFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG  304
            +FGV EI FSQIPDFDQI WLSI+AAVMSFTYSTIGLGLG+ +V  N  V GSLTGISIG
Sbjct  181  IFGVAEIFFSQIPDFDQISWLSILAAVMSFTYSTIGLGLGIVQVVANKGVQGSLTGISIG  240

Query  303  TVSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLF  127
             V+ + K+WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVAVTTLF
Sbjct  241  AVTPIDKVWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVAVTTLF  300

Query  126  YMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            YM+CGC GYAAFGD +PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  301  YMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAAIVV  342



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   509 bits (1311),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 243/322 (75%), Positives = 279/322 (87%), Gaps = 4/322 (1%)
 Frame = -1

Query  957  FDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
            F VS++V     S  FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQLGWVAGP
Sbjct  11   FGVSMDVLPKNRSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGP  70

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
             VM LFS VTYYTS+LL  CYRSGD V GKRNYTYMDAV++NLG ++VK+CG++QY NLF
Sbjct  71   AVMFLFSLVTYYTSILLCSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGLVQYLNLF  130

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            G A+GYTIAS++SM+AI+RSNC H S GK+PC IN NPYMI FGV +I+FSQIPDFD++W
Sbjct  131  GTAIGYTIASAVSMIAIQRSNCHHKSHGKDPCHINGNPYMIAFGVAQIVFSQIPDFDRLW  190

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIA  247
            WLSIVAAVMSF YS+IGL LGV+KVAEN ++ GSLTGI +GTV+  QK+WR+ QALG IA
Sbjct  191  WLSIVAAVMSFMYSSIGLALGVSKVAENKEIKGSLTGIGVGTVTPSQKVWRSFQALGNIA  250

Query  246  FAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNL  67
            FAYSYS+ILIEIQDT+KSPP E KTM+KATLISVAVTTLFYM+CGC GYAAFGD SPGNL
Sbjct  251  FAYSYSMILIEIQDTLKSPPVEEKTMRKATLISVAVTTLFYMLCGCIGYAAFGDTSPGNL  310

Query  66   LTGFGFYNPFWLLDIANAAIVI  1
            L+G GF+NP+WL+DIAN  IVI
Sbjct  311  LSG-GFFNPYWLIDIANLTIVI  331



>emb|CAN65437.1| hypothetical protein VITISV_038918 [Vitis vinifera]
Length=487

 Score =   509 bits (1311),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 252/340 (74%), Positives = 282/340 (83%), Gaps = 8/340 (2%)
 Frame = -1

Query  999  MGENAAAA---AMHQKVFDVSINV----GESKCFDDDGRLKRTGTVWTASAHIITAVIGS  841
            MGENAA       H +VFD+SI+V      SKCFDDDGRLKRTGTVWTASAHIITAVIGS
Sbjct  1    MGENAATKNHHHHHHQVFDISIDVLPHQNTSKCFDDDGRLKRTGTVWTASAHIITAVIGS  60

Query  840  GVLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSN  661
            GVLSLAWA AQLGW+AGP VM LFSFV YYTS LL++CYRSGD V GKRNYTYMDAVRSN
Sbjct  61   GVLSLAWAIAQLGWIAGPAVMFLFSFVIYYTSSLLADCYRSGDRVSGKRNYTYMDAVRSN  120

Query  660  LGSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIM  481
            LG ++VK+CG+IQY N+FGVA+GYTIA+SISMMA+KRSNCFH SGGKNPC I+S PYMIM
Sbjct  121  LGGVKVKVCGLIQYLNIFGVAIGYTIAASISMMAVKRSNCFHESGGKNPCHISSYPYMIM  180

Query  480  FGVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT  301
            FG+ EI FSQIPDFDQIWWLSIV       Y         +  +  G   GSLTGISIGT
Sbjct  181  FGIAEIAFSQIPDFDQIWWLSIVGR-GHVLYLLFNRSCTWSCQSSAGGFKGSLTGISIGT  239

Query  300  VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYM  121
            V++ QKIWR+ QALG IAFAYSYS+ILIEIQDT+KSPP+ESKTMKKATL+S+AVTT FYM
Sbjct  240  VTQTQKIWRSFQALGDIAFAYSYSIILIEIQDTLKSPPSESKTMKKATLVSIAVTTAFYM  299

Query  120  MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +CGC GYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  300  LCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  339



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   509 bits (1310),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 244/339 (72%), Positives = 283/339 (83%), Gaps = 5/339 (1%)
 Frame = -1

Query  1002  KMGENAAAAAMHQKVFDVS-INVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
             +MGEN      +    +VS +  G    SKC+DDDGRLKRTGT+WTASAHIITAVIGSGV
Sbjct  6     EMGENGVGRQPYYPAMEVSGVENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGV  65

Query  834   LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
             LSL WA AQLGWVAGP VMLLFS VTYYTS LLS+CYRSGD   GKRNYTYMDAV +NL 
Sbjct  66    LSLGWAIAQLGWVAGPAVMLLFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLS  125

Query  654   SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              ++V+ICG +QYAN+ GVA+GYTIA+SISM+AIKR+NCFHA G  NPC I+S PYMI+FG
Sbjct  126   GIKVQICGFLQYANIVGVAIGYTIAASISMLAIKRANCFHAKGHVNPCHISSTPYMIIFG  185

Query  474   VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
               +I FSQIPDFDQI WLSIVAA+MSFTYSTIGLGLG+ +V  N  V GSLTGISIG V+
Sbjct  186   AAQIFFSQIPDFDQISWLSIVAAIMSFTYSTIGLGLGIVQVVANRGVKGSLTGISIGVVT  245

Query  294   EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMM  118
              M K+WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVA TTLFYM+
Sbjct  246   PMDKVWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYML  305

Query  117   CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             CGC GYAAFGD++PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  306   CGCMGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAAIVV  344



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   508 bits (1309),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/338 (72%), Positives = 282/338 (83%), Gaps = 5/338 (1%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVS-INVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MGEN      +    +VS +  G    SKC+DDDGRLKRTGT+WTASAHIITAVIGSGVL
Sbjct  1    MGENGVGRQPYYPAMEVSGVENGHTAGSKCYDDDGRLKRTGTMWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SL WA AQLGWVAGP VMLLFS VTYYTS LLS+CYRSGD   GKRNYTYMDAV +NL  
Sbjct  61   SLGWAIAQLGWVAGPAVMLLFSLVTYYTSALLSDCYRSGDETTGKRNYTYMDAVNANLSG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
            ++V+ICG +QYAN+ GVA+GYTIA+SISM+AIKR+NCFHA G  NPC I+S PYMI+FG 
Sbjct  121  IKVQICGFLQYANIVGVAIGYTIAASISMLAIKRANCFHAKGHVNPCHISSTPYMIIFGA  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             +I FSQIPDFDQI WLSIVAA+MSFTYSTIGLGLG+ +V  N  V GSLTGISIG V+ 
Sbjct  181  AQIFFSQIPDFDQISWLSIVAAIMSFTYSTIGLGLGIVQVVANRGVKGSLTGISIGVVTP  240

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMC  115
            M K+WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVA TTLFYM+C
Sbjct  241  MDKVWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYMLC  300

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD++PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  301  GCMGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAAIVV  338



>ref|XP_010530203.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
 ref|XP_010530205.1| PREDICTED: amino acid permease 5 [Tarenaya hassleriana]
Length=480

 Score =   508 bits (1308),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 280/322 (87%), Gaps = 4/322 (1%)
 Frame = -1

Query  957  FDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
            F VSI+V     S  FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQLGWVAGP
Sbjct  11   FVVSIDVLPKSSSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAMAQLGWVAGP  70

Query  786  TVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLF  607
             VM LFS VTYYTS+LLS CYRSGD V GKRNYTYMDAV++NLG ++VK+CG++QY NLF
Sbjct  71   AVMFLFSLVTYYTSILLSSCYRSGDSVSGKRNYTYMDAVQANLGGVKVKLCGLVQYLNLF  130

Query  606  GVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIW  427
            G A+GYTIAS+ISM+AI+RSNC H S GK+PC IN NPYMI FGV +I+FSQIPDFDQ+W
Sbjct  131  GTAIGYTIASAISMIAIQRSNCHHRSHGKDPCHINGNPYMIAFGVAQIVFSQIPDFDQLW  190

Query  426  WLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIA  247
            WLSI+AAVMSFTYS+IGL LG++KV EN +V GSLTGI +GTV+  QK+WR+ QALG +A
Sbjct  191  WLSILAAVMSFTYSSIGLALGISKVTENKEVKGSLTGIGLGTVTPAQKVWRSFQALGNVA  250

Query  246  FAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNL  67
            FAYSYS+ILIEIQDT+KS PAE KTM+KATLISVAVTT+FYM+CGC GYAAFGD SPGNL
Sbjct  251  FAYSYSVILIEIQDTLKSSPAEEKTMRKATLISVAVTTMFYMLCGCIGYAAFGDMSPGNL  310

Query  66   LTGFGFYNPFWLLDIANAAIVI  1
            L+G GF++P+WLLDIAN  IVI
Sbjct  311  LSG-GFFSPYWLLDIANLTIVI  331



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   509 bits (1311),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 239/339 (71%), Positives = 287/339 (85%), Gaps = 16/339 (5%)
 Frame = -1

Query  969  HQKVFDVSINVGESK----------CFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            H    +V   V ESK          CFDDDGRLKRTGT WT+++HIITAVIGSGVLSLAW
Sbjct  28   HYLQVEVQPKVSESKAINPQSNYSTCFDDDGRLKRTGTFWTSASHIITAVIGSGVLSLAW  87

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGWVAGPTV+LLF+FV  YTS LL+ CYR+G+P+ G+RNYTYMDAV++NLG  +V 
Sbjct  88   AIAQLGWVAGPTVLLLFAFVNLYTSNLLAMCYRTGNPITGQRNYTYMDAVKANLGGRKVM  147

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG++QY NLFGVA+GYTIASS+SMMAIKRSNC+H SGG++PC ++SN YMI FG++E+I
Sbjct  148  MCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHRSGGRDPCHMSSNGYMITFGIIEVI  207

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE----  292
            FSQIPDF+Q+WWLSIVAA+MSFTYS++GLGLG+ KVA NG   GSL GISIGTV++    
Sbjct  208  FSQIPDFNQVWWLSIVAAIMSFTYSSVGLGLGIXKVAGNGSFKGSLLGISIGTVTKSGTV  267

Query  291  --MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMM  118
               QKIWR+ QALGAIAFAYSYSL+LIEIQDT++SPP E KTMKKAT+ S+A+TT+FY++
Sbjct  268  TSTQKIWRSMQALGAIAFAYSYSLVLIEIQDTIRSPPXEHKTMKKATVFSIAITTVFYLL  327

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGCFGYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  328  CGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  366



>ref|XP_007137460.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
 gb|ESW09454.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
Length=487

 Score =   508 bits (1308),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 241/327 (74%), Positives = 286/327 (87%), Gaps = 5/327 (2%)
 Frame = -1

Query  966  QKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
            Q+ F VS+++   G+SKCFDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQLGW+
Sbjct  13   QETFSVSLDMHEQGDSKCFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWI  72

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG--SLQVKICGIIQ  622
            AGP VMLLFS +TY+TS+LL++CYR+GDP+ GKRNYTYMDA+RSN G    +VK+CG++Q
Sbjct  73   AGPAVMLLFSAITYFTSLLLTDCYRTGDPLTGKRNYTYMDAIRSNFGGNDFKVKMCGLVQ  132

Query  621  YANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPD  442
            Y NLFG+++GYTIA+SISMMAI+RS+CFH +GGK+ C++NSN YMI FG+VE+IFSQIPD
Sbjct  133  YVNLFGISIGYTIAASISMMAIERSDCFHKNGGKSHCRMNSNMYMISFGIVEMIFSQIPD  192

Query  441  FDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQA  262
            FDQ+WWLSIVAAVMS TYSTIGLG+G+ KV  N ++ G +TGI +GTV++  KI R  QA
Sbjct  193  FDQLWWLSIVAAVMSVTYSTIGLGMGIGKVIGNRRIKGGVTGIIVGTVTKPDKILRAMQA  252

Query  261  LGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQ  82
            +G IAFAYSYS ILIEIQDTVKSPP+ SKTMKK+ LI VAVTT FYM+CGC GYAAFGD 
Sbjct  253  VGNIAFAYSYSFILIEIQDTVKSPPSASKTMKKSALIGVAVTTFFYMLCGCSGYAAFGDL  312

Query  81   SPGNLLTGFGFYNPFWLLDIANAAIVI  1
            SPGNLLTGFGFYNP+WLLDIANAAIV+
Sbjct  313  SPGNLLTGFGFYNPYWLLDIANAAIVV  339



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   508 bits (1307),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 240/327 (73%), Positives = 279/327 (85%), Gaps = 8/327 (2%)
 Frame = -1

Query  957  FDVSINVGE-------SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGW  799
             DVS+ +G        +K +DDDGRLKRTGTVWTA+AHI+TAVIGSGVLSLAW  AQLGW
Sbjct  11   LDVSVELGHEHQLQGATKSYDDDGRLKRTGTVWTATAHIVTAVIGSGVLSLAWTIAQLGW  70

Query  798  VAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQY  619
            VAGP VM LFSFVTYYTS LL++CYRSGDP++GKRNY Y DAV + LG L+VK+CG IQY
Sbjct  71   VAGPVVMFLFSFVTYYTSTLLADCYRSGDPINGKRNYNYTDAVHAYLGGLKVKLCGFIQY  130

Query  618  ANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDF  439
            ANLFGVA+GYTIA+SISMMAIKRS+CFH  G KNPC  +SNPYMIMFGV EI  SQIPDF
Sbjct  131  ANLFGVAIGYTIAASISMMAIKRSDCFHEKGHKNPCLTSSNPYMIMFGVAEIFLSQIPDF  190

Query  438  DQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQAL  259
            DQIWWLSIVAAVMSFTYS+IGL LG+ +V  N    GSLTGISIG +S  QKIWR+ +AL
Sbjct  191  DQIWWLSIVAAVMSFTYSSIGLALGIVQVIGNKSFKGSLTGISIGVISPTQKIWRSLKAL  250

Query  258  GAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQ  82
            G IAFAYS+S++LIEIQDT+++ PP+E+K MKKA+L+S+ VTTLFYM+CGC GYAAFGD 
Sbjct  251  GDIAFAYSFSVVLIEIQDTIRAPPPSEAKVMKKASLLSIVVTTLFYMLCGCMGYAAFGDS  310

Query  81   SPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +PGNLLTGFGFYNP+WLL+IANAAIV+
Sbjct  311  APGNLLTGFGFYNPYWLLNIANAAIVV  337



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   509 bits (1310),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 240/316 (76%), Positives = 277/316 (88%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SK FDDDGRLKRTGT WTAS+HIITAVIGSGVLSLAW   QLGW+AGP VM+LF+FV  Y
Sbjct  50   SKLFDDDGRLKRTGTFWTASSHIITAVIGSGVLSLAWGVGQLGWIAGPAVMILFAFVIQY  109

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LLS+CYR+GDPV GKRNYTYMDAV +NLG  +VKICG IQY NLFGVA+GYTIA+SI
Sbjct  110  TSNLLSDCYRTGDPVTGKRNYTYMDAVGANLGGAKVKICGAIQYVNLFGVAIGYTIAASI  169

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCFHASGGK+PC ++SN YMI+FG++E+I SQIPDFDQ+ WLSIVAAVMS T
Sbjct  170  SMMAIKRSNCFHASGGKDPCHVSSNIYMIIFGIIEVILSQIPDFDQVSWLSIVAAVMSLT  229

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYS  229
            YST+GL LG+A VAENG + G+L GI+IGTV++       QK+WR  QALG IAFAYS+S
Sbjct  230  YSTVGLSLGIANVAENGSIRGNLMGINIGTVTKAGTVTATQKVWRNLQALGDIAFAYSFS  289

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +ILIEIQDT+KSPPAE+KTMKKATL+S+AVTT+FY++CGC GYAAFGD  PGNLLTGFGF
Sbjct  290  MILIEIQDTLKSPPAENKTMKKATLVSIAVTTIFYLLCGCMGYAAFGDDVPGNLLTGFGF  349

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WLLDIAN AIV+
Sbjct  350  YNPYWLLDIANLAIVV  365



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   508 bits (1308),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 279/315 (89%), Gaps = 6/315 (2%)
 Frame = -1

Query  927  KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYYT  748
            KCFDDDGRLKRTGT WT+++HIITAVIGSGVLSLAWA AQLGWVAGP+V+LLF+ V  YT
Sbjct  49   KCFDDDGRLKRTGTFWTSASHIITAVIGSGVLSLAWAIAQLGWVAGPSVLLLFALVNLYT  108

Query  747  SVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSIS  568
            S LL+ CYRSGDPV G+RNYTYMDA+++NLG  +V +CG++QY NLFGVA+GYTIASS+S
Sbjct  109  SNLLAMCYRSGDPVTGQRNYTYMDAIKANLGGRKVMLCGLVQYFNLFGVAIGYTIASSVS  168

Query  567  MMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFTY  388
            MMAIKRSNC+H SGGK+PC ++SN YMI FG++E+IFSQIPDF+Q+WWLSIVAAVMSFTY
Sbjct  169  MMAIKRSNCYHKSGGKDPCHMSSNGYMITFGIIEVIFSQIPDFNQVWWLSIVAAVMSFTY  228

Query  387  STIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYSL  226
            S++GLGLG+ K+  NG   GSL GISIGTV+        QK+WR+ QALGAIAFAYSYSL
Sbjct  229  SSVGLGLGIGKIVGNGGFKGSLLGISIGTVTHAGTVTPTQKMWRSMQALGAIAFAYSYSL  288

Query  225  ILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFY  46
            +LIEIQDT++SPPAE KTMKKAT+ S+A+TT+FY++CGCFGYAAFGD +PGNLLTGFGFY
Sbjct  289  VLIEIQDTIRSPPAEHKTMKKATVFSIALTTVFYLLCGCFGYAAFGDLAPGNLLTGFGFY  348

Query  45   NPFWLLDIANAAIVI  1
            NP+WLLDIAN AIV+
Sbjct  349  NPYWLLDIANVAIVV  363



>gb|KHN25477.1| Amino acid permease 2 [Glycine soja]
Length=513

 Score =   508 bits (1307),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 239/323 (74%), Positives = 281/323 (87%), Gaps = 6/323 (2%)
 Frame = -1

Query  951  VSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLL  772
            ++I    SKCFDDDGRLKRTGT WTA+AHIITAVIGSGVLSLAWA AQLGWVAGP VM L
Sbjct  43   MNIQSNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAVAQLGWVAGPVVMFL  102

Query  771  FSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVG  592
            F+ V  YTS LL++CYR+GD V+G RNYTYM+AV+S LG  +VK+CG+IQY NLFGVA+G
Sbjct  103  FAVVNLYTSNLLTQCYRTGDSVNGHRNYTYMEAVKSILGGKKVKLCGLIQYINLFGVAIG  162

Query  591  YTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIV  412
            YTIA+S+SMMAIKRSNC+H+S GK+PC ++SN YMI FG+ E+IFSQIPDFDQ+WWLSIV
Sbjct  163  YTIAASVSMMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIV  222

Query  411  AAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAI  250
            AA+MSFTYS++GL LGVAKVAEN    GSL GISIGTV++       QKIWR+ QALGA+
Sbjct  223  AAIMSFTYSSVGLSLGVAKVAENKTFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAM  282

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYS+S+ILIEIQDT+KSPPAE KTM+KAT +S+AVTT+FY++CGC GYAAFGD +PGN
Sbjct  283  AFAYSFSIILIEIQDTIKSPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGN  342

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN AIVI
Sbjct  343  LLTGFGFYNPYWLLDIANLAIVI  365



>ref|XP_004289864.1| PREDICTED: amino acid permease 2-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   507 bits (1306),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 241/340 (71%), Positives = 284/340 (84%), Gaps = 17/340 (5%)
 Frame = -1

Query  969  HQKVFDVSINVGES----------KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAW  820
            H    +V   VGES          KCFDDDGRLKRTGT WT+++HIITAVIGSGVLSLAW
Sbjct  25   HYLQVEVQPKVGESEAINPQSNYSKCFDDDGRLKRTGTFWTSTSHIITAVIGSGVLSLAW  84

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQLGWVAGPTV+ LF+ V  YTS LL+ CYR+GDPV G+RNYTYMDAV++NLG  +V 
Sbjct  85   AIAQLGWVAGPTVLALFAIVNLYTSNLLAMCYRAGDPVTGQRNYTYMDAVKANLGGRRVM  144

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG++QY NLFGVA+GYTIASS+SMMAIKRSNC+H SGGK+PC ++SN YMI FG++E+I
Sbjct  145  LCGLVQYLNLFGVAIGYTIASSVSMMAIKRSNCYHKSGGKDPCHMSSNGYMITFGIIEVI  204

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE----  292
            FSQI DF+++WWLSIVAA+MSFTYST+GLGLG+ KVA NG   GSL GISIGTV+     
Sbjct  205  FSQIKDFNEVWWLSIVAAIMSFTYSTVGLGLGIGKVAGNGGFKGSLLGISIGTVTHSGTV  264

Query  291  ---MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYM  121
                +K+WRT QALGAIAFAYSYSL+LIEIQDT++SPPAE KTMKKAT+ S+ VTT+FYM
Sbjct  265  VTSTEKMWRTMQALGAIAFAYSYSLVLIEIQDTIRSPPAEHKTMKKATVFSITVTTVFYM  324

Query  120  MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +CGCFGYAAFGD +PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  325  LCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVAIVV  364



>ref|XP_009604405.1| PREDICTED: amino acid permease 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   506 bits (1303),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 237/330 (72%), Positives = 285/330 (86%), Gaps = 7/330 (2%)
 Frame = -1

Query  969  HQKVFD-VSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            HQK  + ++I    SKCFDDDGRLKRTGT WTA++HIITAVIGSGVLSLAWA  QLGWVA
Sbjct  35   HQKETEPINIQTNYSKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAIGQLGWVA  94

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VM+LF+FV  YTS LLS+CYR+GDP +G RN+TYM+AV+  LG  +VK+CG+IQY N
Sbjct  95   GPAVMILFAFVILYTSNLLSQCYRTGDPANGPRNHTYMEAVKGILGGKKVKVCGLIQYLN  154

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            LFGVA+GYTIA+S+SM+AIKRSNCFH S  ++PC ++SN YMI FGV+EI+FSQIPDFDQ
Sbjct  155  LFGVAIGYTIAASVSMLAIKRSNCFHKSHRRDPCHMSSNGYMIAFGVIEILFSQIPDFDQ  214

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISI------GTVSEMQKIWRT  271
            +WWLSIVAA+MSFTYST+GL LG+AKVAEN    GSLTGISI      GTV+  QK+WR+
Sbjct  215  VWWLSIVAAIMSFTYSTVGLVLGIAKVAENKSFKGSLTGISIGTVTYVGTVTSTQKLWRS  274

Query  270  SQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAF  91
             QALGAIAFAYS+S+ILIEIQDT+KSPPAE KTMKKA+++S+ +TT+FY++CGC GYAAF
Sbjct  275  LQALGAIAFAYSFSIILIEIQDTIKSPPAEHKTMKKASMLSIGITTIFYLLCGCMGYAAF  334

Query  90   GDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GD +PGNLLTGFGF++P+WLLDIANAAIVI
Sbjct  335  GDDAPGNLLTGFGFFDPYWLLDIANAAIVI  364



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   506 bits (1302),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 277/316 (88%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKCFDDDGRLKRTG  WT+S+HIITAVIGSGVLSLAWA AQLGWVAGP VM+LF+FV  Y
Sbjct  48   SKCFDDDGRLKRTGNFWTSSSHIITAVIGSGVLSLAWAIAQLGWVAGPAVMVLFAFVNLY  107

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYRSGDPV G+RNYTYMDAV+S LG  +V +CG+IQY NLFGVA+GYTIA+S+
Sbjct  108  TSNLLAQCYRSGDPVTGQRNYTYMDAVKSYLGGRKVMLCGLIQYLNLFGVAIGYTIAASV  167

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCFH+SGGK+PC ++ N +MI FG++EI+FSQIPDFDQ+WWLSIVAA+MSFT
Sbjct  168  SMMAIKRSNCFHSSGGKDPCHMSCNGFMITFGIIEILFSQIPDFDQVWWLSIVAAIMSFT  227

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGT------VSEMQKIWRTSQALGAIAFAYSYS  229
            YST+GLGLG+ KVA NG   GSLTGISIGT      V+  QK+WR+ QALGAIAFAYS+S
Sbjct  228  YSTVGLGLGIGKVAGNGTFKGSLTGISIGTETHAGPVTSTQKLWRSLQALGAIAFAYSFS  287

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +ILIEIQDT++SPPAE KTMKKATL S+  TT+FY++CGC GYAAFGD +PGNLLTGFGF
Sbjct  288  VILIEIQDTIRSPPAEYKTMKKATLFSIITTTIFYLLCGCMGYAAFGDLAPGNLLTGFGF  347

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WLLDIAN AI +
Sbjct  348  YNPYWLLDIANVAIFV  363



>ref|XP_003540867.1| PREDICTED: amino acid permease 2 [Glycine max]
Length=513

 Score =   505 bits (1301),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 238/323 (74%), Positives = 280/323 (87%), Gaps = 6/323 (2%)
 Frame = -1

Query  951  VSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLL  772
            ++I    SKCFDDDGRLKRTGT WTA+AHIITAVIGSGVLSLAWA AQLGWVAGP VM L
Sbjct  43   MNIQSNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAVAQLGWVAGPVVMFL  102

Query  771  FSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVG  592
            F+ V  YTS LL++CYR+GD V+G RNYTYM+AV+S LG  +VK+CG+IQY NLFGVA+G
Sbjct  103  FAVVNLYTSNLLTQCYRTGDSVNGHRNYTYMEAVKSILGGKKVKLCGLIQYINLFGVAIG  162

Query  591  YTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIV  412
            YTIA+S+SMMAIKRSNC+H+S GK+PC ++SN YMI FG+ E+IFSQIPDFDQ+WWLSIV
Sbjct  163  YTIAASVSMMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIV  222

Query  411  AAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAI  250
            AA+MSFTYS++GL LGVAKVAEN    GSL GISIGTV++       QKIWR+ QALGA+
Sbjct  223  AAIMSFTYSSVGLSLGVAKVAENKTFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAM  282

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYS+S+ILIEIQDT+K PPAE KTM+KAT +S+AVTT+FY++CGC GYAAFGD +PGN
Sbjct  283  AFAYSFSIILIEIQDTIKFPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGN  342

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN AIVI
Sbjct  343  LLTGFGFYNPYWLLDIANLAIVI  365



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   504 bits (1298),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 277/316 (88%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKCFDDDGRLKRTG  WT+++HIITAVIGSGVLSLAWA AQLGWVAGP+V+LLF+ V  Y
Sbjct  48   SKCFDDDGRLKRTGNFWTSASHIITAVIGSGVLSLAWAIAQLGWVAGPSVLLLFALVNLY  107

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL+ CYRSGDPV G+RNYTYMDA+++NLG  +V +CG++QY NLFGVA+GYTIASS+
Sbjct  108  TSNLLAMCYRSGDPVTGQRNYTYMDAIKANLGGRKVMLCGLVQYFNLFGVAIGYTIASSV  167

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNC+H SGGK+PC ++SN YMI FG++E+IFSQIPDF+Q+WWLSIVAA+MSFT
Sbjct  168  SMMAIKRSNCYHKSGGKDPCHMSSNGYMITFGIIEVIFSQIPDFNQVWWLSIVAAIMSFT  227

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYS  229
            YS++GLGLG+ KV  NG   GSL GISIGTV+        QK+WR+ QALGAIAFAYSYS
Sbjct  228  YSSVGLGLGIGKVVGNGGFKGSLLGISIGTVTHAGTVTPTQKMWRSMQALGAIAFAYSYS  287

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            L+LIEIQDT++SPPAE KTMKKAT+ S+A+TT+FY+ CGCFGYAAFGD +PGNLLTGFGF
Sbjct  288  LVLIEIQDTIRSPPAEHKTMKKATVFSIALTTVFYLFCGCFGYAAFGDLAPGNLLTGFGF  347

Query  48   YNPFWLLDIANAAIVI  1
            Y P+WLLDIAN AIV+
Sbjct  348  YKPYWLLDIANVAIVV  363



>ref|XP_007224395.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
 gb|EMJ25594.1| hypothetical protein PRUPE_ppa021701mg [Prunus persica]
Length=483

 Score =   503 bits (1295),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 285/337 (85%), Gaps = 6/337 (2%)
 Frame = -1

Query  999  MGENAAAAAM---HQKVFDVSINV-GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MG++     +   H  VFDVS+NV G SK  DDDGR KRTGTVWT+SAHIITAVIGSGVL
Sbjct  1    MGDHTTTRNLQLHHNPVFDVSLNVRGGSKYIDDDGRPKRTGTVWTSSAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP VM+LFSF+TYYTS LL+ CYR  DPV GKRNYTY DAVRSNLG 
Sbjct  61   SLAWAIAQLGWIAGPVVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNLGE  118

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
            LQVK C  +Q   L GV +GYTIA++ISM+AIKRSNC+H SGGKNPC IN+NPYMI FG+
Sbjct  119  LQVKFCASVQNVVLIGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAFGI  178

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP+FD++ WLSIVAAVMSFTYS IGL LG+A+VA NGK+ G++TGI+IGTV+ 
Sbjct  179  SEIVLSQIPNFDKLSWLSIVAAVMSFTYSGIGLALGIAEVAVNGKIKGNITGITIGTVNP  238

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
            +QK+WRT QALG IAFAYSYS+ILIEIQDT+KSPP+E KTMKKATL S+ VT++FY++CG
Sbjct  239  IQKMWRTFQALGDIAFAYSYSIILIEIQDTIKSPPSEYKTMKKATLFSLIVTSIFYILCG  298

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD SPGNLLT  GF+NPFWL+DIANAAIVI
Sbjct  299  CMGYAAFGDLSPGNLLTDKGFHNPFWLIDIANAAIVI  335



>ref|XP_006366236.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=468

 Score =   502 bits (1293),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 244/319 (76%), Positives = 281/319 (88%), Gaps = 3/319 (1%)
 Frame = -1

Query  954  DVSINV-GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVM  778
             VS+ V  ES  FDDDGRLKR G VWTASAHIITAVI SGVL +AWATAQLGW+AGP ++
Sbjct  4    HVSVTVYDESSSFDDDGRLKRRGNVWTASAHIITAVIDSGVLIVAWATAQLGWIAGPVIL  63

Query  777  LLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVA  598
            LLFS VTYYTS LLS+CYR GD + GKRNYTYMDAVR+NLG + VKICGI+QYAN+ GVA
Sbjct  64   LLFSIVTYYTSNLLSDCYRKGDQLTGKRNYTYMDAVRANLGGVHVKICGILQYANIVGVA  123

Query  597  VGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLS  418
            VGYTIASSISM+A+KRSNCFH  G +  C +++ PYMI FGVV+I+ SQIPDFDQI WLS
Sbjct  124  VGYTIASSISMVAVKRSNCFHEYGHQAACNVSTTPYMIAFGVVQIVLSQIPDFDQISWLS  183

Query  417  IVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAY  238
            IVAAVMS TYSTIGLGLGVAKVAE GKV GSLTG+S GT   MQKIW++SQA+GAIAFAY
Sbjct  184  IVAAVMSMTYSTIGLGLGVAKVAETGKVQGSLTGVSGGT--GMQKIWKSSQAVGAIAFAY  241

Query  237  SYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTG  58
            SYSLILIEIQDT+KSPP+E+KTMKKA+LISV VTT+F+++CGCFGYAAFGDQSPG+LLTG
Sbjct  242  SYSLILIEIQDTIKSPPSEAKTMKKASLISVTVTTVFFILCGCFGYAAFGDQSPGSLLTG  301

Query  57   FGFYNPFWLLDIANAAIVI  1
            FGFY+P+WLL+IAN A+V+
Sbjct  302  FGFYDPYWLLNIANMAVVV  320



>ref|XP_006590854.1| PREDICTED: amino acid permease 2-like [Glycine max]
Length=513

 Score =   504 bits (1297),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 238/323 (74%), Positives = 278/323 (86%), Gaps = 6/323 (2%)
 Frame = -1

Query  951  VSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLL  772
            ++I    SKCFDDDGRLKRTGT W A+AHIITAVIGSGVLSLAWA AQLGWVAGP VM L
Sbjct  43   MNIQSNYSKCFDDDGRLKRTGTFWMATAHIITAVIGSGVLSLAWAVAQLGWVAGPIVMFL  102

Query  771  FSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVG  592
            F+ V  YTS LL++CYR+GD V G RNYTYM+AV S LG  +VK+CG+IQY NLFGVA+G
Sbjct  103  FAVVNLYTSNLLTQCYRTGDSVTGHRNYTYMEAVNSILGGKKVKLCGLIQYINLFGVAIG  162

Query  591  YTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIV  412
            YTIA+S+SMMAIKRSNC+H+S GK+PC ++SN YMI FG+ E+IFSQIPDFDQ+WWLSIV
Sbjct  163  YTIAASVSMMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIV  222

Query  411  AAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAI  250
            AA+MSFTYS++GL LGVAKVAEN    GSL GISIGTV++       QKIWR+ QALGA+
Sbjct  223  AAIMSFTYSSVGLSLGVAKVAENKSFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAM  282

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYS+S+ILIEIQDT+KSPPAE KTM+KAT +S+AVTT+FY++CGC GYAAFGD +PGN
Sbjct  283  AFAYSFSIILIEIQDTIKSPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGN  342

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN AIVI
Sbjct  343  LLTGFGFYNPYWLLDIANLAIVI  365



>gb|KEH35330.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=480

 Score =   503 bits (1294),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 239/325 (74%), Positives = 281/325 (86%), Gaps = 4/325 (1%)
 Frame = -1

Query  969  HQKVFDVSINVG-ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            H + FDVSI+   +SK FDDDGR+KRTGTVWTASAH+ITAV+GSGVLSLAWA AQLGW+A
Sbjct  10   HHQTFDVSIDQQRDSKYFDDDGRVKRTGTVWTASAHVITAVVGSGVLSLAWAIAQLGWIA  69

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VM+LF++VTYYT++LL ECYR+ DP++GKRNYTYMD V SNLG  QV +CGI+QY N
Sbjct  70   GPIVMILFAWVTYYTAILLCECYRNDDPINGKRNYTYMDVVHSNLGGFQVTLCGIVQYLN  129

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            L GVA+GYTIAS+ISMMAI+RSNCFH SGGK+PC + SN YMI FG V+IIFSQIPDFDQ
Sbjct  130  LVGVAIGYTIASAISMMAIERSNCFHRSGGKDPCHMKSNIYMISFGAVQIIFSQIPDFDQ  189

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGA  253
            +WWLS +AAVMSFTYSTIGLGLG+ KV  N K+ G++ G++   V++ QK+W + QALG 
Sbjct  190  LWWLSSLAAVMSFTYSTIGLGLGIGKVIGNKKIDGTMAGVT--DVTKAQKVWGSLQALGD  247

Query  252  IAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
            IAFAYSYS+ILIEIQDTVK+ PP+E+KTMKKAT+I VA T  FYM+CGCFGYAAFG+ SP
Sbjct  248  IAFAYSYSMILIEIQDTVKAPPPSEAKTMKKATIIGVAATAFFYMLCGCFGYAAFGNSSP  307

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
            GNLLTGFGFYNPFWLLDIAN AIVI
Sbjct  308  GNLLTGFGFYNPFWLLDIANVAIVI  332



>emb|CAA10608.1| amino acid carrier [Ricinus communis]
Length=466

 Score =   501 bits (1290),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 246/312 (79%), Positives = 273/312 (88%), Gaps = 2/312 (1%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SK +DDDG+LKRTGTVWTASAHIITAVIGSGVLSLAWA AQLGWVAGP VM LFS VTYY
Sbjct  7    SKWYDDDGKLKRTGTVWTASAHIITAVIGSGVLSLAWAVAQLGWVAGPAVMFLFSLVTYY  66

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LLS CYR+GDPV+GKRNYTYMDAVRSNLG  + KICG +QY NL GVA+GYTIASSI
Sbjct  67   TSTLLSACYRTGDPVNGKRNYTYMDAVRSNLGGAKFKICGYVQYVNLIGVAIGYTIASSI  126

Query  570  SMMAIKRSNCFHASGGKNPCQINSNP-YMIMFGVVEIIFSQIPDFDQ-IWWLSIVAAVMS  397
            SMMA+KRSNCFH S  KNPC +     +  +  VVE   SQIPDFDQ +  LSIVAA+MS
Sbjct  127  SMMAVKRSNCFHKSEAKNPCHMKCQSLHDCILEVVESSSSQIPDFDQTMGGLSIVAAIMS  186

Query  396  FTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILI  217
            FTYSTIGLGLG+A+V +NGK +GS+TGISIGTV+E QKIWR+ QALG IAFAYSYSLILI
Sbjct  187  FTYSTIGLGLGIAEVTKNGKAMGSMTGISIGTVTETQKIWRSFQALGDIAFAYSYSLILI  246

Query  216  EIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPF  37
            EIQDT++SPPAESKTM+KATLISV+VTTLFYM+CGCFGYAAFGD SPGNLLTGFGFYNP+
Sbjct  247  EIQDTIRSPPAESKTMRKATLISVSVTTLFYMLCGCFGYAAFGDMSPGNLLTGFGFYNPY  306

Query  36   WLLDIANAAIVI  1
            WLLDIAN AIV+
Sbjct  307  WLLDIANVAIVV  318



>emb|CBI21597.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   496 bits (1277),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 227/310 (73%), Positives = 269/310 (87%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKC DDDGR KRTGTVWTASAHIIT++IGSGVLSLAWA AQLGW+ GPTV+L+F+ V  Y
Sbjct  14   SKCLDDDGRPKRTGTVWTASAHIITSIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICY  73

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYRSGDP+ GKRNYTYM+ V+SNLG  +VKICG+IQY NLFG+ VGYTIA+S+
Sbjct  74   TSSLLADCYRSGDPISGKRNYTYMEVVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSV  133

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMA+ RSNCFH SG KNPC  +SNPYMIMFG++EI+ SQIPDFDQIWWLSI+A++MSFT
Sbjct  134  SMMAVMRSNCFHRSGNKNPCHESSNPYMIMFGIIEIVLSQIPDFDQIWWLSILASIMSFT  193

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YS+IGLGLGV+ VA NG   G+LTGISIGT++  QK+W+  QAL  IAF+Y YS +L+EI
Sbjct  194  YSSIGLGLGVSTVAANGIFKGTLTGISIGTITRTQKLWKCFQALANIAFSYCYSFVLVEI  253

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDT+KSPP+E+ TMKKA LISVA+TT FYM+CGC GYAA GDQ+PGNLLT FGF +PFWL
Sbjct  254  QDTIKSPPSEATTMKKANLISVAITTSFYMLCGCMGYAALGDQAPGNLLTEFGFRDPFWL  313

Query  30   LDIANAAIVI  1
            +DIAN AIVI
Sbjct  314  IDIANIAIVI  323



>gb|AAK33098.1| amino acid transporter [Glycine max]
Length=513

 Score =   502 bits (1293),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 237/323 (73%), Positives = 277/323 (86%), Gaps = 6/323 (2%)
 Frame = -1

Query  951  VSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLL  772
            ++I    SKCFDDDGRLKRTGT W A+AHIITAVIGSGVLSLAWA AQLGWVAGP VM L
Sbjct  43   MNIQSNYSKCFDDDGRLKRTGTFWMATAHIITAVIGSGVLSLAWAVAQLGWVAGPIVMFL  102

Query  771  FSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVG  592
            F+ V  YTS LL++CYR+GD V G RNYTYM+AV S LG  +VK+CG+ QY NLFGVA+G
Sbjct  103  FAVVNLYTSNLLTQCYRTGDSVSGHRNYTYMEAVNSILGGKKVKLCGLTQYINLFGVAIG  162

Query  591  YTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIV  412
            YTIA+S+SMMAIKRSNC+H+S GK+PC ++SN YMI FG+ E+IFSQIPDFDQ+WWLSIV
Sbjct  163  YTIAASVSMMAIKRSNCYHSSHGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQVWWLSIV  222

Query  411  AAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAI  250
            AA+MSFTYS++GL LGVAKVAEN    GSL GISIGTV++       QKIWR+ QALGA+
Sbjct  223  AAIMSFTYSSVGLSLGVAKVAENKSFKGSLMGISIGTVTQAGTVTSTQKIWRSLQALGAM  282

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYS+S+ILIEIQDT+KSPPAE KTM+KAT +S+AVTT+FY++CGC GYAAFGD +PGN
Sbjct  283  AFAYSFSIILIEIQDTIKSPPAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGN  342

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN AIVI
Sbjct  343  LLTGFGFYNPYWLLDIANLAIVI  365



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 242/340 (71%), Positives = 283/340 (83%), Gaps = 16/340 (5%)
 Frame = -1

Query  1017  ES*NMKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             E  +++ G +AAAA               SKCFDDDGRLKRTGT+WTASAHIITAVIGSG
Sbjct  2     EVSSVEFGHHAAAA---------------SKCFDDDGRLKRTGTMWTASAHIITAVIGSG  46

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA AQLGWVAGPTVMLLFSFVTYYTS LL++CYRSGD   GKRNYTYMDAV +NL
Sbjct  47    VLSLAWAIAQLGWVAGPTVMLLFSFVTYYTSALLADCYRSGDACTGKRNYTYMDAVNANL  106

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
               ++V  CG +QYAN+ GVA+GYTIA+SISM+AI+R+NCFH  G  +PC I+S PYMI+F
Sbjct  107   SGVKVWFCGFLQYANIVGVAIGYTIAASISMLAIQRANCFHVEGHGDPCNISSTPYMIIF  166

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             GVV+I FSQIPDFDQI WLSI+AAVMSFTYSTIGLGLG+A+V  N  V GSLTGIS+G V
Sbjct  167   GVVQIFFSQIPDFDQISWLSILAAVMSFTYSTIGLGLGIAQVVSNKGVQGSLTGISVGLV  226

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYM  121
             + + K+WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVAVTT FYM
Sbjct  227   TPVDKMWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVAVTTFFYM  286

Query  120   MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             +CGC GYAAFGD +PGNLLTGFGFY PFWLLD+ANAAI +
Sbjct  287   LCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAAIAV  326



>ref|NP_001055592.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|AAV24773.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF17506.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|EAY98107.1| hypothetical protein OsI_20024 [Oryza sativa Indica Group]
 gb|EEE63778.1| hypothetical protein OsJ_18601 [Oryza sativa Japonica Group]
Length=496

 Score =   501 bits (1289),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 237/311 (76%), Positives = 273/311 (88%), Gaps = 1/311 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SK +DDDGRLKRTGT+WTASAHIITAVIGSGVLSL WA AQLGWVAGP VMLLFSFVTYY
Sbjct  31   SKLYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLGWAIAQLGWVAGPAVMLLFSFVTYY  90

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYRSGD   GKRNYTYMDAV +NL  ++V++CG +QYAN+ GVA+GYTIA+SI
Sbjct  91   TSALLADCYRSGDESTGKRNYTYMDAVNANLSGIKVQVCGFLQYANIVGVAIGYTIAASI  150

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SM+AIKR+NCFH  G  +PC I+S PYMI+FGV EI FSQIPDFDQI WLSI+AAVMSFT
Sbjct  151  SMLAIKRANCFHVEGHGDPCNISSTPYMIIFGVAEIFFSQIPDFDQISWLSILAAVMSFT  210

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YSTIGLGLGV +V  NG V GSLTGISIG V+ M K+WR+ QA G IAFAYSYSLILIEI
Sbjct  211  YSTIGLGLGVVQVVANGGVKGSLTGISIGVVTPMDKVWRSLQAFGDIAFAYSYSLILIEI  270

Query  210  QDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFW  34
            QDT+++ PP+ES+ M++AT++SVAVTTLFYM+CGC GYAAFGD +PGNLLTGFGFY PFW
Sbjct  271  QDTIRAPPPSESRVMRRATVVSVAVTTLFYMLCGCTGYAAFGDAAPGNLLTGFGFYEPFW  330

Query  33   LLDIANAAIVI  1
            LLD+ANAAIV+
Sbjct  331  LLDVANAAIVV  341



>ref|XP_006486755.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=512

 Score =   501 bits (1289),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 274/316 (87%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            S CFDDDGRLKRTG  WT S+HIITAVIGSGVLSLAWA AQLGWVAGPTV++LF+ V  Y
Sbjct  49   SNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLILFALVNLY  108

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            T+ LLS+CYRSGDPV G+RNYTYMDAV++NLG  +V  CG+IQY NLFGVA+GYTIA+S+
Sbjct  109  TANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYLNLFGVAIGYTIAASV  168

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCF  SGGK+PC ++SN YMI FG++E++FSQIPDFDQ+WWLSIVAA+MSFT
Sbjct  169  SMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFDQVWWLSIVAAIMSFT  228

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISI------GTVSEMQKIWRTSQALGAIAFAYSYS  229
            YST GLGLG+ KVA NG   GSLTGISI      GTV+  QK+WR+ QALGAIAFAYS+S
Sbjct  229  YSTAGLGLGIGKVAGNGSFKGSLTGISIGTLTSAGTVTGTQKLWRSLQALGAIAFAYSFS  288

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +IL+EIQDT++SPPAE KTMKKATL S+ VTT FY++CGC GYAAFGD +P NLLTGFGF
Sbjct  289  IILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGF  348

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WL+DIANAAIV+
Sbjct  349  YNPYWLIDIANAAIVV  364



>ref|XP_007226332.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
 gb|EMJ27531.1| hypothetical protein PRUPE_ppa022253mg [Prunus persica]
Length=483

 Score =   499 bits (1286),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 239/337 (71%), Positives = 287/337 (85%), Gaps = 6/337 (2%)
 Frame = -1

Query  999  MGENAAAAAM---HQKVFDVSINVGE-SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MG++ A   +   H  VFDVS+NV E S   DDDGR KRTGTVWT+SAHIITAVIGSGVL
Sbjct  1    MGDHTATGNLQLHHNPVFDVSLNVQEGSNYIDDDGRPKRTGTVWTSSAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP VM+LFSF+TYYTS LL+ CYR  DPV GKRNYTY DAVRSNLG+
Sbjct  61   SLAWAMAQLGWIAGPIVMVLFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNLGA  118

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
            LQVK CG +Q   LFG+++G+ IA++ISM+AI+R NC H SGGKNPC IN NPYMI FG+
Sbjct  119  LQVKFCGSVQNVALFGISIGFNIAAAISMVAIQRCNCNHKSGGKNPCHININPYMIAFGI  178

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP+FD++ WLSIVAAVMSFTYS IGL LG+AKVAENGK+ G++TGI++GTV+ 
Sbjct  179  SEILLSQIPNFDKLSWLSIVAAVMSFTYSGIGLALGIAKVAENGKIKGNITGITVGTVTP  238

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
            +QK+WRT QALG IAFAYSYS+ILIEIQDT+KSPP+E KTMKKATL+S+ +T++FY++CG
Sbjct  239  IQKMWRTFQALGNIAFAYSYSIILIEIQDTIKSPPSEYKTMKKATLLSLTLTSIFYILCG  298

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD SPGNLL+  GF+NP+WL++IANAAIVI
Sbjct  299  CMGYAAFGDLSPGNLLSDKGFHNPYWLINIANAAIVI  335



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   499 bits (1284),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 279/335 (83%), Gaps = 8/335 (2%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGE---SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLA  823
            +  AAAAM       S+  G+   SKC+DDDGRLKRTGT+WTASAHIITAVIGSGVLSLA
Sbjct  12   QGTAAAAMEVS----SVEHGQAAASKCYDDDGRLKRTGTMWTASAHIITAVIGSGVLSLA  67

Query  822  WATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQV  643
            WA  QLGWVAGP VMLLFS VTYYTS LLS+CYRSGD   GKRNYTYMDAV +NL  ++V
Sbjct  68   WAIGQLGWVAGPAVMLLFSLVTYYTSSLLSDCYRSGDETTGKRNYTYMDAVNANLSGIKV  127

Query  642  KICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEI  463
            ++CG +QYAN+ GVA+GYTIA+SISM+AIK++NCFH  G  NPC I+S PYMI+FGV EI
Sbjct  128  QLCGFLQYANIVGVAIGYTIAASISMLAIKKANCFHVKGHVNPCHISSTPYMIIFGVAEI  187

Query  462  IFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQK  283
             FSQIPDFDQI WLSI+AA+MSFTYS IGL LG+ +V  N  V GSLTGISIG V+ M K
Sbjct  188  FFSQIPDFDQISWLSILAAIMSFTYSIIGLSLGIVQVVANKGVKGSLTGISIGVVTPMDK  247

Query  282  IWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCF  106
            +WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVA TTLFYM+CGC 
Sbjct  248  VWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVATTTLFYMLCGCM  307

Query  105  GYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GYAAFGD +PGNLLTGFGFY PFWLLDIANAAIV+
Sbjct  308  GYAAFGDNAPGNLLTGFGFYEPFWLLDIANAAIVV  342



>ref|XP_006662801.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=475

 Score =   498 bits (1283),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 237/330 (72%), Positives = 279/330 (85%), Gaps = 3/330 (1%)
 Frame = -1

Query  981  AAAMHQKVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQL  805
            AAA+     +     GE  +  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA AQL
Sbjct  5    AAALEVSAAEAGRGAGEEGEWRDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQL  64

Query  804  GWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGII  625
            GWVAGP VMLLF+FV YYTS LL+ECYRSGDP  GKRNYTYMDAVR+NLG  +V++CG+I
Sbjct  65   GWVAGPAVMLLFAFVIYYTSTLLAECYRSGDPCSGKRNYTYMDAVRANLGGAKVRLCGVI  124

Query  624  QYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIP  445
            QYANLFGVA+GYTIA+SISM+AIKR++CFH  G KN C+ +SNPYMI+FG VEI+FSQIP
Sbjct  125  QYANLFGVAIGYTIAASISMLAIKRADCFHEKGHKNACRSSSNPYMILFGAVEIVFSQIP  184

Query  444  DFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTS  268
            DFDQIWWLSIVAA++SFTYS IGL  G+A    +G   GSLTGIS+G  V+ MQK+WR+ 
Sbjct  185  DFDQIWWLSIVAALLSFTYSPIGLPSGIAPTVASGGFSGSLTGISVGAGVTSMQKVWRSL  244

Query  267  QALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAF  91
            QA G IAFAYSY++ILIEIQDT+K+ PP+E+K MK+AT++SVA TT+FYM+CGC GYAAF
Sbjct  245  QAFGDIAFAYSYAIILIEIQDTIKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAF  304

Query  90   GDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GD+SP NLLTGFGFY PFWLLD+ANAAIV+
Sbjct  305  GDRSPDNLLTGFGFYEPFWLLDVANAAIVV  334



>ref|XP_008219720.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=483

 Score =   498 bits (1283),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 285/337 (85%), Gaps = 6/337 (2%)
 Frame = -1

Query  999  MGENAAAAAM---HQKVFDVSINV-GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MG++     +   H  VFDVS+ V G SK  DDDGR KRTGTVWT+SAHIITAVIGSGVL
Sbjct  1    MGDHTTTRNLQLHHNPVFDVSLIVQGGSKYIDDDGRPKRTGTVWTSSAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGW+AGP VM++FSF+TYYTS LL+ CYR  DPV GKRNYTY DAVRSNLG 
Sbjct  61   SLAWAVAQLGWIAGPVVMVMFSFITYYTSTLLAACYR--DPVTGKRNYTYSDAVRSNLGE  118

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
            LQVK CG +Q   L GV +GYTIA++ISM+AIKRSNC+H SGGKNPC IN+NPYMI FG+
Sbjct  119  LQVKFCGSVQNVVLTGVTIGYTIAAAISMVAIKRSNCYHKSGGKNPCHINNNPYMIAFGI  178

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE  292
             EI+ SQIP+FD++ WLSIVAAVMSFTYS IGL LG+A+VA NGK+ G++TGI+IGTV+ 
Sbjct  179  SEILLSQIPNFDKLSWLSIVAAVMSFTYSGIGLALGIAEVAANGKIKGNVTGITIGTVNP  238

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
            ++K+WRT QALG +AFAYSYS+ILIEIQDT+KSPP+E KTMKKATL S+ VT++FY++CG
Sbjct  239  IEKMWRTFQALGDVAFAYSYSIILIEIQDTIKSPPSEYKTMKKATLFSLIVTSIFYILCG  298

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            C GYAAFGD SPGNLLT  GF+NPFWL+DIANAAIVI
Sbjct  299  CMGYAAFGDLSPGNLLTDKGFHNPFWLIDIANAAIVI  335



>ref|XP_010266973.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=475

 Score =   498 bits (1282),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/312 (76%), Positives = 269/312 (86%), Gaps = 0/312 (0%)
 Frame = -1

Query  936  GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVT  757
            G SKCFDDDGRLKRTG      +HIITAVIGSGVLSLAWA  QLGWVAGP VM+LF+FV 
Sbjct  42   GYSKCFDDDGRLKRTGYSLDGVSHIITAVIGSGVLSLAWAIGQLGWVAGPAVMVLFAFVI  101

Query  756  YYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIAS  577
            +YTS LLS+CYRS DP  GKRNYTYMDAV++NLG  +  ICG IQY NLFGVA+GYTIA+
Sbjct  102  FYTSNLLSQCYRSVDPATGKRNYTYMDAVKANLGGKKFSICGAIQYINLFGVAIGYTIAA  161

Query  576  SISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMS  397
            SISMMAIKRSNCFH SGGK+PC ++SN YMI FG+ E++FSQ PDFDQ+WWLSIVAAVMS
Sbjct  162  SISMMAIKRSNCFHKSGGKDPCHMSSNEYMIAFGITEVVFSQNPDFDQVWWLSIVAAVMS  221

Query  396  FTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILI  217
            FTYST+GL LG+AKVAEN    GSL GISIG V+  QK+WR+ QALGAIAFAYSYS ILI
Sbjct  222  FTYSTVGLSLGIAKVAENKGFKGSLMGISIGKVTGTQKMWRSLQALGAIAFAYSYSFILI  281

Query  216  EIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPF  37
            EIQDT+KSPPAE KTMKKATL+S++VTT+FY++CGC GYAAFGD +PGNLLTGFGFYNP+
Sbjct  282  EIQDTLKSPPAEHKTMKKATLMSISVTTVFYLLCGCMGYAAFGDDAPGNLLTGFGFYNPY  341

Query  36   WLLDIANAAIVI  1
             LLDIAN AIV+
Sbjct  342  RLLDIANVAIVV  353



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   498 bits (1281),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 241/340 (71%), Positives = 282/340 (83%), Gaps = 16/340 (5%)
 Frame = -1

Query  1017  ES*NMKMGENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             E  +++ G +AAAA               SKCFDDDGRLKRTGT+WTASAHIITAVIGSG
Sbjct  2     EVSSVEFGHHAAAA---------------SKCFDDDGRLKRTGTMWTASAHIITAVIGSG  46

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA AQLGWVAGPTVMLLFSFVTYYTS LL++CYRSGD   GKRNYTYMDAV +NL
Sbjct  47    VLSLAWAIAQLGWVAGPTVMLLFSFVTYYTSALLADCYRSGDACTGKRNYTYMDAVNANL  106

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
               ++V  CG +QYAN+ GVA+GYTIA+SISM+AI+R+NCFH  G  +PC I+S PYMI+F
Sbjct  107   SGVKVWFCGFLQYANIVGVAIGYTIAASISMLAIQRANCFHVEGHGDPCNISSTPYMIIF  166

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
             GVV+I FSQIPDFDQI WLSI+AAVMSFTYSTIGLGLG+A+V  N  V GSLTGIS+G V
Sbjct  167   GVVQIFFSQIPDFDQISWLSILAAVMSFTYSTIGLGLGIAQVVSNKGVQGSLTGISVGAV  226

Query  297   SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYM  121
             + + K+WR+ QA G IAFAYSYSLILIEIQDT+++ PP+ESK M++AT++SVAVTT  YM
Sbjct  227   TPVDKMWRSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESKVMRRATVVSVAVTTFXYM  286

Query  120   MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             +CGC GYAAFGD +PGNLLTGFGFY PFWLLD+ANAAI +
Sbjct  287   LCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAAIAV  326



>ref|XP_009339433.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=484

 Score =   498 bits (1281),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 243/338 (72%), Positives = 279/338 (83%), Gaps = 7/338 (2%)
 Frame = -1

Query  999  MGENAAAAAM----HQKVFDVSINV-GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            M EN A        H  VFDVS+NV G SK  DDDGR KRTGTVWTAS+HIITAVIGSGV
Sbjct  1    MSENTATRNQLQLHHNPVFDVSLNVDGGSKYIDDDGRPKRTGTVWTASSHIITAVIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWA AQLGW+AGP  M +FSF+TYYTS LL+ CYR  DPV GKRNY+Y DAV+S LG
Sbjct  61   LSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLTSCYR--DPVTGKRNYSYSDAVQSTLG  118

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
              QVK+CG +Q  NLFG+ +GYT+A++ISMMAIKRSN FH SGGK+PC IN NPYMI FG
Sbjct  119  EFQVKMCGFVQQLNLFGITIGYTVAAAISMMAIKRSNYFHNSGGKDPCHINYNPYMIAFG  178

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
              EII SQIP+FD++ WLS+VAAVMSFTYS IGL LG+AKVAEN K+ GS TGIS+G V+
Sbjct  179  TSEIILSQIPNFDKLSWLSVVAAVMSFTYSGIGLALGIAKVAENEKINGSRTGISLGIVT  238

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
              QK+WRT QALG IAFAYSYS+ILIEIQDTVKSPP+E+KTMKKAT +S+ VT++FY++C
Sbjct  239  PAQKMWRTFQALGNIAFAYSYSIILIEIQDTVKSPPSETKTMKKATRLSLTVTSIFYILC  298

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD +PGNLLTG GF NPFWL+DIANAAIVI
Sbjct  299  GCMGYAAFGDLAPGNLLTGKGFSNPFWLIDIANAAIVI  336



>ref|XP_008442173.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   497 bits (1279),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 229/315 (73%), Positives = 276/315 (88%), Gaps = 0/315 (0%)
 Frame = -1

Query  945  INVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFS  766
            + V +S  FDDDGR KRTGT WTASAHIITAVIGSGVLSLAWA AQLGW+AGP+VMLLFS
Sbjct  4    LPVNDSASFDDDGRPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMLLFS  63

Query  765  FVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYT  586
            F+ YYTS LL++CYRSGDPV GKRN TYM AVRS LG   +  CGI+QY NL G+ +GYT
Sbjct  64   FIGYYTSCLLADCYRSGDPVSGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYT  123

Query  585  IASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAA  406
            IASSISMMAIKRSNCFH+SGGKNPC I+SNP+M+ FG+VEII SQIP+FDQIWWLSIVAA
Sbjct  124  IASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIPNFDQIWWLSIVAA  183

Query  405  VMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSL  226
            +MSFTYS+IGL LG+AKVAE+G   G+L+GI++GTV++ +KIWR+ QALG IAFAYS+++
Sbjct  184  IMSFTYSSIGLTLGIAKVAESGVFKGTLSGITVGTVTQSEKIWRSFQALGDIAFAYSFAI  243

Query  225  ILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFY  46
            +LIE+QDT++ PP+E+KTMKKA   S+ +TT+FY++CGC GYAAFG+ +PGNLLTGFGFY
Sbjct  244  VLIEVQDTIRCPPSEAKTMKKAAGFSITLTTIFYILCGCMGYAAFGNTAPGNLLTGFGFY  303

Query  45   NPFWLLDIANAAIVI  1
            NPFWLLDIAN +IV+
Sbjct  304  NPFWLLDIANVSIVV  318



>ref|XP_002534252.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF28130.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   497 bits (1280),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 272/316 (86%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKC+DDDG  KRTGT WTA++HIITAVIG GVLSLAWA AQLGW+AGP VM+LF+ V  Y
Sbjct  21   SKCYDDDGHSKRTGTFWTAASHIITAVIGPGVLSLAWAIAQLGWIAGPAVMVLFAIVNLY  80

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYR+GDPV G+ NYTYM+AV++NLG  +V  CG+IQY NLFGV +GYTIA+S+
Sbjct  81   TSNLLAQCYRAGDPVTGQINYTYMEAVKANLGGRKVFFCGLIQYLNLFGVVIGYTIAASV  140

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCFHASGGK+PC ++SN YMI FG+ E+IFSQIPDFDQIWWLSIVAA+MSFT
Sbjct  141  SMMAIKRSNCFHASGGKDPCHMSSNGYMITFGIAEVIFSQIPDFDQIWWLSIVAAIMSFT  200

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYS  229
            YST+GLGLGV KVA N    GSLTGISIGTV+        QK+WR+ QALGAIAFAYS+S
Sbjct  201  YSTVGLGLGVGKVAGNAAAKGSLTGISIGTVTHAGLLTSTQKLWRSLQALGAIAFAYSFS  260

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
             ILIEIQ+TVKSPPAE KTMKKAT  S+AVTT FY++CGCFGYAAFGD +PGN+LTGFGF
Sbjct  261  AILIEIQETVKSPPAEYKTMKKATAFSIAVTTFFYLLCGCFGYAAFGDNAPGNILTGFGF  320

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WLLDIAN AI++
Sbjct  321  YNPYWLLDIANVAIIV  336



>emb|CDY36017.1| BnaA08g04440D [Brassica napus]
Length=481

 Score =   497 bits (1280),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 233/336 (69%), Positives = 285/336 (85%), Gaps = 7/336 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            M EN+     +++   +SI+V     S  FD+DGR+KRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MVENSK----NRQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLS  56

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQ+GWV GP VM+LFS VTYYTS+LL  CYRSGD V GKRNYTYMDA+ SNLG +
Sbjct  57   LAWAVAQIGWVGGPVVMILFSLVTYYTSILLCACYRSGDSVTGKRNYTYMDAIHSNLGGI  116

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VK+CG++QY NLFG A+GYTIAS+ISM+AI+R++C  ++G K+PC +N NPYMI FG +
Sbjct  117  KVKLCGVVQYVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAI  176

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            +IIFSQIPDFDQ+WWLSIVAA+MSF YSTIGLGLG++++ +N ++ G+LTG++IGTV+  
Sbjct  177  QIIFSQIPDFDQLWWLSIVAALMSFGYSTIGLGLGISRMVDNKEIKGTLTGVTIGTVTPT  236

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            +K+WRT Q+LG IAFAYSYS+ILIEIQDT+K+PPAE KTM+KATLISVAVTTLFYM+CGC
Sbjct  237  EKVWRTFQSLGNIAFAYSYSMILIEIQDTLKAPPAEEKTMRKATLISVAVTTLFYMLCGC  296

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLL   GF NP+WLLDIAN AIVI
Sbjct  297  VGYAAFGDSAPGNLLAAGGFRNPYWLLDIANLAIVI  332



>ref|XP_009764609.1| PREDICTED: amino acid permease 4-like isoform X1 [Nicotiana sylvestris]
Length=513

 Score =   498 bits (1282),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 283/331 (85%), Gaps = 8/331 (2%)
 Frame = -1

Query  969  HQKVFDVSINV--GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWV  796
            HQK  +  IN+    SKCFDDDG L+RTGT WT ++HIITAVIGSGVLSLAWA  QLGWV
Sbjct  35   HQKETEAIINLQTNYSKCFDDDGHLRRTGTFWTTTSHIITAVIGSGVLSLAWAIGQLGWV  94

Query  795  AGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYA  616
            AGPTVM+LF+FV  YTS LLS+CYR+GDPV+G RNYTYM+AV+  LG  +VK+CG+IQY 
Sbjct  95   AGPTVMILFAFVVLYTSNLLSQCYRTGDPVNGPRNYTYMEAVKGILGGKKVKVCGLIQYL  154

Query  615  NLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFD  436
            NLFGVA+GYTIA+S+SM+AIKRSNCFH +  ++PC ++SN YMI FGV EI+FSQIP FD
Sbjct  155  NLFGVAIGYTIAASVSMLAIKRSNCFHRNHRRDPCHMSSNGYMIAFGVTEILFSQIPGFD  214

Query  435  QIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM------QKIWR  274
            Q+WWLSIVAA+MSFTYST+GL LG+AKVA N    GSLTGISIGTV+ +      QKIWR
Sbjct  215  QVWWLSIVAAIMSFTYSTVGLVLGIAKVAGNKSFKGSLTGISIGTVTHIGTVTSTQKIWR  274

Query  273  TSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAA  94
            + QALGAIAFAYS+S+ILIEIQDT+KSPPAE KTMKKA+++S+ VTT+FY++CGC GYAA
Sbjct  275  SLQALGAIAFAYSFSIILIEIQDTIKSPPAEHKTMKKASMLSIGVTTIFYLLCGCIGYAA  334

Query  93   FGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            FG+ +PGNLLTGFGF++P+WLLDIANAAIVI
Sbjct  335  FGNDAPGNLLTGFGFFDPYWLLDIANAAIVI  365



>gb|KDO68035.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=512

 Score =   498 bits (1282),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 273/316 (86%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            S CFDDDGRLKRTG  WT S+HIITAVIGSGVLSLAWA AQLGWVAGPTV++LF+ V  Y
Sbjct  49   SNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLILFALVNLY  108

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            T+ LLS+CYRSGDPV G+RNYTYMDAV++NLG  +V  CG+IQY NLFGVA+GYTIA+S+
Sbjct  109  TANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYLNLFGVAIGYTIAASV  168

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCF  SGGK+PC ++SN YMI FG++E++FSQIPDFDQ+WWLSIVAA+MSFT
Sbjct  169  SMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFDQVWWLSIVAAIMSFT  228

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISI------GTVSEMQKIWRTSQALGAIAFAYSYS  229
            YST GLGLG+ KVA N    GSLTGISI      GTV+  QK+WR+ QALGAIAFAYS+S
Sbjct  229  YSTAGLGLGIGKVAGNRSFKGSLTGISIGTLTSAGTVTGTQKLWRSLQALGAIAFAYSFS  288

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +IL+EIQDT++SPPAE KTMKKATL S+ VTT FY++CGC GYAAFGD +P NLLTGFGF
Sbjct  289  IILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGF  348

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WL+DIANAAIV+
Sbjct  349  YNPYWLIDIANAAIVV  364



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   497 bits (1280),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 280/333 (84%), Gaps = 4/333 (1%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGE-SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  817
              AA AAM  +V    +  G+  KCFDDDGR KR GT+WTASAHIITAVIGSGVLSL WA
Sbjct  13   PTAAPAAM--EVCGAELGQGKPDKCFDDDGRPKRNGTMWTASAHIITAVIGSGVLSLGWA  70

Query  816  TAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKI  637
             AQLGWVAGP VMLLFS VTYYTS LL++CYRSGDP  GKRNYTYMDAV +NL  ++V+I
Sbjct  71   IAQLGWVAGPVVMLLFSLVTYYTSSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQI  130

Query  636  CGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIF  457
            CG +QYAN+ GVA+GYTIA+SISM+AI+R+NCFH  G  NPC+I+S PYMI+FGV EI F
Sbjct  131  CGFLQYANIVGVAIGYTIAASISMLAIRRANCFHQKGHGNPCKISSTPYMIIFGVAEIFF  190

Query  456  SQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIW  277
            SQIPDFDQI WLSI+AAVMSFTYS+IGLGLGV +V  N  V GSLTGI+IG V+ M K+W
Sbjct  191  SQIPDFDQISWLSILAAVMSFTYSSIGLGLGVVQVIANRGVQGSLTGITIGVVTPMDKVW  250

Query  276  RTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            R+ QA G +AFAYSYSLILIEIQDT+++ PP+ES  MK+AT++SVAVTTLFYM+CGC GY
Sbjct  251  RSLQAFGDVAFAYSYSLILIEIQDTIRAPPPSESTVMKRATVVSVAVTTLFYMLCGCMGY  310

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  311  AAFGDGAPGNLLTGFGFYEPFWLLDVANAAIVV  343



>ref|XP_006422618.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
 gb|ESR35858.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
Length=512

 Score =   498 bits (1281),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 273/316 (86%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            S CFDDDGRLKRTG  WT S+HIITAVIGSGVLSLAWA AQLGWVAGPTV++LF+ V  Y
Sbjct  49   SNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLILFALVNLY  108

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            T+ LLS+CYRSGDPV G+RNYTYMDAV++NLG  +V  CG+IQY NLFGVA+GYTIA+S+
Sbjct  109  TANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYLNLFGVAIGYTIAASV  168

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCF  SGGK+PC ++SN YMI FG++E++FSQIPDFDQ+WWLSIVAA+MSFT
Sbjct  169  SMMAIKRSNCFQKSGGKDPCHMSSNGYMITFGIIEVLFSQIPDFDQVWWLSIVAAIMSFT  228

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISI------GTVSEMQKIWRTSQALGAIAFAYSYS  229
            YST GLGLG+ KVA N    GSLTGISI      GTV+  QK+WR+ QALGAIAFAYS+S
Sbjct  229  YSTAGLGLGIGKVAGNRSFKGSLTGISIGTLTSAGTVTGTQKLWRSLQALGAIAFAYSFS  288

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            +IL+EIQDT++SPPAE KTMKKATL S+ VTT FY++CGC GYAAFGD +P NLLTGFGF
Sbjct  289  IILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGF  348

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WL+DIANAAIV+
Sbjct  349  YNPYWLIDIANAAIVV  364



>ref|XP_008368062.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   496 bits (1278),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 243/338 (72%), Positives = 277/338 (82%), Gaps = 7/338 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQ----KVFDVSINV-GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGV  835
            M EN A     Q     VFDVS+NV G SK  DDDGR KRTGTVWTAS+HIITA+IGSGV
Sbjct  1    MSENTATRNQLQLHYNPVFDVSLNVQGGSKYIDDDGRPKRTGTVWTASSHIITAIIGSGV  60

Query  834  LSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLG  655
            LSLAWA AQLGW+AGP  M +FSF+TYYTS LL+ CYR  DPV GKRNY+Y DAVRSNLG
Sbjct  61   LSLAWAIAQLGWIAGPAAMAIFSFITYYTSTLLASCYR--DPVTGKRNYSYSDAVRSNLG  118

Query  654  SLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFG  475
               VK CG +Q  NLFG+ +GYT+A+SISMMAIKRSNCFH SGGK+PC IN NPYMI FG
Sbjct  119  EFLVKXCGFVQQLNLFGITIGYTVAASISMMAIKRSNCFHNSGGKDPCHINYNPYMIAFG  178

Query  474  VVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVS  295
              EII SQIP+FD++ WLS+VAAVMSFTYS IGL LG+AKVAEN K+ GS TGIS+G V+
Sbjct  179  TSEIILSQIPNFDKLSWLSVVAAVMSFTYSGIGLALGIAKVAENEKINGSRTGISLGIVT  238

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMC  115
              QK+WR  QALG IAFAYSYS+ILIEIQDTVKSPP+E+KTMKKAT +S+ VT++FY++C
Sbjct  239  PAQKMWRAFQALGNIAFAYSYSIILIEIQDTVKSPPSETKTMKKATRLSLTVTSIFYILC  298

Query  114  GCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            GC GYAAFGD +PGNLLT  GF NPFWL+DIANAAIVI
Sbjct  299  GCMGYAAFGDLAPGNLLTDKGFSNPFWLIDIANAAIVI  336



>ref|XP_006393747.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
 gb|ESQ31033.1| hypothetical protein EUTSA_v10011449mg [Eutrema salsugineum]
Length=477

 Score =   495 bits (1275),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 232/310 (75%), Positives = 270/310 (87%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            S+ FD+DGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQ+GWV GP VMLLFS VTYY
Sbjct  19   SELFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPAVMLLFSLVTYY  78

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS+LL  CYRSGD V GKRNYTYMDA+ SNLG ++VKICG++QY NLFG A+GYTIAS+I
Sbjct  79   TSILLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLFGTAIGYTIASAI  138

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SM+AI+R++C   +G K+PC +N NPYMI FGV +IIFSQIPDFDQ+WWLSI+AAVMSF 
Sbjct  139  SMIAIQRTSCQQINGDKDPCHVNGNPYMIGFGVAQIIFSQIPDFDQLWWLSILAAVMSFG  198

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YSTIGLGLG+++V EN ++ G+LTG+SIGTV+   K+WRT Q+LG IAFAY+YS+ILIEI
Sbjct  199  YSTIGLGLGISRVVENKEIKGTLTGVSIGTVTPTDKVWRTFQSLGNIAFAYAYSMILIEI  258

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDT+KSPPAE  TMKKATLISVAVTTLFYM+CGC GYAAFGD +PGNLL   GF NP+WL
Sbjct  259  QDTLKSPPAEENTMKKATLISVAVTTLFYMLCGCVGYAAFGDTAPGNLLAQGGFRNPYWL  318

Query  30   LDIANAAIVI  1
            LDIAN AI+I
Sbjct  319  LDIANLAIII  328



>ref|XP_004978920.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=473

 Score =   495 bits (1274),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 237/325 (73%), Positives = 277/325 (85%), Gaps = 6/325 (2%)
 Frame = -1

Query  957  FDVSINVGESK---CFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGP  787
             +VS+  G  +     DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA AQLGW AGP
Sbjct  8    LEVSVEAGNGRDGAWLDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGP  67

Query  786  TVMLLFSFVTYYTSVLLSECYRSG-DPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANL  610
             VMLLF+FV YYTS LL+ECYRSG DPV GKRNYTYMDAVR++LG  +V++CG IQYANL
Sbjct  68   AVMLLFAFVIYYTSTLLAECYRSGGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANL  127

Query  609  FGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQI  430
            FGVA+GYTIA+SISM+AIKR++CFHA G +NPC+ +SNPYMI+FGV E++FSQIPDFDQI
Sbjct  128  FGVAIGYTIAASISMLAIKRADCFHAKGHRNPCRSSSNPYMILFGVAEVVFSQIPDFDQI  187

Query  429  WWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALGA  253
            WWLSIVAAVMSFTYS IGL LGV +   NG   GSLTG+++G  V+  QKI+R+ QA G 
Sbjct  188  WWLSIVAAVMSFTYSAIGLALGVMQTVANGGFRGSLTGVAVGAGVTSAQKIFRSLQAFGN  247

Query  252  IAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSP  76
            IAFAYSY++ILIEIQDT+K+ PP+E+K MKKAT+ISVA TT+FYM+CGC GYAAFGD +P
Sbjct  248  IAFAYSYAIILIEIQDTIKAPPPSEAKVMKKATMISVATTTVFYMLCGCMGYAAFGDDAP  307

Query  75   GNLLTGFGFYNPFWLLDIANAAIVI  1
             NLLTGFGFY PFWLLDIANAAIV+
Sbjct  308  DNLLTGFGFYEPFWLLDIANAAIVV  332



>ref|XP_002458869.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
 gb|EES03989.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
Length=491

 Score =   495 bits (1275),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 240/333 (72%), Positives = 279/333 (84%), Gaps = 4/333 (1%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGES-KCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWA  817
              AA AAM  +V    +  G S KCFDDDGR KR GT+WTAS+HIITAVIGSGVLSL WA
Sbjct  12   PTAAPAAM--EVCGAELGKGASDKCFDDDGRPKRNGTMWTASSHIITAVIGSGVLSLGWA  69

Query  816  TAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKI  637
             AQLGWVAGP  MLLFS VTYYTS LL++CYRSGDP  GKRNYTYMDAV +NL  ++V+I
Sbjct  70   IAQLGWVAGPAAMLLFSLVTYYTSSLLADCYRSGDPSTGKRNYTYMDAVNANLSGIKVQI  129

Query  636  CGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIF  457
            CG +QYAN+ GVA+GYTIA+SISM+AI+R+NCFH  G  NPC+++S PYMI+FGV EI F
Sbjct  130  CGFLQYANIVGVAIGYTIAASISMLAIRRANCFHQKGHGNPCKVSSTPYMIIFGVAEIFF  189

Query  456  SQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIW  277
            SQIPDFDQI WLSI+AAVMSFTYS+IGLGLG+ +V  N  V GSLTGISIG V+ M K+W
Sbjct  190  SQIPDFDQISWLSILAAVMSFTYSSIGLGLGIVQVIANRGVQGSLTGISIGVVTPMDKVW  249

Query  276  RTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGY  100
            R+ QA G IAFAYSYSLILIEIQDT+++ PP+ES  MK+AT++SVAVTTLFYM+CGC GY
Sbjct  250  RSLQAFGDIAFAYSYSLILIEIQDTIRAPPPSESTVMKRATVVSVAVTTLFYMLCGCMGY  309

Query  99   AAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            AAFGD +PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  310  AAFGDGAPGNLLTGFGFYEPFWLLDVANAAIVV  342



>ref|XP_010653015.1| PREDICTED: amino acid permease 4-like [Vitis vinifera]
Length=504

 Score =   496 bits (1276),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 227/310 (73%), Positives = 269/310 (87%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKC DDDGR KRTGTVWTASAHIIT++IGSGVLSLAWA AQLGW+ GPTV+L+F+ V  Y
Sbjct  59   SKCLDDDGRPKRTGTVWTASAHIITSIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICY  118

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYRSGDP+ GKRNYTYM+ V+SNLG  +VKICG+IQY NLFG+ VGYTIA+S+
Sbjct  119  TSSLLADCYRSGDPISGKRNYTYMEVVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSV  178

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMA+ RSNCFH SG KNPC  +SNPYMIMFG++EI+ SQIPDFDQIWWLSI+A++MSFT
Sbjct  179  SMMAVMRSNCFHRSGNKNPCHESSNPYMIMFGIIEIVLSQIPDFDQIWWLSILASIMSFT  238

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YS+IGLGLGV+ VA NG   G+LTGISIGT++  QK+W+  QAL  IAF+Y YS +L+EI
Sbjct  239  YSSIGLGLGVSTVAANGIFKGTLTGISIGTITRTQKLWKCFQALANIAFSYCYSFVLVEI  298

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDT+KSPP+E+ TMKKA LISVA+TT FYM+CGC GYAA GDQ+PGNLLT FGF +PFWL
Sbjct  299  QDTIKSPPSEATTMKKANLISVAITTSFYMLCGCMGYAALGDQAPGNLLTEFGFRDPFWL  358

Query  30   LDIANAAIVI  1
            +DIAN AIVI
Sbjct  359  IDIANIAIVI  368



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   496 bits (1276),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 233/323 (72%), Positives = 273/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  951  VSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLL  772
            ++I    SKCFDDDGRLKRTGT WTA+AHIITAVIGSGVLSLAWA AQLGW  GP VM L
Sbjct  43   ITIQSNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAIAQLGWAVGPVVMFL  102

Query  771  FSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVG  592
            F+ V  YTS LL++CYR+ D V G+RNYTYMDAV+S LG  +VKICG+IQY NLFGVA+G
Sbjct  103  FAVVNLYTSSLLTQCYRTDDSVTGQRNYTYMDAVKSILGGKKVKICGVIQYVNLFGVAIG  162

Query  591  YTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIV  412
            YTIA+S+SMMAIKRSNC+H S GK+PC ++SN YMI FGV E++ SQIPDFDQ+WWLSIV
Sbjct  163  YTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFGVAEVLLSQIPDFDQVWWLSIV  222

Query  411  AAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAI  250
            AA+MSFTYS +GLGLGVAKVAEN    GSL GISIGTV++        KIWR+ QALGA+
Sbjct  223  AAIMSFTYSAVGLGLGVAKVAENRSFKGSLMGISIGTVTQAGTVTGTNKIWRSLQALGAM  282

Query  249  AFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGN  70
            AFAYS+S+ILIEIQDT+KSPP+E KTMKKAT++S+ +TT+FY++CG  GYAAFGD  PGN
Sbjct  283  AFAYSFSIILIEIQDTIKSPPSEHKTMKKATMLSIMITTVFYILCGSMGYAAFGDHVPGN  342

Query  69   LLTGFGFYNPFWLLDIANAAIVI  1
            LLTGFGFYNP+WLLDIAN AIV+
Sbjct  343  LLTGFGFYNPYWLLDIANFAIVV  365



>ref|XP_009107481.1| PREDICTED: amino acid permease 5-like [Brassica rapa]
Length=481

 Score =   494 bits (1272),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 232/336 (69%), Positives = 284/336 (85%), Gaps = 7/336 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSINV---GESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLS  829
            M EN+ +    ++   +SI+V     S  FD+DGR+KRTGTVWTASAHIITAVIGSGVLS
Sbjct  1    MVENSKS----RQELGISIDVLPRNSSDLFDEDGRVKRTGTVWTASAHIITAVIGSGVLS  56

Query  828  LAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSL  649
            LAWA AQ+GWV GP VM+LFS VTYYTS+LL  CYRSGD   GKRNYTYMDA+ SNLG +
Sbjct  57   LAWAVAQIGWVGGPVVMILFSLVTYYTSILLCACYRSGDSDTGKRNYTYMDAIHSNLGGI  116

Query  648  QVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVV  469
            +VK+CG++QY NLFG A+GYTIAS+ISM+AI+R++C  ++G K+PC +N NPYMI FG +
Sbjct  117  KVKLCGVVQYVNLFGTAIGYTIASAISMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGAI  176

Query  468  EIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM  289
            +IIFSQIPDFDQ+WWLSIVAA+MSF YSTIGLGLG++++ +N ++ G+LTG++IGTV+  
Sbjct  177  QIIFSQIPDFDQLWWLSIVAALMSFGYSTIGLGLGISRMVDNKEIKGTLTGVAIGTVTPT  236

Query  288  QKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGC  109
            +K+WRT Q+LG IAFAYSYS+ILIEIQDT+K+PPAE KTM+KATLISVAVTTLFYM+CGC
Sbjct  237  EKVWRTFQSLGNIAFAYSYSMILIEIQDTLKAPPAEEKTMRKATLISVAVTTLFYMLCGC  296

Query  108  FGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             GYAAFGD +PGNLL   GF NP+WLLDIAN AIVI
Sbjct  297  VGYAAFGDSAPGNLLAAGGFRNPYWLLDIANLAIVI  332



>ref|XP_006654425.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=495

 Score =   494 bits (1273),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 241/340 (71%), Positives = 281/340 (83%), Gaps = 7/340 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQKVFDVSI------NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
            M ENA AA ++     +S+      + G SK + D GRLKRTGT+WTASAHIITAVIGSG
Sbjct  1    MYENAIAAYVYYTAAILSLISAGLGHRGGSKLYADAGRLKRTGTMWTASAHIITAVIGSG  60

Query  837  VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
            VLSL WA AQLGWVAGP VMLLFSFVTYYTS LL++CYRSGD   GKRNYTYMDAV +NL
Sbjct  61   VLSLGWAIAQLGWVAGPAVMLLFSFVTYYTSALLADCYRSGDESSGKRNYTYMDAVNANL  120

Query  657  GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
              ++V++CG +QYA + GVA+GYTIA+SISM+AIKR+NCFH  G  +PC I+S PYMI+F
Sbjct  121  SGIKVQVCGFLQYATIVGVAIGYTIAASISMLAIKRANCFHVEGHGDPCNISSTPYMIIF  180

Query  477  GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTV  298
            GV EI FSQIPDFDQI WLSI+AAVMSFTYSTIGLGLGV +V  N    GS TGISIG V
Sbjct  181  GVAEIFFSQIPDFDQISWLSILAAVMSFTYSTIGLGLGVVQVVANKGAKGSFTGISIGVV  240

Query  297  SEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYM  121
            + M K+WR+ QA G IAFAYSYSLILIEIQDT+K+ PP+ESK M++AT++SVAVTTLFYM
Sbjct  241  TPMDKVWRSLQAFGDIAFAYSYSLILIEIQDTIKAPPPSESKVMRRATIVSVAVTTLFYM  300

Query  120  MCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            +CGC GYAAFGD++PGNLLTGFGFY PFWLLD+ANAAIV+
Sbjct  301  LCGCSGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAAIVV  340



>ref|XP_010090330.1| hypothetical protein L484_024995 [Morus notabilis]
 gb|EXB39300.1| hypothetical protein L484_024995 [Morus notabilis]
Length=511

 Score =   495 bits (1274),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 240/316 (76%), Positives = 278/316 (88%), Gaps = 6/316 (2%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKCFDDDGRLKRTGT WTA++HIITAVIGSGVLSLAWA AQLGWV GP VMLLF+FV  Y
Sbjct  48   SKCFDDDGRLKRTGTFWTATSHIITAVIGSGVLSLAWAVAQLGWVTGPIVMLLFAFVNLY  107

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYR+GD V G+RNYTYM+AV++NLG  +  +CG+IQY NLFGVA+GYTIA+S+
Sbjct  108  TSNLLAQCYRTGDRVTGQRNYTYMEAVKANLGGKRTMLCGLIQYLNLFGVAIGYTIAASV  167

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMAIKRSNCFH SGGK+PC ++SN YMI FG+ EIIFSQI DF Q+WWLSIVAA+MSFT
Sbjct  168  SMMAIKRSNCFHKSGGKDPCHMSSNGYMITFGISEIIFSQIQDFSQVWWLSIVAAIMSFT  227

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSYS  229
            YST+GLGLG+ KVA NGKV GSL GISIGTV+        QK+WR+ QALGAIAFAYS+S
Sbjct  228  YSTVGLGLGIGKVAVNGKVKGSLLGISIGTVTRAGTVTATQKMWRSLQALGAIAFAYSFS  287

Query  228  LILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            L+LIEIQDT++SPPAE KTMKKAT++SV VTT+FYM+CG FGYAAFGD+SPGNLLTGFGF
Sbjct  288  LVLIEIQDTIRSPPAEHKTMKKATVLSVTVTTVFYMLCGSFGYAAFGDESPGNLLTGFGF  347

Query  48   YNPFWLLDIANAAIVI  1
            YNP+WLLDIAN AIV+
Sbjct  348  YNPYWLLDIANVAIVV  363



>ref|XP_010479037.1| PREDICTED: amino acid permease 5 isoform X1 [Camelina sativa]
 ref|XP_010479038.1| PREDICTED: amino acid permease 5 isoform X2 [Camelina sativa]
 ref|XP_010479039.1| PREDICTED: amino acid permease 5 isoform X3 [Camelina sativa]
Length=474

 Score =   493 bits (1269),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 234/310 (75%), Positives = 266/310 (86%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            S  FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQ+GWV GP  MLLFS VTYY
Sbjct  17   SDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPVTMLLFSLVTYY  76

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS+LL  CYRSGD V GKRNYTYMDA++SNLG +++KICGI+QY NLFG A+GYTIAS+I
Sbjct  77   TSILLCSCYRSGDSVTGKRNYTYMDAIQSNLGGMKMKICGIVQYLNLFGTAIGYTIASAI  136

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SM+AI+R++C   +G   PC +N NPYMI FG+ +IIFSQIPD DQ+WWLSIVA VMSF 
Sbjct  137  SMIAIQRTSCQQTNGEDAPCPVNGNPYMIAFGISQIIFSQIPDIDQLWWLSIVATVMSFG  196

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YSTIGLGLG++KV EN +V G+LTG+SIGTV+  QK+WRT Q+LG IAFAYSYS+ILIEI
Sbjct  197  YSTIGLGLGISKVVENKEVKGTLTGVSIGTVTPEQKVWRTFQSLGNIAFAYSYSMILIEI  256

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDTVKSPP+E  TMKKATLISVAVTTLFYM+CGC GYAAFGD +PGNLL   GF NPFWL
Sbjct  257  QDTVKSPPSEENTMKKATLISVAVTTLFYMLCGCVGYAAFGDSAPGNLLATGGFRNPFWL  316

Query  30   LDIANAAIVI  1
            LDIAN AIV+
Sbjct  317  LDIANIAIVV  326



>ref|XP_004156002.1| PREDICTED: amino acid permease 4-like [Cucumis sativus]
Length=467

 Score =   493 bits (1268),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 227/315 (72%), Positives = 276/315 (88%), Gaps = 0/315 (0%)
 Frame = -1

Query  945  INVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFS  766
            + V +S  FDDDG  KRTGT WTASAHIITAVIGSGVLSLAWA AQLGW+AGP+VM+LF+
Sbjct  4    LPVNDSASFDDDGCPKRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWIAGPSVMILFA  63

Query  765  FVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYT  586
            F+ YYTS LL++CYRSGDPV+GKRN TYM AVRS LG   +  CGI+QY NL G+ +GYT
Sbjct  64   FIGYYTSCLLADCYRSGDPVNGKRNPTYMHAVRSLLGETHMVACGIMQYINLIGITIGYT  123

Query  585  IASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAA  406
            IASSISMMAIKRSNCFH+SGGKNPC I+SNP+M+ FG+VEII SQIP+FDQIWWLSIVAA
Sbjct  124  IASSISMMAIKRSNCFHSSGGKNPCHISSNPFMLSFGIVEIILSQIPNFDQIWWLSIVAA  183

Query  405  VMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSL  226
            +MSFTYS+IGL LG+AKVAE+G   G+L+GI++GTV++ +KIWR+ QALG IAFA S+++
Sbjct  184  IMSFTYSSIGLTLGIAKVAESGSFKGTLSGITVGTVTQSEKIWRSFQALGDIAFASSFAI  243

Query  225  ILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFY  46
            +LIE+QDT++SPP+E+KTMKKA   S+ +TT+FYM+CGC GYAAFG+ +PGNLLTGFGFY
Sbjct  244  VLIEVQDTIRSPPSETKTMKKAAGFSITLTTIFYMLCGCMGYAAFGNTAPGNLLTGFGFY  303

Query  45   NPFWLLDIANAAIVI  1
            NPFWLLDIAN +IV+
Sbjct  304  NPFWLLDIANVSIVV  318



>ref|XP_002449174.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
 gb|EES08162.1| hypothetical protein SORBIDRAFT_05g006010 [Sorghum bicolor]
Length=481

 Score =   493 bits (1269),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 234/313 (75%), Positives = 271/313 (87%), Gaps = 2/313 (1%)
 Frame = -1

Query  933  ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTY  754
            +++  DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA AQLGW AGP VM+LF+ V Y
Sbjct  27   DAEWRDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMILFAVVIY  86

Query  753  YTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASS  574
            YTS LL+ECYRSGDPV GKRNYTYMDAVRS+LG  +V +CG IQYANLFGVA+GYTIA+S
Sbjct  87   YTSTLLAECYRSGDPVAGKRNYTYMDAVRSSLGGAKVTLCGSIQYANLFGVAIGYTIAAS  146

Query  573  ISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSF  394
            ISM+AIKR++CFH  G +NPC+ +SNPYMI+FGV E++FSQIPDFDQIWWLSIVAAVMSF
Sbjct  147  ISMLAIKRADCFHVKGHRNPCRSSSNPYMILFGVAEVVFSQIPDFDQIWWLSIVAAVMSF  206

Query  393  TYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALGAIAFAYSYSLILI  217
            TYSTIGL LGV +   NG   GSLTGISIG  ++  QK+WR+ QA G IAFAYSYS+ILI
Sbjct  207  TYSTIGLVLGVMQTVANGGFQGSLTGISIGAGITPTQKVWRSLQAFGNIAFAYSYSIILI  266

Query  216  EIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNP  40
            EIQDTVK+ PP+E+K MK+AT++SVA TT+FYM+CGC GYAAFGD +P NLLTGFGFY P
Sbjct  267  EIQDTVKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAFGDGAPDNLLTGFGFYEP  326

Query  39   FWLLDIANAAIVI  1
            FWLLDIAN AIV+
Sbjct  327  FWLLDIANVAIVV  339



>ref|XP_009145052.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145053.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 ref|XP_009145054.1| PREDICTED: amino acid permease 5 [Brassica rapa]
 emb|CDY43854.1| BnaA05g18660D [Brassica napus]
Length=487

 Score =   493 bits (1269),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 230/317 (73%), Positives = 271/317 (85%), Gaps = 6/317 (2%)
 Frame = -1

Query  933  ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTY  754
             S  FD+DGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQ+GWV GP VM+LFS VTY
Sbjct  22   SSDLFDEDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPAVMILFSLVTY  81

Query  753  YTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASS  574
            YTS+LL  CYRSGD V GKRNYTYMDA+ SNLG ++VKICG++QY NLFG A+GYTIAS+
Sbjct  82   YTSILLCTCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLFGTAIGYTIASA  141

Query  573  ISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSF  394
            +SM+AI+R++C  ++G K+PC +N NPYMI FGV++I+FSQIPDFDQ+WWLSIVAAVMSF
Sbjct  142  VSMIAIQRTSCQQSNGDKDPCHVNGNPYMIAFGVIQIVFSQIPDFDQLWWLSIVAAVMSF  201

Query  393  TYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------MQKIWRTSQALGAIAFAYSY  232
             YST+GLGLG++KV EN ++ G+LTG++IGTV+        QK+WRT Q+LG IAFAY+Y
Sbjct  202  GYSTVGLGLGISKVVENKEIKGTLTGVTIGTVTSSGTVTPTQKVWRTFQSLGNIAFAYAY  261

Query  231  SLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFG  52
            S+ILIEIQDT+KSPPAE  TM+KATLISV VTTLFYM+CGC GYAAFGD SPGNLL   G
Sbjct  262  SMILIEIQDTLKSPPAEENTMRKATLISVVVTTLFYMLCGCVGYAAFGDSSPGNLLAAGG  321

Query  51   FYNPFWLLDIANAAIVI  1
            F NP+WLLDIAN AIVI
Sbjct  322  FRNPYWLLDIANLAIVI  338



>ref|XP_008679681.1| PREDICTED: amino acid permease 3-like [Zea mays]
 gb|AFW65568.1| hypothetical protein ZEAMMB73_193502 [Zea mays]
Length=472

 Score =   492 bits (1267),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 234/318 (74%), Positives = 272/318 (86%), Gaps = 2/318 (1%)
 Frame = -1

Query  948  SINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLF  769
            S+  G     DDDGR +RTGTVWTASAHIITAVIGSGVLSLAWA AQLGW AGP VMLLF
Sbjct  14   SVEAGAYGGRDDDGRPRRTGTVWTASAHIITAVIGSGVLSLAWAIAQLGWAAGPAVMLLF  73

Query  768  SFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGY  589
            + V YYTS LL+ECYRSGDPV GKRNYTYMDAVR++LG  +V++CG IQYANLFGVA+GY
Sbjct  74   AVVIYYTSTLLAECYRSGDPVAGKRNYTYMDAVRASLGGAKVRLCGAIQYANLFGVAIGY  133

Query  588  TIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVA  409
            TIA+SISM+AIKR++CFHA G K+ C+ +SNPYMI+FGV E++FSQIPDFDQIWWLSIVA
Sbjct  134  TIAASISMLAIKRADCFHAKGHKHACRSSSNPYMILFGVAEVVFSQIPDFDQIWWLSIVA  193

Query  408  AVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALGAIAFAYSY  232
            AVMSFTY+TIGL LG+ +   NG   GSLTGISIG  V+  +K+WR+ QA G IAFAYSY
Sbjct  194  AVMSFTYATIGLVLGIMQTVANGGFQGSLTGISIGAGVTPTEKVWRSLQAFGNIAFAYSY  253

Query  231  SLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGF  55
            S+ILIEIQDTVK+ PP+E+K MK+AT++SVA TT+FYM+CGC GYAAFGD +P NLLTGF
Sbjct  254  SIILIEIQDTVKAPPPSEAKVMKRATMVSVATTTVFYMLCGCMGYAAFGDAAPDNLLTGF  313

Query  54   GFYNPFWLLDIANAAIVI  1
            GFY PFWLLDIAN AIV+
Sbjct  314  GFYEPFWLLDIANVAIVV  331



>gb|KEH30491.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   493 bits (1270),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 277/337 (82%), Gaps = 6/337 (2%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAT  814
            E  A   +  +   VSI    SKCFDDDGRLKRTGT WTA+AHIITAVIGSGVLSLAWA 
Sbjct  28   EVEAQPKIQTETESVSIEPNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAI  87

Query  813  AQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKIC  634
            AQLGW  GP VM+LF+ V  YTS LL++CYR+ D V+G+RNYTY DAV+S LG  + K+C
Sbjct  88   AQLGWAVGPVVMILFAVVNLYTSSLLTQCYRTDDSVNGQRNYTYTDAVKSILGGKKFKMC  147

Query  633  GIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFS  454
            G+IQY NLFG+A+GYTIA+S+SMMAIKRSNC+H S GK+PC ++SN YMI F + E+I S
Sbjct  148  GLIQYVNLFGIAIGYTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFAIAEVILS  207

Query  453  QIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------  292
            QIPDFDQ+WWLSIVAA+MSFTYS +GLGLG+AKVAENG   GSL GISIG V++      
Sbjct  208  QIPDFDQVWWLSIVAAIMSFTYSAVGLGLGIAKVAENGAFQGSLMGISIGAVTQAGTVTG  267

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALGA+AF+YS+S+ILIEIQDT+KSPP+E KTMKKATL+S+ VTT+FY++CG
Sbjct  268  TQKIWRSLQALGAMAFSYSFSIILIEIQDTLKSPPSEHKTMKKATLVSIMVTTVFYLLCG  327

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
              GYAAFGD  PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  328  GMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLAIVV  364



>gb|KEH30492.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   493 bits (1269),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 277/337 (82%), Gaps = 6/337 (2%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAT  814
            E  A   +  +   VSI    SKCFDDDGRLKRTGT WTA+AHIITAVIGSGVLSLAWA 
Sbjct  28   EVEAQPKIQTETESVSIEPNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAI  87

Query  813  AQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKIC  634
            AQLGW  GP VM+LF+ V  YTS LL++CYR+ D V+G+RNYTY DAV+S LG  + K+C
Sbjct  88   AQLGWAVGPVVMILFAVVNLYTSSLLTQCYRTDDSVNGQRNYTYTDAVKSILGGKKFKMC  147

Query  633  GIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFS  454
            G+IQY NLFG+A+GYTIA+S+SMMAIKRSNC+H S GK+PC ++SN YMI F + E+I S
Sbjct  148  GLIQYVNLFGIAIGYTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFAIAEVILS  207

Query  453  QIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------  292
            QIPDFDQ+WWLSIVAA+MSFTYS +GLGLG+AKVAENG   GSL GISIG V++      
Sbjct  208  QIPDFDQVWWLSIVAAIMSFTYSAVGLGLGIAKVAENGAFQGSLMGISIGAVTQAGTVTG  267

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALGA+AF+YS+S+ILIEIQDT+KSPP+E KTMKKATL+S+ VTT+FY++CG
Sbjct  268  TQKIWRSLQALGAMAFSYSFSIILIEIQDTLKSPPSEHKTMKKATLVSIMVTTVFYLLCG  327

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
              GYAAFGD  PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  328  GMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLAIVV  364



>gb|EEC68963.1| hypothetical protein OsI_37697 [Oryza sativa Indica Group]
Length=482

 Score =   492 bits (1266),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 239/341 (70%), Positives = 278/341 (82%), Gaps = 7/341 (2%)
 Frame = -1

Query  1008  NMKMGENAAAAAMHQKVFDVSI---NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSG  838
             +M  G+ A    M  K  +VS+   N G++   DDDGR +RTGT WTASAHIITAVIGSG
Sbjct  3     DMASGQKAKQQVM--KPMEVSVEAGNAGDAAWLDDDGRARRTGTFWTASAHIITAVIGSG  60

Query  837   VLSLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNL  658
             VLSLAWA AQLGWVAGP VMLLF+FV YYTS LL+ECYR+GDP  GKRNYTYMDAVR+NL
Sbjct  61    VLSLAWAIAQLGWVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANL  120

Query  657   GSLQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMF  478
             G  +V  CG+IQYANL GVA+GYTIASSISM AI+R+ CFH +G  +PC+ +SNPYMI+F
Sbjct  121   GGAKVTFCGVIQYANLVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILF  180

Query  477   GVVEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-  301
             GVV+I+FSQIPDFDQIWWLSIVAAVMSFTYS IGL LG+ +   NG + GSLTGISIG  
Sbjct  181   GVVQIVFSQIPDFDQIWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVG  240

Query  300   VSEMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFY  124
             VS  QK+WR+ QA G IAFAYS+S ILIEIQDT+K+ PP+E+K MK AT +SVA TT+FY
Sbjct  241   VSSTQKVWRSLQAFGDIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFY  300

Query  123   MMCGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
             M+CGC GYAAFGD +P NLLTGFGFY PFWLLD+AN AIV+
Sbjct  301   MLCGCMGYAAFGDAAPDNLLTGFGFYEPFWLLDVANVAIVV  341



>ref|XP_002893978.1| hypothetical protein ARALYDRAFT_473798 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70237.1| hypothetical protein ARALYDRAFT_473798 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   491 bits (1264),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/317 (74%), Positives = 268/317 (85%), Gaps = 6/317 (2%)
 Frame = -1

Query  933  ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTY  754
             S  FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQ+GWV GP  MLLFSFVTY
Sbjct  16   SSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPVTMLLFSFVTY  75

Query  753  YTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASS  574
            YTS LL  CYRSGD V GKRNYTYMDA+ +NLG ++VK+CG++QY NLFG A+GYTIAS+
Sbjct  76   YTSTLLCSCYRSGDSVSGKRNYTYMDAIHANLGGIKVKVCGVVQYLNLFGTAIGYTIASA  135

Query  573  ISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSF  394
            IS++AI+R++C   +GG +PC +N N YMI FGVV+IIFSQIPDFDQ+WWLSIVAAVMSF
Sbjct  136  ISLVAIQRTSCQQMNGGNHPCHVNGNVYMIAFGVVQIIFSQIPDFDQLWWLSIVAAVMSF  195

Query  393  TYSTIGLGLGVAKVAENGKVLGSLTGISI------GTVSEMQKIWRTSQALGAIAFAYSY  232
             YSTIGLGLGV+KV EN ++ GSLTG+++      GTV+  QKIWRT Q+LG IAFAYSY
Sbjct  196  GYSTIGLGLGVSKVVENKEIKGSLTGVTVGTVTPSGTVTPTQKIWRTFQSLGNIAFAYSY  255

Query  231  SLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFG  52
            S+ILIEIQDTVKSPPAE  TM+KAT +SVAVTTLFYM+CGC GYAAFGD +PGNLL   G
Sbjct  256  SMILIEIQDTVKSPPAEVNTMRKATFVSVAVTTLFYMLCGCVGYAAFGDTAPGNLLANGG  315

Query  51   FYNPFWLLDIANAAIVI  1
            F NPFWLLDIAN AIVI
Sbjct  316  FRNPFWLLDIANLAIVI  332



>gb|AFK37021.1| unknown [Medicago truncatula]
Length=512

 Score =   491 bits (1265),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/337 (69%), Positives = 276/337 (82%), Gaps = 6/337 (2%)
 Frame = -1

Query  993  ENAAAAAMHQKVFDVSINVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWAT  814
            E  A   +  +   VSI    SKCFDDDGRLKRTGT WTA+AHIITAVIGSGVLSLAWA 
Sbjct  28   EVEAQPKIQTETESVSIEPNYSKCFDDDGRLKRTGTFWTATAHIITAVIGSGVLSLAWAI  87

Query  813  AQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKIC  634
            AQLGW  GP VM+LF+ V  YTS LL++CYR+ D V+G+RNYTY DAV+S LG  + K+C
Sbjct  88   AQLGWAVGPVVMILFAVVNLYTSSLLTQCYRTDDSVNGQRNYTYTDAVKSILGGKKFKMC  147

Query  633  GIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFS  454
            G+IQY NLFG+A+GYTIA+S+SMMAIKRSNC+H S GK+PC ++SN YMI F + E+I S
Sbjct  148  GLIQYVNLFGIAIGYTIAASVSMMAIKRSNCYHESHGKDPCHMSSNGYMITFAIAEVILS  207

Query  453  QIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSE------  292
            QIPDFDQ+WWLSIVAA+MSFTYS +GLGLG+AKVAENG   GSL GISIG V++      
Sbjct  208  QIPDFDQVWWLSIVAAIMSFTYSAVGLGLGIAKVAENGAFQGSLMGISIGAVTQAGTVTG  267

Query  291  MQKIWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCG  112
             QKIWR+ QALGA+AF+YS+S+ILIEIQDT+KSPP+E KTMKKATL+S+ VT +FY++CG
Sbjct  268  TQKIWRSLQALGAMAFSYSFSIILIEIQDTLKSPPSEHKTMKKATLVSIMVTAVFYLLCG  327

Query  111  CFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
              GYAAFGD  PGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  328  GMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLAIVV  364



>emb|CAN77083.1| hypothetical protein VITISV_003992 [Vitis vinifera]
Length=546

 Score =   492 bits (1266),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 226/310 (73%), Positives = 268/310 (86%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            SKC DDDG  KRTGTVWTASAHIIT++IGSGVLSLAWA AQLGW+ GPTV+L+F+ V  Y
Sbjct  89   SKCLDDDGXPKRTGTVWTASAHIITSIIGSGVLSLAWAVAQLGWIGGPTVILMFAVVICY  148

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS LL++CYRSGDP+ GKRNYTYM+ V+SNLG  +VKICG+IQY NLFG+ VGYTIA+S+
Sbjct  149  TSSLLADCYRSGDPISGKRNYTYMEVVQSNLGGAKVKICGLIQYCNLFGITVGYTIATSV  208

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SMMA+ RSNCFH SG KNPC  +SNPYMIMFG++EI+ SQIPDFDQIWWLSI+A++MSFT
Sbjct  209  SMMAVMRSNCFHRSGNKNPCHESSNPYMIMFGIIEIVLSQIPDFDQIWWLSILASIMSFT  268

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YS+IGLGLGV+ VA NG   G+LTGISIGT++  QK+W+  QAL  IAF+Y YS +L+EI
Sbjct  269  YSSIGLGLGVSTVAANGIFKGTLTGISIGTITRTQKLWKCFQALANIAFSYCYSFVLVEI  328

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDT+KSPP+E+ TMKKA LISVA+TT FYM+CGC GYAA GDQ+PGNLLT FGF +PFWL
Sbjct  329  QDTIKSPPSEATTMKKANLISVAITTSFYMLCGCMGYAALGDQAPGNLLTEFGFRDPFWL  388

Query  30   LDIANAAIVI  1
            +DIAN AIVI
Sbjct  389  IDIANIAIVI  398



>ref|NP_001066316.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|ABA95951.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29335.1| Os12g0181500 [Oryza sativa Japonica Group]
 gb|EAZ19852.1| hypothetical protein OsJ_35437 [Oryza sativa Japonica Group]
 dbj|BAG87933.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93965.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   489 bits (1259),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 236/326 (72%), Positives = 272/326 (83%), Gaps = 5/326 (2%)
 Frame = -1

Query  963  KVFDVSI---NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            K  +VS+   N GE+   DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA AQLGWVA
Sbjct  9    KPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVA  68

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLF+FV YYTS LL+ECYR+GDP  GKRNYTYMDAVR+NLG  +V  CG+IQYAN
Sbjct  69   GPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYAN  128

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            L GVA+GYTIASSISM AI+R+ CFH +G  +PC+ +SNPYMI+FGVV+I+FSQIPDFDQ
Sbjct  129  LVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVFSQIPDFDQ  188

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALG  256
            IWWLSIVAAVMSFTYS IGL LG+ +   NG + GSLTGISIG  VS  QK+WR+ QA G
Sbjct  189  IWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSLQAFG  248

Query  255  AIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
             IAFAYS+S ILIEIQDT+K+ PP+E+K MK AT +SVA TT+FYM+CGC GYAAFGD +
Sbjct  249  DIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAFGDAA  308

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            P NLLTGFGFY PFWLLD+AN AIV+
Sbjct  309  PDNLLTGFGFYEPFWLLDVANVAIVV  334



>gb|EAY82481.1| hypothetical protein OsI_37698 [Oryza sativa Indica Group]
Length=475

 Score =   489 bits (1259),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 236/326 (72%), Positives = 272/326 (83%), Gaps = 5/326 (2%)
 Frame = -1

Query  963  KVFDVSI---NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            K  +VS+   N GE+   DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA AQLGWVA
Sbjct  9    KPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVA  68

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLF+FV YYTS LL+ECYR+GDP  GKRNYTYMDAVR+NLG  +V  CG+IQYAN
Sbjct  69   GPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYAN  128

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            L GVA+GYTIASSISM AI+R+ CFH +G  +PC+ +SNPYMI+FGVV+I+FSQIPDFDQ
Sbjct  129  LVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVFSQIPDFDQ  188

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALG  256
            IWWLSIVAAVMSFTYS IGL LG+ +   NG + GSLTGISIG  VS  QK+WR+ QA G
Sbjct  189  IWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSLQAFG  248

Query  255  AIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
             IAFAYS+S ILIEIQDT+K+ PP+E+K MK AT +SVA TT+FYM+CGC GYAAFGD +
Sbjct  249  DIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAFGDAA  308

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            P NLLTGFGFY PFWLLD+AN AIV+
Sbjct  309  PDNLLTGFGFYEPFWLLDVANVAIVV  334



>ref|XP_002442926.1| hypothetical protein SORBIDRAFT_08g005000 [Sorghum bicolor]
 gb|EES16764.1| hypothetical protein SORBIDRAFT_08g005000 [Sorghum bicolor]
Length=482

 Score =   489 bits (1258),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 268/316 (85%), Gaps = 2/316 (1%)
 Frame = -1

Query  942  NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSF  763
            N G +   DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA AQLGWVAGPT MLLF+F
Sbjct  26   NAGAAAWLDDDGRPRRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVAGPTAMLLFAF  85

Query  762  VTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTI  583
            VTYYT+ LL+ECYR+GDP  GKRNYTYMDAVRSNLG  +V  CGIIQYANL GVA+GYTI
Sbjct  86   VTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGGAKVVFCGIIQYANLVGVAIGYTI  145

Query  582  ASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAV  403
            ASSISM AI+R+ CFH+ G ++PC+ +S PYMI+FGVVEI+FSQIPDFDQIWWLSIVAAV
Sbjct  146  ASSISMKAIRRAGCFHSHGHEDPCKSSSTPYMILFGVVEILFSQIPDFDQIWWLSIVAAV  205

Query  402  MSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALGAIAFAYSYSL  226
            MSFTYS+IGL LG+A+   +G   GSLTG+SIG  V+  QKIW T QA G IAFAYS+S 
Sbjct  206  MSFTYSSIGLSLGIAQTVSHGGFKGSLTGVSIGAGVTSTQKIWHTLQAFGDIAFAYSFSN  265

Query  225  ILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGF  49
            ILIEIQDT+K+ PP+ESK M+KAT +SVA TT+FYM+CGC GYAAFGD +P NLLTGFGF
Sbjct  266  ILIEIQDTIKAPPPSESKVMQKATRLSVATTTIFYMLCGCMGYAAFGDAAPDNLLTGFGF  325

Query  48   YNPFWLLDIANAAIVI  1
            Y PFWLLDIAN AIV+
Sbjct  326  YEPFWLLDIANIAIVV  341



>gb|AAX56952.1| amino acid transporter, partial [Pisum sativum]
Length=468

 Score =   488 bits (1256),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/311 (74%), Positives = 268/311 (86%), Gaps = 0/311 (0%)
 Frame = -1

Query  933  ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTY  754
            +SK FDDD RLKRTGTVWT S+HIITAV+GSGVLSLAWA AQLGWV GP+VML FS +T+
Sbjct  13   DSKLFDDDDRLKRTGTVWTTSSHIITAVVGSGVLSLAWAIAQLGWVIGPSVMLFFSLITW  72

Query  753  YTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASS  574
            YTS LL+ECYR GDP  GKRNYT+M+AV + LG     +CGI+QY+NL+G A+GYTIA++
Sbjct  73   YTSSLLAECYRIGDPHSGKRNYTFMEAVHTILGGFNDTLCGIVQYSNLYGTAIGYTIAAA  132

Query  573  ISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSF  394
            ISMMAIKRS CFH+SGGK+ C I+SNPYMI FGV++I FSQIPDF ++WWLSIVAA+MSF
Sbjct  133  ISMMAIKRSGCFHSSGGKDGCHISSNPYMISFGVIQIFFSQIPDFHKMWWLSIVAAIMSF  192

Query  393  TYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIE  214
            TYS IGLGL +AKVAENG   GSLTG++IG V+E QK+W   QALG IAFAYSYS ILIE
Sbjct  193  TYSLIGLGLAIAKVAENGSFKGSLTGVTIGMVTEAQKVWGVFQALGNIAFAYSYSQILIE  252

Query  213  IQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFW  34
            IQDT+K+PP+E KTMK+AT IS+ VTT+FYM+CG  GYAAFGD SPGNLLTGFGFYNP+W
Sbjct  253  IQDTIKNPPSEVKTMKQATRISIGVTTIFYMLCGGMGYAAFGDTSPGNLLTGFGFYNPYW  312

Query  33   LLDIANAAIVI  1
            L+DIANAAIVI
Sbjct  313  LIDIANAAIVI  323



>ref|XP_004977210.1| PREDICTED: amino acid permease 3-like [Setaria italica]
Length=480

 Score =   488 bits (1257),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 279/339 (82%), Gaps = 6/339 (2%)
 Frame = -1

Query  999  MGENAAAAAMHQ-KVFDVSINVG---ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVL  832
            MG +     MH+    +VS+  G   +++  DDDGR +RTGT WTASAHIITAVIGSGVL
Sbjct  1    MGAHNGVNNMHEVAPMEVSVEAGNFQDAERLDDDGRPRRTGTFWTASAHIITAVIGSGVL  60

Query  831  SLAWATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGS  652
            SLAWA AQLGWVAGP  MLLF+FVTYYT+ LL+ECYR+GDP  GKRNYTYMDAVRSNLG 
Sbjct  61   SLAWAIAQLGWVAGPAAMLLFAFVTYYTATLLAECYRTGDPETGKRNYTYMDAVRSNLGG  120

Query  651  LQVKICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGV  472
             +V  CG+IQYANL GVA+GYTIASSISM AI+R++CFH +G  +PC+ +S PYMI+FGV
Sbjct  121  AKVVFCGVIQYANLVGVAIGYTIASSISMRAIRRADCFHTNGHADPCKSSSTPYMILFGV  180

Query  471  VEIIFSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VS  295
            V+I+FSQIPDFDQIWWLSIVAAVMSFTYS+IGL LG+A+   NG   GSLTGISIG  V+
Sbjct  181  VQILFSQIPDFDQIWWLSIVAAVMSFTYSSIGLSLGIAQTISNGGFKGSLTGISIGADVT  240

Query  294  EMQKIWRTSQALGAIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMM  118
              QKIW + QA G IAFAYS+S ILIEIQDT+K+ PP+E+K M+KAT +SVA TT+FYM+
Sbjct  241  STQKIWHSLQAFGDIAFAYSFSNILIEIQDTIKAPPPSEAKVMQKATRLSVATTTIFYML  300

Query  117  CGCFGYAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            CGC GYAAFGD++P NLLTGFGFY PFWLLDIAN AIV+
Sbjct  301  CGCMGYAAFGDEAPDNLLTGFGFYEPFWLLDIANVAIVV  339



>ref|XP_006307383.1| hypothetical protein CARUB_v10009009mg [Capsella rubella]
 gb|EOA40281.1| hypothetical protein CARUB_v10009009mg [Capsella rubella]
Length=480

 Score =   488 bits (1257),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 230/317 (73%), Positives = 264/317 (83%), Gaps = 6/317 (2%)
 Frame = -1

Query  933  ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTY  754
             S  FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQ+GWV GP  MLLFS VTY
Sbjct  16   SSDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPVTMLLFSLVTY  75

Query  753  YTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASS  574
            YTS LL  CYRSGD V GKRNYTYMDA+ SNLG ++VKICG++QY NLFG A+GYTIAS+
Sbjct  76   YTSTLLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKICGVVQYVNLFGTAIGYTIASA  135

Query  573  ISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSF  394
            IS++AI+R+ C   +G  +PC +N NPYMI FG+V+IIFSQIPDFDQ+WWLSIVAAVMSF
Sbjct  136  ISLIAIQRTTCQQTNGANDPCHVNGNPYMIAFGIVQIIFSQIPDFDQLWWLSIVAAVMSF  195

Query  393  TYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEM------QKIWRTSQALGAIAFAYSY  232
             YS IGLGLGV+KV EN ++ G+LTG++IGTV+        QK+WRT Q+LG IAFAYSY
Sbjct  196  GYSAIGLGLGVSKVVENKEIKGTLTGVTIGTVTSSGTVTPPQKVWRTFQSLGNIAFAYSY  255

Query  231  SLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFG  52
            S+ILIEIQDTVKSPPAE  TM+KAT +SV VTTLFYM+CGC GYAAFGD +PGNLL   G
Sbjct  256  SMILIEIQDTVKSPPAEENTMRKATFVSVVVTTLFYMLCGCIGYAAFGDSAPGNLLAAGG  315

Query  51   FYNPFWLLDIANAAIVI  1
            F NPFWLLD+AN AIV+
Sbjct  316  FRNPFWLLDVANIAIVV  332



>ref|NP_001066317.1| Os12g0181600 [Oryza sativa Japonica Group]
 gb|ABA95955.1| amino acid transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29336.1| Os12g0181600 [Oryza sativa Japonica Group]
 dbj|BAG87950.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97363.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   488 bits (1256),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 235/326 (72%), Positives = 271/326 (83%), Gaps = 5/326 (2%)
 Frame = -1

Query  963  KVFDVSI---NVGESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVA  793
            K  +VS+   N GE+   DDDGR +RTGT WTASAHIITAVIGSGVLSLAWA AQLGWVA
Sbjct  9    KPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWAIAQLGWVA  68

Query  792  GPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYAN  613
            GP VMLLF+FV YYTS LL+ECYR+GDP  GKRNYTYMDAVR+NLG  +V  CG+IQYAN
Sbjct  69   GPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTFCGVIQYAN  128

Query  612  LFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQ  433
            L GVA+GYTIASSISM AI+R+ CFH +G  +PC+ +SNPYMI+FG V+I+FSQIPDFDQ
Sbjct  129  LVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGAVQIVFSQIPDFDQ  188

Query  432  IWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIGT-VSEMQKIWRTSQALG  256
            IWWLSIVAAVMSFTYS IGL LG+ +   NG + GSLTGISIG  VS  QK+WR+ QA G
Sbjct  189  IWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKVWRSLQAFG  248

Query  255  AIAFAYSYSLILIEIQDTVKS-PPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQS  79
             IAFAYS+S ILIEIQDT+K+ PP+E+K MK AT +SVA TT+FYM+CGC GYAAFGD +
Sbjct  249  DIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMGYAAFGDAA  308

Query  78   PGNLLTGFGFYNPFWLLDIANAAIVI  1
            P NLLTGFGFY PFWLLD+AN AIV+
Sbjct  309  PDNLLTGFGFYEPFWLLDVANVAIVV  334



>emb|CAA92992.1| amino acid carrier [Ricinus communis]
Length=284

 Score =   480 bits (1236),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/274 (82%), Positives = 250/274 (91%), Gaps = 1/274 (0%)
 Frame = -1

Query  819  ATAQLGWVAGPTVMLLFSFVTYYTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVK  640
            A AQ+GW+AGP VM LFS VTYYTS LLS CYRSGDPV+GKRNYTYMDAVR+NLG  +VK
Sbjct  1    AIAQIGWIAGPAVMFLFSLVTYYTSTLLSACYRSGDPVNGKRNYTYMDAVRTNLGGAKVK  60

Query  639  ICGIIQYANLFGVAVGYTIASSISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEII  460
            +CG +QY NLFGVA+GYTIASSISMMAIKRSNCFH SGGKNPC IN+NPYMI FG+ EII
Sbjct  61   LCGFVQYLNLFGVAIGYTIASSISMMAIKRSNCFHKSGGKNPCHINANPYMIAFGIAEII  120

Query  459  FSQIPDFDQIWWLSIVAAVMSFTYSTIGLGLGVAKVAENGKVLGSLTGISIG-TVSEMQK  283
            FSQIPDFDQ+WWLSI+AAVMSFTYSTIGLGLG+A+V ENGK +GS+TGISIG  V+  QK
Sbjct  121  FSQIPDFDQLWWLSILAAVMSFTYSTIGLGLGIAQVVENGKAMGSVTGISIGANVTPTQK  180

Query  282  IWRTSQALGAIAFAYSYSLILIEIQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFG  103
            IWR+ QALG IAFAYSYS+ILIEIQDTV+SPP+ESKTMKKATLISVAVTTLFYM+CGCFG
Sbjct  181  IWRSFQALGDIAFAYSYSIILIEIQDTVRSPPSESKTMKKATLISVAVTTLFYMLCGCFG  240

Query  102  YAAFGDQSPGNLLTGFGFYNPFWLLDIANAAIVI  1
            YAAFGD SPGNLLTGFGFYNP+WLLDIAN AIV+
Sbjct  241  YAAFGDMSPGNLLTGFGFYNPYWLLDIANVAIVV  274



>ref|XP_010500132.1| PREDICTED: amino acid permease 5-like isoform X1 [Camelina sativa]
 ref|XP_010500133.1| PREDICTED: amino acid permease 5-like isoform X2 [Camelina sativa]
Length=474

 Score =   487 bits (1254),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 231/310 (75%), Positives = 264/310 (85%), Gaps = 0/310 (0%)
 Frame = -1

Query  930  SKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTYY  751
            S  FDDDGR KRTGTVWTASAHIITAVIGSGVLSLAWA AQ+GWV GP  MLLFS VTYY
Sbjct  17   SDLFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWVGGPVTMLLFSLVTYY  76

Query  750  TSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASSI  571
            TS+LL  CYRSGD V GKRNYTYMDA++SNLG +++KICGI+QY NLFG A+GYTIAS+ 
Sbjct  77   TSILLCSCYRSGDSVTGKRNYTYMDAIQSNLGGIKMKICGIVQYLNLFGTAIGYTIASAT  136

Query  570  SMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSFT  391
            SM+AI+R++C   +G   PC +N NPYMI FGV +IIFSQIPD DQ+WWLSIVA VMSF 
Sbjct  137  SMIAIQRTSCQQTNGEDAPCPVNGNPYMIAFGVSQIIFSQIPDIDQLWWLSIVATVMSFG  196

Query  390  YSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIEI  211
            YSTIGLGLG++KV EN +V G+LTG+SIGTV+  QK+W+T Q+LG IAFAYSYS+ILIEI
Sbjct  197  YSTIGLGLGISKVVENKEVKGTLTGVSIGTVTPEQKVWKTFQSLGNIAFAYSYSMILIEI  256

Query  210  QDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFWL  31
            QDTVKSPP+E  TMKKAT+ISV VTTLFYM+CGC GYAAFGD +PGNLL   GF NPFWL
Sbjct  257  QDTVKSPPSEENTMKKATIISVGVTTLFYMLCGCVGYAAFGDSAPGNLLATGGFRNPFWL  316

Query  30   LDIANAAIVI  1
            LDIAN AIV+
Sbjct  317  LDIANIAIVV  326



>emb|CAC51423.1| amino acid permease AAP1 [Vicia faba var. minor]
Length=475

 Score =   486 bits (1252),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 227/311 (73%), Positives = 270/311 (87%), Gaps = 0/311 (0%)
 Frame = -1

Query  933  ESKCFDDDGRLKRTGTVWTASAHIITAVIGSGVLSLAWATAQLGWVAGPTVMLLFSFVTY  754
            +SK FDDD R+KRTGTVWT S+HIITAV+GSGVLSLAWA AQLGW+ G +VM+ FS +T+
Sbjct  20   DSKLFDDDDRVKRTGTVWTTSSHIITAVVGSGVLSLAWAIAQLGWIIGLSVMIFFSLITW  79

Query  753  YTSVLLSECYRSGDPVDGKRNYTYMDAVRSNLGSLQVKICGIIQYANLFGVAVGYTIASS  574
            YTS LLSECYR+GDP  GKRNYT+M+AV + LG     +CGI+QY+NL+G AVGYTI +S
Sbjct  80   YTSSLLSECYRTGDPHFGKRNYTFMEAVHTILGGFYDTLCGIVQYSNLYGTAVGYTIGAS  139

Query  573  ISMMAIKRSNCFHASGGKNPCQINSNPYMIMFGVVEIIFSQIPDFDQIWWLSIVAAVMSF  394
            ISMMAIKRSNCFH+SGGK+ C+I+SNPYMI FGV++I FSQIPDF ++WWLSIVAA+MSF
Sbjct  140  ISMMAIKRSNCFHSSGGKDGCRISSNPYMISFGVIQIFFSQIPDFHEMWWLSIVAAIMSF  199

Query  393  TYSTIGLGLGVAKVAENGKVLGSLTGISIGTVSEMQKIWRTSQALGAIAFAYSYSLILIE  214
            TYS IGLGL +AKVAENG   GS+TG+SIGTV+E QK+W   Q+LG IAFAYSYS ILIE
Sbjct  200  TYSLIGLGLAIAKVAENGSFKGSITGVSIGTVTEAQKVWGVFQSLGNIAFAYSYSQILIE  259

Query  213  IQDTVKSPPAESKTMKKATLISVAVTTLFYMMCGCFGYAAFGDQSPGNLLTGFGFYNPFW  34
            IQDT+KSPP+E KTMK+AT IS+ VTT+FYM+CG  GYAAFGD SPGNLLTGFGFYNP+W
Sbjct  260  IQDTIKSPPSEMKTMKQATKISIGVTTIFYMLCGGMGYAAFGDLSPGNLLTGFGFYNPYW  319

Query  33   LLDIANAAIVI  1
            L+DIANAA++I
Sbjct  320  LIDIANAALII  330



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3061147228170