BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22949_g1_i2 len=529 path=[4221:0-335 1944:336-528]

Length=529
                                                                      Score     E

emb|CAN66052.1|  hypothetical protein VITISV_009508                     107   3e-23   Vitis vinifera
ref|XP_002284234.2|  PREDICTED: low affinity sulfate transporter 3      103   2e-22   Vitis vinifera
gb|EYU43600.1|  hypothetical protein MIMGU_mgv1a021951mg              94.4    9e-21   
ref|XP_009804329.1|  PREDICTED: low affinity sulfate transporter ...  93.6    9e-19   
ref|XP_009593440.1|  PREDICTED: low affinity sulfate transporter ...  92.0    3e-18   
ref|XP_010105877.1|  Low affinity sulfate transporter 3               91.7    5e-18   
ref|XP_007018861.1|  STAS domain / Sulfate transporter family iso...  91.3    7e-18   
ref|XP_006354020.1|  PREDICTED: low affinity sulfate transporter ...  90.5    9e-18   
ref|XP_007136219.1|  hypothetical protein PHAVU_009G028400g           90.9    9e-18   
ref|XP_006354019.1|  PREDICTED: low affinity sulfate transporter ...  90.9    9e-18   
ref|XP_004490361.1|  PREDICTED: low affinity sulfate transporter ...  90.5    1e-17   
gb|KHN09143.1|  Low affinity sulfate transporter 3                    90.5    1e-17   
ref|XP_011074142.1|  PREDICTED: low affinity sulfate transporter ...  90.1    1e-17   
ref|XP_003526596.1|  PREDICTED: low affinity sulfate transporter ...  90.1    2e-17   
ref|XP_010320152.1|  PREDICTED: low affinity sulfate transporter ...  90.1    2e-17   
gb|KHN31354.1|  Sulfate transporter 2.1                               89.4    2e-17   
ref|XP_010061827.1|  PREDICTED: low affinity sulfate transporter ...  89.7    2e-17   
ref|XP_010090564.1|  Sulfate transporter 2.1                          89.7    2e-17   
ref|XP_011098127.1|  PREDICTED: low affinity sulfate transporter 3    89.7    2e-17   
gb|KCW68851.1|  hypothetical protein EUGRSUZ_F02448                   89.7    2e-17   
ref|XP_010061828.1|  PREDICTED: low affinity sulfate transporter ...  89.7    2e-17   
gb|KCW68852.1|  hypothetical protein EUGRSUZ_F02448                   89.0    3e-17   
gb|KHN41503.1|  Low affinity sulfate transporter 3                    89.0    3e-17   
ref|XP_003544185.1|  PREDICTED: low affinity sulfate transporter ...  89.0    3e-17   
ref|XP_010652824.1|  PREDICTED: low affinity sulfate transporter 3    89.0    4e-17   
emb|CBI21449.3|  unnamed protein product                              89.0    4e-17   
gb|KEH34870.1|  sulfate/bicarbonate/oxalate exchanger and transpo...  89.0    4e-17   
ref|XP_003543772.1|  PREDICTED: low affinity sulfate transporter ...  89.0    4e-17   
ref|XP_009781347.1|  PREDICTED: low affinity sulfate transporter ...  89.0    4e-17   
ref|XP_004237881.1|  PREDICTED: low affinity sulfate transporter ...  89.0    4e-17   
emb|CBK55653.1|  sulphate transporter                                 89.0    4e-17   Astragalus racemosus
ref|XP_006596331.1|  PREDICTED: low affinity sulfate transporter ...  88.6    5e-17   
ref|XP_006596332.1|  PREDICTED: low affinity sulfate transporter ...  88.2    6e-17   
gb|KHN26070.1|  Low affinity sulfate transporter 3                    88.2    6e-17   
emb|CBK55658.1|  sulphate transporter                                 88.2    7e-17   Astragalus bisulcatus
emb|CBK55661.1|  sulphate transporter                                 88.2    7e-17   Astragalus drummondii
ref|XP_003552820.1|  PREDICTED: sulfate transporter 2.1-like          88.2    7e-17   
ref|XP_007141139.1|  hypothetical protein PHAVU_008G170700g           87.8    8e-17   
ref|XP_003602002.1|  Sulfate/bicarbonate/oxalate exchanger and tr...  87.8    8e-17   
ref|XP_004500603.1|  PREDICTED: low affinity sulfate transporter ...  87.8    8e-17   
ref|XP_004252542.2|  PREDICTED: low affinity sulfate transporter ...  87.4    1e-16   
gb|KHN44326.1|  Sulfate transporter 2.1                               87.4    1e-16   
ref|XP_003538517.1|  PREDICTED: sulfate transporter 2.1-like          87.4    1e-16   
ref|XP_004502442.1|  PREDICTED: sulfate transporter 2.1-like isof...  87.4    1e-16   
ref|XP_008246148.1|  PREDICTED: sulfate transporter 2.1-like          82.0    2e-16   
sp|P53393.1|SUT3_STYHA  RecName: Full=Low affinity sulfate transp...  87.0    2e-16   Stylosanthes hamata [Caribbean stylo]
ref|XP_010533355.1|  PREDICTED: sulfate transporter 2.2-like          83.6    2e-16   
gb|EYU36527.1|  hypothetical protein MIMGU_mgv1a002607mg              87.0    2e-16   
ref|XP_011027673.1|  PREDICTED: low affinity sulfate transporter 3    86.7    2e-16   
ref|XP_007163633.1|  hypothetical protein PHAVU_001G250700g           86.7    2e-16   
ref|XP_003614966.1|  Sulfate transporter-like protein                 86.7    2e-16   
ref|XP_004304832.1|  PREDICTED: sulfate transporter 2.1-like          86.7    3e-16   
gb|KEH28061.1|  sulfate/bicarbonate/oxalate exchanger and transpo...  85.5    4e-16   
gb|KCW62157.1|  hypothetical protein EUGRSUZ_H04816                   85.1    7e-16   
ref|XP_009591937.1|  PREDICTED: low affinity sulfate transporter ...  85.1    7e-16   
ref|XP_010025490.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...  85.1    9e-16   
ref|XP_010547619.1|  PREDICTED: sulfate transporter 2.1               85.1    9e-16   
ref|XP_010261212.1|  PREDICTED: low affinity sulfate transporter ...  84.7    1e-15   
ref|XP_010523328.1|  PREDICTED: sulfate transporter 2.1-like          84.7    1e-15   
ref|XP_006428147.1|  hypothetical protein CICLE_v10025101mg           84.7    1e-15   
ref|XP_002302276.1|  Low affinity sulfate transporter 3 family pr...  84.3    1e-15   Populus trichocarpa [western balsam poplar]
gb|KDP32701.1|  hypothetical protein JCGZ_11993                       84.3    1e-15   
ref|XP_010261213.1|  PREDICTED: low affinity sulfate transporter ...  84.3    1e-15   
ref|XP_010534060.1|  PREDICTED: sulfate transporter 2.2 isoform X1    84.0    2e-15   
gb|ABB59582.1|  putative sulfate transporter                          83.6    2e-15   Populus tremula x Populus alba [gray poplar]
ref|XP_010534061.1|  PREDICTED: sulfate transporter 2.2 isoform X2    83.6    2e-15   
ref|XP_007226968.1|  hypothetical protein PRUPE_ppa002519mg           82.8    5e-15   
ref|XP_009345532.1|  PREDICTED: low affinity sulfate transporter ...  82.8    5e-15   
ref|XP_008233993.1|  PREDICTED: low affinity sulfate transporter 3    82.8    5e-15   
gb|ABB59581.1|  putative sulfate transporter                          82.0    7e-15   Populus tremula x Populus alba [gray poplar]
ref|XP_007204972.1|  hypothetical protein PRUPE_ppa002425mg           82.4    7e-15   
ref|XP_009345531.1|  PREDICTED: low affinity sulfate transporter ...  82.4    8e-15   
ref|XP_004149160.1|  PREDICTED: sulfate transporter 2.1-like          82.0    9e-15   
ref|XP_004163495.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...  82.0    1e-14   
ref|XP_008233449.1|  PREDICTED: sulfate transporter 2.1-like          82.0    1e-14   
ref|NP_001274303.1|  sulfate transporter 2.1-like                     81.6    1e-14   
ref|XP_008346989.1|  PREDICTED: sulfate transporter 2.1-like          77.8    1e-14   
ref|XP_008453779.1|  PREDICTED: low affinity sulfate transporter ...  81.3    2e-14   
ref|XP_010926257.1|  PREDICTED: low affinity sulfate transporter ...  80.9    2e-14   
gb|EEC74682.1|  hypothetical protein OsI_10373                        80.5    3e-14   Oryza sativa Indica Group [Indian rice]
gb|AAN59769.1|  Putative sulfate transporter                          80.5    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006399511.1|  hypothetical protein EUTSA_v10012871mg           80.5    3e-14   
ref|XP_006366475.1|  PREDICTED: sulfate transporter 2.1-like          80.5    3e-14   
ref|XP_009776146.1|  PREDICTED: low affinity sulfate transporter ...  80.1    4e-14   
ref|XP_009378551.1|  PREDICTED: sulfate transporter 2.1-like          80.1    5e-14   
ref|XP_007048017.1|  Slufate transporter 2,1                          79.7    5e-14   
ref|XP_006651130.1|  PREDICTED: low affinity sulfate transporter ...  79.3    7e-14   
gb|EMS53139.1|  hypothetical protein TRIUR3_34455                     75.5    1e-13   
ref|XP_009619632.1|  PREDICTED: low affinity sulfate transporter ...  78.6    2e-13   
ref|XP_004301932.1|  PREDICTED: low affinity sulfate transporter ...  78.2    2e-13   
ref|XP_003537509.1|  PREDICTED: sulfate transporter 2.1-like          75.5    2e-13   
ref|XP_002887712.1|  hypothetical protein ARALYDRAFT_316712           77.8    2e-13   
ref|XP_002309991.2|  Early nodulin 70 family protein                  77.8    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010416764.1|  PREDICTED: sulfate transporter 2.2-like          77.8    2e-13   
emb|CDP01189.1|  unnamed protein product                              77.8    2e-13   
ref|XP_003558598.1|  PREDICTED: low affinity sulfate transporter ...  77.8    3e-13   
ref|XP_002306322.2|  Early nodulin 70 family protein                  77.4    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006472651.1|  PREDICTED: low affinity sulfate transporter ...  77.4    3e-13   
ref|XP_006434040.1|  hypothetical protein CICLE_v10000521mg           77.4    3e-13   
gb|KDO80888.1|  hypothetical protein CISIN_1g006030mg                 77.4    3e-13   
ref|XP_006434037.1|  hypothetical protein CICLE_v10000521mg           77.4    3e-13   
gb|KDO80891.1|  hypothetical protein CISIN_1g006030mg                 77.4    3e-13   
ref|XP_006434038.1|  hypothetical protein CICLE_v10000521mg           77.0    4e-13   
ref|XP_006300833.1|  hypothetical protein CARUB_v10019923mg           77.0    4e-13   
gb|KFK42184.1|  hypothetical protein AALP_AA2G222200                  77.0    4e-13   
gb|KFK25313.1|  hypothetical protein AALP_AA8G096500                  77.0    4e-13   
ref|XP_002513876.1|  sulfate transporter, putative                    77.0    5e-13   Ricinus communis
ref|XP_009404428.1|  PREDICTED: sulfate transporter 2.1               76.6    5e-13   
ref|XP_006300834.1|  hypothetical protein CARUB_v10019923mg           76.6    6e-13   
dbj|BAJ85215.1|  predicted protein                                    76.3    7e-13   
gb|KHN31355.1|  Early nodulin-70                                      75.1    1e-12   
ref|XP_009122080.1|  PREDICTED: sulfate transporter 2.1-like isof...  75.9    1e-12   
ref|XP_009122079.1|  PREDICTED: sulfate transporter 2.1-like isof...  75.9    1e-12   
gb|ABK35754.1|  sulfate transporter                                   75.5    1e-12   Populus tremula x Populus alba [gray poplar]
gb|ABK35755.1|  sulfate transporter                                   75.5    1e-12   Populus tremula x Populus alba [gray poplar]
gb|AAZ67600.1|  80A08_15                                              75.5    1e-12   Brassica rapa subsp. pekinensis [bai cai]
ref|NP_565165.2|  sulfate transporter 2;2                             75.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985352.1|  PREDICTED: low affinity sulfate transporter ...  75.5    1e-12   
ref|XP_002465703.1|  hypothetical protein SORBIDRAFT_01g044100        75.5    1e-12   Sorghum bicolor [broomcorn]
dbj|BAA12811.1|  sulfate transporter                                  75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20714.1|  sulfate transporter, putative                         75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA25174.1|  sulfate transporter                                  75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAL67130.2|  putative sulfate transporter protein                  75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAF17693.1|AC009243_20  F28K19.21                                  75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428901.1|  PREDICTED: sulfate transporter 2.2               75.1    2e-12   
ref|XP_009125320.1|  PREDICTED: sulfate transporter 2.1               75.1    2e-12   
emb|CDX87488.1|  BnaA07g33850D                                        75.1    2e-12   
ref|XP_009106442.1|  PREDICTED: sulfate transporter 2.2               75.1    2e-12   
emb|CDY40086.1|  BnaC02g00440D                                        75.1    2e-12   
gb|AAZ08077.2|  putative low affinity sulfate transporter             75.1    2e-12   Brassica napus [oilseed rape]
emb|CAG17931.1|  plasma membrane sulphate transporter                 75.1    2e-12   Brassica oleracea var. viridis [collards]
emb|CDX88403.1|  BnaC06g38470D                                        75.1    2e-12   
ref|XP_011008597.1|  PREDICTED: sulfate transporter 2.1               75.1    2e-12   
gb|ACK44507.1|  AT5G10180-like protein                                74.7    2e-12   Arabidopsis arenosa
ref|XP_008460487.1|  PREDICTED: LOW QUALITY PROTEIN: low affinity...  74.7    2e-12   
ref|NP_196580.1|  sulfate transporter 2;1                             74.7    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140372.1|  PREDICTED: low affinity sulfate transporter ...  74.7    2e-12   
emb|CAM33601.1|  plasma membrane sulphate transporter                 74.7    2e-12   Brassica oleracea
ref|XP_004155745.1|  PREDICTED: LOW QUALITY PROTEIN: low affinity...  74.7    2e-12   
ref|XP_010495132.1|  PREDICTED: sulfate transporter 2.1-like          73.2    2e-12   
gb|EMS54294.1|  Low affinity sulfate transporter 3                    74.3    3e-12   
ref|XP_003602001.1|  Sulfate/bicarbonate/oxalate exchanger and tr...  74.7    3e-12   
gb|ACO25294.1|  low affinity sulfate transporter Bnst2-1              74.3    3e-12   
ref|XP_010261211.1|  PREDICTED: low affinity sulfate transporter ...  74.3    4e-12   
ref|XP_010905915.1|  PREDICTED: low affinity sulfate transporter ...  73.9    4e-12   
emb|CAA11413.1|  sulfate permease                                     73.2    4e-12   Brassica juncea [brown mustard]
gb|EMT09908.1|  hypothetical protein F775_52532                       73.9    4e-12   
ref|XP_004985354.1|  PREDICTED: low affinity sulfate transporter ...  73.6    5e-12   
ref|XP_006390036.1|  hypothetical protein EUTSA_v10018230mg           73.9    5e-12   
ref|XP_006601860.1|  PREDICTED: early nodulin-70 isoform X1           73.6    5e-12   
ref|XP_002871408.1|  hypothetical protein ARALYDRAFT_908975           73.6    6e-12   
ref|XP_004985353.1|  PREDICTED: low affinity sulfate transporter ...  73.6    6e-12   
ref|XP_010491672.1|  PREDICTED: sulfate transporter 2.1-like isof...  73.6    7e-12   
emb|CDX96981.1|  BnaC09g46440D                                        73.2    7e-12   
ref|XP_010491673.1|  PREDICTED: sulfate transporter 2.1-like isof...  73.2    8e-12   
ref|XP_010491674.1|  PREDICTED: sulfate transporter 2.1-like isof...  73.2    8e-12   
ref|XP_010471997.1|  PREDICTED: sulfate transporter 2.2-like          73.2    8e-12   
ref|XP_010453042.1|  PREDICTED: sulfate transporter 2.1               73.2    8e-12   
ref|XP_010422881.1|  PREDICTED: sulfate transporter 2.1-like          72.8    9e-12   
gb|KDP46877.1|  hypothetical protein JCGZ_24086                       72.8    1e-11   
emb|CDP01420.1|  unnamed protein product                              72.8    1e-11   
ref|XP_006287209.1|  hypothetical protein CARUB_v10000384mg           72.4    1e-11   
gb|ACL53345.1|  unknown                                               72.0    2e-11   Zea mays [maize]
ref|XP_008652499.1|  PREDICTED: low affinity sulfate transporter 3    71.6    2e-11   
ref|XP_006585288.1|  PREDICTED: sulfate transporter 2.1-like isof...  71.2    3e-11   
ref|XP_007163634.1|  hypothetical protein PHAVU_001G250800g           71.2    4e-11   
ref|XP_003531363.1|  PREDICTED: sulfate transporter 2.1-like isof...  71.2    4e-11   
gb|KHN29086.1|  Sulfate transporter 2.1                               70.9    4e-11   
ref|XP_002528970.1|  sulfate transporter, putative                    70.5    6e-11   Ricinus communis
ref|XP_008809316.1|  PREDICTED: LOW QUALITY PROTEIN: low affinity...  70.1    7e-11   
ref|XP_010687477.1|  PREDICTED: sulfate transporter 1.2-like          70.5    7e-11   
ref|XP_002513877.1|  sulfate transporter, putative                    69.3    2e-10   Ricinus communis
ref|XP_006649557.1|  PREDICTED: sulfate transporter 2.1-like          68.9    2e-10   
ref|XP_009362511.1|  PREDICTED: sulfate transporter 1.3-like          68.6    3e-10   
gb|AAN59770.1|  Putative sulfate transporter                          68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE58498.1|  hypothetical protein OsJ_09763                        68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74681.1|  hypothetical protein OsI_10372                        68.2    3e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001049257.1|  Os03g0195300                                     68.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004502509.1|  PREDICTED: early nodulin-70-like                 67.8    5e-10   
ref|XP_010939615.1|  PREDICTED: sulfate transporter 1.3-like          67.8    5e-10   
sp|P53391.1|SUT1_STYHA  RecName: Full=High affinity sulfate trans...  67.8    5e-10   Stylosanthes hamata [Caribbean stylo]
gb|ABK35753.1|  sulfate transporter                                   67.4    5e-10   Populus tremula x Populus alba [gray poplar]
gb|KFK32123.1|  hypothetical protein AALP_AA6G201100                  67.8    5e-10   
sp|P53392.1|SUT2_STYHA  RecName: Full=High affinity sulfate trans...  67.8    5e-10   Stylosanthes hamata [Caribbean stylo]
ref|XP_008339255.1|  PREDICTED: sulfate transporter 1.2-like          67.4    7e-10   
ref|XP_010939616.1|  PREDICTED: sulfate transporter 1.3-like          67.4    8e-10   
ref|XP_010103934.1|  High affinity sulfate transporter 2              66.6    1e-09   
gb|KDP32700.1|  hypothetical protein JCGZ_11992                       66.6    1e-09   
ref|XP_008374998.1|  PREDICTED: sulfate transporter 1.3-like          66.6    1e-09   
ref|XP_006826990.1|  hypothetical protein AMTR_s00010p00209860        66.6    1e-09   
ref|XP_007226563.1|  hypothetical protein PRUPE_ppa024463mg           66.6    1e-09   
ref|XP_008218902.1|  PREDICTED: sulfate transporter 1.3-like          66.6    1e-09   
ref|XP_010477471.1|  PREDICTED: sulfate transporter 1.3               66.2    1e-09   
ref|XP_010498678.1|  PREDICTED: sulfate transporter 1.3-like          66.2    1e-09   
gb|KHG07987.1|  High affinity sulfate transporter 2                   66.2    2e-09   
ref|XP_008361631.1|  PREDICTED: sulfate transporter 1.2-like          66.2    2e-09   
gb|EYU43602.1|  hypothetical protein MIMGU_mgv1a019382mg              66.2    2e-09   
ref|XP_008790803.1|  PREDICTED: sulfate transporter 1.3-like          66.2    2e-09   
emb|CBK55655.1|  sulphate transporter                                 65.9    2e-09   Astragalus glycyphyllos [liquorice milk-vetch]
gb|KHN33509.1|  High affinity sulfate transporter 2                   65.9    2e-09   
ref|XP_010269183.1|  PREDICTED: sulfate transporter 1.2-like          65.9    2e-09   
emb|CBK55660.1|  sulphate transporter                                 65.9    2e-09   Astragalus drummondii
ref|XP_002465704.1|  hypothetical protein SORBIDRAFT_01g044110        65.5    2e-09   Sorghum bicolor [broomcorn]
ref|XP_011092411.1|  PREDICTED: sulfate transporter 1.3-like          65.9    2e-09   
emb|CAN75170.1|  hypothetical protein VITISV_041032                   65.5    2e-09   Vitis vinifera
ref|XP_010030061.1|  PREDICTED: sulfate transporter 1.3-like          65.5    2e-09   
ref|XP_010455280.1|  PREDICTED: sulfate transporter 1.1               65.5    3e-09   
ref|NP_564159.1|  sulfate transporter 1.3                             65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496703.1|  PREDICTED: sulfate transporter 1.1-like          65.5    3e-09   
ref|XP_010421777.1|  PREDICTED: sulfate transporter 1.1-like          65.5    3e-09   
ref|XP_010664070.1|  PREDICTED: sulfate transporter isoform X1        65.5    3e-09   
ref|XP_002890494.1|  F2E2.22                                          65.5    3e-09   
gb|AAF86552.1|AC069252_11  F2E2.22                                    65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098138.1|  PREDICTED: sulfate transporter 1.2-like          65.5    3e-09   
ref|XP_003593165.1|  Sulfate transporter                              65.5    3e-09   
emb|CBK55656.1|  sulphate transporter                                 65.1    3e-09   Astragalus glycyphyllos [liquorice milk-vetch]
ref|XP_010459957.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...  65.1    3e-09   
gb|AES63416.2|  high affinity sulfate transporter type 1              65.1    4e-09   
ref|XP_009758742.1|  PREDICTED: sulfate transporter 1.3-like          65.1    4e-09   
emb|CDO97472.1|  unnamed protein product                              65.1    4e-09   
ref|XP_010527609.1|  PREDICTED: sulfate transporter 2.1-like          62.0    4e-09   
ref|XP_008375005.1|  PREDICTED: low affinity sulfate transporter ...  65.1    4e-09   
ref|XP_009607386.1|  PREDICTED: sulfate transporter 1.3-like          65.1    4e-09   
ref|XP_004485559.1|  PREDICTED: high affinity sulfate transporter...  65.1    4e-09   
gb|ABM17059.2|  sulfate transporter                                   65.1    4e-09   Vitis rupestris [bush grape]
ref|XP_003532966.1|  PREDICTED: high affinity sulfate transporter...  65.1    4e-09   
ref|XP_008375006.1|  PREDICTED: low affinity sulfate transporter ...  65.1    4e-09   
gb|KEH36439.1|  high affinity sulfate transporter type 1              65.1    4e-09   
ref|XP_006290109.1|  hypothetical protein CARUB_v10003753mg           64.7    5e-09   
ref|XP_010667626.1|  PREDICTED: sulfate transporter 1.2-like isof...  64.7    5e-09   
ref|XP_010667625.1|  PREDICTED: sulfate transporter 1.2-like isof...  64.7    6e-09   
ref|XP_009345534.1|  PREDICTED: sulfate transporter 1.2-like          64.3    6e-09   
ref|XP_006304513.1|  hypothetical protein CARUB_v10011339mg           64.3    6e-09   
ref|XP_010030063.1|  PREDICTED: sulfate transporter 1.3-like          64.3    7e-09   
emb|CBK55657.1|  sulphate transporter                                 64.3    7e-09   Astragalus bisulcatus
emb|CBK55651.1|  sulphate transporter                                 64.3    7e-09   Astragalus racemosus
gb|EYU39155.1|  hypothetical protein MIMGU_mgv1a002721mg              64.3    7e-09   
emb|CBK55663.1|  sulphate transporter                                 64.3    7e-09   Astragalus crotalariae
emb|CDX94791.1|  BnaC07g18000D                                        63.5    8e-09   
emb|CAG17933.1|  plasma membrane sulphate transporter                 63.9    8e-09   Brassica oleracea var. viridis [collards]
gb|EYU39154.1|  hypothetical protein MIMGU_mgv1a002718mg              63.9    8e-09   
gb|EYU39153.1|  hypothetical protein MIMGU_mgv1a002707mg              63.9    8e-09   
ref|XP_004140373.1|  PREDICTED: sulfate transporter 1.3-like          63.9    8e-09   
gb|AGI96997.1|  putative high-affinity sulfate transporter            63.9    9e-09   
ref|XP_004485557.1|  PREDICTED: high affinity sulfate transporter...  63.9    1e-08   
emb|CBK55652.1|  sulphate transporter                                 63.9    1e-08   Astragalus racemosus
dbj|BAA33932.1|  sulfate transporter                                  63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192602.1|  sulfate transporter 1.1                             63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485558.1|  PREDICTED: high affinity sulfate transporter...  63.5    1e-08   
ref|XP_004299604.1|  PREDICTED: sulfate transporter 1.3-like          63.5    1e-08   
ref|XP_004237882.1|  PREDICTED: sulfate transporter 1.3               63.5    1e-08   
ref|XP_009758428.1|  PREDICTED: sulfate transporter 1.3-like          63.5    1e-08   
ref|XP_006354018.1|  PREDICTED: sulfate transporter 1.3-like          63.5    1e-08   
ref|XP_007225673.1|  hypothetical protein PRUPE_ppa002542mg           63.5    1e-08   
ref|XP_008233994.1|  PREDICTED: sulfate transporter 1.3-like          63.2    1e-08   
ref|XP_007043016.1|  Sulfate transporter 1,3 isoform 1                63.2    1e-08   
gb|AGT40333.1|  sulfate transporter                                   63.2    1e-08   
ref|XP_008337948.1|  PREDICTED: sulfate transporter 1.2-like          63.2    2e-08   
gb|EMT11843.1|  High affinity sulfate transporter 2                   63.2    2e-08   
ref|XP_007043017.1|  Sulfate transporter 1,3 isoform 2                63.2    2e-08   
ref|XP_004490362.1|  PREDICTED: sulfate transporter 1.3-like isof...  63.2    2e-08   
gb|EMS55614.1|  Sulfate transporter 1.2                               63.2    2e-08   
ref|XP_009369644.1|  PREDICTED: sulfate transporter 1.2               63.2    2e-08   
gb|ACN39795.1|  unknown                                               63.2    2e-08   Picea sitchensis
ref|XP_009592454.1|  PREDICTED: sulfate transporter 1.3-like          63.2    2e-08   
emb|CBK55650.1|  sulphate transporter                                 63.2    2e-08   Astragalus racemosus
emb|CBI19124.3|  unnamed protein product                              61.6    2e-08   
ref|XP_003614968.1|  Sulfate transporter                              63.2    2e-08   
ref|XP_009127201.1|  PREDICTED: sulfate transporter 1.1               63.2    2e-08   
ref|XP_010664910.1|  PREDICTED: high affinity sulfate transporter...  60.5    2e-08   
ref|XP_009145372.1|  PREDICTED: sulfate transporter 1.3               62.8    2e-08   
ref|XP_009800111.1|  PREDICTED: sulfate transporter 1.3-like          62.8    2e-08   
ref|XP_010916916.1|  PREDICTED: sulfate transporter 1.3-like          62.8    2e-08   
ref|XP_009409155.1|  PREDICTED: sulfate transporter 1.3-like          62.8    2e-08   
ref|XP_008798427.1|  PREDICTED: sulfate transporter 1.3-like          62.8    2e-08   
emb|CDX96184.1|  BnaC02g14670D                                        62.8    2e-08   
gb|KDO80894.1|  hypothetical protein CISIN_1g006132mg                 62.8    2e-08   
ref|XP_006472647.1|  PREDICTED: sulfate transporter 1.3-like isof...  62.8    2e-08   
ref|XP_010030062.1|  PREDICTED: sulfate transporter 1.3-like          62.8    2e-08   
gb|AFX60922.1|  high-affinity sulfate transporter 1;1                 62.8    2e-08   
ref|XP_009389865.1|  PREDICTED: low affinity sulfate transporter ...  62.8    2e-08   
ref|XP_011087852.1|  PREDICTED: sulfate transporter 1.3-like isof...  62.4    3e-08   
ref|XP_003574460.1|  PREDICTED: sulfate transporter 1.2               62.4    3e-08   
ref|XP_008444099.1|  PREDICTED: sulfate transporter 1.3-like          62.4    3e-08   
ref|XP_003543770.2|  PREDICTED: sulfate transporter 1.3-like isof...  62.4    3e-08   
ref|XP_011087851.1|  PREDICTED: sulfate transporter 1.3-like isof...  62.4    3e-08   
ref|XP_008460486.1|  PREDICTED: sulfate transporter 1.2-like isof...  62.4    3e-08   
gb|EYU39150.1|  hypothetical protein MIMGU_mgv1a002714mg              62.4    3e-08   
ref|XP_006596866.1|  PREDICTED: sulfate transporter 1.3-like          62.4    3e-08   
ref|XP_006826989.1|  hypothetical protein AMTR_s00010p00208980        62.4    3e-08   
ref|XP_007141140.1|  hypothetical protein PHAVU_008G170800g           62.4    3e-08   
ref|XP_010521202.1|  PREDICTED: sulfate transporter 1.2-like          62.4    3e-08   
ref|XP_006360279.1|  PREDICTED: sulfate transporter 1.2-like isof...  62.4    3e-08   
ref|XP_008460483.1|  PREDICTED: sulfate transporter 1.3-like isof...  62.4    3e-08   
gb|KHN41502.1|  Sulfate transporter 1.3                               62.0    3e-08   
ref|XP_010060154.1|  PREDICTED: sulfate transporter 1.3               62.0    3e-08   
ref|XP_006341835.1|  PREDICTED: sulfate transporter 1.3               62.0    3e-08   
ref|NP_001061769.1|  Os08g0406400                                     61.2    3e-08   
ref|NP_001275426.1|  high affinity sulfate transporter type 1         62.0    4e-08   
ref|NP_001234565.1|  sulfate transporter 1                            62.0    4e-08   
ref|XP_010327388.1|  PREDICTED: sulfate transporter 1 isoform X1      62.0    4e-08   
ref|XP_003526594.1|  PREDICTED: sulfate transporter 1.3-like isof...  62.0    4e-08   
ref|XP_002991793.1|  hypothetical protein SELMODRAFT_134130           62.0    4e-08   
gb|AAK62820.1|  high affinity sulfate transporter                     62.0    4e-08   
ref|XP_006434036.1|  hypothetical protein CICLE_v10000528mg           62.0    4e-08   
ref|XP_006416228.1|  hypothetical protein EUTSA_v10009756mg           62.0    4e-08   
ref|XP_004150525.1|  PREDICTED: sulfate transporter 1.3-like          61.6    4e-08   
ref|XP_006434033.1|  hypothetical protein CICLE_v10000528mg           61.6    4e-08   
ref|XP_002989687.1|  hypothetical protein SELMODRAFT_184750           61.6    4e-08   
ref|XP_010538958.1|  PREDICTED: sulfate transporter 1.1-like          61.6    5e-08   
ref|XP_010539238.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...  61.6    5e-08   
ref|XP_008780885.1|  PREDICTED: low affinity sulfate transporter ...  61.6    5e-08   
gb|EMS62366.1|  High affinity sulfate transporter 1                   61.6    5e-08   
gb|EPS63999.1|  hypothetical protein M569_10782                       61.6    5e-08   
ref|XP_007136221.1|  hypothetical protein PHAVU_009G028500g           61.6    5e-08   
ref|XP_010527550.1|  PREDICTED: sulfate transporter 1.3-like          61.6    6e-08   
ref|XP_011074140.1|  PREDICTED: sulfate transporter 1.3               61.6    6e-08   
gb|EYU36528.1|  hypothetical protein MIMGU_mgv1a002617mg              61.2    6e-08   
ref|XP_006390034.1|  hypothetical protein EUTSA_v10018244mg           61.2    6e-08   
ref|NP_001234569.1|  sulfate transporter 2                            61.2    6e-08   
gb|EAZ06949.1|  hypothetical protein OsI_29191                        61.2    6e-08   
dbj|BAC98594.1|  putative high affinity sulfate transporter           61.2    6e-08   
ref|XP_003547605.1|  PREDICTED: high affinity sulfate transporter...  61.2    7e-08   
emb|CAC39420.1|  sulfate transporter                                  61.2    7e-08   
ref|XP_007148429.1|  hypothetical protein PHAVU_006G207800g           61.2    7e-08   
dbj|BAK00729.1|  predicted protein                                    61.2    7e-08   
ref|XP_010428902.1|  PREDICTED: sulfate transporter 1.2-like isof...  61.2    7e-08   
emb|CDX88404.1|  BnaC06g38480D                                        61.2    7e-08   
emb|CDX87487.1|  BnaA07g33860D                                        61.2    7e-08   
ref|XP_009128268.1|  PREDICTED: sulfate transporter 1.2-like          61.2    7e-08   
ref|XP_007018857.1|  Sulfate transporter 1,3 isoform 1                61.2    7e-08   
ref|XP_009106443.1|  PREDICTED: sulfate transporter 1.2               60.8    8e-08   
ref|XP_009409847.1|  PREDICTED: sulfate transporter 1.2-like          60.8    8e-08   
ref|XP_010471998.1|  PREDICTED: sulfate transporter 1.2-like          60.8    8e-08   
ref|XP_010657602.1|  PREDICTED: sulfate transporter 1.3-like          60.8    8e-08   
ref|XP_010428905.1|  PREDICTED: sulfate transporter 1.2-like isof...  60.8    8e-08   
gb|AFX60923.1|  high-affinity sulfate transporter 1;2a                60.8    8e-08   
ref|XP_006301018.1|  hypothetical protein CARUB_v10021409mg           60.8    8e-08   
ref|XP_009629531.1|  PREDICTED: sulfate transporter 1.3-like          60.8    8e-08   
ref|XP_004301997.1|  PREDICTED: high affinity sulfate transporter...  60.8    8e-08   
ref|XP_007018858.1|  Sulfate transporter 1,3 isoform 2                60.8    9e-08   
ref|XP_004973399.1|  PREDICTED: sulfate transporter 1.2-like isof...  60.8    9e-08   
gb|AFX60924.1|  high-affinity sulfate transporter 1;2b                60.8    9e-08   
ref|XP_002889173.1|  SULTR1_2                                         60.5    1e-07   
emb|CDY14642.1|  BnaC02g24710D                                        60.5    1e-07   
gb|ABB59580.1|  putative sulfate transporter                          60.1    1e-07   
ref|NP_565166.1|  sulfate transporter 1;2                             60.5    1e-07   
ref|NP_001169750.1|  uncharacterized protein LOC100383631             59.7    1e-07   
gb|AAF17685.1|AC009243_12  F28K19.22                                  60.5    1e-07   
ref|XP_003638788.1|  Sulfate transporter                              60.5    1e-07   
ref|XP_010416766.1|  PREDICTED: sulfate transporter 1.2               60.5    1e-07   
ref|XP_008677620.1|  PREDICTED: uncharacterized protein LOC100383...  60.1    1e-07   
ref|NP_001132356.1|  uncharacterized protein LOC100193800             60.1    1e-07   
gb|KEH34875.1|  high affinity sulfate transporter type 1              60.1    2e-07   
ref|XP_002872409.1|  SULTR1_1                                         60.1    2e-07   
ref|XP_010105878.1|  Sulfate transporter 1.3                          60.1    2e-07   
gb|KEH34873.1|  high affinity sulfate transporter type 1              60.1    2e-07   
gb|KEH34874.1|  high affinity sulfate transporter type 1              59.7    2e-07   
ref|XP_011027674.1|  PREDICTED: sulfate transporter 1.2-like          59.7    2e-07   
ref|XP_006659385.1|  PREDICTED: sulfate transporter 1.2-like          59.7    2e-07   
ref|XP_008780888.1|  PREDICTED: sulfate transporter 1.2-like          59.7    2e-07   
gb|KHN45351.1|  Sulfate transporter 1.3                               59.7    2e-07   
ref|XP_002301036.1|  high affinity sulfate transporter family pro...  59.3    2e-07   
ref|XP_002307394.1|  high affinity sulfate transporter family pro...  59.3    3e-07   
emb|CAC94920.1|  sulfate transporter                                  59.3    3e-07   
gb|ABK35751.2|  sulfate transporter                                   59.3    3e-07   
ref|XP_010926258.1|  PREDICTED: sulfate transporter 1.2-like          59.3    3e-07   
ref|XP_009403246.1|  PREDICTED: sulfate transporter 1.3-like          59.3    3e-07   
ref|XP_010229044.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...  58.9    3e-07   
ref|XP_002534156.1|  sulfate transporter, putative                    58.9    3e-07   
ref|XP_009404054.1|  PREDICTED: sulfate transporter 1.2-like          58.9    3e-07   
ref|NP_001105050.1|  sulfate permease1                                58.9    4e-07   
gb|AFW89362.1|  hypothetical protein ZEAMMB73_695392                  58.9    4e-07   
ref|XP_010261215.1|  PREDICTED: sulfate transporter 1.3-like          58.9    4e-07   
ref|XP_008648264.1|  PREDICTED: sulfate permease1 isoform X1          58.5    4e-07   
ref|XP_004985349.1|  PREDICTED: sulfate transporter 1.2-like isof...  58.5    4e-07   
gb|ABR25461.1|  sulfate transporter                                   55.8    4e-07   
gb|ACG46907.1|  sulfate transporter 1.2                               58.5    5e-07   
ref|XP_008677618.1|  PREDICTED: uncharacterized protein LOC100383...  58.5    5e-07   
emb|CAD55700.1|  sulphate transporter                                 58.5    5e-07   
ref|XP_003561623.1|  PREDICTED: sulfate transporter 1.2-like          58.5    5e-07   
ref|XP_010652002.1|  PREDICTED: sulfate transporter 3.1-like          58.5    5e-07   
gb|EMT20443.1|  High affinity sulfate transporter 2                   58.5    5e-07   
ref|XP_004985351.1|  PREDICTED: sulfate transporter 1.2-like isof...  58.5    5e-07   
emb|CAB42986.1|  putative high affinity sulfate transporter           58.5    5e-07   
emb|CAD55697.1|  sulphate transporter                                 58.2    6e-07   
ref|XP_002980841.1|  hypothetical protein SELMODRAFT_113596           57.8    8e-07   
ref|XP_001760822.1|  predicted protein                                57.8    8e-07   
ref|XP_002989364.1|  hypothetical protein SELMODRAFT_184503           57.8    8e-07   
emb|CAA65291.1|  high affinity sulphate transporter                   57.8    8e-07   
gb|AAA97952.1|  high affinity sulfate transporter HVST1               57.8    9e-07   
emb|CAD54673.1|  sulphate transporter                                 57.8    1e-06   
gb|EMS54293.1|  High affinity sulfate transporter 2                   57.4    1e-06   
ref|XP_011015979.1|  PREDICTED: sulfate transporter 1.2-like          57.4    1e-06   
ref|XP_011006147.1|  PREDICTED: sulfate transporter 1.2-like          57.4    1e-06   
emb|CAD55698.1|  sulphate transporter                                 57.4    1e-06   
ref|XP_004296670.1|  PREDICTED: sulfate transporter 3.1-like          57.4    1e-06   
emb|CAD55696.1|  sulphate transporter                                 57.4    1e-06   
emb|CAD54674.1|  sulphate transporter                                 57.0    1e-06   
gb|ACF85430.1|  unknown                                               56.2    1e-06   
ref|XP_002468339.1|  hypothetical protein SORBIDRAFT_01g044090        57.0    2e-06   
ref|XP_007136220.1|  hypothetical protein PHAVU_009G028400g           56.6    2e-06   
emb|CAD55695.1|  sulphate transporter                                 57.0    2e-06   
gb|EMT20444.1|  High affinity sulfate transporter 2                   57.0    2e-06   
gb|AGI96996.1|  putative high-affinity sulfate transporter            57.0    2e-06   
emb|CAD55701.1|  sulphate transporter                                 56.6    2e-06   
ref|XP_002464158.1|  hypothetical protein SORBIDRAFT_01g013290        56.6    2e-06   
tpg|DAA43466.1|  TPA: hypothetical protein ZEAMMB73_358631            55.8    2e-06   
emb|CAB42985.1|  putative high affinity sulfate transporter           56.2    3e-06   
emb|CAD55702.1|  sulphate transporter                                 56.2    3e-06   
gb|ACN71177.1|  plasma membrane sulphate transporter                  52.8    3e-06   
gb|EAY74777.1|  hypothetical protein OsI_02669                        56.2    3e-06   
ref|XP_004155506.1|  PREDICTED: high affinity sulfate transporter...  54.7    3e-06   
ref|XP_006649559.1|  PREDICTED: sulfate transporter 1.2-like isof...  56.2    3e-06   
ref|XP_006649560.1|  PREDICTED: sulfate transporter 1.2-like isof...  55.8    4e-06   
ref|NP_001049259.1|  Os03g0195800                                     55.8    4e-06   
gb|AAM14588.1|AF493790_1  putative sulphate transporter               55.8    4e-06   
ref|XP_006838985.1|  hypothetical protein AMTR_s00002p00271530        55.5    4e-06   
emb|CAN70402.1|  hypothetical protein VITISV_039695                   55.5    4e-06   
ref|XP_002968282.1|  hypothetical protein SELMODRAFT_169988           55.5    4e-06   
ref|XP_006649558.1|  PREDICTED: sulfate transporter 1.2-like          55.5    5e-06   
ref|XP_002976095.1|  hypothetical protein SELMODRAFT_175286           55.5    5e-06   
emb|CBI28733.3|  unnamed protein product                              55.5    5e-06   
ref|XP_003632327.1|  PREDICTED: sulfate transporter 3.1-like          55.5    5e-06   
ref|XP_008455224.1|  PREDICTED: sulfate transporter 1.2-like          55.1    6e-06   
gb|ABK35756.1|  sulfate transporter                                   55.1    6e-06   
ref|NP_001141114.1|  uncharacterized protein LOC100273198             55.1    7e-06   
ref|XP_004298020.1|  PREDICTED: sulfate transporter 3.1-like          55.1    7e-06   
emb|CBZ39218.1|  sulfate transporter                                  54.7    7e-06   
ref|XP_004298019.1|  PREDICTED: sulfate transporter 3.1-like          54.7    9e-06   
gb|KGN43700.1|  hypothetical protein Csa_7G060690                     54.3    1e-05   
ref|XP_004137049.1|  PREDICTED: high affinity sulfate transporter...  54.3    1e-05   
gb|EAZ25923.1|  hypothetical protein OsJ_09766                        53.9    1e-05   
ref|NP_001049261.1|  Os03g0196000                                     53.9    1e-05   
ref|XP_008390930.1|  PREDICTED: sulfate transporter 3.1-like          53.9    2e-05   
ref|XP_009335285.1|  PREDICTED: sulfate transporter 3.1-like          53.9    2e-05   
gb|AAL66177.1|AF458090_1  high affinity sulfate transporter           52.0    2e-05   
gb|EYU18500.1|  hypothetical protein MIMGU_mgv1a0267592mg             52.0    2e-05   
gb|EPS65934.1|  hypothetical protein M569_08843                       53.5    2e-05   
gb|KCW82477.1|  hypothetical protein EUGRSUZ_C03866                   52.0    2e-05   
emb|CAD55699.1|  sulphate transporter                                 53.5    2e-05   
ref|XP_003290559.1|  hypothetical protein DICPUDRAFT_49264            53.5    2e-05   
ref|XP_002464601.1|  hypothetical protein SORBIDRAFT_01g021670        53.1    2e-05   
ref|XP_009593442.1|  PREDICTED: low affinity sulfate transporter ...  50.4    3e-05   
gb|EAZ12544.1|  hypothetical protein OsJ_02445                        52.8    3e-05   
ref|XP_007139276.1|  hypothetical protein PHAVU_008G015600g           52.8    3e-05   
ref|XP_008390998.1|  PREDICTED: sulfate transporter 3.1-like isof...  52.8    3e-05   
ref|XP_011090680.1|  PREDICTED: sulfate transporter 3.1-like          52.8    4e-05   
ref|NP_001172445.1|  Os01g0593700                                     52.8    4e-05   
gb|ABK35746.2|  sulfate transporter                                   52.4    4e-05   
gb|ABK35757.1|  sulfate transporter                                   52.4    4e-05   
ref|XP_011023507.1|  PREDICTED: probable sulfate transporter 3.3      52.4    5e-05   
gb|KHG25913.1|  Sulfate transporter 4                                 52.4    5e-05   
ref|XP_002315248.2|  hypothetical protein POPTR_0010s21820g           52.4    5e-05   
ref|XP_010261543.1|  PREDICTED: sulfate transporter 1.2-like          52.4    5e-05   
gb|ABB59577.2|  putative sulfate transporter                          52.4    5e-05   
ref|XP_004362360.1|  Sulfate transporter                              52.4    5e-05   
ref|XP_008390997.1|  PREDICTED: sulfate transporter 3.1-like isof...  52.4    5e-05   
ref|XP_002312065.2|  hypothetical protein POPTR_0008s04930g           52.4    5e-05   
gb|ABK24712.1|  unknown                                               52.0    5e-05   
ref|XP_006379763.1|  hypothetical protein POPTR_0008s12940g           52.4    5e-05   
ref|XP_002312444.2|  sulfate transporter 3.3 family protein           52.4    6e-05   
gb|ABK35747.1|  sulfate transporter                                   52.0    6e-05   
ref|XP_002524733.1|  sulfate transporter, putative                    52.0    6e-05   
gb|EMT23790.1|  Sulfate transporter 3.1                               52.0    6e-05   
emb|CDP03663.1|  unnamed protein product                              52.0    6e-05   
dbj|GAM25517.1|  hypothetical protein SAMD00019534_086920             52.0    6e-05   
ref|XP_006345930.1|  PREDICTED: probable sulfate transporter 4.2-...  52.0    6e-05   
ref|XP_006379571.1|  hypothetical protein POPTR_0008s04930g           52.0    7e-05   
gb|KHN27202.1|  Sulfate transporter 4.1, chloroplastic                52.0    7e-05   
ref|NP_001274722.1|  probable sulfate transporter 4.2-like            52.0    8e-05   
ref|XP_009419196.1|  PREDICTED: sulfate transporter 3.1-like          51.6    8e-05   
ref|XP_009778471.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    8e-05   
ref|XP_009631512.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    8e-05   
ref|XP_010908924.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    9e-05   
ref|XP_010253335.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    9e-05   
ref|XP_006379570.1|  hypothetical protein POPTR_0008s04930g           51.6    9e-05   
ref|XP_010024227.1|  PREDICTED: sulfate transporter 3.1-like          51.6    9e-05   
ref|XP_004332873.1|  STAS domain containing protein                   51.2    9e-05   
ref|XP_003520027.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    9e-05   
ref|XP_006360746.1|  PREDICTED: sulfate transporter 3.1-like          51.6    9e-05   
ref|XP_003621787.1|  Sulfate transporter                              51.6    1e-04   
ref|XP_007225118.1|  hypothetical protein PRUPE_ppa002648mg           51.6    1e-04   
ref|XP_011091483.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    1e-04   
ref|XP_003552670.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.6    1e-04   
ref|XP_006287201.1|  hypothetical protein CARUB_v10000377mg           51.2    1e-04   
ref|XP_011021488.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.2    1e-04   
ref|XP_006844262.1|  hypothetical protein AMTR_s00145p00040850        51.2    1e-04   
ref|XP_008224259.1|  PREDICTED: sulfate transporter 3.1-like          51.2    1e-04   
ref|XP_011021427.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.2    1e-04   
ref|XP_004332874.1|  sulfate permease subfamily protein               51.2    1e-04   
emb|CDY21906.1|  BnaC09g00120D                                        50.4    1e-04   
ref|XP_009388632.1|  PREDICTED: sulfate transporter 4.1, chloropl...  51.2    1e-04   
ref|XP_002873617.1|  SULTR4_1                                         51.2    1e-04   
ref|XP_004347176.1|  inorganic anion transporter, sulfate permeas...  51.2    1e-04   
ref|XP_011026981.1|  PREDICTED: sulfate transporter 3.1-like          51.2    1e-04   
ref|XP_006399849.1|  hypothetical protein EUTSA_v10012850mg           51.2    1e-04   
ref|XP_001754160.1|  predicted protein                                51.2    1e-04   
ref|XP_010254171.1|  PREDICTED: probable sulfate transporter 3.5 ...  51.2    1e-04   
emb|CAN84174.1|  hypothetical protein VITISV_001475                   51.2    1e-04   



>emb|CAN66052.1| hypothetical protein VITISV_009508 [Vitis vinifera]
Length=887

 Score =   107 bits (266),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL+SIRPS++G+GKLPGTDIFC+I +YP A   PGILI+RIN+G LCFAN+ F+R
Sbjct  459  SFAKIILNSIRPSVEGLGKLPGTDIFCDINQYPMAIKTPGILIVRINSGLLCFANANFVR  518

Query  343  ER  338
            ER
Sbjct  519  ER  520



>ref|XP_002284234.2| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
 ref|XP_010664300.1| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
 ref|XP_010664301.1| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
 emb|CBI19121.3| unnamed protein product [Vitis vinifera]
Length=664

 Score =   103 bits (258),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL+SIRPS++G+GKLPGTDIFC+I +YP A   PGILI+RIN+G LCFAN+ F+R
Sbjct  500  SFAKIILNSIRPSVEGLGKLPGTDIFCDINQYPMAIKTPGILIVRINSGLLCFANANFVR  559

Query  343  ER  338
            ER
Sbjct  560  ER  561



>gb|EYU43600.1| hypothetical protein MIMGU_mgv1a021951mg, partial [Erythranthe 
guttata]
Length=169

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SI+PS + +G+LPGTDIFC   +YP AT IPGILI+RIN+G+LCFAN+ F
Sbjct  2    AISFAKIIVSSIKPSTEVLGRLPGTDIFCNQLQYPVATKIPGILIVRINSGTLCFANANF  61

Query  349  IRER  338
            IR R
Sbjct  62   IRGR  65



>ref|XP_009804329.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
sylvestris]
Length=651

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+D+IRPS++  G+LPGT  FC+IT++P AT  PGILIIR+NN SLCFAN+ FIR
Sbjct  493  SFGKIIVDTIRPSVELQGRLPGTYTFCDITQFPVATETPGILIIRVNNASLCFANANFIR  552

Query  343  ER  338
            +R
Sbjct  553  QR  554



>ref|XP_009593440.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
tomentosiformis]
Length=651

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+D+IRPS++  G+LPGT  FC+IT++P A   PGILIIR+NN SLCFAN+ FIR
Sbjct  493  SFGKIIVDTIRPSVELQGRLPGTYTFCDITQFPVAAETPGILIIRVNNASLCFANANFIR  552

Query  343  ER  338
            +R
Sbjct  553  QR  554



>ref|XP_010105877.1| Low affinity sulfate transporter 3 [Morus notabilis]
 gb|EXC06696.1| Low affinity sulfate transporter 3 [Morus notabilis]
Length=686

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L SIRP ++ +G++P TD FCEI++YP A   PGILIIRI++G LCFAN+ F
Sbjct  516  AISFAKILLHSIRPGVEVLGRIPRTDTFCEISQYPMAAKAPGILIIRIDSGLLCFANANF  575

Query  349  IRER  338
            +RER
Sbjct  576  VRER  579



>ref|XP_007018861.1| STAS domain / Sulfate transporter family isoform 1 [Theobroma 
cacao]
 gb|EOY16086.1| STAS domain / Sulfate transporter family isoform 1 [Theobroma 
cacao]
Length=660

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+SIRP+I+ +G+LP TDIFCEI +YP A   PGIL +R+N+  LCFAN+ F+R
Sbjct  495  SFAKILLNSIRPAIEQLGRLPRTDIFCEIDQYPMAIKTPGILTLRVNSALLCFANANFLR  554

Query  343  ER  338
            ER
Sbjct  555  ER  556



>ref|XP_006354020.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Solanum tuberosum]
Length=598

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL +IRPS++  G+LPGTD FC+IT++P AT   GILIIR+NN SLCFAN+ FIR
Sbjct  434  SFGKIILGTIRPSVELQGRLPGTDTFCDITQFPVATETQGILIIRVNNASLCFANANFIR  493

Query  343  ER  338
             R
Sbjct  494  GR  495



>ref|XP_007136219.1| hypothetical protein PHAVU_009G028400g [Phaseolus vulgaris]
 gb|ESW08213.1| hypothetical protein PHAVU_009G028400g [Phaseolus vulgaris]
Length=654

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T+ FC++++YP AT+ PGIL+IRI++GSLCFAN+ F
Sbjct  492  SISFAKILIQSIRPGIEVLGQVPRTEAFCDVSQYPMATSTPGILVIRISSGSLCFANANF  551

Query  349  IRER  338
            +RER
Sbjct  552  VRER  555



>ref|XP_006354019.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Solanum tuberosum]
Length=653

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL +IRPS++  G+LPGTD FC+IT++P AT   GILIIR+NN SLCFAN+ FIR
Sbjct  489  SFGKIILGTIRPSVELQGRLPGTDTFCDITQFPVATETQGILIIRVNNASLCFANANFIR  548

Query  343  ER  338
             R
Sbjct  549  GR  550



>ref|XP_004490361.1| PREDICTED: low affinity sulfate transporter 3-like [Cicer arietinum]
Length=654

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP ++ +G++P T++FC++T+YP A + PGIL+IRI++GSLCFAN+ F++
Sbjct  493  SFAKILIQSIRPGVEILGRVPRTEVFCDVTQYPMAVSTPGILVIRISSGSLCFANANFVK  552

Query  343  ER  338
            ER
Sbjct  553  ER  554



>gb|KHN09143.1| Low affinity sulfate transporter 3 [Glycine soja]
Length=647

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T+ FC++++YP AT+ PG+L+IRI++GSLCFAN+ F
Sbjct  486  SISFAKILIQSIRPGIEVLGRVPRTEAFCDVSQYPMATSTPGMLVIRISSGSLCFANANF  545

Query  349  IRER  338
            +RER
Sbjct  546  VRER  549



>ref|XP_011074142.1| PREDICTED: low affinity sulfate transporter 3-like [Sesamum indicum]
Length=654

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KI++ SI+PS + +G+LPGTD+FC I +YP A  I GILI RIN+G+LCFAN+ FIR
Sbjct  490  SFGKIMVSSIKPSTEVVGRLPGTDLFCNIVQYPVANKISGILITRINSGTLCFANASFIR  549

Query  343  ER  338
            ER
Sbjct  550  ER  551



>ref|XP_003526596.1| PREDICTED: low affinity sulfate transporter 3-like [Glycine max]
Length=653

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T+ FC++++YP AT+ PG+L+IRI++GSLCFAN+ F
Sbjct  492  SISFAKILIQSIRPGIEVLGRVPRTEAFCDVSQYPMATSTPGMLVIRISSGSLCFANANF  551

Query  349  IRER  338
            +RER
Sbjct  552  VRER  555



>ref|XP_010320152.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Solanum lycopersicum]
Length=631

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL +IRPS++  G+LPGTD FC+IT++P AT   G+L+IR+NN SLCFAN+ FIR
Sbjct  467  SFGKIILGTIRPSVELQGRLPGTDTFCDITQFPVATETQGVLVIRVNNASLCFANANFIR  526

Query  343  ER  338
             R
Sbjct  527  GR  528



>gb|KHN31354.1| Sulfate transporter 2.1 [Glycine soja]
Length=522

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF+KIIL SIRP  + +GKLPGTD+FC++ +YP A  +PG++IIR+ +  LCFAN+ F+R
Sbjct  365  SFSKIILISIRPGTETLGKLPGTDLFCDVYQYPMAVKVPGVMIIRVKSALLCFANANFVR  424

Query  343  ER  338
            ER
Sbjct  425  ER  426



>ref|XP_010061827.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Eucalyptus grandis]
Length=674

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF  IIL SIRP  + +G+LPGTD+FC+I +YP A   PG+L+IRIN+G +CFAN+ F
Sbjct  507  AISFGNIILLSIRPGTELLGRLPGTDVFCDIRQYPMAIETPGVLLIRINSGLMCFANANF  566

Query  349  IRER*SKS  326
            IRER  +S
Sbjct  567  IRERIMRS  574



>ref|XP_010090564.1| Sulfate transporter 2.1 [Morus notabilis]
 gb|EXB39770.1| Sulfate transporter 2.1 [Morus notabilis]
Length=677

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAK+IL SIRP  + +GKLPGTD+FC+I +YP A  +PGI+I+R+ +  LCFAN+ FIR
Sbjct  518  SFAKVILISIRPGTETLGKLPGTDLFCDIQQYPMAVQLPGIMIMRLKSALLCFANANFIR  577

Query  343  ER  338
            ER
Sbjct  578  ER  579



>ref|XP_011098127.1| PREDICTED: low affinity sulfate transporter 3 [Sesamum indicum]
Length=658

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SI+PS + +G LPGTDIFC   +YP AT +PGI I RIN+ +LCFAN+ FIR
Sbjct  499  SFGKIILSSIKPSTEVLGNLPGTDIFCNTVQYPMATKLPGISIFRINSATLCFANANFIR  558

Query  343  ER  338
            ER
Sbjct  559  ER  560



>gb|KCW68851.1| hypothetical protein EUGRSUZ_F02448 [Eucalyptus grandis]
Length=656

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF  IIL SIRP  + +G+LPGTD+FC+I +YP A   PG+L+IRIN+G +CFAN+ F
Sbjct  489  AISFGNIILLSIRPGTELLGRLPGTDVFCDIRQYPMAIETPGVLLIRINSGLMCFANANF  548

Query  349  IRER*SKS  326
            IRER  +S
Sbjct  549  IRERIMRS  556



>ref|XP_010061828.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Eucalyptus grandis]
Length=670

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF  IIL SIRP  + +G+LPGTD+FC+I +YP A   PG+L+IRIN+G +CFAN+ F
Sbjct  503  AISFGNIILLSIRPGTELLGRLPGTDVFCDIRQYPMAIETPGVLLIRINSGLMCFANANF  562

Query  349  IRER*SKS  326
            IRER  +S
Sbjct  563  IRERIMRS  570



>gb|KCW68852.1| hypothetical protein EUGRSUZ_F02448 [Eucalyptus grandis]
Length=553

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF  IIL SIRP  + +G+LPGTD+FC+I +YP A   PG+L+IRIN+G +CFAN+ F
Sbjct  489  AISFGNIILLSIRPGTELLGRLPGTDVFCDIRQYPMAIETPGVLLIRINSGLMCFANANF  548

Query  349  IRER  338
            IRER
Sbjct  549  IRER  552



>gb|KHN41503.1| Low affinity sulfate transporter 3 [Glycine soja]
Length=655

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP I+ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F+R
Sbjct  492  SFAKILIQSIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVR  551

Query  343  ER  338
            ER
Sbjct  552  ER  553



>ref|XP_003544185.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Glycine max]
Length=654

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP I+ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F+R
Sbjct  492  SFAKILIQSIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVR  551

Query  343  ER  338
            ER
Sbjct  552  ER  553



>ref|XP_010652824.1| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
Length=676

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL++IRP I+ +G+LPGT++FC++ +YP A T PG+LI+R+ +  LCFAN+ F+R
Sbjct  514  SFAKIILNAIRPGIETLGRLPGTNMFCDVDQYPMAITSPGVLIVRVKSALLCFANANFVR  573

Query  343  ER  338
            ER
Sbjct  574  ER  575



>emb|CBI21449.3| unnamed protein product [Vitis vinifera]
Length=641

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL++IRP I+ +G+LPGT++FC++ +YP A T PG+LI+R+ +  LCFAN+ F+R
Sbjct  479  SFAKIILNAIRPGIETLGRLPGTNMFCDVDQYPMAITSPGVLIVRVKSALLCFANANFVR  538

Query  343  ER  338
            ER
Sbjct  539  ER  540



>gb|KEH34870.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=660

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T  FC++++YP AT+ PGIL+IRI++GSLCFAN+  
Sbjct  495  SISFAKIVIQSIRPGIEVLGRIPTTQAFCDVSQYPMATSTPGILVIRISSGSLCFANANV  554

Query  349  IRER  338
            +RER
Sbjct  555  VRER  558



>ref|XP_003543772.1| PREDICTED: low affinity sulfate transporter 3-like [Glycine max]
Length=654

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP I+ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F+R
Sbjct  492  SFAKILIQSIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVR  551

Query  343  ER  338
            ER
Sbjct  552  ER  553



>ref|XP_009781347.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
sylvestris]
Length=664

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGT-DIFCEITKYPAATTIPGILIIRINNGSLCFANSQ  353
            + SFA+IILD+IR S +  G+LPGT D FC+IT+YP ATT  GILIIRIN+GSLCFAN+ 
Sbjct  495  SISFARIILDTIRASTEVQGRLPGTTDTFCDITQYPGATTTSGILIIRINSGSLCFANAT  554

Query  352  FIRER  338
             IRER
Sbjct  555  SIRER  559



>ref|XP_004237881.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Solanum lycopersicum]
Length=653

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL +IRPS++  G+LPGTD FC+IT++P AT   G+L+IR+NN SLCFAN+ FIR
Sbjct  489  SFGKIILGTIRPSVELQGRLPGTDTFCDITQFPVATETQGVLVIRVNNASLCFANANFIR  548

Query  343  ER  338
             R
Sbjct  549  GR  550



>emb|CBK55653.1| sulphate transporter [Astragalus racemosus]
Length=662

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T+ FC +++YP AT+ PGIL+IRI++GSLCFAN+  
Sbjct  491  SISFAKIVIQSIRPGIEILGRIPSTEAFCNVSQYPMATSTPGILVIRISSGSLCFANANA  550

Query  349  IRER  338
            +RER
Sbjct  551  VRER  554



>ref|XP_006596331.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Glycine max]
Length=611

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP I+ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F+R
Sbjct  492  SFAKILIQSIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVR  551

Query  343  ER  338
            ER
Sbjct  552  ER  553



>ref|XP_006596332.1| PREDICTED: low affinity sulfate transporter 3-like isoform X3 
[Glycine max]
Length=595

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP I+ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F+R
Sbjct  492  SFAKILIQSIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVR  551

Query  343  ER  338
            ER
Sbjct  552  ER  553



>gb|KHN26070.1| Low affinity sulfate transporter 3 [Glycine soja]
Length=573

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ SIRP I+ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F+R
Sbjct  410  SFAKILIQSIRPGIEVLGRVPRTEAFCDVTQYPMAISTPGIIVIRISSGSLCFANANFVR  469

Query  343  ER  338
            ER
Sbjct  470  ER  471



>emb|CBK55658.1| sulphate transporter [Astragalus bisulcatus]
Length=662

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T+ FC +++YP AT+ PGIL+IRI++GSLCFAN+  
Sbjct  491  SISFAKIVIQSIRPGIEILGRIPSTEAFCNVSQYPMATSSPGILVIRISSGSLCFANANA  550

Query  349  IRER  338
            +RER
Sbjct  551  VRER  554



>emb|CBK55661.1| sulphate transporter [Astragalus drummondii]
Length=662

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP I+ +G++P T+ FC +++YP AT+ PGIL+IRI++GSLCFAN+  
Sbjct  491  SISFAKIVIQSIRPGIEILGRIPRTEAFCNVSQYPMATSTPGILVIRISSGSLCFANANA  550

Query  349  IRER  338
            +RER
Sbjct  551  VRER  554



>ref|XP_003552820.1| PREDICTED: sulfate transporter 2.1-like [Glycine max]
Length=653

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF+KIIL SIRP  + +GKLPGTD+FC++ +YP A  +PG++IIR+ +  LCFAN+ F+R
Sbjct  496  SFSKIILISIRPGTETLGKLPGTDLFCDVYQYPMAVKVPGVMIIRVKSALLCFANANFVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_007141139.1| hypothetical protein PHAVU_008G170700g [Phaseolus vulgaris]
 gb|ESW13133.1| hypothetical protein PHAVU_008G170700g [Phaseolus vulgaris]
Length=654

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ S+RP I+ +G++P T+ FC++T+YP A + PGI +IRI++GSLCFAN+ F+R
Sbjct  492  SFAKILIQSVRPGIEVLGRVPRTEAFCDVTQYPMAISTPGITVIRISSGSLCFANANFVR  551

Query  343  ER  338
            ER
Sbjct  552  ER  553



>ref|XP_003602002.1| Sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
 gb|AES72253.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SIRPS + +GKLPGTD+FC++ +YP A  IPG++IIR+ +  LCFAN+ F++
Sbjct  495  SFAKIIVISIRPSTETLGKLPGTDLFCDVDQYPMAIQIPGVMIIRMKSALLCFANANFVK  554

Query  343  ER  338
            ER
Sbjct  555  ER  556



>ref|XP_004500603.1| PREDICTED: low affinity sulfate transporter 3-like [Cicer arietinum]
Length=678

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SF KI++ SIRP I+ +G++P T+ FC++++YP AT+ PGIL+IRI++GSLCFANS  
Sbjct  515  SISFGKIVIQSIRPGIEVLGRIPRTEAFCDVSQYPIATSTPGILVIRISSGSLCFANSNV  574

Query  349  IRER  338
            +RER
Sbjct  575  VRER  578



>ref|XP_004252542.2| PREDICTED: low affinity sulfate transporter 3-like [Solanum lycopersicum]
Length=679

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/63 (68%), Positives = 52/63 (83%), Gaps = 1/63 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGT-DIFCEITKYPAATTIPGILIIRINNGSLCFANSQFI  347
            SFA+I+LD+IR S +  G+LPGT D FC+IT+YP AT+  GILIIRIN+GSLCFANS  I
Sbjct  511  SFARIVLDTIRASTEVQGRLPGTLDTFCDITQYPGATSTSGILIIRINSGSLCFANSTSI  570

Query  346  RER  338
            RER
Sbjct  571  RER  573



>gb|KHN44326.1| Sulfate transporter 2.1 [Glycine soja]
Length=653

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF+KIIL SIRP  + +GK+PGTD+FC++ +YP A  IPG++IIR+ +  LCFAN+ F+R
Sbjct  496  SFSKIILISIRPGTETLGKIPGTDLFCDVYQYPMAVKIPGVMIIRVKSALLCFANANFVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_003538517.1| PREDICTED: sulfate transporter 2.1-like [Glycine max]
Length=653

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF+KIIL SIRP  + +GK+PGTD+FC++ +YP A  IPG++IIR+ +  LCFAN+ F+R
Sbjct  496  SFSKIILISIRPGTETLGKIPGTDLFCDVYQYPMAVKIPGVMIIRVKSALLCFANANFVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_004502442.1| PREDICTED: sulfate transporter 2.1-like isoform X1 [Cicer arietinum]
Length=657

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP  + +GKLPGTD+FC++ +YP A  IPG++I+RI +  LCFAN+ F+R
Sbjct  496  SFAKIILISIRPGTETLGKLPGTDLFCDVYQYPMAIQIPGVMILRIKSPLLCFANASFVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_008246148.1| PREDICTED: sulfate transporter 2.1-like, partial [Prunus mume]
Length=122

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SIRP  + +GKLPG+++FC+  +YP A  IPG++IIR+ +   CFAN+ F++
Sbjct  4    SFTKIILISIRPGTETLGKLPGSEMFCDTAQYPMAVKIPGVMIIRVKSALFCFANANFVK  63

Query  343  ER  338
            ER
Sbjct  64   ER  65



>sp|P53393.1|SUT3_STYHA RecName: Full=Low affinity sulfate transporter 3 [Stylosanthes 
hamata]
 emb|CAA57831.1| low affinity sulphate transporter [Stylosanthes hamata]
Length=644

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L +IRP ++ +G++P T+ +C++ +YP A T PGIL+IRI++GSLCFAN+ F
Sbjct  478  SISFAKILLQAIRPGVEVLGRIPTTEAYCDVAQYPMAVTTPGILVIRISSGSLCFANAGF  537

Query  349  IRER  338
            +RER
Sbjct  538  VRER  541



>ref|XP_010533355.1| PREDICTED: sulfate transporter 2.2-like, partial [Tarenaya hassleriana]
Length=213

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SIRP ++ +G+LP TD+FC I +YP A+  PGI  +R+++  LCFAN+ FIR
Sbjct  142  SFAKILLSSIRPGVEALGRLPRTDVFCNINQYPMASKTPGIFTVRVSSPMLCFANANFIR  201

Query  343  ER  338
            +R
Sbjct  202  DR  203



>gb|EYU36527.1| hypothetical protein MIMGU_mgv1a002607mg [Erythranthe guttata]
Length=654

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+ SI+PS + +G L GTD+FC I +YP A  +PGILI RIN+G+ CFAN+ FIR
Sbjct  490  SFGKIIVSSIKPSTEVLGILTGTDLFCNILQYPMANKLPGILITRINSGTFCFANASFIR  549

Query  343  ER  338
            ER
Sbjct  550  ER  551



>ref|XP_011027673.1| PREDICTED: low affinity sulfate transporter 3 [Populus euphratica]
Length=644

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+LD+IRP I+ +G+LP  D++C++ +YP A   PGIL +RIN+  LCFAN+ FIR
Sbjct  479  SFARILLDAIRPGIEALGRLPRADVYCDMNQYPMAIKTPGILAVRINSALLCFANANFIR  538

Query  343  ER  338
            ER
Sbjct  539  ER  540



>ref|XP_007163633.1| hypothetical protein PHAVU_001G250700g [Phaseolus vulgaris]
 gb|ESW35627.1| hypothetical protein PHAVU_001G250700g [Phaseolus vulgaris]
Length=653

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF+KIIL SIRP  + +GKLPGT++FC++ +YP A  IPG++IIR+ +  LCFAN+ F+R
Sbjct  496  SFSKIILISIRPGTETLGKLPGTNLFCDVYQYPMAVKIPGVMIIRVKSALLCFANANFVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_003614966.1| Sulfate transporter-like protein [Medicago truncatula]
 gb|AES97924.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP ++ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F
Sbjct  491  SISFAKILIQSIRPGVEILGRVPRTEAFCDVTQYPMAISTPGIVVIRISSGSLCFANANF  550

Query  349  IRER  338
            ++ER
Sbjct  551  VKER  554



>ref|XP_004304832.1| PREDICTED: sulfate transporter 2.1-like [Fragaria vesca subsp. 
vesca]
Length=710

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF KIIL SIRP  + +G+LPGTD+FC+  +YP A T+ GI+I+R+ +  LCFANS F
Sbjct  544  AISFTKIILISIRPGTETLGQLPGTDMFCDTEQYPMAITVSGIMIVRVKSALLCFANSNF  603

Query  349  IRER  338
            +RER
Sbjct  604  VRER  607



>gb|KEH28061.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=559

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI++ SIRP ++ +G++P T+ FC++T+YP A + PGI++IRI++GSLCFAN+ F
Sbjct  491  SISFAKILIQSIRPGVEILGRVPRTEAFCDVTQYPMAISTPGIVVIRISSGSLCFANANF  550

Query  349  IRER  338
            ++ER
Sbjct  551  VKER  554



>gb|KCW62157.1| hypothetical protein EUGRSUZ_H04816 [Eucalyptus grandis]
Length=700

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SI+P I+ +G+LPGTD FC + +YP A TIPG++++R+ +  LCFAN+ FI+
Sbjct  538  SFVKIILISIQPGIETLGRLPGTDTFCNVDQYPMAITIPGVMVVRVKSSLLCFANANFIK  597

Query  343  ER  338
            +R
Sbjct  598  DR  599



>ref|XP_009591937.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
tomentosiformis]
Length=662

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGT-DIFCEITKYPAATTIPGILIIRINNGSLCFANSQ  353
            + SFA+II+D+IR S +  G+LPGT D FC+IT+YP AT   GILIIRIN+GSLCFAN+ 
Sbjct  493  SISFARIIVDTIRASTEVQGRLPGTTDTFCDITQYPGATGTSGILIIRINSGSLCFANAT  552

Query  352  FIRER  338
             IRER
Sbjct  553  SIRER  557



>ref|XP_010025490.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 2.1, partial 
[Eucalyptus grandis]
Length=689

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SI+P I+ +G+LPGTD FC + +YP A TIPG++++R+ +  LCFAN+ FI+
Sbjct  527  SFVKIILISIQPGIETLGRLPGTDTFCNVDQYPMAITIPGVMVVRVKSSLLCFANANFIK  586

Query  343  ER  338
            +R
Sbjct  587  DR  588



>ref|XP_010547619.1| PREDICTED: sulfate transporter 2.1 [Tarenaya hassleriana]
Length=687

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKIIL SIRP I+ +G++PGT+IF +  +YP A  IPG+ I+R+ +  LCFAN+ F
Sbjct  525  AISFAKIILVSIRPGIETLGRMPGTNIFADTDQYPMAVKIPGVFIVRVKSALLCFANANF  584

Query  349  IRER  338
            IRER
Sbjct  585  IRER  588



>ref|XP_010261212.1| PREDICTED: low affinity sulfate transporter 3-like [Nelumbo nucifera]
Length=659

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF K+IL++IRPS++ +G+LPGTDIFC   +YP A  I G LIIRI++   CFAN+ FIR
Sbjct  491  SFGKVILNAIRPSMEFLGQLPGTDIFCSTNQYPMAVKISGTLIIRIHSSYFCFANANFIR  550

Query  343  ER  338
            ER
Sbjct  551  ER  552



>ref|XP_010523328.1| PREDICTED: sulfate transporter 2.1-like [Tarenaya hassleriana]
Length=706

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKIIL SIRP I+ +G++PGT+IF +  +YP A  IPG+ I+R+ +  LCFAN+ F
Sbjct  544  AISFAKIILVSIRPGIETLGRMPGTNIFADTDQYPMAVKIPGVFIVRVKSALLCFANANF  603

Query  349  IRER  338
            IRER
Sbjct  604  IRER  607



>ref|XP_006428147.1| hypothetical protein CICLE_v10025101mg [Citrus clementina]
 ref|XP_006464259.1| PREDICTED: sulfate transporter 2.1-like [Citrus sinensis]
 gb|ESR41387.1| hypothetical protein CICLE_v10025101mg [Citrus clementina]
Length=657

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SI+P  + +GKLPGTD+FC++ +YP A   PGILIIR+ +  LCFAN+  +R
Sbjct  493  SFAKIILISIQPGTEKLGKLPGTDLFCDVGQYPMAVKTPGILIIRVKSALLCFANANSVR  552

Query  343  ER  338
            ER
Sbjct  553  ER  554



>ref|XP_002302276.1| Low affinity sulfate transporter 3 family protein [Populus trichocarpa]
 gb|EEE81549.1| Low affinity sulfate transporter 3 family protein [Populus trichocarpa]
Length=635

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L++IRP I+ +G+LP  D++C++ +YP A   PGIL +RIN+  LCFAN+ FIR
Sbjct  470  SFARILLNAIRPGIEALGRLPRADVYCDMNQYPMAVKTPGILAVRINSALLCFANANFIR  529

Query  343  ER  338
            ER
Sbjct  530  ER  531



>gb|KDP32701.1| hypothetical protein JCGZ_11993 [Jatropha curcas]
Length=654

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KI+L+SIRPSI+ +G++P TD F +I +YP A   PG+LI+RIN+  LCFAN+ FIR
Sbjct  496  SFGKILLNSIRPSIEELGRIPRTDTFGDINQYPMAIKTPGVLIVRINSSLLCFANANFIR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_010261213.1| PREDICTED: low affinity sulfate transporter 3-like [Nelumbo nucifera]
Length=666

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL+ IRPS++ +G+LP TDIFC   +YP A  I G LIIRI++  LCFAN+ FIR
Sbjct  497  SFAKIILNGIRPSMEILGQLPTTDIFCSTNQYPMAVKISGTLIIRIHSSYLCFANANFIR  556

Query  343  ER  338
            ER
Sbjct  557  ER  558



>ref|XP_010534060.1| PREDICTED: sulfate transporter 2.2 isoform X1 [Tarenaya hassleriana]
Length=652

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SIRP ++ +G+LP TD+FC I +YP A+  PGI  +R+++  LCFAN+ FIR
Sbjct  487  SFAKILLSSIRPGVEALGRLPRTDVFCNINQYPMASKTPGIFTVRVSSPMLCFANANFIR  546

Query  343  ER  338
            +R
Sbjct  547  DR  548



>gb|ABB59582.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=622

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L++IRP I+ +G+LP  D++C++ +YP A   PGIL +R+N+  LCFAN+ FIR
Sbjct  457  SFARILLNAIRPGIEALGRLPRADVYCDMNQYPMAVKTPGILAVRVNSALLCFANANFIR  516

Query  343  ER  338
            ER
Sbjct  517  ER  518



>ref|XP_010534061.1| PREDICTED: sulfate transporter 2.2 isoform X2 [Tarenaya hassleriana]
Length=624

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SIRP ++ +G+LP TD+FC I +YP A+  PGI  +R+++  LCFAN+ FIR
Sbjct  487  SFAKILLSSIRPGVEALGRLPRTDVFCNINQYPMASKTPGIFTVRVSSPMLCFANANFIR  546

Query  343  ER  338
            +R
Sbjct  547  DR  548



>ref|XP_007226968.1| hypothetical protein PRUPE_ppa002519mg [Prunus persica]
 gb|EMJ28167.1| hypothetical protein PRUPE_ppa002519mg [Prunus persica]
Length=663

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++S+RP I+ +G+LP TDIFC I +YP AT  P ILII IN+  LCFAN+  
Sbjct  495  SISFAKILVNSLRPGIEVLGRLPRTDIFCNINQYPMATKTPSILIIGINSSLLCFANANS  554

Query  349  IRER*SKS  326
            +RER  +S
Sbjct  555  VRERVMRS  562



>ref|XP_009345532.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Pyrus x bretschneideri]
Length=696

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++S+RP ID +GKLP TDIFC I +YP A   P ILII IN+  LCFAN+  
Sbjct  539  SISFAKILINSLRPGIDVLGKLPTTDIFCNINQYPMAIETPSILIIGINSSLLCFANANS  598

Query  349  IRER  338
            ++ER
Sbjct  599  VKER  602



>ref|XP_008233993.1| PREDICTED: low affinity sulfate transporter 3 [Prunus mume]
Length=663

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++S+RP I+ +G+LP TDIFC I +YP AT  P ILII IN+  LCFAN+  
Sbjct  495  SISFAKILVNSLRPGIEVLGRLPRTDIFCNINQYPMATKTPSILIIGINSSLLCFANANS  554

Query  349  IRER  338
            +RER
Sbjct  555  VRER  558



>gb|ABB59581.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=622

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L++IRP I+ +G+LP  D++C++ +YP A   PGIL +RIN+   CFAN+ FIR
Sbjct  457  SFARILLNAIRPGIEALGRLPRADVYCDMNQYPMAVKTPGILAVRINSALPCFANANFIR  516

Query  343  ER  338
            ER
Sbjct  517  ER  518



>ref|XP_007204972.1| hypothetical protein PRUPE_ppa002425mg [Prunus persica]
 gb|EMJ06171.1| hypothetical protein PRUPE_ppa002425mg [Prunus persica]
Length=674

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SIRP  + +GKLPGT++FC+  +YP A  IPG++IIR+ +   CFAN+ F++
Sbjct  509  SFTKIILISIRPGTETLGKLPGTEMFCDTAQYPMAIKIPGVMIIRVKSALFCFANANFVK  568

Query  343  ER  338
            ER
Sbjct  569  ER  570



>ref|XP_009345531.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Pyrus x bretschneideri]
Length=707

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++S+RP ID +GKLP TDIFC I +YP A   P ILII IN+  LCFAN+  
Sbjct  539  SISFAKILINSLRPGIDVLGKLPTTDIFCNINQYPMAIETPSILIIGINSSLLCFANANS  598

Query  349  IRER  338
            ++ER
Sbjct  599  VKER  602



>ref|XP_004149160.1| PREDICTED: sulfate transporter 2.1-like [Cucumis sativus]
 gb|KGN53230.1| hypothetical protein Csa_4G031010 [Cucumis sativus]
Length=658

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI+P  + +GK+PGTD FC+I +YP A   PG+LI+R+ +G LCFAN+ F++
Sbjct  500  SFAKIIVTSIKPGTEILGKIPGTDTFCDIHQYPMALNTPGVLIVRVKSGLLCFANANFVK  559

Query  343  ER  338
            +R
Sbjct  560  DR  561



>ref|XP_004163495.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 2.1-like 
[Cucumis sativus]
Length=658

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI+P  + +GK+PGTD FC+I +YP A   PG+LI+R+ +G LCFAN+ F++
Sbjct  500  SFAKIIVTSIKPGTEILGKIPGTDTFCDIHQYPMALNTPGVLIVRVKSGLLCFANANFVK  559

Query  343  ER  338
            +R
Sbjct  560  DR  561



>ref|XP_008233449.1| PREDICTED: sulfate transporter 2.1-like [Prunus mume]
Length=713

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SIRP  + +GKLPG+++FC+  +YP A  IPG++IIR+ +   CFAN+ F++
Sbjct  548  SFTKIILISIRPGTETLGKLPGSEMFCDTAQYPMAVKIPGVMIIRVKSALFCFANANFVK  607

Query  343  ER  338
            ER
Sbjct  608  ER  609



>ref|NP_001274303.1| sulfate transporter 2.1-like [Solanum lycopersicum]
 gb|AHA36634.1| sulfate transporter 2.1-like protein [Solanum lycopersicum]
 gb|AHA36635.1| sulfate transporter 2.2-like protein [Solanum lycopersicum]
Length=689

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL+SI+P  + +G+LPG+D+F ++ +YP ATT PG LI+R+ +  LCFAN+ FIR
Sbjct  525  SFAKIILNSIQPGTEKLGRLPGSDLFGDMEQYPIATTTPGALIVRVKSALLCFANANFIR  584

Query  343  ER  338
             R
Sbjct  585  GR  586



>ref|XP_008346989.1| PREDICTED: sulfate transporter 2.1-like [Malus domestica]
Length=175

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 6/86 (7%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SI P  + +GKLP TD+FC+  +YP A  IPGI+IIR+ +   CFAN+ F+ 
Sbjct  12   SFTKIILISIGPGTETLGKLPRTDMFCDXAQYPMAVKIPGIMIIRVKSALFCFANANFVX  71

Query  343  ER*SKSCAY*KWVFIK*SSNSCKSVQ  266
            ER        +W+  K   ++ +++Q
Sbjct  72   ER------IVRWITAKKGEDTKEAIQ  91



>ref|XP_008453779.1| PREDICTED: low affinity sulfate transporter 3-like [Cucumis melo]
Length=658

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI+P  + +GK+PGTD FC+I +YP A   PG+LI+R+ +G LCFAN+ F++
Sbjct  500  SFAKIIVISIKPGTEILGKIPGTDTFCDIHQYPMALNTPGVLIVRVKSGLLCFANANFVK  559

Query  343  ER  338
            +R
Sbjct  560  DR  561



>ref|XP_010926257.1| PREDICTED: low affinity sulfate transporter 3-like [Elaeis guineensis]
Length=661

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +II++SIRP I+ +G++ GTDIFC + +YP AT  PGILII I +  LCF N+ FIR
Sbjct  497  SFIRIIINSIRPRIEMLGRIQGTDIFCSMRQYPKATETPGILIIHIESSFLCFMNANFIR  556

Query  343  ER  338
            ER
Sbjct  557  ER  558



>gb|EEC74682.1| hypothetical protein OsI_10373 [Oryza sativa Indica Group]
Length=660

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SIRP ++ +G+L GT+IFC I +YP A  IP +L IRI+   LCF NS F
Sbjct  493  AISFAKIIIQSIRPQVEVLGRLQGTNIFCSIRQYPVACRIPSVLTIRIDTSFLCFINSTF  552

Query  349  IRER  338
            I+ER
Sbjct  553  IKER  556



>gb|AAN59769.1| Putative sulfate transporter [Oryza sativa Japonica Group]
 gb|EAZ25921.1| hypothetical protein OsJ_09764 [Oryza sativa Japonica Group]
Length=660

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SIRP ++ +G+L GT+IFC I +YP A  IP +L IRI+   LCF NS F
Sbjct  493  AISFAKIIIQSIRPQVEVLGRLQGTNIFCSIRQYPVACRIPSVLTIRIDTSFLCFINSTF  552

Query  349  IRER  338
            I+ER
Sbjct  553  IKER  556



>ref|XP_006399511.1| hypothetical protein EUTSA_v10012871mg [Eutrema salsugineum]
 gb|ESQ40964.1| hypothetical protein EUTSA_v10012871mg [Eutrema salsugineum]
Length=678

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD+F +  +YP +   PG+LI R+ +  LCFAN+ FI 
Sbjct  517  SFAKIILISIRPGIETLGRMPGTDVFADTDQYPMSVKTPGVLIFRVKSALLCFANASFIE  576

Query  343  ER  338
            ER
Sbjct  577  ER  578



>ref|XP_006366475.1| PREDICTED: sulfate transporter 2.1-like [Solanum tuberosum]
Length=689

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL+SI+P  + +G+LPG+D+F ++ +YP ATT PG LI+R+ +  LCFAN+ FIR
Sbjct  525  SFAKIILNSIQPGTEKLGRLPGSDLFGDMEQYPIATTTPGALIVRVKSALLCFANANFIR  584

Query  343  ER  338
             R
Sbjct  585  GR  586



>ref|XP_009776146.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
sylvestris]
Length=676

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAK+IL+SI+P  + +G+LPG+D+F ++ +YP A  IPGILI+R+ +  LCFAN+ FIR
Sbjct  508  SFAKVILNSIQPGTEKLGRLPGSDLFGDVNQYPMAMKIPGILIVRVKSALLCFANADFIR  567

Query  343  ER  338
             +
Sbjct  568  AK  569



>ref|XP_009378551.1| PREDICTED: sulfate transporter 2.1-like [Pyrus x bretschneideri]
Length=710

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KIIL SI P  + +GKLP TDIFC+  +YP A  IPGI+IIR+ +   CFAN+ F++
Sbjct  547  SFTKIILISIGPGTETLGKLPRTDIFCDTAQYPMAVKIPGIMIIRVKSALFCFANANFVK  606

Query  343  ER  338
            ER
Sbjct  607  ER  608



>ref|XP_007048017.1| Slufate transporter 2,1 [Theobroma cacao]
 gb|EOX92174.1| Slufate transporter 2,1 [Theobroma cacao]
Length=645

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP  + +G+LPG+D+F ++ +YP A   PG+L +R+ +  LCFAN+ F+R
Sbjct  490  SFAKIILISIRPGTETLGRLPGSDMFGDVNQYPMAVKTPGVLTMRLKSALLCFANANFVR  549

Query  343  ER  338
            ER
Sbjct  550  ER  551



>ref|XP_006651130.1| PREDICTED: low affinity sulfate transporter 3-like, partial [Oryza 
brachyantha]
Length=596

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ S+RP ++ +G+L GT IFC I +YP A  IP +L IRI+   LCF NS F
Sbjct  429  AISFAKIIIQSLRPQVEVLGRLQGTSIFCSIRQYPVACRIPAVLTIRIDTSFLCFINSTF  488

Query  349  IRER  338
            I+ER
Sbjct  489  IKER  492



>gb|EMS53139.1| hypothetical protein TRIUR3_34455 [Triticum urartu]
Length=232

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ S+RP ++G+G+L GT+IFC + +YP A   P + +IRI+   L F N+ F
Sbjct  65   AISFAKIIIQSLRPQVEGLGRLQGTNIFCSVRQYPVACRTPAVQVIRIDTSFLYFINATF  124

Query  349  IRER  338
            I+ER
Sbjct  125  IKER  128



>ref|XP_009619632.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
tomentosiformis]
Length=706

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAK+IL+SI+P  + +G+LPG+D+F ++ +YP A  IPG LI+R+ +  LCFAN+ FIR
Sbjct  543  SFAKVILNSIQPGTEKLGRLPGSDLFGDVNQYPMAMKIPGALIVRVKSALLCFANANFIR  602

Query  343  ER  338
             +
Sbjct  603  AK  604



>ref|XP_004301932.1| PREDICTED: low affinity sulfate transporter 3-like [Fragaria 
vesca subsp. vesca]
Length=657

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++++RP I+ +G+LP +DIFC +++YP A   P ILII IN+  LCFAN+  
Sbjct  488  SISFAKILINALRPGIEVLGRLPRSDIFCNMSQYPMAIKTPSILIIGINSSLLCFANANS  547

Query  349  IRER  338
            +RER
Sbjct  548  VRER  551



>ref|XP_003537509.1| PREDICTED: sulfate transporter 2.1-like [Glycine max]
Length=244

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI+P+   IG+LPGTD F ++ +YP A  IPG+LI+ + +  LCFAN+  + 
Sbjct  84   SFAKIIITSIQPATAVIGRLPGTDAFGDVEQYPMAVNIPGVLIVSLKSSWLCFANANLVE  143

Query  343  ER  338
            ER
Sbjct  144  ER  145



>ref|XP_002887712.1| hypothetical protein ARALYDRAFT_316712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63971.1| hypothetical protein ARALYDRAFT_316712 [Arabidopsis lyrata subsp. 
lyrata]
Length=649

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRP+I+ +G+L  TDIF +I +YP A   PG+L +RI++  LCFAN+ FIR
Sbjct  481  SFARIMLSSIRPNIEALGRLSKTDIFGDINQYPMANKTPGLLTLRISSPLLCFANANFIR  540

Query  343  ER  338
            +R
Sbjct  541  DR  542



>ref|XP_002309991.2| Early nodulin 70 family protein [Populus trichocarpa]
 gb|EEE90441.2| Early nodulin 70 family protein [Populus trichocarpa]
Length=652

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+ SIRP  + +G+LP TDIFC++ +YP A   P +LIIR+ +G LCFAN+ F++
Sbjct  493  SFVKIIIISIRPGAEVLGRLPETDIFCDVDQYPMAAKNPQVLIIRVKSGLLCFANANFVK  552

Query  343  ER  338
            E+
Sbjct  553  EK  554



>ref|XP_010416764.1| PREDICTED: sulfate transporter 2.2-like [Camelina sativa]
Length=654

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +I+L SIRP+I+ +G+L  TDIF +I +YP AT  PG+L +RI++  LCFAN+ FIR
Sbjct  486  SFTRIVLSSIRPNIEALGRLSKTDIFGDINQYPMATKTPGLLTLRISSPLLCFANANFIR  545

Query  343  ER  338
            +R
Sbjct  546  DR  547



>emb|CDP01189.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANS  356
            SF K+I+ SIRPS + +G++PGT  F  + +YP AT +PG+LIIRIN+GSLCFAN+
Sbjct  478  SFVKVIVGSIRPSTEVLGRVPGTSTFSNVIQYPMATKVPGLLIIRINSGSLCFANA  533



>ref|XP_003558598.1| PREDICTED: low affinity sulfate transporter 3-like [Brachypodium 
distachyon]
Length=662

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SIRP ++ +G+L GT+IFC I +YP A   P + +IRI+   LCF N+ F
Sbjct  495  AISFAKIIIQSIRPQVEILGRLQGTNIFCSIRQYPVACRTPAVQVIRIDTSFLCFINASF  554

Query  349  IRER  338
            I+ER
Sbjct  555  IKER  558



>ref|XP_002306322.2| Early nodulin 70 family protein [Populus trichocarpa]
 gb|EEE93318.2| Early nodulin 70 family protein [Populus trichocarpa]
Length=611

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+ SIRP  + +G+LPGTDIFC++ +YP A      LIIR+ +G LCFAN+ F++
Sbjct  451  SFVKIIIFSIRPGTEELGRLPGTDIFCDVNQYPMAVKNSKALIIRLKSGLLCFANANFVK  510

Query  343  ER  338
            E+
Sbjct  511  EK  512



>ref|XP_006472651.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006472652.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Citrus sinensis]
Length=664

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+++RP I+  G+LP TD + +I+++P A   PGIL IRIN+   CFAN+ FIR
Sbjct  499  SFAKILLNAVRPGIELQGRLPRTDTYGDISQFPMAIKTPGILTIRINSALFCFANANFIR  558

Query  343  ER  338
            ER
Sbjct  559  ER  560



>ref|XP_006434040.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47280.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|KDO80890.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=523

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+++RP I+  G+LP TD + +I+++P A   PGIL IRIN+   CFAN+ FIR
Sbjct  358  SFAKILLNAVRPGIELQGRLPRTDTYGDISQFPMAIKTPGILTIRINSALFCFANANFIR  417

Query  343  ER  338
            ER
Sbjct  418  ER  419



>gb|KDO80888.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
 gb|KDO80889.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=664

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+++RP I+  G+LP TD + +I+++P A   PGIL IRIN+   CFAN+ FIR
Sbjct  499  SFAKILLNAVRPGIELQGRLPRTDTYGDISQFPMAIKTPGILTIRINSALFCFANANFIR  558

Query  343  ER  338
            ER
Sbjct  559  ER  560



>ref|XP_006434037.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 ref|XP_006434039.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 ref|XP_006434041.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47277.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47279.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47281.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
Length=664

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+++RP I+  G+LP TD + +I+++P A   PGIL IRIN+   CFAN+ FIR
Sbjct  499  SFAKILLNAVRPGIELQGRLPRTDTYGDISQFPMAIKTPGILTIRINSALFCFANANFIR  558

Query  343  ER  338
            ER
Sbjct  559  ER  560



>gb|KDO80891.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=607

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+++RP I+  G+LP TD + +I+++P A   PGIL IRIN+   CFAN+ FIR
Sbjct  499  SFAKILLNAVRPGIELQGRLPRTDTYGDISQFPMAIKTPGILTIRINSALFCFANANFIR  558

Query  343  ER  338
            ER
Sbjct  559  ER  560



>ref|XP_006434038.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47278.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
Length=603

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L+++RP I+  G+LP TD + +I+++P A   PGIL IRIN+   CFAN+ FIR
Sbjct  499  SFAKILLNAVRPGIELQGRLPRTDTYGDISQFPMAIKTPGILTIRINSALFCFANANFIR  558

Query  343  ER  338
            ER
Sbjct  559  ER  560



>ref|XP_006300833.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
 gb|EOA33731.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
Length=657

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRP+I+ +G+L  TDIF +I +YP A   PG+L +RI++  LCFAN+ FIR
Sbjct  489  SFARIMLSSIRPNIEALGRLSKTDIFGDINQYPMAIKTPGLLTLRISSPLLCFANANFIR  548

Query  343  ER  338
            +R
Sbjct  549  DR  550



>gb|KFK42184.1| hypothetical protein AALP_AA2G222200 [Arabis alpina]
Length=661

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRP+I+ +G+L  TDIF +I +YP A   PG+L +RI++  LCFAN+ FIR
Sbjct  491  SFARIMLSSIRPNIEALGRLSRTDIFGDINQYPMANKTPGLLTLRISSPLLCFANANFIR  550

Query  343  ER  338
            +R
Sbjct  551  DR  552



>gb|KFK25313.1| hypothetical protein AALP_AA8G096500 [Arabis alpina]
Length=677

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD + +  +YP +   PG+LI RI +  LCFAN+ FI 
Sbjct  516  SFAKIILISIRPGIETLGRMPGTDNYADTDQYPMSVKTPGVLIFRIKSALLCFANASFIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>ref|XP_002513876.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF48459.1| sulfate transporter, putative [Ricinus communis]
Length=658

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KI+L+SIRP I+ +G++P TD + +I +YP A    GIL +RIN+  LCFAN+ FIR
Sbjct  496  SFLKILLNSIRPGIEELGRIPRTDTYSDINQYPMAIKTSGILTVRINSALLCFANANFIR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_009404428.1| PREDICTED: sulfate transporter 2.1 [Musa acuminata subsp. malaccensis]
Length=649

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ ++RPS++ +G++ GTD FC + +YP+A   P ++I+RI++  LCF N+ FIR
Sbjct  487  SFAKIIISALRPSVEMLGRIQGTDTFCSMRQYPSAAETPNLMILRIDSPFLCFMNANFIR  546

Query  343  ER  338
            ER
Sbjct  547  ER  548



>ref|XP_006300834.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
 gb|EOA33732.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
Length=591

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRP+I+ +G+L  TDIF +I +YP A   PG+L +RI++  LCFAN+ FIR
Sbjct  489  SFARIMLSSIRPNIEALGRLSKTDIFGDINQYPMAIKTPGLLTLRISSPLLCFANANFIR  548

Query  343  ER  338
            +R
Sbjct  549  DR  550



>dbj|BAJ85215.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ S+RP ++ +G+L GT+IFC + +YP A   P + +IRI+   LCF N+ F
Sbjct  498  AISFAKIIIQSLRPQVEVLGRLQGTNIFCSVRQYPVACRTPAVQVIRIDTSFLCFTNATF  557

Query  349  IRER  338
            I+ER
Sbjct  558  IKER  561



>gb|KHN31355.1| Early nodulin-70 [Glycine soja]
Length=423

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SI+P+I  IG+LPGT  F ++ +YP A  IPG+LI+ + +  LCFAN+  
Sbjct  260  AISFAKIIITSIQPAIAVIGRLPGTAAFGDVEQYPMAVNIPGVLIVSLKSSWLCFANANL  319

Query  349  IRER  338
            + ER
Sbjct  320  VEER  323



>ref|XP_009122080.1| PREDICTED: sulfate transporter 2.1-like isoform X2 [Brassica 
rapa]
Length=599

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTDIF +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  439  SFAKIILISIRPGIETLGRIPGTDIFADTDQYPMSVKTPGVLICRVKSALLCFANASSIE  498

Query  343  ER  338
            ER
Sbjct  499  ER  500



>ref|XP_009122079.1| PREDICTED: sulfate transporter 2.1-like isoform X1 [Brassica 
rapa]
 emb|CDX69856.1| BnaA10g22050D [Brassica napus]
Length=676

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTDIF +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  516  SFAKIILISIRPGIETLGRIPGTDIFADTDQYPMSVKTPGVLICRVKSALLCFANASSIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>gb|ABK35754.1| sulfate transporter [Populus tremula x Populus alba]
Length=585

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KI++ SIRP  + +G+LP TDIFC++ +YP A   P +L+IR+ +G LCFAN+ F++
Sbjct  426  SFVKILIISIRPGAEVLGRLPETDIFCDVDQYPMAAKNPQVLVIRVKSGLLCFANANFVK  485

Query  343  ER  338
            E+
Sbjct  486  EK  487



>gb|ABK35755.1| sulfate transporter [Populus tremula x Populus alba]
Length=585

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KI++ SIRP  + +G+LP TDIFC++ +YP A   P +L+IR+ +G LCFAN+ F++
Sbjct  426  SFVKILIISIRPGAEVLGRLPETDIFCDVDQYPMAAKNPQVLVIRVKSGLLCFANANFVK  485

Query  343  ER  338
            E+
Sbjct  486  EK  487



>gb|AAZ67600.1| 80A08_15 [Brassica rapa subsp. pekinensis]
Length=639

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTDIF +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  479  SFAKIILISIRPGIETLGRIPGTDIFADTDQYPMSVKTPGVLICRVKSALLCFANASSIE  538

Query  343  ER  338
            ER
Sbjct  539  ER  540



>ref|NP_565165.2| sulfate transporter 2;2 [Arabidopsis thaliana]
 sp|P92946.3|SUT22_ARATH RecName: Full=Sulfate transporter 2.2; AltName: Full=AST56; AltName: 
Full=AtH14 [Arabidopsis thaliana]
 gb|AEE36054.1| sulfate transporter 2.2 [Arabidopsis thaliana]
Length=677

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRPSI+ +G+L  TDIF +I +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  509  SFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLCFANANFIR  568

Query  343  ER  338
            +R
Sbjct  569  DR  570



>ref|XP_004985352.1| PREDICTED: low affinity sulfate transporter 3-like [Setaria italica]
Length=656

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ S+RP ++ +G+L GT+IFC I +YP A   P +L IRI+   +CF N+ F
Sbjct  489  AISFAKIIIQSLRPQVEVLGRLQGTNIFCSIRQYPVACRTPTVLTIRIDTSFMCFINATF  548

Query  349  IRER  338
            I+ER
Sbjct  549  IKER  552



>ref|XP_002465703.1| hypothetical protein SORBIDRAFT_01g044100 [Sorghum bicolor]
 gb|EER92701.1| hypothetical protein SORBIDRAFT_01g044100 [Sorghum bicolor]
Length=660

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SIRP ++ +G+L GT+IFC + +YP A   P +L IR++   LCF N+ F
Sbjct  493  AISFAKIIIQSIRPQVEVLGRLQGTNIFCSVRQYPVACQTPTVLPIRMDTSFLCFINATF  552

Query  349  IRER  338
            I+ER
Sbjct  553  IKER  556



>dbj|BAA12811.1| sulfate transporter [Arabidopsis thaliana]
Length=658

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRPSI+ +G+L  TDIF +I +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  490  SFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLCFANANFIR  549

Query  343  ER  338
            +R
Sbjct  550  DR  551



>gb|AAM20714.1| sulfate transporter, putative [Arabidopsis thaliana]
Length=658

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRPSI+ +G+L  TDIF +I +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  490  SFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLCFANANFIR  549

Query  343  ER  338
            +R
Sbjct  550  DR  551



>dbj|BAA25174.1| sulfate transporter [Arabidopsis thaliana]
Length=658

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRPSI+ +G+L  TDIF +I +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  490  SFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLCFANANFIR  549

Query  343  ER  338
            +R
Sbjct  550  DR  551



>gb|AAL67130.2| putative sulfate transporter protein [Arabidopsis thaliana]
Length=658

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRPSI+ +G+L  TDIF +I +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  490  SFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLCFANANFIR  549

Query  343  ER  338
            +R
Sbjct  550  DR  551



>gb|AAF17693.1|AC009243_20 F28K19.21 [Arabidopsis thaliana]
Length=711

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRPSI+ +G+L  TDIF +I +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  529  SFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLCFANANFIR  588

Query  343  ER  338
            +R
Sbjct  589  DR  590



>ref|XP_010428901.1| PREDICTED: sulfate transporter 2.2 [Camelina sativa]
Length=657

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +I+L SIRP+I+ +G+L  TDIF +I +YP A   PG+L +RI++  LCFAN+ FIR
Sbjct  489  SFTRIMLSSIRPNIEALGRLSKTDIFGDINQYPMAIKTPGLLTLRISSPLLCFANANFIR  548

Query  343  ER  338
            +R
Sbjct  549  DR  550



>ref|XP_009125320.1| PREDICTED: sulfate transporter 2.1 [Brassica rapa]
 emb|CDX85772.1| BnaA02g00410D [Brassica napus]
Length=677

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD F +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  516  SFAKIILISIRPGIETLGRMPGTDTFADTDQYPMSVKTPGVLIFRVKSALLCFANASSIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>emb|CDX87488.1| BnaA07g33850D [Brassica napus]
Length=640

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +IIL SIRP+++ +G+L  TDIF +I +YP AT   G+L +RI++  LCFAN+ FIR
Sbjct  475  SFTRIILSSIRPTVEALGRLSKTDIFGDINQYPMATKTQGLLTLRISSPLLCFANANFIR  534

Query  343  ER  338
            +R
Sbjct  535  DR  536



>ref|XP_009106442.1| PREDICTED: sulfate transporter 2.2 [Brassica rapa]
Length=653

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +IIL SIRP+++ +G+L  TDIF +I +YP AT   G+L +RI++  LCFAN+ FIR
Sbjct  484  SFTRIILSSIRPTVEALGRLSKTDIFGDINQYPMATKTQGLLTLRISSPLLCFANANFIR  543

Query  343  ER  338
            +R
Sbjct  544  DR  545



>emb|CDY40086.1| BnaC02g00440D [Brassica napus]
Length=677

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD F +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  516  SFAKIILISIRPGIETLGRMPGTDTFADTDQYPMSVKTPGVLIFRVKSALLCFANASSIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>gb|AAZ08077.2| putative low affinity sulfate transporter [Brassica napus]
Length=653

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +IIL SIRP+++ +G+L  TDIF +I +YP AT   G+L +RI++  LCFAN+ FIR
Sbjct  484  SFTRIILSSIRPTVEALGRLSKTDIFGDINQYPMATKTQGLLTLRISSPLLCFANANFIR  543

Query  343  ER  338
            +R
Sbjct  544  DR  545



>emb|CAG17931.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=677

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD F +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  516  SFAKIILISIRPGIETLGRMPGTDTFADTDQYPMSVKTPGVLIFRVKSALLCFANASSIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>emb|CDX88403.1| BnaC06g38470D [Brassica napus]
Length=644

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +IIL SIRP+++ +G+L  TDIF +I +YP AT   G+L +RI++  LCFAN+ FIR
Sbjct  475  SFTRIILSSIRPTVEALGRLSKTDIFGDINQYPMATKTQGLLTLRISSPLLCFANANFIR  534

Query  343  ER  338
            +R
Sbjct  535  DR  536



>ref|XP_011008597.1| PREDICTED: sulfate transporter 2.1 [Populus euphratica]
Length=652

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+ SIRP  + +G+LP TDIFC++ +YP A   P +LI R+ +G LCFAN+ F+ 
Sbjct  493  SFVKIIIISIRPGAEVLGRLPETDIFCDVDQYPMAAKNPQVLITRVKSGLLCFANANFVN  552

Query  343  ER  338
            E+
Sbjct  553  EK  554



>gb|ACK44507.1| AT5G10180-like protein [Arabidopsis arenosa]
Length=677

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD F +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  517  SFAKIILISIRPGIETLGRMPGTDTFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  576

Query  343  ER  338
            ER
Sbjct  577  ER  578



>ref|XP_008460487.1| PREDICTED: LOW QUALITY PROTEIN: low affinity sulfate transporter 
3 [Cucumis melo]
Length=671

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SIRP  + +G+LP +D+FC + ++P AT   G  IIRIN+  LCFAN+ FIR
Sbjct  506  SFAKILLISIRPGAEEVGRLPRSDMFCNMKQFPMATKTQGFSIIRINSPLLCFANASFIR  565

Query  343  ER  338
            +R
Sbjct  566  DR  567



>ref|NP_196580.1| sulfate transporter 2;1 [Arabidopsis thaliana]
 sp|O04722.1|SUT21_ARATH RecName: Full=Sulfate transporter 2.1; AltName: Full=AST68 [Arabidopsis 
thaliana]
 dbj|BAA20084.1| sulfate transporter [Arabidopsis thaliana]
 dbj|BAA20085.1| sulfate transporter [Arabidopsis thaliana]
 emb|CAB92059.1| sulfate transporter [Arabidopsis thaliana]
 gb|AAL32624.1| sulfate transporter [Arabidopsis thaliana]
 gb|AAM13334.1| sulfate transporter [Arabidopsis thaliana]
 gb|AED91505.1| sulfate transporter 2;1 [Arabidopsis thaliana]
Length=677

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD F +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  517  SFAKIILISIRPGIETLGRMPGTDTFTDTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  576

Query  343  ER  338
            ER
Sbjct  577  ER  578



>ref|XP_004140372.1| PREDICTED: low affinity sulfate transporter 3-like [Cucumis sativus]
 gb|KGN51012.1| hypothetical protein Csa_5G407060 [Cucumis sativus]
Length=669

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SIRP  + +G+LP +D+FC   ++P AT   G  IIRIN+  LCFAN+ FIR
Sbjct  506  SFAKILLISIRPGTEEVGRLPRSDMFCNRKQFPMATKTQGFSIIRINSALLCFANASFIR  565

Query  343  ER  338
            +R
Sbjct  566  DR  567



>emb|CAM33601.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=653

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +IIL SIRP+++ +G+L  TDIF +I +YP AT   G+L +RI++  LCFAN+ FIR
Sbjct  484  SFTRIILSSIRPTVEALGRLSKTDIFGDINQYPMATKTQGLLTLRISSPLLCFANANFIR  543

Query  343  ER  338
            +R
Sbjct  544  DR  545



>ref|XP_004155745.1| PREDICTED: LOW QUALITY PROTEIN: low affinity sulfate transporter 
3-like [Cucumis sativus]
Length=669

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SIRP  + +G+LP +D+FC   ++P AT   G  IIRIN+  LCFAN+ FIR
Sbjct  506  SFAKILLISIRPGTEEVGRLPRSDMFCNRKQFPMATKTQGFSIIRINSALLCFANASFIR  565

Query  343  ER  338
            +R
Sbjct  566  DR  567



>ref|XP_010495132.1| PREDICTED: sulfate transporter 2.1-like, partial [Camelina sativa]
Length=331

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP I+ + ++PGTDIF +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  171  SFAKIILISVRPGIETLRRMPGTDIFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  230

Query  343  ER  338
            ER
Sbjct  231  ER  232



>gb|EMS54294.1| Low affinity sulfate transporter 3 [Triticum urartu]
Length=535

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ S+RP ++ +G+L GT+ FC + +YP A   P + +IRI+   LCF N+ F
Sbjct  368  AISFAKIIIQSLRPQVEVLGRLQGTNTFCSVRQYPVACRTPAVQVIRIDTSFLCFINATF  427

Query  349  IRER  338
            I+ER
Sbjct  428  IKER  431



>ref|XP_003602001.1| Sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
 gb|AES72252.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=660

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 6/81 (7%)
 Frame = -1

Query  526  TSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFI  347
             SFAKII+ SI+P I  +G+LPGTD F ++ +YP A  +PG+L++ I +  LCFAN+  I
Sbjct  499  VSFAKIIVISIQPGIAVVGRLPGTDAFGDVEQYPMAINMPGVLVVSIKSAWLCFANASPI  558

Query  346  RER*SKSCAY*KWVFIK*SSN  284
            R+R        KWV I  + N
Sbjct  559  RDRIE------KWVIIDEAEN  573



>gb|ACO25294.1| low affinity sulfate transporter Bnst2-1 [Brassica napus]
Length=677

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTD F +  +YP +   PG+LI R+ +  LCFAN+  I 
Sbjct  516  SFAKIILISIRPGIETLGRMPGTDTFADTDQYPMSVKTPGVLIFRVKSALLCFANAGSIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>ref|XP_010261211.1| PREDICTED: low affinity sulfate transporter 3-like [Nelumbo nucifera]
Length=658

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            S  +I+L++IRP  + +GKLPGTD+FC   +YP A    GILIIRI++  LCF N+  I+
Sbjct  494  SIGRILLNAIRPGTEVLGKLPGTDVFCSTNQYPMAVKTSGILIIRIHSAFLCFVNANSIK  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>ref|XP_010905915.1| PREDICTED: low affinity sulfate transporter 3-like [Elaeis guineensis]
Length=564

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF++IIL+ IRP I+ +G++ GTDIFC I +YP A    G+LI+R+++  L F N+  
Sbjct  396  AISFSRIILNLIRPQIEMLGRIQGTDIFCSIKQYPMANQESGLLILRMDSSFLYFVNANM  455

Query  349  IRER*SKSC  323
            I+ER +K C
Sbjct  456  IKERIAKYC  464



>emb|CAA11413.1| sulfate permease [Brassica juncea]
Length=385

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +IIL SIRP+++ +G+L  TDIF ++ +YP A    G+L +RI++  LCFAN+ FIR
Sbjct  216  SFTRIILSSIRPTVEALGRLSKTDIFGDVNQYPMANKTEGLLTLRISSPLLCFANANFIR  275

Query  343  ER  338
            +R
Sbjct  276  DR  277



>gb|EMT09908.1| hypothetical protein F775_52532 [Aegilops tauschii]
Length=651

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ S+RP ++ +G+L GT+ FC + +YP A   P + +IRI+   LCF N+ F
Sbjct  484  AISFAKIIIQSLRPQVEVLGRLQGTNTFCSVRQYPVACRTPAVQVIRIDTSFLCFINATF  543

Query  349  IRER  338
            I+ER
Sbjct  544  IKER  547



>ref|XP_004985354.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Setaria italica]
Length=578

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
              SFAK+I+ S+RP +  +G+L GT+IFC I +YP     P +L  RI+   LCF N+ F
Sbjct  419  GVSFAKVIVHSVRPQVQILGRLRGTNIFCNIKQYPMVCQTPAVLTTRIDTSFLCFINANF  478

Query  349  IRER  338
            IRER
Sbjct  479  IRER  482



>ref|XP_006390036.1| hypothetical protein EUTSA_v10018230mg [Eutrema salsugineum]
 gb|ESQ27322.1| hypothetical protein EUTSA_v10018230mg [Eutrema salsugineum]
Length=674

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFA+I+L SIRP+I+ +G+L  TDIF +I +YP A+   G+L +RI++  LCFAN+ FIR
Sbjct  506  SFARIMLSSIRPNIEALGRLSRTDIFGDINQYPMASKTQGLLTLRISSPLLCFANANFIR  565

Query  343  ER  338
            +R
Sbjct  566  DR  567



>ref|XP_006601860.1| PREDICTED: early nodulin-70 isoform X1 [Glycine max]
Length=668

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKII+ SI+P+I  IG+LPGT  F ++ +YP A  IPG+LI+ + +  LCFAN+  
Sbjct  505  AISFAKIIITSIQPAIAVIGRLPGTAAFGDVEQYPMAVNIPGVLIVSLKSSWLCFANANL  564

Query  349  IRER  338
            + ER
Sbjct  565  VEER  568



>ref|XP_002871408.1| hypothetical protein ARALYDRAFT_908975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47667.1| hypothetical protein ARALYDRAFT_908975 [Arabidopsis lyrata subsp. 
lyrata]
Length=677

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP ++ +G++PGTD F +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  517  SFAKIILISIRPGVETLGRMPGTDTFADSNQYPMTVKTPGVLIFRVKSALLCFANASSIE  576

Query  343  ER  338
            ER
Sbjct  577  ER  578



>ref|XP_004985353.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Setaria italica]
Length=655

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
              SFAK+I+ S+RP +  +G+L GT+IFC I +YP     P +L  RI+   LCF N+ F
Sbjct  496  GVSFAKVIVHSVRPQVQILGRLRGTNIFCNIKQYPMVCQTPAVLTTRIDTSFLCFINANF  555

Query  349  IRER  338
            IRER
Sbjct  556  IRER  559



>ref|XP_010491672.1| PREDICTED: sulfate transporter 2.1-like isoform X1 [Camelina 
sativa]
Length=706

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP I+ + ++PGTDIF +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  546  SFAKIILISVRPGIETLRRMPGTDIFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  605

Query  343  ER  338
            ER
Sbjct  606  ER  607



>emb|CDX96981.1| BnaC09g46440D [Brassica napus]
Length=676

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL SIRP I+ +G++PGTDIF +  +YP +   P +LI R+ +  LCFAN+  I 
Sbjct  516  SFAKIILISIRPGIETLGRIPGTDIFADTDQYPMSVKTPRVLICRVKSALLCFANASSIE  575

Query  343  ER  338
            ER
Sbjct  576  ER  577



>ref|XP_010491673.1| PREDICTED: sulfate transporter 2.1-like isoform X2 [Camelina 
sativa]
Length=692

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP I+ + ++PGTDIF +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  532  SFAKIILISVRPGIETLRRMPGTDIFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  591

Query  343  ER  338
            ER
Sbjct  592  ER  593



>ref|XP_010491674.1| PREDICTED: sulfate transporter 2.1-like isoform X3 [Camelina 
sativa]
Length=692

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP I+ + ++PGTDIF +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  532  SFAKIILISVRPGIETLRRMPGTDIFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  591

Query  343  ER  338
            ER
Sbjct  592  ER  593



>ref|XP_010471997.1| PREDICTED: sulfate transporter 2.2-like [Camelina sativa]
Length=654

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF +I+L SIRP+I+ +G+L  TDIF +I +YP AT   G+L +RI++  LCFAN+ FIR
Sbjct  486  SFTRIMLSSIRPNIEALGRLSKTDIFGDINQYPMATKTLGLLTLRISSPLLCFANANFIR  545

Query  343  ER  338
            +R
Sbjct  546  DR  547



>ref|XP_010453042.1| PREDICTED: sulfate transporter 2.1 [Camelina sativa]
Length=689

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP I+ + ++PGTDIF +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  529  SFAKIILISVRPGIETLRRMPGTDIFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  588

Query  343  ER  338
            ER
Sbjct  589  ER  590



>ref|XP_010422881.1| PREDICTED: sulfate transporter 2.1-like, partial [Camelina sativa]
Length=517

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP ++ + ++PGTDIF +  +YP     PG+LI R+ +  LCFAN+  I 
Sbjct  357  SFAKIILISVRPGVETLRRMPGTDIFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIE  416

Query  343  ER  338
            ER
Sbjct  417  ER  418



>gb|KDP46877.1| hypothetical protein JCGZ_24086 [Jatropha curcas]
Length=658

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+ SI+P  + +G++PGTD+FC++ +YP A   P +L+IR+ +G LCFAN+  ++
Sbjct  495  SFLKIIIISIKPGTEVLGRIPGTDMFCDVLQYPMALETPSVLVIRVKSGFLCFANANLVK  554

Query  343  E  341
             
Sbjct  555  H  555



>emb|CDP01420.1| unnamed protein product [Coffea canephora]
Length=694

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
              SF  +IL SI+P  + +G++PG DIF ++ +YP A  IPGIL+ R+    LCFANS  
Sbjct  532  GVSFVTVILSSIQPGTETLGRIPGADIFVDVNQYPMAVEIPGILVTRLKCALLCFANSNC  591

Query  349  IRER  338
            I+ER
Sbjct  592  IKER  595



>ref|XP_006287209.1| hypothetical protein CARUB_v10000384mg [Capsella rubella]
 gb|EOA20107.1| hypothetical protein CARUB_v10000384mg [Capsella rubella]
Length=677

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S+RP I+ + ++PGTDIF +  +YP     PG+L+ R+ +  LCFAN+  I 
Sbjct  517  SFAKIILISVRPGIETLRRMPGTDIFADTNQYPMTVKTPGVLVFRVKSALLCFANASSIE  576

Query  343  ER  338
            ER
Sbjct  577  ER  578



>gb|ACL53345.1| unknown [Zea mays]
 tpg|DAA43991.1| TPA: hypothetical protein ZEAMMB73_140973 [Zea mays]
Length=523

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ S+RP ++ +G+L GTDIFC + +YP A   P +L IR++   LCF N+  ++
Sbjct  358  SFAKIIIQSLRPQVEILGRLQGTDIFCSVRQYPVACLTPTVLPIRVDTSFLCFINATSVK  417

Query  343  ER  338
            ER
Sbjct  418  ER  419



>ref|XP_008652499.1| PREDICTED: low affinity sulfate transporter 3 [Zea mays]
 tpg|DAA43990.1| TPA: hypothetical protein ZEAMMB73_140973 [Zea mays]
Length=705

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ S+RP ++ +G+L GTDIFC + +YP A   P +L IR++   LCF N+  ++
Sbjct  540  SFAKIIIQSLRPQVEILGRLQGTDIFCSVRQYPVACLTPTVLPIRVDTSFLCFINATSVK  599

Query  343  ER  338
            ER
Sbjct  600  ER  601



>ref|XP_006585288.1| PREDICTED: sulfate transporter 2.1-like isoform X2 [Glycine max]
Length=625

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII  SI    + +G+LPGTD+FC+  +YP A  IPG+ IIR+ +  LCF+N+  +R
Sbjct  494  SFTKIIWISIGAGTETLGRLPGTDVFCDAQQYPMAVKIPGVAIIRVKSSLLCFSNANSVR  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>ref|XP_007163634.1| hypothetical protein PHAVU_001G250800g [Phaseolus vulgaris]
 gb|ESW35628.1| hypothetical protein PHAVU_001G250800g [Phaseolus vulgaris]
Length=671

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL S++P+I  IG+LPGTD F ++ +YP A  IPG+ I+ + +  LCFAN+  + 
Sbjct  515  SFAKIILTSVQPAIAVIGRLPGTDSFGDVQQYPMALNIPGVFIVSLKSAWLCFANANLVE  574

Query  343  E  341
            E
Sbjct  575  E  575



>ref|XP_003531363.1| PREDICTED: sulfate transporter 2.1-like isoformX1 [Glycine max]
Length=652

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII  SI    + +G+LPGTD+FC+  +YP A  IPG+ IIR+ +  LCF+N+  +R
Sbjct  494  SFTKIIWISIGAGTETLGRLPGTDVFCDAQQYPMAVKIPGVAIIRVKSSLLCFSNANSVR  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>gb|KHN29086.1| Sulfate transporter 2.1 [Glycine soja]
Length=630

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII  SI    + +G+LPGTD+FC+  +YP A  IPG+ IIR+ +  LCF+N+  +R
Sbjct  472  SFTKIIWISIGAGTETLGRLPGTDVFCDAQQYPMAVKIPGVAIIRVKSSLLCFSNANSVR  531

Query  343  ER  338
            ER
Sbjct  532  ER  533



>ref|XP_002528970.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF33389.1| sulfate transporter, putative [Ricinus communis]
Length=590

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SF KII+ SI P  + +G+LPGT +F ++ +YP A   P +LIIR+ +G LCFAN+ F++
Sbjct  496  SFMKIIIISIGPGTEILGRLPGTQVFGDVDQYPMAIKTPPVLIIRVKSGFLCFANANFVK  555

Query  343  ER  338
            E+
Sbjct  556  EK  557



>ref|XP_008809316.1| PREDICTED: LOW QUALITY PROTEIN: low affinity sulfate transporter 
3-like [Phoenix dactylifera]
Length=562

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SF++II + IRP +D +G++ GTDIFC I +YP A    G+LI+RI++  L F N+  
Sbjct  396  AISFSRIIWNLIRPQVDILGRIQGTDIFCSIKQYPMAKQASGLLILRIDSSFLYFVNANM  455

Query  349  IRER*SK  329
            I+ER +K
Sbjct  456  IKERIAK  462



>ref|XP_010687477.1| PREDICTED: sulfate transporter 1.2-like [Beta vulgaris subsp. 
vulgaris]
Length=652

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP I  +G LPGT I+  I +YPAA+TIPG+LIIR+++ S+ F+NS +++
Sbjct  490  SFAKILLQVTRPRIALLGNLPGTTIYRNIQQYPAASTIPGVLIIRVDS-SIYFSNSNYVK  548

Query  343  ER  338
            +R
Sbjct  549  DR  550



>ref|XP_002513877.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF48460.1| sulfate transporter, putative [Ricinus communis]
Length=667

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLPGT ++  I +YP AT +PG+LI+R+++ ++ F+NS +IR
Sbjct  498  SFAKILLQVTRPRTAILGKLPGTTVYRNIQQYPGATKVPGVLIVRVDS-AIYFSNSNYIR  556

Query  343  ER  338
            ER
Sbjct  557  ER  558



>ref|XP_006649557.1| PREDICTED: sulfate transporter 2.1-like [Oryza brachyantha]
Length=656

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
              SFAKI++ SIR  ++ +G+L GTDIFC I +YP     P +L IRI    LCF N+  
Sbjct  496  GVSFAKIVIQSIRSQVEILGRLQGTDIFCSINQYPVVQQTPTVLTIRIETSFLCFINASS  555

Query  349  IRER  338
            I+E+
Sbjct  556  IKEK  559



>ref|XP_009362511.1| PREDICTED: sulfate transporter 1.3-like [Pyrus x bretschneideri]
Length=668

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L   RP    +GKLPGT+++  I +YP AT IPGILI+R+++ ++ F+NS +
Sbjct  503  SISFAKILLQVTRPRTTLLGKLPGTNVYRNIQQYPHATQIPGILIVRVDS-AIYFSNSNY  561

Query  349  IRER  338
            I+ER
Sbjct  562  IKER  565



>gb|AAN59770.1| Putative sulfate transporter [Oryza sativa Japonica Group]
Length=646

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI P ++ +G+L GT+IFC + +YP     P +L +RI    LCF NS  I+
Sbjct  458  SFAKIIIQSIWPQVEILGRLQGTEIFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSIK  517

Query  343  ER  338
            E+
Sbjct  518  EK  519



>gb|EEE58498.1| hypothetical protein OsJ_09763 [Oryza sativa Japonica Group]
Length=638

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI P ++ +G+L GT+IFC + +YP     P +L +RI    LCF NS  I+
Sbjct  480  SFAKIIIQSIWPQVEILGRLQGTEIFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSIK  539

Query  343  ER  338
            E+
Sbjct  540  EK  541



>gb|EEC74681.1| hypothetical protein OsI_10372 [Oryza sativa Indica Group]
Length=638

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI P ++ +G+L GT+IFC + +YP     P +L +RI    LCF NS  I+
Sbjct  480  SFAKIIIQSIWPQVEILGRLQGTEIFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSIK  539

Query  343  ER  338
            E+
Sbjct  540  EK  541



>ref|NP_001049257.1| Os03g0195300 [Oryza sativa Japonica Group]
 gb|ABF94444.1| Sulfate transporter 2.1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11171.1| Os03g0195300 [Oryza sativa Japonica Group]
Length=656

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKII+ SI P ++ +G+L GT+IFC + +YP     P +L +RI    LCF NS  I+
Sbjct  498  SFAKIIIQSIWPQVEILGRLQGTEIFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSIK  557

Query  343  ER  338
            E+
Sbjct  558  EK  559



>ref|XP_004502509.1| PREDICTED: early nodulin-70-like [Cicer arietinum]
Length=677

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L SI+PSI   G++PG++ F ++ +YP A  +PG+L++ + +  LCF N+  IR
Sbjct  518  SFAKILLISIQPSIAVFGRIPGSEAFGDVEQYPMAINMPGVLVVSVKSAWLCFTNASPIR  577

Query  343  ER  338
            ER
Sbjct  578  ER  579



>ref|XP_010939615.1| PREDICTED: sulfate transporter 1.3-like [Elaeis guineensis]
Length=658

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    IG LPGT I+  I +YP AT +PG+LI+R+++ ++ F+NS ++R
Sbjct  497  SFAKILLQVTRPRTALIGNLPGTTIYRNIEQYPEATKVPGVLIVRVDS-AIYFSNSNYVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>sp|P53391.1|SUT1_STYHA RecName: Full=High affinity sulfate transporter 1 [Stylosanthes 
hamata]
 emb|CAA57710.1| high affinity sulphate transporter [Stylosanthes hamata]
Length=667

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LIIR+++ ++ F+NS +
Sbjct  505  AISFAKILLQVTRPRTAVLGKLPGTSVYRNIQQYPKAAQIPGMLIIRVDS-AIYFSNSNY  563

Query  349  IRER  338
            I+ER
Sbjct  564  IKER  567



>gb|ABK35753.1| sulfate transporter, partial [Populus tremula x Populus alba]
Length=466

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  493  RPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIRER  338
            RP  + +G+LPGTDIFC++ +YP A      LIIR+ +G LCFAN+ F++E+
Sbjct  316  RPGTEELGRLPGTDIFCDVNQYPMAVKNSKALIIRVKSGLLCFANANFVKEK  367



>gb|KFK32123.1| hypothetical protein AALP_AA6G201100 [Arabis alpina]
Length=641

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGTD++    +YP A  IPG LIIRI++ ++ F+NS +
Sbjct  477  AISFAKILLQVTRPRTAILGKLPGTDVYRNTYQYPEANKIPGFLIIRIDS-AIYFSNSNY  535

Query  349  IRER  338
            +RER
Sbjct  536  VRER  539



>sp|P53392.1|SUT2_STYHA RecName: Full=High affinity sulfate transporter 2 [Stylosanthes 
hamata]
 emb|CAA57711.1| high affinity sulphate transporter [Stylosanthes hamata]
Length=662

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LIIR+++ ++ F+NS +
Sbjct  500  AISFAKILLQVTRPRTAVLGKLPGTSVYRNIQQYPKAEQIPGMLIIRVDS-AIYFSNSNY  558

Query  349  IRER  338
            I+ER
Sbjct  559  IKER  562



>ref|XP_008339255.1| PREDICTED: sulfate transporter 1.2-like [Malus domestica]
Length=818

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L   RP    +GKLP T+++  I +YP AT IPGILIIR+++ ++ F+NS +
Sbjct  503  SISFAKILLQVTRPRTTLLGKLPRTNVYRNIQQYPHATQIPGILIIRVDS-AIYFSNSNY  561

Query  349  IRER  338
            I+ER
Sbjct  562  IKER  565



>ref|XP_010939616.1| PREDICTED: sulfate transporter 1.3-like [Elaeis guineensis]
 ref|XP_010939617.1| PREDICTED: sulfate transporter 1.3-like [Elaeis guineensis]
Length=658

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +G LPGT I+  I +YP AT +PG+LI+R+++ ++ F+NS ++R
Sbjct  497  SFAKILLQVTRPRTALLGNLPGTTIYRNIEQYPEATKVPGVLIVRVDS-AIYFSNSNYVR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>ref|XP_010103934.1| High affinity sulfate transporter 2 [Morus notabilis]
 gb|EXB97451.1| High affinity sulfate transporter 2 [Morus notabilis]
Length=659

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKIIL   RP    +GKLP TDI+  I +YP A  IPG++IIR+++ ++ F+NS +IR
Sbjct  497  SFAKIILQVTRPRTAILGKLPRTDIYRNIQQYPDAAKIPGVVIIRVDS-AIYFSNSNYIR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>gb|KDP32700.1| hypothetical protein JCGZ_11992 [Jatropha curcas]
Length=636

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L   RP    +GKLPGT ++  I +YP AT +PG+L++R+++ ++ F+NS +
Sbjct  472  SISFAKILLQVTRPRTAILGKLPGTTVYRNIQQYPGATKVPGVLVVRVDS-AIYFSNSNY  530

Query  349  IRER  338
            I+ER
Sbjct  531  IKER  534



>ref|XP_008374998.1| PREDICTED: sulfate transporter 1.3-like [Malus domestica]
 ref|XP_008374999.1| PREDICTED: sulfate transporter 1.3-like [Malus domestica]
 ref|XP_008375000.1| PREDICTED: sulfate transporter 1.3-like [Malus domestica]
 ref|XP_008375001.1| PREDICTED: sulfate transporter 1.3-like [Malus domestica]
 ref|XP_008375002.1| PREDICTED: sulfate transporter 1.3-like [Malus domestica]
 ref|XP_008375003.1| PREDICTED: sulfate transporter 1.3-like [Malus domestica]
Length=659

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+PGT+++  I +YP AT +PG++I+R+++ ++ F+NS +I+
Sbjct  498  SFAKILLQVTRPRTAILGKIPGTNVYRNIQQYPEATKVPGVMIVRVDS-AIYFSNSNYIK  556

Query  343  ER  338
            ER
Sbjct  557  ER  558



>ref|XP_006826990.1| hypothetical protein AMTR_s00010p00209860 [Amborella trichopoda]
 gb|ERM94227.1| hypothetical protein AMTR_s00010p00209860 [Amborella trichopoda]
Length=617

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + S  KI+L   RPSI  +G++PGTDI+C I +Y    ++PG+LI R+++  +CF N+  
Sbjct  491  SISLLKIVLHIGRPSISKLGRVPGTDIYCSIEQYSHVESVPGVLIARVDSALICFFNAGC  550

Query  349  IRER  338
            IR+R
Sbjct  551  IRDR  554



>ref|XP_007226563.1| hypothetical protein PRUPE_ppa024463mg [Prunus persica]
 gb|EMJ27762.1| hypothetical protein PRUPE_ppa024463mg [Prunus persica]
Length=668

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP T+++  I +YP AT IPGILIIR+++ ++ F+NS +I+
Sbjct  508  SFAKILLQVTRPRTALLGKLPRTNVYRNILQYPNATQIPGILIIRVDS-AIYFSNSNYIK  566

Query  343  ER  338
            ER
Sbjct  567  ER  568



>ref|XP_008218902.1| PREDICTED: sulfate transporter 1.3-like [Prunus mume]
 ref|XP_008218903.1| PREDICTED: sulfate transporter 1.3-like [Prunus mume]
Length=668

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP T+++  I +YP AT IPGILIIR+++ ++ F+NS +I+
Sbjct  508  SFAKILLQVTRPRTALLGKLPRTNVYRNILQYPNATQIPGILIIRVDS-AIYFSNSNYIK  566

Query  343  ER  338
            ER
Sbjct  567  ER  568



>ref|XP_010477471.1| PREDICTED: sulfate transporter 1.3 [Camelina sativa]
Length=656

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+PGT ++  I +YP AT +PG+L IR+++ ++ F+NS +
Sbjct  493  AISFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRVPGVLTIRVDS-AIYFSNSNY  551

Query  349  IRER  338
            +RER
Sbjct  552  VRER  555



>ref|XP_010498678.1| PREDICTED: sulfate transporter 1.3-like [Camelina sativa]
Length=667

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+PGT ++  I +YP AT +PG+L IR+++ ++ F+NS +
Sbjct  504  AISFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRVPGVLTIRVDS-AIYFSNSNY  562

Query  349  IRER  338
            +RER
Sbjct  563  VRER  566



>gb|KHG07987.1| High affinity sulfate transporter 2 [Gossypium arboreum]
Length=623

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLPGT ++  I +YP AT +PGILIIR+++ ++ F+NS ++R
Sbjct  497  SFAKILLQVTRPRTAILGKLPGTTVYRNIQQYPEATKVPGILIIRVDS-AIYFSNSSYVR  555

Query  343  E  341
            E
Sbjct  556  E  556



>ref|XP_008361631.1| PREDICTED: sulfate transporter 1.2-like [Malus domestica]
Length=665

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L   RP    +GKLP T+++  I +YP AT IPGILIIR+++ ++ F+NS +
Sbjct  503  SISFAKILLQVTRPRTTLLGKLPRTNVYRNIQQYPHATQIPGILIIRVDS-AIYFSNSNY  561

Query  349  IRER  338
            I+ER
Sbjct  562  IKER  565



>gb|EYU43602.1| hypothetical protein MIMGU_mgv1a019382mg [Erythranthe guttata]
Length=639

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAK++L   RP    +GK+PG++++  I +YP AT +PG+LIIR+++ ++ F+NS +
Sbjct  476  SISFAKLLLQVTRPRTALLGKIPGSNVYRNIQQYPEATKVPGVLIIRVDS-AIYFSNSNY  534

Query  349  IRER  338
            IRER
Sbjct  535  IRER  538



>ref|XP_008790803.1| PREDICTED: sulfate transporter 1.3-like [Phoenix dactylifera]
Length=658

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +G LPGT I+  I +YP A+ +PG+LI+R+++ ++ F+NS +IR
Sbjct  497  SFAKILLQVTRPRTALLGNLPGTTIYRNIEQYPEASKVPGVLIVRVDS-AIYFSNSNYIR  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>emb|CBK55655.1| sulphate transporter [Astragalus glycyphyllos]
Length=658

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A+ IPG+LIIR+++ ++ F+NS +
Sbjct  496  AISFAKILLQVTRPRTAILGKLPGTKVYRNILQYPKASQIPGMLIIRVDS-AIYFSNSNY  554

Query  349  IRER  338
            I++R
Sbjct  555  IKDR  558



>gb|KHN33509.1| High affinity sulfate transporter 2 [Glycine soja]
Length=659

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +G+LPGT I+  I +YP AT I GILIIR+++ ++ F+NS +
Sbjct  497  AISFAKILLQVTRPRTAVLGRLPGTTIYRNIQQYPKATQINGILIIRVDS-AIYFSNSNY  555

Query  349  IRER  338
            I+ER
Sbjct  556  IKER  559



>ref|XP_010269183.1| PREDICTED: sulfate transporter 1.2-like [Nelumbo nucifera]
Length=658

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP I  +GKLP T IF  I +Y  AT +PGILI+R+++ ++ F+NS ++R
Sbjct  495  SFAKILLQVTRPRIALLGKLPRTTIFRNIQQYAEATRVPGILIVRVDS-AIYFSNSNYVR  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>emb|CBK55660.1| sulphate transporter [Astragalus drummondii]
Length=662

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT+++  I +YP A+ IPG++I+R+++ ++ F+NS +
Sbjct  500  AISFAKILLQVTRPRTALLGKLPGTNVYRNILQYPKASQIPGMVIVRVDS-AIYFSNSNY  558

Query  349  IRER  338
            I++R
Sbjct  559  IKDR  562



>ref|XP_002465704.1| hypothetical protein SORBIDRAFT_01g044110 [Sorghum bicolor]
 gb|EER92702.1| hypothetical protein SORBIDRAFT_01g044110 [Sorghum bicolor]
Length=612

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI++ S+ P ++ +G+L GT+IFC + +YP     P +L IRI+   LCF N   IR
Sbjct  480  SFAKIVVHSVWPQVEILGRLQGTNIFCNMEQYPMVCQTPAVLAIRISTSFLCFINGNSIR  539

Query  343  ER  338
            E+
Sbjct  540  EK  541



>ref|XP_011092411.1| PREDICTED: sulfate transporter 1.3-like [Sesamum indicum]
 ref|XP_011092412.1| PREDICTED: sulfate transporter 1.3-like [Sesamum indicum]
Length=651

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+P T ++  I +YP AT +PG+LI+R+++ ++ F+NS +
Sbjct  490  AISFAKILLQVTRPRTAVLGKIPRTTVYRNIQQYPEATKVPGVLIVRVDS-AIYFSNSNY  548

Query  349  IRER  338
            IRER
Sbjct  549  IRER  552



>emb|CAN75170.1| hypothetical protein VITISV_041032 [Vitis vinifera]
Length=646

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLP T ++  I +YP AT IPG+LI+RI++ ++ F+NS +
Sbjct  495  AISFAKILLQVTRPRTAILGKLPRTTVYRNIQQYPEATKIPGLLIVRIDS-AIYFSNSNY  553

Query  349  IRER  338
            ++ER
Sbjct  554  VKER  557



>ref|XP_010030061.1| PREDICTED: sulfate transporter 1.3-like [Eucalyptus grandis]
Length=656

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP T ++  I +YP AT +PG+LI+R+++ ++ F+NS +IR
Sbjct  496  SFAKILLQVTRPRTAILGKLPRTTVYRNILQYPEATKVPGVLIVRVDS-AIYFSNSNYIR  554

Query  343  ER  338
            ER
Sbjct  555  ER  556



>ref|XP_010455280.1| PREDICTED: sulfate transporter 1.1 [Camelina sativa]
 ref|XP_010455281.1| PREDICTED: sulfate transporter 1.1 [Camelina sativa]
 ref|XP_010455283.1| PREDICTED: sulfate transporter 1.1 [Camelina sativa]
Length=653

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLP T+++    +YP A  IPGILIIR+++ ++ F+NS +
Sbjct  489  AISFAKILLQVTRPRTAILGKLPNTNVYRNTLQYPDAAKIPGILIIRVDS-AIYFSNSNY  547

Query  349  IRER*SK  329
            +RER S+
Sbjct  548  VRERASR  554



>ref|NP_564159.1| sulfate transporter 1.3 [Arabidopsis thaliana]
 sp|Q9FEP7.1|SUT13_ARATH RecName: Full=Sulfate transporter 1.3 [Arabidopsis thaliana]
 dbj|BAB16410.1| sulfate tansporter Sultr1;3 [Arabidopsis thaliana]
 gb|AEE30203.1| sulfate transporter 1.3 [Arabidopsis thaliana]
Length=656

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+PGT ++  I +YP AT IPG+L IR+++ ++ F+NS ++R
Sbjct  495  SFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRIPGVLTIRVDS-AIYFSNSNYVR  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>ref|XP_010496703.1| PREDICTED: sulfate transporter 1.1-like [Camelina sativa]
Length=653

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLP T+++    +YP A  IPGILIIR+++ ++ F+NS +
Sbjct  489  AISFAKILLQVTRPRTAILGKLPNTNVYRNTLQYPDAAKIPGILIIRVDS-AIYFSNSNY  547

Query  349  IRER*SK  329
            +RER S+
Sbjct  548  VRERASR  554



>ref|XP_010421777.1| PREDICTED: sulfate transporter 1.1-like [Camelina sativa]
Length=653

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLP T+++    +YP A  IPGILIIR+++ ++ F+NS +
Sbjct  489  AISFAKILLQVTRPRTAILGKLPNTNVYRNTLQYPDAAKIPGILIIRVDS-AIYFSNSNY  547

Query  349  IRER*SK  329
            +RER S+
Sbjct  548  VRERASR  554



>ref|XP_010664070.1| PREDICTED: sulfate transporter isoform X1 [Vitis vinifera]
 ref|XP_010664071.1| PREDICTED: sulfate transporter isoform X1 [Vitis vinifera]
 emb|CBI19122.3| unnamed protein product [Vitis vinifera]
Length=658

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLP T ++  I +YP AT IPG+LI+RI++ ++ F+NS +
Sbjct  495  AISFAKILLQVTRPRTAILGKLPRTTVYRNIQQYPEATKIPGLLIVRIDS-AIYFSNSNY  553

Query  349  IRER  338
            ++ER
Sbjct  554  VKER  557



>ref|XP_002890494.1| F2E2.22 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66753.1| F2E2.22 [Arabidopsis lyrata subsp. lyrata]
Length=683

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+PGT ++  I +YP AT IPG+L IR+++ ++ F+NS ++R
Sbjct  522  SFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRIPGVLTIRVDS-AIYFSNSNYVR  580

Query  343  ER  338
            ER
Sbjct  581  ER  582



>gb|AAF86552.1|AC069252_11 F2E2.22 [Arabidopsis thaliana]
Length=683

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+PGT ++  I +YP AT IPG+L IR+++ ++ F+NS ++R
Sbjct  522  SFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRIPGVLTIRVDS-AIYFSNSNYVR  580

Query  343  ER  338
            ER
Sbjct  581  ER  582



>ref|XP_011098138.1| PREDICTED: sulfate transporter 1.2-like [Sesamum indicum]
 ref|XP_011098147.1| PREDICTED: sulfate transporter 1.2-like [Sesamum indicum]
 ref|XP_011098155.1| PREDICTED: sulfate transporter 1.2-like [Sesamum indicum]
Length=641

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAK++L   RP    +GK+P T+++  I +YP AT +PG+LIIR+++ ++ F+NS +IR
Sbjct  480  SFAKLLLQVTRPRTALLGKIPRTNVYRNIQQYPEATKVPGVLIIRVDS-AIYFSNSNYIR  538

Query  343  ER  338
            ER
Sbjct  539  ER  540



>ref|XP_003593165.1| Sulfate transporter [Medicago truncatula]
Length=759

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LI+R+++ ++ F+NS +
Sbjct  597  AISFAKILLQVTRPKTAVLGKLPGTTVYRNILQYPKAAQIPGMLIVRVDS-AIYFSNSNY  655

Query  349  IRER  338
            I++R
Sbjct  656  IKDR  659



>emb|CBK55656.1| sulphate transporter [Astragalus glycyphyllos]
Length=658

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LIIR+++ ++ F+NS +
Sbjct  496  AISFAKILLQVTRPRTAILGKLPGTKVYRNILQYPKAAQIPGMLIIRVDS-AIYFSNSNY  554

Query  349  IRER  338
            I++R
Sbjct  555  IKDR  558



>ref|XP_010459957.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 1.3-like 
[Camelina sativa]
Length=656

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+PGT ++  I +YP AT +PG+L IR+++ ++ F+NS ++R
Sbjct  495  SFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRVPGVLTIRVDS-AIYFSNSNYVR  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>gb|AES63416.2| high affinity sulfate transporter type 1 [Medicago truncatula]
Length=677

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LI+R+++ ++ F+NS +
Sbjct  515  AISFAKILLQVTRPKTAVLGKLPGTTVYRNILQYPKAAQIPGMLIVRVDS-AIYFSNSNY  573

Query  349  IRER  338
            I++R
Sbjct  574  IKDR  577



>ref|XP_009758742.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana sylvestris]
Length=652

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP I  +GK+P T ++  I +YP AT +PGILI+R+++ ++ F+NS +
Sbjct  491  AISFAKILLQVTRPRIAVLGKVPRTTVYRNIQQYPEATRVPGILIVRVDS-AIYFSNSNY  549

Query  349  IRER  338
            +R+R
Sbjct  550  MRDR  553



>emb|CDO97472.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+P T+++  I +YP A  +PGILI+R+++ ++ F+NS +
Sbjct  495  AISFAKILLQVTRPRTAVLGKVPRTNVYRNIQQYPEAAKVPGILIVRVDS-AIYFSNSNY  553

Query  349  IRER  338
            IRER
Sbjct  554  IRER  557



>ref|XP_010527609.1| PREDICTED: sulfate transporter 2.1-like [Tarenaya hassleriana]
Length=147

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  466  LPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIRER  338
            +PGTDIF +  +YP A   PG+LI+R+ +  LCFAN+ FIRER
Sbjct  1    MPGTDIFADTDQYPMAVKTPGVLIVRVKSALLCFANANFIRER  43



>ref|XP_008375005.1| PREDICTED: low affinity sulfate transporter 3 isoform X1 [Malus 
domestica]
Length=709

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++S+RP I+ +G+LP TDIFC I +YP A   P ILII I +  LCFAN+  
Sbjct  539  SISFAKILINSLRPGIEVLGRLPTTDIFCNINQYPMAIETPSILIIGIXSSLLCFANANS  598

Query  349  IRER  338
            ++ER
Sbjct  599  VKER  602



>ref|XP_009607386.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana tomentosiformis]
Length=656

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP I  +GK+P T ++  I +YP AT +PGILI+R+++ ++ F+NS +
Sbjct  495  AISFAKILLQVTRPRIAVLGKVPRTTVYRNIQQYPEATRVPGILIVRVDS-AIYFSNSNY  553

Query  349  IRER  338
            +R+R
Sbjct  554  MRDR  557



>ref|XP_004485559.1| PREDICTED: high affinity sulfate transporter 2-like [Cicer arietinum]
Length=644

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LIIR+++ ++ F+NS +
Sbjct  482  AISFAKILLQVTRPRTAVLGKLPGTTVYRNILQYPKAAQIPGMLIIRVDS-AIYFSNSNY  540

Query  349  IRER  338
            I++R
Sbjct  541  IKDR  544



>gb|ABM17059.2| sulfate transporter [Vitis rupestris]
Length=658

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLP T ++  I +YP AT IPG+LI+RI++ ++ F+NS +
Sbjct  495  AISFAKILLQVTRPRTAILGKLPRTTVYRNIQQYPEATKIPGLLIVRIDS-AIYFSNSNY  553

Query  349  IRER  338
            ++ER
Sbjct  554  VKER  557



>ref|XP_003532966.1| PREDICTED: high affinity sulfate transporter 2-like [Glycine 
max]
 gb|KHN26733.1| High affinity sulfate transporter 2 [Glycine soja]
Length=657

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP AT I G+LIIR+++ ++ F+NS +
Sbjct  495  AISFAKILLQVTRPRTAVLGKLPGTTVYRNILQYPKATQINGMLIIRVDS-AIYFSNSNY  553

Query  349  IRER  338
            I+ER
Sbjct  554  IKER  557



>ref|XP_008375006.1| PREDICTED: low affinity sulfate transporter 3 isoform X2 [Malus 
domestica]
Length=664

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+++S+RP I+ +G+LP TDIFC I +YP A   P ILII I +  LCFAN+  
Sbjct  539  SISFAKILINSLRPGIEVLGRLPTTDIFCNINQYPMAIETPSILIIGIXSSLLCFANANS  598

Query  349  IRER  338
            ++ER
Sbjct  599  VKER  602



>gb|KEH36439.1| high affinity sulfate transporter type 1 [Medicago truncatula]
Length=658

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LI+R+++ ++ F+NS +
Sbjct  496  AISFAKILLQVTRPKTAVLGKLPGTTVYRNILQYPKAAQIPGMLIVRVDS-AIYFSNSNY  554

Query  349  IRER  338
            I++R
Sbjct  555  IKDR  558



>ref|XP_006290109.1| hypothetical protein CARUB_v10003753mg [Capsella rubella]
 gb|EOA23007.1| hypothetical protein CARUB_v10003753mg [Capsella rubella]
Length=653

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP T+++    +YP A  IPGILIIR+++ ++ F+NS +IR
Sbjct  491  SFAKILLQVTRPRTAILGKLPNTNVYRNTLQYPDAAKIPGILIIRVDS-AIYFSNSNYIR  549

Query  343  ER*SK  329
            ER S+
Sbjct  550  ERASR  554



>ref|XP_010667626.1| PREDICTED: sulfate transporter 1.2-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010667629.1| PREDICTED: sulfate transporter 1.2-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +G LPG+ I+  + +YP AT IPGILI+R+++ ++ F+NS +I+
Sbjct  498  SFAKILLQVTRPRTALLGNLPGSTIYRNMQQYPEATNIPGILIVRVDS-AIYFSNSNYIK  556

Query  343  ER  338
            ER
Sbjct  557  ER  558



>ref|XP_010667625.1| PREDICTED: sulfate transporter 1.2-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +G LPG+ I+  + +YP AT IPGILI+R+++ ++ F+NS +I+
Sbjct  523  SFAKILLQVTRPRTALLGNLPGSTIYRNMQQYPEATNIPGILIVRVDS-AIYFSNSNYIK  581

Query  343  ER  338
            ER
Sbjct  582  ER  583



>ref|XP_009345534.1| PREDICTED: sulfate transporter 1.2-like [Pyrus x bretschneideri]
 ref|XP_009345535.1| PREDICTED: sulfate transporter 1.2-like [Pyrus x bretschneideri]
Length=659

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L   RP    +GK+PGT+++    +YP AT +PG++I+R+++ ++ F+NS +
Sbjct  496  SISFAKILLQVTRPRTAILGKIPGTNVYRNFQQYPEATKVPGVMIVRVDS-AIYFSNSNY  554

Query  349  IRER  338
            I+ER
Sbjct  555  IKER  558



>ref|XP_006304513.1| hypothetical protein CARUB_v10011339mg [Capsella rubella]
 gb|EOA37411.1| hypothetical protein CARUB_v10011339mg [Capsella rubella]
Length=656

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+PGT +   I +YP AT IPG+L IR+++ ++ F+NS ++R
Sbjct  495  SFAKILLQVTRPRTAILGKIPGTSVHRNINQYPEATRIPGVLTIRVDS-AIYFSNSNYVR  553

Query  343  ER  338
            ER
Sbjct  554  ER  555



>ref|XP_010030063.1| PREDICTED: sulfate transporter 1.3-like [Eucalyptus grandis]
 ref|XP_010030064.1| PREDICTED: sulfate transporter 1.3-like [Eucalyptus grandis]
 gb|KCW57019.1| hypothetical protein EUGRSUZ_I02687 [Eucalyptus grandis]
Length=656

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            + SFAKI+L   RP    +GKLP T ++  I +YP AT +PG+LI+R+++ ++ F+NS +
Sbjct  494  SISFAKILLQVTRPRTAILGKLPRTTVYRNILQYPEATKVPGVLIVRVDS-AIYFSNSNY  552

Query  349  IRER  338
            IRER
Sbjct  553  IRER  556



>emb|CBK55657.1| sulphate transporter [Astragalus bisulcatus]
Length=662

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT+++  I +YP A+ IPG++I+R+++ ++ F+NS +
Sbjct  500  AISFAKILLQVTRPRTALLGKLPGTNVYRNILQYPKASQIPGMVIVRVDS-AIYFSNSNY  558

Query  349  IRER  338
            I++R
Sbjct  559  IKDR  562



>emb|CBK55651.1| sulphate transporter [Astragalus racemosus]
Length=662

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT+++  I +YP A+ IPG++I+R+++ ++ F+NS +
Sbjct  500  AISFAKILLQVTRPRTALLGKLPGTNVYRNILQYPKASQIPGMVIVRVDS-AIYFSNSNY  558

Query  349  IRER  338
            I++R
Sbjct  559  IKDR  562



>gb|EYU39155.1| hypothetical protein MIMGU_mgv1a002721mg [Erythranthe guttata]
Length=644

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+P T ++    +YP AT +PG+LI+R+++ ++ F+NS +
Sbjct  483  AISFAKILLQVTRPRTAVLGKIPRTSVYRNTQQYPEATKVPGVLIVRVDS-AIYFSNSNY  541

Query  349  IRER  338
            IRER
Sbjct  542  IRER  545



>emb|CBK55663.1| sulphate transporter [Astragalus crotalariae]
Length=662

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GKLPGT+++  I +YP A+ IPG++I+R+++ ++ F+NS +
Sbjct  500  AISFAKILLQVTRPRTALLGKLPGTNVYRNILQYPKASQIPGMVIVRVDS-AIYFSNSNY  558

Query  349  IRER  338
            I++R
Sbjct  559  IKDR  562



>emb|CDX94791.1| BnaC07g18000D [Brassica napus]
Length=405

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP T+++    +YP A  IPGILIIR+++ ++ F+NS ++R
Sbjct  283  SFAKILLQVTRPRTAVLGKLPRTNVYRNTLQYPDAAKIPGILIIRVDS-AIYFSNSNYVR  341

Query  343  ER  338
            ER
Sbjct  342  ER  343



>emb|CAG17933.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=491

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+P T ++  I +YP AT +PG++IIR+++ ++ F+NS ++R
Sbjct  330  SFAKILLQVTRPRTAILGKIPRTSVYRNIHQYPEATMVPGVMIIRVDS-AIYFSNSNYVR  388

Query  343  ER  338
            ER
Sbjct  389  ER  390



>gb|EYU39154.1| hypothetical protein MIMGU_mgv1a002718mg [Erythranthe guttata]
Length=644

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+P T ++    +YP AT +PG+LI+R+++ ++ F+NS +
Sbjct  483  ALSFAKILLQVTRPRTAVLGKIPRTTVYRNTQQYPEATNVPGVLIVRVDS-AIYFSNSNY  541

Query  349  IRER  338
            IRER
Sbjct  542  IRER  545



>gb|EYU39153.1| hypothetical protein MIMGU_mgv1a002707mg [Erythranthe guttata]
Length=645

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +GK+P T ++    +YP AT +PG+LI+R+++ ++ F+NS +
Sbjct  484  ALSFAKILLQVTRPRTAVLGKIPRTTVYRNTQQYPEATNVPGVLIVRVDS-AIYFSNSNY  542

Query  349  IRER  338
            IRER
Sbjct  543  IRER  546



>ref|XP_004140373.1| PREDICTED: sulfate transporter 1.3-like [Cucumis sativus]
 gb|KGN51007.1| hypothetical protein Csa_5G402540 [Cucumis sativus]
Length=658

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP +  +GK+P T ++    +YP AT +PGILI+R+++ ++ F+NS +I+
Sbjct  497  SFAKILLQVTRPRVSVLGKIPRTTVYRNTQQYPEATRVPGILIVRVDS-AIYFSNSNYIK  555

Query  343  ER  338
            ER
Sbjct  556  ER  557



>gb|AGI96997.1| putative high-affinity sulfate transporter [Triticum turgidum 
subsp. durum]
Length=656

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = -1

Query  529  ATSFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQF  350
            A SFAKI+L   RP    +G LPGT I+  I++YP A   PG++I+R+++ ++ F+NS +
Sbjct  493  AISFAKILLQVTRPRTALLGNLPGTTIYRNISQYPEAKLTPGVVIVRVDS-AIYFSNSNY  551

Query  349  IRER  338
            +RER
Sbjct  552  VRER  555



>ref|XP_004485557.1| PREDICTED: high affinity sulfate transporter 2-like isoform X1 
[Cicer arietinum]
Length=658

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LIIR+++ ++ F+NS +I+
Sbjct  498  SFAKILLQVTRPRTAVLGKLPGTTVYRNILQYPKAAQIPGMLIIRVDS-AIYFSNSNYIK  556

Query  343  ER  338
            +R
Sbjct  557  DR  558



>emb|CBK55652.1| sulphate transporter [Astragalus racemosus]
Length=662

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    IGKLPGT++F  I +YP A  IPG++I+R+++ ++ F+NS +I+
Sbjct  502  SFAKILLHVTRPRTALIGKLPGTNVFRNILQYPKALQIPGMVIVRVDS-AIYFSNSNYIK  560

Query  343  ER  338
            +R
Sbjct  561  DR  562



>dbj|BAA33932.1| sulfate transporter [Arabidopsis thaliana]
Length=649

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP ++++    +YP A  IPGILIIR+++ ++ F+NS ++R
Sbjct  487  SFAKILLQVTRPRTTVLGKLPNSNVYRNTLQYPDAAQIPGILIIRVDS-AIYFSNSNYVR  545

Query  343  ER*SK  329
            ER S+
Sbjct  546  ERASR  550



>ref|NP_192602.1| sulfate transporter 1.1 [Arabidopsis thaliana]
 sp|Q9SAY1.2|SUT11_ARATH RecName: Full=Sulfate transporter 1.1; AltName: Full=AST101; 
AltName: Full=High-affinity sulfate transporter 1; AltName: 
Full=Hst1At [Arabidopsis thaliana]
 gb|AAB81876.1| putative sulfate transporter [Arabidopsis thaliana]
 emb|CAB77987.1| putative sulfate transporter [Arabidopsis thaliana]
 gb|AEE82664.1| sulfate transporter 1.1 [Arabidopsis thaliana]
Length=649

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLP ++++    +YP A  IPGILIIR+++ ++ F+NS ++R
Sbjct  487  SFAKILLQVTRPRTTVLGKLPNSNVYRNTLQYPDAAQIPGILIIRVDS-AIYFSNSNYVR  545

Query  343  ER*SK  329
            ER S+
Sbjct  546  ERASR  550



>ref|XP_004485558.1| PREDICTED: high affinity sulfate transporter 2-like isoform X2 
[Cicer arietinum]
Length=662

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GKLPGT ++  I +YP A  IPG+LIIR+++ ++ F+NS +I+
Sbjct  502  SFAKILLQVTRPRTAVLGKLPGTTVYRNILQYPKAAQIPGMLIIRVDS-AIYFSNSNYIK  560

Query  343  ER  338
            +R
Sbjct  561  DR  562



>ref|XP_004299604.1| PREDICTED: sulfate transporter 1.3-like [Fragaria vesca subsp. 
vesca]
Length=651

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -1

Query  523  SFAKIILDSIRPSIDGIGKLPGTDIFCEITKYPAATTIPGILIIRINNGSLCFANSQFIR  344
            SFAKI+L   RP    +GK+P T ++  I +YP AT +PG++I+R+++ ++ F+NS +I+
Sbjct  490  SFAKILLQVTRPRTALLGKIPSTTVYRNIQQYPEATKVPGVMIVRVDS-AIYFSNSNYIK  548

Query  343  ER  338
            ER
Sbjct  549  ER  550



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514890587360