BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22938_g2_i1 len=938 path=[1:0-156 158:157-198 2669:199-536
535:537-646 645:647-659 658:660-707 3102:708-722 721:723-747
746:748-937]

Length=938
                                                                      Score     E

ref|XP_010317149.1|  PREDICTED: STS14 protein                           205   2e-61   
ref|XP_009767432.1|  PREDICTED: STS14 protein-like                      202   2e-60   
ref|XP_006344822.1|  PREDICTED: STS14 protein-like                      201   3e-60   
sp|Q41495.1|ST14_SOLTU  RecName: Full=STS14 protein; Flags: Precu...    201   2e-59   Solanum tuberosum [potatoes]
ref|XP_009602269.1|  PREDICTED: STS14 protein-like                      198   7e-59   
ref|XP_003519913.2|  PREDICTED: STS14 protein-like                      194   2e-57   
gb|EYU44322.1|  hypothetical protein MIMGU_mgv1a014661mg                188   6e-55   
gb|KEH20457.1|  CAP, cysteine-rich secretory protein, antigen 5         187   2e-54   
ref|XP_011099257.1|  PREDICTED: STS14 protein                           185   1e-53   
ref|XP_003637257.1|  Pathogenesis-related maize seed protein            184   2e-53   
ref|XP_003548004.1|  PREDICTED: STS14 protein-like                      184   2e-53   
ref|XP_004509223.1|  PREDICTED: STS14 protein-like                      183   3e-53   
ref|XP_011004602.1|  PREDICTED: STS14 protein-like                      184   3e-53   
ref|XP_007155998.1|  hypothetical protein PHAVU_003G250100g             183   3e-53   
ref|XP_007047086.1|  CAP                                                181   3e-52   
ref|XP_002307231.2|  hypothetical protein POPTR_0005s13830g             181   5e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006466695.1|  PREDICTED: STS14 protein-like                      180   5e-52   
gb|KDO79415.1|  hypothetical protein CISIN_1g037670mg                   179   6e-52   
ref|XP_009376461.1|  PREDICTED: STS14 protein-like                      180   8e-52   
ref|XP_004300579.1|  PREDICTED: STS14 protein-like                      179   9e-52   
ref|XP_006425773.1|  hypothetical protein CICLE_v10026624mg             179   1e-51   
ref|XP_008241601.1|  PREDICTED: STS14 protein                           179   1e-51   
ref|XP_002522391.1|  STS14 protein precursor, putative                  179   1e-51   Ricinus communis
emb|CAN83306.1|  hypothetical protein VITISV_023017                     179   2e-51   Vitis vinifera
ref|XP_002262744.1|  PREDICTED: STS14 protein                           179   3e-51   Vitis vinifera
ref|XP_011025679.1|  PREDICTED: STS14 protein-like                      177   1e-50   
ref|XP_007204059.1|  hypothetical protein PRUPE_ppb010244mg             176   2e-50   
ref|XP_008342997.1|  PREDICTED: STS14 protein                           176   3e-50   
gb|KCW56824.1|  hypothetical protein EUGRSUZ_I02492                     175   4e-50   
ref|XP_010029866.1|  PREDICTED: STS14 protein                           175   5e-50   
ref|XP_010465229.1|  PREDICTED: STS14 protein-like                      175   6e-50   
ref|XP_004148042.1|  PREDICTED: STS14 protein-like                      176   6e-50   
ref|XP_010484620.1|  PREDICTED: STS14 protein-like                      174   1e-49   
ref|XP_002310192.1|  hypothetical protein POPTR_0007s12110g             174   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_008457800.1|  PREDICTED: STS14 protein                           171   2e-48   
ref|XP_010646385.1|  PREDICTED: STS14 protein-like                      170   3e-48   
ref|XP_006279500.1|  hypothetical protein CARUB_v10027169mg             170   6e-48   
ref|XP_010547472.1|  PREDICTED: STS14 protein-like                      170   6e-48   
ref|XP_006279499.1|  hypothetical protein CARUB_v10027169mg             170   7e-48   
ref|XP_010557979.1|  PREDICTED: STS14 protein                           169   1e-47   
ref|XP_007156869.1|  hypothetical protein PHAVU_002G024400g             168   3e-47   
ref|XP_003517263.1|  PREDICTED: STS14 protein-like                      167   5e-47   
ref|XP_003611867.1|  Sts14 protein                                      167   7e-47   
ref|XP_010444772.1|  PREDICTED: STS14 protein-like                      167   7e-47   
ref|NP_201460.1|  CAP (Cysteine-rich secretory proteins, Antigen ...    167   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63321.1|  sts14                                                   167   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866752.1|  hypothetical protein ARALYDRAFT_496946             166   2e-46   
ref|XP_009112312.1|  PREDICTED: STS14 protein                           164   8e-46   
emb|CDY18613.1|  BnaA09g07820D                                          164   8e-46   
ref|NP_001147033.1|  pathogenesis-related protein PRB1-3 precursor      164   8e-46   Zea mays [maize]
gb|KDP31828.1|  hypothetical protein JCGZ_12289                         164   1e-45   
ref|XP_010103679.1|  hypothetical protein L484_011731                   163   3e-45   
ref|XP_009379158.1|  PREDICTED: STS14 protein-like                      160   1e-44   
gb|EPS72456.1|  hypothetical protein M569_02307                         160   1e-44   
ref|XP_006393853.1|  hypothetical protein EUTSA_v10004516mg             166   2e-44   
gb|KFK28335.1|  hypothetical protein AALP_AA8G502600                    158   2e-43   
ref|XP_010243305.1|  PREDICTED: STS14 protein                           157   7e-43   
ref|XP_009379189.1|  PREDICTED: STS14 protein-like                      154   5e-42   
gb|ABL97973.1|  STS14                                                   147   5e-40   Brassica rapa
ref|XP_004511992.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    147   5e-38   
gb|KFK28336.1|  hypothetical protein AALP_AA8G502700                    141   6e-37   
ref|XP_006856163.1|  hypothetical protein AMTR_s00059p00174680          138   6e-36   
gb|ADE75973.1|  unknown                                                 138   1e-35   
dbj|BAA34937.1|  PR-1 like protein                                      131   5e-33   Camellia sinensis [black tea]
ref|XP_009415310.1|  PREDICTED: STS14 protein-like                      128   5e-32   
dbj|BAK07226.1|  predicted protein                                      125   7e-31   
dbj|BAJ90969.1|  predicted protein                                      125   7e-31   
ref|XP_009412303.1|  PREDICTED: STS14 protein-like                      125   9e-31   
ref|XP_003611865.1|  Pathogenesis-related protein 1C                    126   3e-30   
ref|XP_008665360.1|  PREDICTED: STS14 protein-like                      123   8e-30   
ref|XP_003559460.2|  PREDICTED: STS14 protein                           123   8e-30   
gb|KFK28334.1|  hypothetical protein AALP_AA8G502500                    122   1e-29   
ref|XP_002463930.1|  hypothetical protein SORBIDRAFT_01g009100          122   1e-29   Sorghum bicolor [broomcorn]
gb|EAY91762.1|  hypothetical protein OsI_13405                          121   4e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_001778553.1|  predicted protein                                  119   6e-29   
ref|XP_004981879.1|  PREDICTED: STS14 protein-like                      118   5e-28   
ref|XP_008805422.1|  PREDICTED: pathogenesis-related protein PR-1...    112   2e-26   
gb|KHN00577.1|  STS14 protein                                           108   4e-26   
ref|XP_011079315.1|  PREDICTED: pathogenesis-related protein PR-1...    111   7e-26   
ref|XP_003608313.1|  Pathogenesis-related protein 1A                    110   1e-25   
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4                110   2e-25   
gb|AHW81904.1|  pathogenesis-related protein                            110   2e-25   
ref|XP_009402037.1|  PREDICTED: pathogenesis-related protein PR-1...    110   2e-25   
ref|XP_007148301.1|  hypothetical protein PHAVU_006G196900g             110   3e-25   
ref|XP_010914120.1|  PREDICTED: pathogenesis-related protein PR-1       109   3e-25   
gb|AFK37568.1|  unknown                                                 110   3e-25   
ref|XP_002270128.1|  PREDICTED: pathogenesis-related leaf protein 4     108   7e-25   Vitis vinifera
ref|XP_010252392.1|  PREDICTED: basic form of pathogenesis-relate...    108   9e-25   
gb|KCW56841.1|  hypothetical protein EUGRSUZ_I02509                     108   1e-24   
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4                108   1e-24   
dbj|BAO09561.1|  pathogenesis-related protein 1                         107   1e-24   
ref|XP_002981886.1|  hypothetical protein SELMODRAFT_233855             107   1e-24   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...    107   1e-24   
ref|XP_010088981.1|  hypothetical protein L484_013561                   107   1e-24   
ref|XP_010904557.1|  PREDICTED: pathogenesis-related protein 1-like     107   1e-24   
ref|XP_010691813.1|  PREDICTED: pathogenesis-related protein 1C         107   2e-24   
ref|XP_009342193.1|  PREDICTED: pathogenesis-related protein PRMS...    107   2e-24   
emb|CDY46098.1|  BnaA03g52700D                                          107   2e-24   
ref|XP_010029887.1|  PREDICTED: pathogenesis-related protein PR-1...    107   2e-24   
gb|AAB05225.1|  pathogenesis-related protein-1                          107   2e-24   Nicotiana glutinosa
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like     107   2e-24   
emb|CAA31009.1|  PR1b preprotein                                        107   2e-24   Nicotiana tabacum [American tobacco]
ref|XP_002313936.2|  pathogenesis-related family protein                107   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_002532413.1|  STS14 protein precursor, putative                  107   2e-24   Ricinus communis
ref|XP_009119957.1|  PREDICTED: pathogenesis-related protein 1          107   3e-24   
emb|CAA29022.1|  PR-1b protein                                          106   3e-24   Nicotiana tabacum [American tobacco]
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...    106   3e-24   
ref|XP_007205909.1|  hypothetical protein PRUPE_ppa011521mg             107   3e-24   
gb|KFK28333.1|  hypothetical protein AALP_AA8G502400                    107   3e-24   
ref|XP_009605825.1|  PREDICTED: pathogenesis-related protein 1B-like    107   3e-24   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B         106   4e-24   
ref|XP_009138205.1|  PREDICTED: pathogenesis-related protein 1-like     106   5e-24   
emb|CDP12737.1|  unnamed protein product                                106   5e-24   
emb|CDX69000.1|  BnaC01g04530D                                          106   5e-24   
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg             105   6e-24   
gb|EMT11012.1|  Pathogenesis-related protein PRMS                       106   6e-24   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...    105   6e-24   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg             105   6e-24   
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg             105   7e-24   
ref|XP_001781201.1|  predicted protein                                  105   7e-24   
gb|KFK27304.1|  hypothetical protein AALP_AA8G365000                    106   7e-24   
ref|XP_002993585.1|  hypothetical protein SELMODRAFT_451245             105   8e-24   
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like     105   8e-24   
ref|XP_002992723.1|  hypothetical protein SELMODRAFT_135802             105   9e-24   
ref|XP_002983458.1|  hypothetical protein SELMODRAFT_234269             105   9e-24   
ref|XP_007041425.1|  Pathogenesis-related protein 1                     105   9e-24   
ref|XP_002974034.1|  hypothetical protein SELMODRAFT_100429             105   9e-24   
ref|XP_004301876.1|  PREDICTED: STS14 protein-like                      105   1e-23   
ref|XP_010048670.1|  PREDICTED: pathogenesis-related protein PR-1       105   1e-23   
emb|CAA30017.1|  unnamed protein product                                105   1e-23   Nicotiana tabacum [American tobacco]
ref|XP_006401187.1|  hypothetical protein EUTSA_v10014709mg             106   1e-23   
emb|CAA36790.1|  unnamed protein product                                105   1e-23   Nicotiana tabacum [American tobacco]
ref|NP_188603.1|  putative pathogenesis-related protein                 105   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|WP_035693568.1|  hypothetical protein                               104   1e-23   
ref|XP_008382391.1|  PREDICTED: pathogenesis-related protein 1A-like    105   1e-23   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...    105   1e-23   
ref|XP_009138206.1|  PREDICTED: pathogenesis-related protein 1-like     105   1e-23   
emb|CAA29023.1|  PR-1c protein                                          105   1e-23   Nicotiana tabacum [American tobacco]
ref|XP_007014137.1|  STS14 protein, putative                            105   1e-23   
ref|XP_006413271.1|  hypothetical protein EUTSA_v10026254mg             106   1e-23   
ref|XP_008237375.1|  PREDICTED: pathogenesis-related protein PRB1...    105   1e-23   
ref|XP_006845767.1|  hypothetical protein AMTR_s00019p00250630          104   1e-23   
emb|CAA31010.1|  PR1c preprotein                                        105   1e-23   Nicotiana tabacum [American tobacco]
emb|CDO97325.1|  unnamed protein product                                105   1e-23   
ref|XP_010904546.1|  PREDICTED: pathogenesis-related protein PRB1...    105   1e-23   
gb|AHA56682.1|  pathogenesis related protein                            104   1e-23   
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like    104   1e-23   
ref|XP_002272115.1|  PREDICTED: basic form of pathogenesis-relate...    104   1e-23   Vitis vinifera
ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C         105   2e-23   
ref|XP_002522065.1|  STS14 protein precursor, putative                  104   2e-23   Ricinus communis
emb|CAA31008.1|  PR1a preprotein                                        104   2e-23   Nicotiana tabacum [American tobacco]
gb|AEL99925.1|  pathogenesis-related protein 1                          104   2e-23   
ref|XP_008653595.1|  PREDICTED: pathogenesis-related protein PRB1...    104   2e-23   
ref|XP_001784190.1|  predicted protein                                  103   2e-23   
gb|AID60095.1|  CAP superfamily protein                                 104   2e-23   
ref|XP_009346545.1|  PREDICTED: pathogenesis-related protein 1A-like    104   2e-23   
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...    104   3e-23   Nicotiana tabacum [American tobacco]
ref|XP_004146301.1|  PREDICTED: pathogenesis-related protein PR-1...    104   3e-23   
gb|AHE81273.1|  pathogenesis-related protein 1-9                        104   3e-23   
gb|AHE81252.1|  pathogenesis-related protein 1-9                        104   3e-23   
ref|XP_009138211.1|  PREDICTED: pathogenesis-related protein 1-like     103   3e-23   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...    103   3e-23   
gb|AEH25624.1|  pathogenesis-related protein 1-9                        103   3e-23   
ref|XP_010265476.1|  PREDICTED: pathogenesis-related protein PRB1...    104   3e-23   
ref|XP_002273199.1|  PREDICTED: basic form of pathogenesis-relate...    103   3e-23   Vitis vinifera
ref|XP_006408913.1|  hypothetical protein EUTSA_v10002159mg             104   3e-23   
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like     103   3e-23   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like    104   3e-23   
ref|XP_010448371.1|  PREDICTED: pathogenesis-related protein PR-1...    105   4e-23   
emb|CDY68552.1|  BnaCnng59490D                                          105   4e-23   
gb|AEQ33601.1|  pathogenesis-related protein 1a                         103   4e-23   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...    103   4e-23   
dbj|BAA14220.1|  PR1a protein precursor                                 103   4e-23   Nicotiana tabacum [American tobacco]
ref|XP_008364362.1|  PREDICTED: pathogenesis-related protein PRB1...    103   4e-23   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like     103   4e-23   
emb|CDP02944.1|  unnamed protein product                                103   5e-23   
ref|XP_009397726.1|  PREDICTED: pathogenesis-related protein PRB1...    105   5e-23   
ref|XP_009138212.1|  PREDICTED: pathogenesis-related protein 1-like     103   5e-23   
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A         103   5e-23   
ref|XP_002965160.1|  hypothetical protein SELMODRAFT_28101              102   6e-23   
ref|XP_010438832.1|  PREDICTED: pathogenesis-related protein PR-1...    104   6e-23   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3                102   6e-23   
ref|XP_008455064.1|  PREDICTED: pathogenesis-related protein PRB1...    103   6e-23   
ref|XP_011069885.1|  PREDICTED: pathogenesis-related protein PR-1...    103   6e-23   
ref|XP_002522071.1|  STS14 protein precursor, putative                  103   7e-23   Ricinus communis
ref|XP_006845590.1|  hypothetical protein AMTR_s00019p00200490          103   7e-23   
ref|XP_002459308.1|  hypothetical protein SORBIDRAFT_02g002130          103   7e-23   Sorghum bicolor [broomcorn]
ref|XP_002313935.2|  hypothetical protein POPTR_0009s08660g             102   7e-23   Populus trichocarpa [western balsam poplar]
gb|KHN33603.1|  Basic form of pathogenesis-related protein 1            102   7e-23   
ref|XP_002522070.1|  STS14 protein precursor, putative                  102   8e-23   Ricinus communis
emb|CDY49367.1|  BnaA03g50560D                                          102   8e-23   
gb|AFM76999.1|  pathogenesis related protein 1a                         102   8e-23   
ref|XP_009132116.1|  PREDICTED: pathogenesis-related protein PR-1...    103   8e-23   
gb|KFK29089.1|  hypothetical protein AALP_AA7G087400                    103   9e-23   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6     102   9e-23   
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like     102   1e-22   
ref|NP_001234314.1|  pathogenesis-related leaf protein 6 precursor      102   1e-22   
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...    102   1e-22   
ref|NP_001237253.1|  uncharacterized protein LOC100527778 precursor     102   1e-22   
emb|CDY11859.1|  BnaC03g12850D                                          103   1e-22   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...    102   1e-22   
emb|CDY59219.1|  BnaCnng34480D                                          102   1e-22   
ref|XP_001759774.1|  predicted protein                                  101   1e-22   
gb|KDP35900.1|  hypothetical protein JCGZ_09872                         102   1e-22   
gb|EMS62872.1|  Pathogenesis-related protein PRMS                       102   1e-22   
ref|XP_008453637.1|  PREDICTED: pathogenesis-related protein PR-1       102   1e-22   
ref|XP_010688504.1|  PREDICTED: pathogenesis-related protein PR-1...    102   1e-22   
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like     102   1e-22   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                         102   1e-22   
ref|XP_002885324.1|  hypothetical protein ARALYDRAFT_898358             102   1e-22   
ref|XP_004289697.1|  PREDICTED: pathogenesis-related protein 1C-like    102   1e-22   
ref|XP_008383442.1|  PREDICTED: pathogenesis-related protein PR-1...    103   1e-22   
ref|XP_010443455.1|  PREDICTED: pathogenesis-related protein 1-like     103   1e-22   
ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...    102   1e-22   
gb|AAZ94265.1|  pathogenesis-related 1a                                 102   1e-22   Triticum monococcum [einkorn wheat]
gb|EEE54618.1|  hypothetical protein OsJ_01863                          101   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010088980.1|  hypothetical protein L484_013560                   102   2e-22   
ref|XP_008798895.1|  PREDICTED: pathogenesis-related protein 1-like     102   2e-22   
ref|XP_011045001.1|  PREDICTED: pathogenesis-related protein PRB1...    102   2e-22   
ref|XP_010452554.1|  PREDICTED: pathogenesis-related protein 1-like     103   2e-22   
emb|CDO97323.1|  unnamed protein product                                102   2e-22   
gb|ABK55610.1|  pathogenesis-related protein PR1c                       102   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6     102   2e-22   Vitis vinifera
ref|XP_010065835.1|  PREDICTED: pathogenesis-related protein PR-1...    101   2e-22   
emb|CDY22960.1|  BnaC03g41090D                                          102   2e-22   
gb|KDP37606.1|  hypothetical protein JCGZ_06949                         101   2e-22   
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310          101   2e-22   
ref|XP_003610169.1|  Pathogenesis-related protein PR-1                  102   2e-22   
ref|XP_006285131.1|  hypothetical protein CARUB_v10006471mg             102   2e-22   
ref|NP_195098.1|  putative pathogenesis-related protein                 101   2e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58847.1|  BnaA02g35230D                                          102   2e-22   
gb|AFG50738.1|  hypothetical protein 0_18914_01                         101   2e-22   
ref|NP_001238109.1|  uncharacterized protein LOC100499927 precursor     101   2e-22   
ref|XP_011092472.1|  PREDICTED: basic form of pathogenesis-relate...    101   2e-22   
ref|XP_002273546.1|  PREDICTED: basic form of pathogenesis-relate...    101   2e-22   Vitis vinifera
gb|AFG50742.1|  hypothetical protein 0_18914_01                         100   2e-22   
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...    101   2e-22   
ref|NP_001043091.1|  Os01g0382400                                       101   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like    101   2e-22   
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like     101   2e-22   
ref|XP_009126825.1|  PREDICTED: pathogenesis-related protein PR-1...    102   3e-22   
ref|XP_010095625.1|  hypothetical protein L484_003726                   101   3e-22   
ref|XP_002962245.1|  hypothetical protein SELMODRAFT_76987              102   3e-22   
gb|KCW78615.1|  hypothetical protein EUGRSUZ_C00080                     100   3e-22   
ref|XP_004487816.1|  PREDICTED: pathogenesis-related protein 1-like     102   3e-22   
ref|XP_010102995.1|  hypothetical protein L484_022874                   101   3e-22   
ref|XP_002867590.1|  hypothetical protein ARALYDRAFT_492241             102   3e-22   
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like     100   3e-22   
ref|XP_006379156.1|  pathogenesis-related family protein                101   3e-22   
gb|AFJ93090.1|  pathogenesis-related protein 1                          101   3e-22   
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like     101   3e-22   
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...    101   3e-22   
gb|ABK94784.1|  unknown                                                 101   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002985765.1|  hypothetical protein SELMODRAFT_122880             101   3e-22   
ref|XP_002276768.1|  PREDICTED: pathogenesis-related protein PR-1       101   4e-22   Vitis vinifera
ref|XP_010065833.1|  PREDICTED: pathogenesis-related protein 1-like     101   4e-22   
ref|XP_004507821.1|  PREDICTED: pathogenesis-related protein PR-1...    101   4e-22   
emb|CAN64209.1|  hypothetical protein VITISV_015312                     101   4e-22   Vitis vinifera
gb|KDP37603.1|  hypothetical protein JCGZ_06946                         100   4e-22   
gb|KCW44084.1|  hypothetical protein EUGRSUZ_L02505                     100   4e-22   
ref|XP_010065836.1|  PREDICTED: pathogenesis-related protein 1-like     100   4e-22   
gb|AHE81254.1|  pathogenesis-related protein 1-11                       100   4e-22   
gb|ABA41593.1|  pathogenesis-related protein                            100   4e-22   Solanum lycopersicum
ref|XP_010483291.1|  PREDICTED: pathogenesis-related protein 1-like     102   4e-22   
gb|KCW63502.1|  hypothetical protein EUGRSUZ_G01132                     100   4e-22   
emb|CAA65420.1|  pathogenesis-related protein 1                         100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194309.1|  allergen V5/Tpx-1-related family protein              102   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148306.1|  hypothetical protein PHAVU_006G197400g             100   5e-22   
gb|AAQ19681.1|  cytoplasmic small heat shock protein class I            100   5e-22   Capsicum frutescens [bird pepper]
emb|CBI25093.3|  unnamed protein product                                100   5e-22   
ref|XP_002883954.1|  hypothetical protein ARALYDRAFT_480471             100   5e-22   
ref|XP_008225773.1|  PREDICTED: pathogenesis-related protein PRMS...    100   5e-22   
ref|XP_010433592.1|  PREDICTED: pathogenesis-related protein PR-1...    102   5e-22   
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...    100   5e-22   
ref|XP_010065832.1|  PREDICTED: pathogenesis-related protein 1-like     100   5e-22   
gb|AFM77011.1|  pathogenesis related protein 1a                         100   5e-22   
ref|XP_009767365.1|  PREDICTED: pathogenesis-related protein PRB1...    101   5e-22   
gb|AFK44980.1|  unknown                                                 100   5e-22   
ref|XP_011092471.1|  PREDICTED: basic form of pathogenesis-relate...    100   5e-22   
gb|ABK23936.1|  unknown                                                 100   5e-22   
ref|XP_009135645.1|  PREDICTED: pathogenesis-related protein 1          100   5e-22   
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...    100   6e-22   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                       100   6e-22   
ref|XP_006282972.1|  hypothetical protein CARUB_v10007846mg             100   6e-22   
emb|CDX82282.1|  BnaA03g35390D                                          100   6e-22   
ref|XP_006281936.1|  hypothetical protein CARUB_v10028144mg             101   6e-22   
gb|KHN19052.1|  Basic form of pathogenesis-related protein 1            100   6e-22   
ref|XP_002270281.2|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    100   6e-22   
gb|KDP37604.1|  hypothetical protein JCGZ_06947                         100   6e-22   
ref|XP_010046906.1|  PREDICTED: pathogenesis-related protein 1C-like    100   6e-22   
ref|XP_006369711.1|  Pathogenesis-related family protein                100   6e-22   
emb|CDX89632.1|  BnaC03g45460D                                          100   6e-22   
ref|XP_007041421.1|  CAP (Cysteine-rich secretory proteins, Antig...    100   6e-22   
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...    100   7e-22   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like    100   7e-22   
gb|AFG50743.1|  hypothetical protein 0_18914_01                       99.8    7e-22   
ref|XP_010065834.1|  PREDICTED: pathogenesis-related protein 1-like     100   7e-22   
gb|AHE81275.1|  pathogenesis-related protein 1-11                       100   8e-22   
ref|XP_010270442.1|  PREDICTED: basic form of pathogenesis-relate...    100   8e-22   
gb|ABR18381.1|  unknown                                                 100   8e-22   
gb|ADP69172.1|  pathogenesis related protein-1                          100   8e-22   
gb|ACT99721.1|  pathogen-related protein 1                              100   9e-22   
gb|AGK89727.1|  pathogenesis-related 1 protein                          100   9e-22   
gb|ADN43429.1|  pathogenesis-related protein 1                        99.8    9e-22   
ref|XP_006412319.1|  hypothetical protein EUTSA_v10026438mg           99.8    1e-21   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like   99.8    1e-21   
ref|XP_007148307.1|  hypothetical protein PHAVU_006G197500g           99.8    1e-21   
gb|AHE81280.1|  pathogenesis-related protein 1-16                     99.8    1e-21   
gb|AHE81259.1|  pathogenesis-related protein 1-16                     99.8    1e-21   
gb|AEH25631.1|  pathogenesis-related protein 1-16                     99.8    1e-21   
ref|NP_001234523.1|  pathogenesis-related leaf protein 4 precursor    99.4    1e-21   
gb|AAX20041.1|  cytoplasmic small heat shock protein class I          99.4    1e-21   
ref|XP_006412587.1|  hypothetical protein EUTSA_v10026331mg             100   1e-21   
ref|XP_006845587.1|  hypothetical protein AMTR_s00019p00199400        99.0    1e-21   
ref|XP_010536929.1|  PREDICTED: pathogenesis-related protein PR-1       100   1e-21   
gb|AEH25634.1|  pathogenesis-related protein 1-19                     99.8    1e-21   
ref|XP_002961744.1|  hypothetical protein SELMODRAFT_28035            99.0    1e-21   
emb|CAN68901.1|  hypothetical protein VITISV_019988                   99.0    2e-21   
gb|AAB06458.1|  pathogenesis-related protein PR1                      99.4    2e-21   
ref|XP_010447203.1|  PREDICTED: pathogenesis-related protein 1-like   99.4    2e-21   
gb|KFK39972.1|  hypothetical protein AALP_AA3G313200                  99.0    2e-21   
gb|ABA34079.1|  pathogenesis-related protein 1                        99.4    2e-21   
ref|XP_002974459.1|  hypothetical protein SELMODRAFT_101024           99.4    2e-21   
ref|XP_009622046.1|  PREDICTED: pathogenesis-related protein PRB1...  99.8    2e-21   
ref|XP_003550666.1|  PREDICTED: pathogenesis-related protein PR-1...  99.4    2e-21   
ref|XP_004295465.1|  PREDICTED: pathogenesis-related protein PR-1...  99.4    2e-21   
ref|XP_011091978.1|  PREDICTED: basic form of pathogenesis-relate...  99.0    2e-21   
ref|XP_006299650.1|  hypothetical protein CARUB_v10015837mg           99.8    2e-21   
ref|NP_001235516.1|  uncharacterized protein LOC100306470 precursor   99.4    2e-21   
gb|KDP37611.1|  hypothetical protein JCGZ_06954                       99.0    2e-21   
gb|AFK64734.1|  pathogenesis related protein 1a                       99.0    2e-21   
gb|KHN17570.1|  Pathogenesis-related protein PR-1                     99.4    2e-21   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...  99.0    2e-21   
ref|XP_010437726.1|  PREDICTED: pathogenesis-related protein 1-like   99.0    2e-21   
emb|CDY63648.1|  BnaC07g51020D                                        99.4    2e-21   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...  99.0    2e-21   
gb|ABA34062.1|  pathogenesis-related protein 1                        99.0    2e-21   
ref|WP_038140978.1|  hypothetical protein                             98.6    2e-21   
ref|XP_008223670.1|  PREDICTED: pathogenesis-related protein PR-1...  99.0    2e-21   
prf||1803521A  pathogenesis-related protein 1                         98.2    2e-21
ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...  98.6    2e-21   
ref|XP_002864522.1|  hypothetical protein ARALYDRAFT_495859           99.8    2e-21   
gb|ACJ62499.1|  pathogenesis-related protein class I                  98.6    2e-21   
ref|XP_007199090.1|  hypothetical protein PRUPE_ppa020367mg           97.8    2e-21   
emb|CDX93140.1|  BnaA03g38620D                                        98.6    3e-21   
gb|ACJ62489.1|  pathogenesis-related protein class I                  98.6    3e-21   
gb|ACJ62461.1|  pathogenesis-related protein class I                  98.6    3e-21   
ref|NP_680450.1|  CAP (Cysteine-rich secretory proteins, Antigen ...  99.8    3e-21   
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...  98.6    3e-21   
emb|CAE51954.1|  putative basic PR1                                   98.6    3e-21   
ref|XP_009136246.1|  PREDICTED: pathogenesis-related protein 1-like   98.6    3e-21   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...  98.6    3e-21   
ref|NP_001048335.1|  Os02g0786400                                     99.0    3e-21   
gb|ACJ62486.1|  pathogenesis-related protein class I                  98.6    3e-21   
gb|ACJ62462.1|  pathogenesis-related protein class I                  98.6    3e-21   
emb|CDY13434.1|  BnaA03g51520D                                        99.0    3e-21   
gb|KDP36353.1|  hypothetical protein JCGZ_09850                       99.0    3e-21   
gb|EMS35766.1|  Pathogenesis-related protein PRMS                     98.6    3e-21   
gb|ABA34056.1|  pathogenesis-related protein 1                        98.2    3e-21   
ref|XP_002300292.2|  Pathogenesis-related family protein              98.6    3e-21   
gb|ABA34077.1|  pathogenesis-related protein 1                        98.2    3e-21   
ref|XP_010530685.1|  PREDICTED: pathogenesis-related protein 1-like   97.8    3e-21   
dbj|BAN09077.1|  pathogenesis related protein-1.2                     98.6    3e-21   
ref|XP_009342367.1|  PREDICTED: pathogenesis-related protein PR-1...  98.2    3e-21   
dbj|BAF03626.1|  pathogenesis related protein 1                       98.2    3e-21   
pdb|1CFE|A  Chain A, P14a, Nmr, 20 Structures                         97.4    3e-21   
ref|XP_010942046.1|  PREDICTED: uncharacterized protein LOC105060136    101   3e-21   
gb|ABK25508.1|  unknown                                               98.6    3e-21   
ref|NP_001105399.1|  pathogenesis related protein4 precursor          98.2    3e-21   
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...  98.2    4e-21   
gb|ABA34060.1|  pathogenesis-related protein 1                        98.2    4e-21   
ref|XP_002994637.1|  hypothetical protein SELMODRAFT_138925           98.6    4e-21   
gb|ABA34063.1|  pathogenesis-related protein 1                        98.2    4e-21   
gb|ABA34055.1|  pathogenesis-related protein 1                        98.2    4e-21   
gb|AEH25629.1|  pathogenesis-related protein 1-14                     98.6    4e-21   
gb|ABA34066.1|  pathogenesis-related protein 1                        98.2    4e-21   
gb|KFK40371.1|  hypothetical protein AALP_AA3G364900                  98.6    4e-21   
ref|XP_002324487.1|  hypothetical protein POPTR_0018s10410g           98.2    4e-21   
ref|XP_010260172.1|  PREDICTED: pathogenesis-related protein PRB1...  99.0    4e-21   
ref|XP_003545770.1|  PREDICTED: basic form of pathogenesis-relate...  98.2    4e-21   
dbj|BAK01044.1|  predicted protein                                    98.2    4e-21   
ref|XP_009138015.1|  PREDICTED: pathogenesis-related protein PRB1-3   98.6    4e-21   
ref|XP_010539449.1|  PREDICTED: pathogenesis-related protein PR-1...  99.4    4e-21   
ref|XP_002962721.1|  hypothetical protein SELMODRAFT_230161           98.2    4e-21   
ref|XP_006298656.1|  hypothetical protein CARUB_v10014746mg           98.6    4e-21   
ref|XP_010527114.1|  PREDICTED: pathogenesis-related protein PRB1-3   98.2    4e-21   
ref|XP_004168740.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    5e-21   
ref|XP_008236236.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    5e-21   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...  97.8    5e-21   
gb|AEJ88253.1|  putative pathogenesis-related protein 1               97.8    5e-21   
ref|XP_010530686.1|  PREDICTED: pathogenesis-related protein 1-like   97.8    5e-21   
gb|KGN48339.1|  hypothetical protein Csa_6G483242                     97.4    5e-21   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    5e-21   
ref|XP_010052996.1|  PREDICTED: pathogenesis-related protein 1-like   97.8    5e-21   
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    5e-21   
ref|XP_004983398.1|  PREDICTED: pathogenesis-related protein PRMS...  98.2    5e-21   
ref|XP_010266519.1|  PREDICTED: pathogenesis-related protein 1A-like  97.8    5e-21   
gb|ACJ62530.1|  pathogenesis-related protein class I                  97.4    6e-21   
ref|XP_002273355.1|  PREDICTED: basic form of pathogenesis-relate...  97.4    6e-21   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1              97.8    6e-21   
gb|AEH25622.1|  pathogenesis-related protein 1-7                      97.8    6e-21   
gb|ACJ62513.1|  pathogenesis-related protein class I                  97.4    6e-21   
gb|AEV57469.1|  pathogensis-related protein 1b                        98.2    6e-21   
gb|EEC81457.1|  hypothetical protein OsI_24759                        97.1    6e-21   
ref|NP_179589.1|  pathogenesis-related protein-1-like protein         97.8    6e-21   
ref|XP_008245926.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    6e-21   
ref|XP_006412320.1|  hypothetical protein EUTSA_v10027447mg           97.4    7e-21   
ref|XP_009394873.1|  PREDICTED: pathogenesis-related protein PRMS...  97.8    7e-21   
gb|AEH25633.1|  pathogenesis-related protein 1-18                     97.8    7e-21   
ref|XP_010941968.1|  PREDICTED: pathogenesis-related protein PRB1...  97.4    7e-21   
gb|KEH27545.1|  CAP, cysteine-rich secretory protein, antigen 5       95.9    7e-21   
emb|CDO97326.1|  unnamed protein product                              97.4    7e-21   
ref|XP_006409652.1|  hypothetical protein EUTSA_v10022888mg           97.4    7e-21   
gb|AFK46675.1|  unknown                                               97.4    7e-21   
ref|XP_010040969.1|  PREDICTED: pathogenesis-related protein 1-like   97.4    8e-21   
gb|ABA34014.1|  pathogenesis-related maize seed protein               97.4    8e-21   
ref|XP_004955414.1|  PREDICTED: pathogenesis-related protein 1-like   97.4    8e-21   
ref|XP_008455069.1|  PREDICTED: basic form of pathogenesis-relate...  97.4    8e-21   
ref|XP_010691518.1|  PREDICTED: pathogenesis-related protein 1B-like  97.1    8e-21   
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...  97.1    8e-21   
gb|ACJ62494.1|  pathogenesis-related protein class I                  97.1    9e-21   
ref|XP_001774214.1|  predicted protein                                97.1    9e-21   
ref|XP_006299640.1|  hypothetical protein CARUB_v10015827mg           97.1    9e-21   
ref|XP_002452941.1|  hypothetical protein SORBIDRAFT_04g035320        97.8    9e-21   
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...  97.1    9e-21   
ref|XP_002974458.1|  hypothetical protein SELMODRAFT_101466           97.4    9e-21   
gb|ADN43442.1|  pathogenesis-related protein 1                        97.1    9e-21   
ref|XP_009139534.1|  PREDICTED: pathogenesis-related protein PR-1     98.2    1e-20   
gb|AFR90191.1|  pathogenesis-related protein 1a                       97.1    1e-20   
gb|AFK38989.1|  unknown                                               97.1    1e-20   
ref|XP_008651988.1|  PREDICTED: pathogenesis-related protein PRB1...  97.1    1e-20   
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...  96.7    1e-20   
ref|NP_001058815.1|  Os07g0129200                                     97.1    1e-20   
ref|XP_011018173.1|  PREDICTED: pathogenesis-related protein PR-1...  97.1    1e-20   
ref|XP_009378592.1|  PREDICTED: pathogenesis-related protein PR-1...  97.1    1e-20   
ref|XP_004246724.1|  PREDICTED: pathogenesis-related leaf protein 4   96.7    1e-20   
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...  96.7    1e-20   
gb|EAY87791.1|  hypothetical protein OsI_09211                        97.4    1e-20   
gb|KCW63515.1|  hypothetical protein EUGRSUZ_G01148                   96.7    1e-20   
ref|NP_001275095.1|  pathogenesis-related protein 1b precursor        96.7    1e-20   
ref|XP_010467953.1|  PREDICTED: pathogenesis-related protein 1-like   97.1    1e-20   
gb|AAG44566.1|AF251277_1  acidic PR-1 type pathogenesis-related p...  97.1    1e-20   
ref|XP_010691522.1|  PREDICTED: pathogenesis-related protein PR-1...  97.1    1e-20   
gb|ADN43433.1|  pathogenesis-related protein 1                        96.7    1e-20   
gb|KHN19054.1|  Basic form of pathogenesis-related protein 1          96.7    1e-20   
ref|XP_009138209.1|  PREDICTED: pathogenesis-related protein 1-like   96.7    1e-20   
dbj|BAD34031.1|  putative pathogenesis related protein                97.1    1e-20   
ref|XP_003579097.1|  PREDICTED: repressed by EFG1 protein 1-like      99.8    1e-20   
ref|XP_002964816.1|  hypothetical protein SELMODRAFT_83728            97.4    1e-20   
ref|XP_010065842.1|  PREDICTED: pathogenesis-related protein 1-like   96.7    1e-20   
ref|NP_179068.1|  pathogenesis-related protein 1                      96.7    1e-20   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...  96.7    1e-20   
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...  96.7    1e-20   
gb|ABK28181.1|  unknown                                               96.7    1e-20   
gb|KDP43811.1|  hypothetical protein JCGZ_23019                       96.7    1e-20   
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940        96.7    1e-20   
gb|AEX55228.1|  pathogenesis-related protein 1                        96.7    1e-20   
gb|ADN43435.1|  pathogenesis-related protein 1                        96.7    1e-20   
gb|EAZ02649.1|  hypothetical protein OsI_24760                        96.3    1e-20   
ref|XP_007227657.1|  hypothetical protein PRUPE_ppa015046mg           96.7    2e-20   
gb|ABK22175.1|  unknown                                               96.7    2e-20   
ref|XP_002985764.1|  hypothetical protein SELMODRAFT_234874           96.7    2e-20   
ref|XP_004954162.1|  PREDICTED: pathogenesis-related protein PR-1...  97.4    2e-20   
ref|XP_003543105.1|  PREDICTED: basic form of pathogenesis-relate...  96.7    2e-20   
ref|XP_006846388.1|  hypothetical protein AMTR_s00012p00263950        97.1    2e-20   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g           96.7    2e-20   
gb|KDP37607.1|  hypothetical protein JCGZ_06950                       96.3    2e-20   
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...  96.3    2e-20   
gb|EMS45142.1|  Pathogenesis-related protein 1                        96.3    2e-20   
gb|AEH25636.1|  pathogenesis-related protein 1-21                     96.7    2e-20   
ref|XP_004246723.1|  PREDICTED: pathogenesis-related leaf protein...  96.3    2e-20   
ref|XP_007148304.1|  hypothetical protein PHAVU_006G197200g           96.3    2e-20   
ref|XP_006406470.1|  hypothetical protein EUTSA_v10022205mg           96.3    2e-20   
ref|NP_001058816.1|  Os07g0129300                                     96.3    2e-20   
ref|XP_010943437.1|  PREDICTED: pathogenesis-related protein 1B-like  97.1    2e-20   
ref|WP_026596339.1|  hypothetical protein                             96.3    2e-20   
gb|EMT00919.1|  Pathogenesis-related protein PRB1-2                   98.2    2e-20   
gb|AFM77000.1|  pathogenesis related protein 1a                       96.3    2e-20   
ref|XP_007154793.1|  hypothetical protein PHAVU_003G148400g           96.3    2e-20   
ref|XP_004955945.1|  PREDICTED: pathogenesis-related protein PRMS...  96.3    2e-20   
ref|XP_006846385.1|  hypothetical protein AMTR_s00012p00263720        95.9    2e-20   
ref|XP_003545772.1|  PREDICTED: basic form of pathogenesis-relate...  96.3    2e-20   
ref|XP_010447501.1|  PREDICTED: pathogenesis-related protein PRB1...  96.7    2e-20   
ref|XP_011030266.1|  PREDICTED: basic form of pathogenesis-relate...  95.9    2e-20   
gb|KCW63507.1|  hypothetical protein EUGRSUZ_G01138                   95.5    2e-20   
emb|CDY69090.1|  BnaAnng29270D                                        95.9    2e-20   
gb|KCW63509.1|  hypothetical protein EUGRSUZ_G01140                   95.9    2e-20   
ref|XP_008442602.1|  PREDICTED: pathogenesis-related protein 1C       96.7    2e-20   
ref|XP_010065838.1|  PREDICTED: pathogenesis-related protein 1-like   95.9    3e-20   
ref|XP_006850133.1|  hypothetical protein AMTR_s00022p00231670        95.9    3e-20   
emb|CAA47374.1|  prb-1b                                               96.3    3e-20   
ref|XP_009342363.1|  PREDICTED: pathogenesis-related leaf protein...  95.9    3e-20   
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...  95.5    3e-20   
ref|XP_010547940.1|  PREDICTED: pathogenesis-related protein 1-like   95.5    3e-20   
ref|XP_010672687.1|  PREDICTED: pathogenesis-related protein PRB1...  97.4    3e-20   
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...  95.9    3e-20   
ref|XP_010065837.1|  PREDICTED: pathogenesis-related protein 1A-like  95.9    3e-20   
gb|AEH25626.1|  pathogenesis-related protein 1-11                     95.9    3e-20   
ref|XP_003557605.1|  PREDICTED: pathogenesis-related protein 1-like   95.9    3e-20   
ref|XP_006846386.1|  hypothetical protein AMTR_s00012p00263770        95.5    3e-20   



>ref|XP_010317149.1| PREDICTED: STS14 protein [Solanum lycopersicum]
Length=180

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLDVHN+AR++VGV PLTWSP LA    L VRYQRD QNCS+A+LS G+YG NQ+ + G
Sbjct  44   EFLDVHNKARSEVGVGPLTWSPMLAKETSLLVRYQRDKQNCSFANLSNGKYGGNQLWASG  103

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T VTPRMA ++WV +K FY+Y NN C  G  +C  YTQV+WKKS+ELGC+QATC KG  T
Sbjct  104  TVVTPRMAVDSWVAEKKFYSYENNSCT-GDDKCGVYTQVIWKKSIELGCAQATCSKGAAT  162

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFYNPPGN +GEKPY
Sbjct  163  LTVCFYNPPGNVIGEKPY  180



>ref|XP_009767432.1| PREDICTED: STS14 protein-like [Nicotiana sylvestris]
Length=182

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLD HN+ARA+VGV PL WSP LA    L VRYQR+ QNC++A+L+ G+YG NQ+ + G
Sbjct  46   EFLDAHNKARAEVGVGPLKWSPMLAKETSLLVRYQRNKQNCNFANLTSGKYGGNQLWASG  105

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTPRMA +NWV +K FYNYANN CV  H +C  YTQVVWK+SLELGC+QATC  G  T
Sbjct  106  MAVTPRMAVDNWVAEKKFYNYANNSCVGDH-KCGVYTQVVWKESLELGCAQATCSNGPST  164

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +GEKPY
Sbjct  165  LTICFYNPPGNVIGEKPY  182



>ref|XP_006344822.1| PREDICTED: STS14 protein-like [Solanum tuberosum]
Length=181

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLD HN+AR++VGV PLTWSP LA    L VRYQRD QNCS+A+LS G+YG NQ+ + G
Sbjct  45   EFLDAHNKARSEVGVGPLTWSPMLAKETSLLVRYQRDKQNCSFANLSNGKYGGNQLWASG  104

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T V PRMA ++WV +K FYNY NN C  G  +C  YTQVVWKKS ELGC+QATC KG  T
Sbjct  105  TVVIPRMAVDSWVAEKKFYNYENNSCT-GDDKCGVYTQVVWKKSTELGCAQATCSKGPAT  163

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFYNPPGN +GEKPY
Sbjct  164  LTVCFYNPPGNVIGEKPY  181



>sp|Q41495.1|ST14_SOLTU RecName: Full=STS14 protein; Flags: Precursor [Solanum tuberosum]
 gb|AAG32153.1|U17111_1 pistil-specific; similar to PR-1 proteins, Swiss-Prot Accession 
Number P11670 [Solanum tuberosum]
 emb|CAA57976.1| sts14 [Solanum tuberosum]
 prf||2211417A sts14 gene
Length=214

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLD HN+AR++VGV PLTWSP LA    L VRYQRD QNCS+A+LS G+YG NQ+ + G
Sbjct  78   EFLDAHNKARSEVGVGPLTWSPMLAKETSLLVRYQRDKQNCSFANLSNGKYGGNQLWASG  137

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T VTPRMA ++WV +K FYNY NN C  G  +C  YTQ+VWKKS+ELGC+Q TC +G  T
Sbjct  138  TVVTPRMAVDSWVAEKKFYNYENNSC-TGDDKCGVYTQIVWKKSIELGCAQRTCYEGPAT  196

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFYNPPGN +GEKPY
Sbjct  197  LTVCFYNPPGNVIGEKPY  214



>ref|XP_009602269.1| PREDICTED: STS14 protein-like [Nicotiana tomentosiformis]
Length=181

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDP-LTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSD  430
            EFLD HN+ARA+VGV P L WSP LA    L VRYQR+ QNC++A+L+ G+YG NQ+ + 
Sbjct  44   EFLDAHNKARAEVGVAPPLKWSPMLAKETSLLVRYQRNKQNCNFANLTSGKYGGNQLWAS  103

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G AVTPRMA +NW+ +K FYNYANN CV  H +C  YTQVVWK+SLELGC+QATC  G  
Sbjct  104  GMAVTPRMAVDNWIAEKKFYNYANNSCVGDH-KCGVYTQVVWKQSLELGCAQATCSNGPA  162

Query  611  TLTICFYNPPGNTVGEKPY  667
            TLTICFYNPPGN +GEKPY
Sbjct  163  TLTICFYNPPGNVIGEKPY  181



>ref|XP_003519913.2| PREDICTED: STS14 protein-like [Glycine max]
Length=174

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA VGV+PL WS +LA       RYQRD   C +A+LS G+YG+NQ+L+ G
Sbjct  38   EFLEAHNQARAAVGVEPLRWSEQLANVTSKLARYQRDKLGCEFANLSTGKYGANQLLAWG  97

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            TAVTPRMA E WV+QK FYN+A+N CV  H RC  YTQVVW+KSLELGC++ATC K Q +
Sbjct  98   TAVTPRMAVEEWVKQKQFYNHADNSCVPNH-RCGVYTQVVWRKSLELGCARATCVKEQAS  156

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +GE PY
Sbjct  157  LTICFYNPPGNYIGESPY  174



>gb|EYU44322.1| hypothetical protein MIMGU_mgv1a014661mg [Erythranthe guttata]
Length=182

 Score =   188 bits (477),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L+ HNQARA+VGV PL WSP LA +A L  R QRD  NCS+A+L+  +YG NQ+ + G
Sbjct  46   EYLEAHNQARAEVGVGPLQWSPSLAKSASLTARLQRDKHNCSFANLANSKYGGNQLWAGG  105

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A+TPR A E WV +K FY Y NN C   H RC  YTQVVWKKS ELGC+ A CPK Q +
Sbjct  106  FAMTPRAAVETWVAEKKFYTYENNSCAPDH-RCGVYTQVVWKKSAELGCAAAACPKDQSS  164

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN VGEKPY
Sbjct  165  LTICFYNPPGNVVGEKPY  182



>gb|KEH20457.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=172

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HNQARA VGV+PLTWS +LA      VRYQRD  +C +A+L+ G+YG+NQ+++ G
Sbjct  36   EFLQTHNQARASVGVEPLTWSEQLANTTSKLVRYQRDKLSCQFANLTAGKYGANQLMARG  95

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTPRM  E WV++K FYN+++N CV  H RC  YTQVVW+KS+ELGC+Q TC K   +
Sbjct  96   AAVTPRMVVEEWVKEKEFYNHSDNTCVVNH-RCGVYTQVVWRKSVELGCAQTTCGKEDTS  154

Query  614  LTICFYNPPGNTVGEKPY  667
            L+ICFY PPGN VGE PY
Sbjct  155  LSICFYYPPGNYVGESPY  172



>ref|XP_011099257.1| PREDICTED: STS14 protein [Sesamum indicum]
Length=175

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L+ HNQARA+VGV PL WS  LA +A L VR QRD  NCS+A+L+ G+YG NQ+ + G
Sbjct  39   EYLEAHNQARAEVGVGPLQWSQPLAKSASLLVRLQRDKHNCSFANLANGKYGGNQLWAGG  98

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              VTPR A E WV +K FYNY +N C   H RC  YTQVVWK+S+ELGC+QA C K Q +
Sbjct  99   FRVTPRTAVETWVAEKKFYNYQDNSCAPDH-RCGVYTQVVWKQSVELGCAQAGCAKDQSS  157

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN VGEKPY
Sbjct  158  LTICFYNPPGNIVGEKPY  175



>ref|XP_003637257.1| Pathogenesis-related maize seed protein [Medicago truncatula]
Length=172

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HNQARA VGV+PLTWS +LA      VRYQRD  +C +A+L+ G+YG+NQ+++ G
Sbjct  36   EFLQTHNQARASVGVEPLTWSEQLANTTSKLVRYQRDKLSCQFANLTAGKYGANQLMARG  95

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTPRM  E WV++K F N+++N CV  H RC  YTQVVW+KS+ELGC+Q TC K   +
Sbjct  96   AAVTPRMVVEEWVKEKEFLNHSDNTCVVNH-RCGVYTQVVWRKSVELGCAQTTCGKEDTS  154

Query  614  LTICFYNPPGNTVGEKPY  667
            L+ICFY PPGN VGE PY
Sbjct  155  LSICFYYPPGNYVGESPY  172



>ref|XP_003548004.1| PREDICTED: STS14 protein-like [Glycine max]
Length=176

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA VGV+PL WS ++A       RYQR    C +A+L+ G+YG+NQ+L+ G
Sbjct  39   EFLEAHNQARAAVGVEPLRWSEQVANVTSKLARYQRVKTGCQFANLTAGKYGANQLLARG  98

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            +A VTPRMA E WV+QK FYN+A+N C   H RC  YTQVVW+KS+ELGC+QATC K Q 
Sbjct  99   SAAVTPRMAVEEWVKQKQFYNHADNSCAPNH-RCGVYTQVVWRKSVELGCAQATCVKEQA  157

Query  611  TLTICFYNPPGNTVGEKPY  667
            +LTICFYNPPGN VGE PY
Sbjct  158  SLTICFYNPPGNYVGESPY  176



>ref|XP_004509223.1| PREDICTED: STS14 protein-like [Cicer arietinum]
Length=170

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA VGV+PLTWS +LA      VRYQRD  +C +A+L+ G+YG+NQ+ + G
Sbjct  34   EFLESHNQARASVGVEPLTWSEQLANTTSKLVRYQRDRMSCQFANLTAGKYGANQLWARG  93

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              VTPR+  + WV+QK FYN+++N CV  H RC  YTQVVWKKSL+LGC+Q  C K Q +
Sbjct  94   ETVTPRLVVDEWVKQKQFYNHSDNSCVPNH-RCGVYTQVVWKKSLQLGCAQTLCAKEQAS  152

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFY PPGN VGE PY
Sbjct  153  LTICFYYPPGNYVGESPY  170



>ref|XP_011004602.1| PREDICTED: STS14 protein-like [Populus euphratica]
Length=182

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 119/179 (66%), Gaps = 5/179 (3%)
 Frame = +2

Query  143  SLSVIIALAICH----GCaqgvppapptvaataaalpgsaqEFLDVHNQARADVGVDPLT  310
            SL  I+ LA+CH    G A      P  V      LP  A+EFL  HNQARA VGV PL 
Sbjct  5    SLLPILFLALCHSSTHGAALASDHKPTQVTIAPVPLPNVAKEFLQSHNQARAAVGVGPLK  64

Query  311  WSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENWVQQKSFY  490
            WS  LA A    VRYQR+   C +A+LS  +YG+NQ+ + G AVTP MA ++W Q+K++Y
Sbjct  65   WSQMLANATSRLVRYQRNKMGCQFANLSSSKYGANQLWASGMAVTPLMAVDHWAQEKNYY  124

Query  491  NYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGNTVGEKPY  667
            N+ NN C + H RC  YTQVVW+KSLELGC+QATC K Q +LTICFYNPPGN +GE PY
Sbjct  125  NHTNNSCASSH-RCGVYTQVVWRKSLELGCAQATCVKDQASLTICFYNPPGNIIGESPY  182



>ref|XP_007155998.1| hypothetical protein PHAVU_003G250100g [Phaseolus vulgaris]
 gb|ESW27992.1| hypothetical protein PHAVU_003G250100g [Phaseolus vulgaris]
Length=172

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HN+AR  VGV+PL WS ++A      VRYQRD   C +A+L+ G+YG+NQ+ + G
Sbjct  36   EFLEAHNEARVAVGVEPLRWSEQVANVTSKLVRYQRDKMGCQFANLTAGKYGANQLWAHG  95

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            TAVT RMA E WV+QK FYN+ +N CV  H +C  YTQVVW+KS+ELGC+QATC K + +
Sbjct  96   TAVTARMAVEEWVKQKQFYNHTDNSCVPNH-KCGVYTQVVWRKSVELGCAQATCVKEEAS  154

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN VGE PY
Sbjct  155  LTICFYNPPGNYVGESPY  172



>ref|XP_007047086.1| CAP [Theobroma cacao]
 gb|EOX91243.1| CAP [Theobroma cacao]
Length=177

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = +2

Query  143  SLSVIIALAICHG-CaqgvppapptvaataaalpgsaqEFLDVHNQARADVGVDPLTWSP  319
            +L  ++ LAICH      VP A P   A A  LP +A+EFL+ HNQARA VGV PL WS 
Sbjct  4    ALVAVLVLAICHDRAQGVVPAASPGTTAPAVLLPSAAREFLEAHNQARAAVGVGPLRWSE  63

Query  320  KLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENWVQQKSFYNYA  499
            +LA A     RYQR+   C +A+L+  +YG+NQ+ S G AVTPRMA + WV++K++YNYA
Sbjct  64   QLANATSRLARYQRNKMGCQFANLTDHKYGANQLWSGGAAVTPRMAVDTWVKEKNYYNYA  123

Query  500  NNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGNTVGEKPY  667
            +N C   H  C  YTQVVWK S ELGC+QATC K QITLTICFYNPPGN +GEKPY
Sbjct  124  SNSCAPNH-MCGVYTQVVWKNSSELGCAQATC-KEQITLTICFYNPPGNYIGEKPY  177



>ref|XP_002307231.2| hypothetical protein POPTR_0005s13830g [Populus trichocarpa]
 gb|EEE94227.2| hypothetical protein POPTR_0005s13830g [Populus trichocarpa]
Length=182

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HNQARA VGV PL WS  L  A    VRYQR+   C +A+LS  +YG+NQ+ + G
Sbjct  46   EFLQSHNQARAAVGVGPLKWSEMLPNATSRLVRYQRNKMGCQFANLSNSKYGANQLWASG  105

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP MA ++WVQ+K++YN+ NN C   H RC  YTQVVW+KSLELGC+QATC K Q +
Sbjct  106  MAVTPLMAVDHWVQEKNYYNHTNNSCAPSH-RCGVYTQVVWRKSLELGCAQATCVKDQAS  164

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +GE PY
Sbjct  165  LTICFYNPPGNIIGESPY  182



>ref|XP_006466695.1| PREDICTED: STS14 protein-like [Citrus sinensis]
Length=171

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA VGV PL WS KL       VR+QR+   C +A+L+ G+YG+NQ+   G
Sbjct  35   EFLEAHNQARAAVGVAPLKWSEKLGNGTNRVVRFQRNKMGCQFANLTSGKYGANQLWGSG  94

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTPRMA + WV++K+FYN+A+N C   H  C  Y QVVW+KSLELGC+QATC K Q+T
Sbjct  95   MAVTPRMAVDAWVKEKTFYNHADNSCAPNH-ICGVYKQVVWRKSLELGCAQATCVKQQVT  153

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFY+PPGN +GE PY
Sbjct  154  LTVCFYDPPGNIIGESPY  171



>gb|KDO79415.1| hypothetical protein CISIN_1g037670mg, partial [Citrus sinensis]
Length=152

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HN ARA VGV PL WS KL       VR+QR+   C +A+L+ G+YG+NQ+   G
Sbjct  16   EFLEAHNLARAAVGVAPLKWSEKLGNGTNRVVRFQRNKMGCQFANLTSGKYGANQLWGSG  75

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTPRMA + WV +K+FYN+A+N C   H RC  Y QVVW+KSLELGC+QATC K Q+T
Sbjct  76   MAVTPRMAVDAWVNEKTFYNHADNSCAPNH-RCGVYKQVVWRKSLELGCAQATCVKQQVT  134

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFY+PPGN +GE PY
Sbjct  135  LTVCFYDPPGNIIGESPY  152



>ref|XP_009376461.1| PREDICTED: STS14 protein-like [Pyrus x bretschneideri]
Length=173

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL-SGGEYGSNQMLSD  430
            E+L  HNQARA VGV+PL WS  LA A    VRYQR+NQ C++A+L SG +YG+NQ+ + 
Sbjct  36   EYLQAHNQARAAVGVEPLKWSESLANATSRLVRYQRNNQACNFANLTSGSKYGANQLWAS  95

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G +V+P M  + WV++K FYN++ N CV  H RC  YTQVVW+KSLELGC+QATC K Q 
Sbjct  96   GQSVSPTMVVDTWVKEKDFYNHSGNSCVPNH-RCGVYTQVVWRKSLELGCAQATCVKEQS  154

Query  611  TLTICFYNPPGNTVGEKPY  667
            +L+ICFYNPPGN VGE PY
Sbjct  155  SLSICFYNPPGNVVGESPY  173



>ref|XP_004300579.1| PREDICTED: STS14 protein-like [Fragaria vesca subsp. vesca]
Length=172

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L  HNQARA VGV PL WS  LA A    VRYQRD   C++A+L+ G+YG NQ+ + G
Sbjct  36   EYLRAHNQARAAVGVPPLQWSESLANATSRLVRYQRDKMGCNFANLTSGKYGGNQLWASG  95

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              VTP M  + WV++K FYN+ +N CV  H  C  YTQVVW+KSLELGC+QATCPK Q T
Sbjct  96   QVVTPTMVVDTWVKEKEFYNHTDNTCVPNH-HCGVYTQVVWRKSLELGCAQATCPKDQST  154

Query  614  LTICFYNPPGNTVGEKPY  667
            L +CFYNPPGN VGE PY
Sbjct  155  LCVCFYNPPGNYVGESPY  172



>ref|XP_006425773.1| hypothetical protein CICLE_v10026624mg [Citrus clementina]
 gb|ESR39013.1| hypothetical protein CICLE_v10026624mg [Citrus clementina]
Length=171

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA VGV PL WS KL       VR+QR+   C +A+L+ G+YG+NQ+   G
Sbjct  35   EFLEAHNQARAAVGVAPLKWSEKLGNGTNRVVRFQRNKMGCQFANLTSGKYGANQLWGSG  94

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTPRMA + WV++K+FYN+A+N C   H  C  Y QVVW+KSLELGC+QATC K Q+T
Sbjct  95   MAVTPRMAVDAWVKEKTFYNHADNSCAPNH-ICGVYKQVVWRKSLELGCAQATCVKQQVT  153

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFY+PPGN +GE PY
Sbjct  154  LTVCFYDPPGNIIGESPY  171



>ref|XP_008241601.1| PREDICTED: STS14 protein [Prunus mume]
Length=175

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L  HNQARA VGV+PL WS  LA A    VRYQRDN+ C++A+L+ G+YG NQ+ + G
Sbjct  39   EYLKAHNQARAAVGVEPLKWSESLANATSRLVRYQRDNKACNFANLTSGKYGGNQLWASG  98

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             +VTP M  + W+++K FYN+ +N CV  H  C  YTQVVW+KS+ELGC+QATC K Q +
Sbjct  99   QSVTPTMVVDTWLKEKDFYNHTDNSCVPNH-SCGVYTQVVWRKSVELGCAQATCVKDQSS  157

Query  614  LTICFYNPPGNTVGEKPY  667
            L+ICFYNPPGN +GE PY
Sbjct  158  LSICFYNPPGNVIGESPY  175



>ref|XP_002522391.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40075.1| STS14 protein precursor, putative [Ricinus communis]
Length=173

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 116/175 (66%), Gaps = 5/175 (3%)
 Frame = +2

Query  143  SLSVIIALAICHGCaqgvppapptvaataaalpgsaqEFLDVHNQARADVGVDPLTWSPK  322
            +L  ++ LAICHG             A    LP +A++FL  HNQARA VGV PL WS  
Sbjct  4    ALLPLLVLAICHG----YLSIEAAAQAPTPPLPSAARDFLSAHNQARAAVGVSPLKWSEM  59

Query  323  LATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENWVQQKSFYNYAN  502
            LA A    VRYQR+   C +A+L+  +YG NQ+ + G AVTP MA +NWVQ+K++YN  +
Sbjct  60   LANATSRLVRYQRNKMGCQFANLTNSKYGGNQLWASGMAVTPLMAVDNWVQEKAYYNRTD  119

Query  503  NMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGNTVGEKPY  667
            N C   H +C  YTQVVWKKSLELGC+QA+C K Q +LT+CFYNPPGN +GE PY
Sbjct  120  NSCEPNH-QCGVYTQVVWKKSLELGCAQASCVKEQASLTVCFYNPPGNIIGESPY  173



>emb|CAN83306.1| hypothetical protein VITISV_023017 [Vitis vinifera]
Length=169

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA+VGV P  WS +LA A  L VRYQRD   C +A+LS  +YG NQ+ + G
Sbjct  33   EFLEAHNQARAEVGVGPFQWSEQLAHATSLLVRYQRDKHGCQFANLSNSKYGGNQLWASG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            + +T R+A E WV +K +YN+++N CVA H  C  YTQVVW+KSLELGC++A C K   +
Sbjct  93   SGMTARLAVEEWVGEKKYYNHSDNSCVANH-ECGVYTQVVWRKSLELGCAKAVCAKEDAS  151

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +GE PY
Sbjct  152  LTICFYNPPGNVIGESPY  169



>ref|XP_002262744.1| PREDICTED: STS14 protein [Vitis vinifera]
 emb|CBI38354.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA+VGV P  WS +LA A  L VRYQRD   C +A+LS  +YG NQ+ + G
Sbjct  48   EFLEAHNQARAEVGVGPFQWSEQLAHATSLLVRYQRDKHGCQFANLSNSKYGGNQLWASG  107

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            + +T R+A E WV +K +YN+++N CVA H  C  YTQVVW+KSLELGC++A C K   +
Sbjct  108  SGMTARLAVEEWVGEKKYYNHSDNSCVANH-ECGVYTQVVWRKSLELGCAKAVCAKEDAS  166

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +GE PY
Sbjct  167  LTICFYNPPGNVIGESPY  184



>ref|XP_011025679.1| PREDICTED: STS14 protein-like [Populus euphratica]
Length=182

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HNQARA VGV PL WS  LA A    VRYQR+   C +A+LS  +YG NQ+ S G
Sbjct  46   EFLQPHNQARAAVGVGPLKWSEMLANATSRIVRYQRNKMGCQFANLSNSKYGGNQLWSSG  105

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            TA+TPRMA +NWVQ+K++YN+ +N C   H  C  YTQVVW+KSLELGC+QATC   Q +
Sbjct  106  TAMTPRMAVDNWVQEKNYYNHTDNSCAPNH-SCGVYTQVVWRKSLELGCAQATCVTEQAS  164

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFY+PPGN  GE PY
Sbjct  165  LTVCFYDPPGNIKGESPY  182



>ref|XP_007204059.1| hypothetical protein PRUPE_ppb010244mg [Prunus persica]
 gb|EMJ05258.1| hypothetical protein PRUPE_ppb010244mg [Prunus persica]
Length=176

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL-SGGEYGSNQMLSD  430
            E+L  HNQARA VGV+PL WS  LA A    VRYQRDN+ C++A+L SG +YG NQ+ + 
Sbjct  39   EYLKAHNQARAAVGVEPLKWSEFLANATSRLVRYQRDNKACNFANLTSGSKYGGNQLWAS  98

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G +VTP M  + W+++K FYN+  N CV  H  C  YTQVVWKKSLELGC+QATC K Q 
Sbjct  99   GQSVTPTMVVDTWLKEKDFYNHTGNSCVPNH-SCGVYTQVVWKKSLELGCAQATCVKDQS  157

Query  611  TLTICFYNPPGNTVGEKPY  667
            +L+ICFYNPPGN +GE PY
Sbjct  158  SLSICFYNPPGNVIGESPY  176



>ref|XP_008342997.1| PREDICTED: STS14 protein [Malus domestica]
Length=173

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL-SGGEYGSNQMLSD  430
            E+L  HNQARA VGV+PL WS  LA A    VRYQR+NQ C++A++ SG +YG+NQ+ + 
Sbjct  36   EYLQAHNQARAAVGVEPLKWSESLANATSRLVRYQRNNQACNFANITSGSKYGANQLWAS  95

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G +V+P M  + WV++K FYN++ N CV  H  C  YTQVVW+KSLELGC+QATC K Q 
Sbjct  96   GQSVSPTMVVDTWVKEKDFYNHSGNSCVPNH-WCGVYTQVVWRKSLELGCAQATCVKEQS  154

Query  611  TLTICFYNPPGNTVGEKPY  667
            +L+ICFYNPPGN VGE PY
Sbjct  155  SLSICFYNPPGNVVGESPY  173



>gb|KCW56824.1| hypothetical protein EUGRSUZ_I02492, partial [Eucalyptus grandis]
Length=168

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLD HNQARA+VGV PL WSP+LA A    VRYQRD  +C++A+L+  +YG NQ+ + G
Sbjct  30   EFLDAHNQARAEVGVAPLRWSPQLAAATSRLVRYQRDRMSCNFANLTASKYGGNQLWAGG  89

Query  434  --TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
              TA+ PR A   W+++K +Y++ANN C  G  RC  YTQVVW+ S ELGC+QA+CPK  
Sbjct  90   AGTAMPPRAAVGAWLKEKIYYDHANNTCAEGR-RCGVYTQVVWRNSSELGCAQASCPKEA  148

Query  608  ITLTICFYNPPGNTVGEKPY  667
             +LTICFYNPPGN VGE+PY
Sbjct  149  ASLTICFYNPPGNVVGERPY  168



>ref|XP_010029866.1| PREDICTED: STS14 protein [Eucalyptus grandis]
Length=182

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLD HNQARA+VGV PL WSP+LA A    VRYQRD  +C++A+L+  +YG NQ+ + G
Sbjct  44   EFLDAHNQARAEVGVAPLRWSPQLAAATSRLVRYQRDRMSCNFANLTASKYGGNQLWAGG  103

Query  434  --TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
              TA+ PR A   W+++K +Y++ANN C  G  RC  YTQVVW+ S ELGC+QA+CPK  
Sbjct  104  AGTAMPPRAAVGAWLKEKIYYDHANNTCAEGR-RCGVYTQVVWRNSSELGCAQASCPKEA  162

Query  608  ITLTICFYNPPGNTVGEKPY  667
             +LTICFYNPPGN VGE+PY
Sbjct  163  ASLTICFYNPPGNVVGERPY  182



>ref|XP_010465229.1| PREDICTED: STS14 protein-like [Camelina sativa]
Length=185

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F D HN+ARA VGV PL WSP L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G
Sbjct  49   DFTDAHNKARATVGVPPLVWSPTLEAAANRLTRYQRNQKKCEFASLNPGKYGANQLWAKG  108

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  109  LAVTPSLAVETWVKEKPFYNYKSDACAANH-TCGVYKQVVWRNSKELGCAQATCTKESTV  167

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  168  LTICFYNPPGNIIGQKPY  185



>ref|XP_004148042.1| PREDICTED: STS14 protein-like [Cucumis sativus]
 ref|XP_004163627.1| PREDICTED: STS14 protein-like [Cucumis sativus]
 gb|KGN62026.1| STS14 protein [Cucumis sativus]
Length=212

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L+ HN+ARA+VGV+PL WS  LA+      R+QR+ + C +A LSG  YG NQM   G
Sbjct  76   EYLEAHNRARAEVGVEPLQWSQNLASLTDRLARFQRNQKGCGFAELSGSRYGGNQMWVSG  135

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +TPR A E WV++K+FYNY++N CV  H  C  YTQVVW+KS+E+GC QATC K  IT
Sbjct  136  RVLTPREAVEAWVREKAFYNYSSNTCVGDH-HCGVYTQVVWRKSVEVGCGQATCWKEGIT  194

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN VGE PY
Sbjct  195  LTICFYNPPGNVVGESPY  212



>ref|XP_010484620.1| PREDICTED: STS14 protein-like [Camelina sativa]
Length=184

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F D HN+ARA VGV PL WSP L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G
Sbjct  48   DFTDAHNKARATVGVPPLVWSPTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWAKG  107

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  108  LAVTPSLAVETWVKEKPFYNYKSDACAANH-TCGVYKQVVWRNSKELGCAQATCTKESTI  166

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  167  LTICFYNPPGNIIGQKPY  184



>ref|XP_002310192.1| hypothetical protein POPTR_0007s12110g [Populus trichocarpa]
 gb|EEE90642.1| hypothetical protein POPTR_0007s12110g [Populus trichocarpa]
Length=183

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 100/139 (72%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSD-  430
            EFL  HNQARA VGV PL WS  LA A    VRYQR+   C +A+LS  +YG NQ+ S  
Sbjct  46   EFLQSHNQARAAVGVGPLKWSEMLANATSRIVRYQRNKMGCQFANLSDSKYGGNQLWSST  105

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G AVTPRMA +NWVQ+K++YN+  N C   H  C  YTQVVW+KSLELGC+QATC K Q 
Sbjct  106  GMAVTPRMAVDNWVQEKNYYNHTGNSCAPNH-SCGVYTQVVWRKSLELGCAQATCVKEQA  164

Query  611  TLTICFYNPPGNTVGEKPY  667
            +LTIC+Y+PPGN +GE PY
Sbjct  165  SLTICYYDPPGNIIGESPY  183



>ref|XP_008457800.1| PREDICTED: STS14 protein [Cucumis melo]
Length=177

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L+ HN+ARA+VGV+PL WS  LA       R+QR+ + C +A LSG  YG NQM   G
Sbjct  41   EYLEAHNRARAEVGVEPLQWSQNLANLTDRLARFQRNQKGCGFAELSGSRYGGNQMWVSG  100

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +TPR A E WV++K+FYN+ +N CV  H  C  YTQVVW+KS E+GC QATC K  I+
Sbjct  101  RVLTPREAVEEWVKEKAFYNHTSNTCVGDH-HCGVYTQVVWRKSKEVGCGQATCRKEGIS  159

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +GE P+
Sbjct  160  LTICFYNPPGNVIGESPF  177



>ref|XP_010646385.1| PREDICTED: STS14 protein-like [Vitis vinifera]
Length=169

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+LD HNQARA VGV PL WS +LA    L VRYQRDNQ C +A+L  G+YG+NQ+   G
Sbjct  33   EYLDAHNQARAQVGVGPLQWSEQLAHETSLLVRYQRDNQGCEFANLKRGQYGANQLRVGG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++PR+  E+WV+QK +YN+  N C   H  C SYTQVVW+KSLELGC+ A C     +
Sbjct  93   GIMSPRLVVESWVEQKKYYNHPANSCAQNHT-CGSYTQVVWRKSLELGCAMAVCGNVTAS  151

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+CFYNPPGN  G+ PY
Sbjct  152  LTVCFYNPPGNYYGQSPY  169



>ref|XP_006279500.1| hypothetical protein CARUB_v10027169mg [Capsella rubella]
 gb|EOA12398.1| hypothetical protein CARUB_v10027169mg [Capsella rubella]
Length=185

 Score =   170 bits (431),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+   G
Sbjct  49   DFLDAHNKARAMVGVPPLVWSRTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWGKG  108

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AV P +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  109  LAVPPSLAVETWVKEKPFYNYKSDTCAANH-TCGVYKQVVWRNSKELGCAQATCAKESTV  167

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  168  LTICFYNPPGNIIGQKPY  185



>ref|XP_010547472.1| PREDICTED: STS14 protein-like [Tarenaya hassleriana]
Length=183

 Score =   170 bits (430),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HN+ARA VGV  L WS  LATA     RYQR+ + C +ASL+ G+YG+NQ+ + G
Sbjct  47   EFLEAHNEARAAVGVAALRWSQALATAVSRVARYQRNQKRCEFASLNPGKYGANQLWAKG  106

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              V PR+A E WV++K FY+Y  N C   H  C  Y QVVW+ S ELGC+QATCP     
Sbjct  107  MDVAPRLAVETWVKEKQFYDYRTNTCGGNHS-CGVYKQVVWRNSKELGCAQATCPNDSTI  165

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN VG+KPY
Sbjct  166  LTICFYNPPGNIVGQKPY  183



>ref|XP_006279499.1| hypothetical protein CARUB_v10027169mg [Capsella rubella]
 gb|EOA12397.1| hypothetical protein CARUB_v10027169mg [Capsella rubella]
Length=197

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+   G
Sbjct  61   DFLDAHNKARAMVGVPPLVWSRTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWGKG  120

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AV P +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  121  LAVPPSLAVETWVKEKPFYNYKSDTCAANH-TCGVYKQVVWRNSKELGCAQATCAKESTV  179

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  180  LTICFYNPPGNIIGQKPY  197



>ref|XP_010557979.1| PREDICTED: STS14 protein [Tarenaya hassleriana]
 ref|XP_010557989.1| PREDICTED: STS14 protein [Tarenaya hassleriana]
Length=180

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN+ARA VGV PL WS  L TAA    RYQR+ +NC +A+L+ G+YG+NQ+   G
Sbjct  44   DFLDAHNEARAAVGVAPLAWSQALTTAASRFARYQRNQKNCEFANLNRGKYGANQLWVKG  103

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A+ PR A E WV +K FY+Y  + C A H  C  Y QVVW+ S ELGC+QATCPK    
Sbjct  104  MAMPPRSAVEAWVNEKEFYDYGTDTCAANH-TCAVYKQVVWRNSKELGCAQATCPKDSTV  162

Query  614  LTICFYNPPGNTVGEKPY  667
            LTIC YNPPGN  G+KPY
Sbjct  163  LTICLYNPPGNIDGQKPY  180



>ref|XP_007156869.1| hypothetical protein PHAVU_002G024400g [Phaseolus vulgaris]
 gb|ESW28863.1| hypothetical protein PHAVU_002G024400g [Phaseolus vulgaris]
Length=179

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L+ HN+ARA VGV+PL WS KL  A+ L VRYQR+   C +A+L+  +YG NQ+ +  
Sbjct  43   EYLEAHNEARAAVGVEPLRWSEKLGNASSLMVRYQRNKMGCEFANLTDSKYGGNQLWAGV  102

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            TAV PR+A E WV++K FY  ANN CV  H  C  YTQVVW+ S E+GC++A C K   +
Sbjct  103  TAVAPRVAVEEWVKEKEFYVRANNTCVGKH-ECGVYTQVVWRNSTEVGCAEAACVKEHSS  161

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFY+PPGN +GE P+
Sbjct  162  LTICFYDPPGNVIGENPF  179



>ref|XP_003517263.1| PREDICTED: STS14 protein-like [Glycine max]
Length=178

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 96/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HNQARA+VGV+ L+WS KL   + L VRYQR+ + C +A+L+   YG NQ+ +  
Sbjct  42   EFLEAHNQARAEVGVEALSWSEKLGNVSSLMVRYQRNKKGCEFANLTASRYGGNQLWAGV  101

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T V PR+  E WV++K FY   NN CV  H  C  YTQVVW+ S E+GC+QA C K Q +
Sbjct  102  TEVAPRVVVEEWVKEKKFYVRENNTCVGKH-ECGVYTQVVWRNSTEVGCAQAVCVKEQAS  160

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFY+PPGN +GE PY
Sbjct  161  LTICFYDPPGNVIGEIPY  178



>ref|XP_003611867.1| Sts14 protein [Medicago truncatula]
 gb|AES94825.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=185

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 3/140 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLS-D  430
            EFL+ HN+ARA+VGV+PL WS KLA    L VRYQR+   C +A+L+  +YG NQ+ +  
Sbjct  47   EFLESHNKARAEVGVEPLQWSEKLAKDTSLLVRYQRNKMACDFANLTASKYGGNQLWAGS  106

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCP-KGQ  607
              AVTP  A E WV++K FY + NN CV  H  C  YTQVVWKKS +LGCSQATC  K +
Sbjct  107  AAAVTPSKAVEEWVKEKEFYIHVNNTCVVNH-ECGVYTQVVWKKSAQLGCSQATCTGKKE  165

Query  608  ITLTICFYNPPGNTVGEKPY  667
             +LTICFY+PPGN +GE P+
Sbjct  166  ASLTICFYDPPGNVIGESPF  185



>ref|XP_010444772.1| PREDICTED: STS14 protein-like [Camelina sativa]
Length=196

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F D HN+ARA VGV PL WSP L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G
Sbjct  50   DFTDAHNKARAAVGVPPLVWSPTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKG  109

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  110  LAVTPSLAVETWVKEKPFYNYKSDACAANH-TCGVYKQVVWRNSKELGCAQATCTKESTV  168

Query  614  LTICFYNPPGNTVGE  658
            LTICFYNPPGN +G+
Sbjct  169  LTICFYNPPGNIIGQ  183



>ref|NP_201460.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Arabidopsis thaliana]
 gb|AAK62432.1|AF386987_1 Unknown protein [Arabidopsis thaliana]
 dbj|BAB10935.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13247.1| unknown protein [Arabidopsis thaliana]
 gb|AED98232.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Arabidopsis thaliana]
Length=185

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG-  433
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G 
Sbjct  49   FTDAHNKARAMVGVPPLVWSQTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKGL  108

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  109  VAVTPSLAVETWVKEKPFYNYKSDTCAANH-TCGVYKQVVWRNSKELGCAQATCTKESTV  167

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  168  LTICFYNPPGNVIGQKPY  185



>gb|AAM63321.1| sts14 [Arabidopsis thaliana]
Length=185

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG-  433
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G 
Sbjct  49   FTDAHNKARAMVGVPPLVWSQTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKGL  108

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP +A E WV++K FYNY ++ C A H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  109  VAVTPSLAVETWVKEKPFYNYKSDTCAANH-TCGVYKQVVWRNSKELGCAQATCTKESTV  167

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  168  LTICFYNPPGNIIGQKPY  185



>ref|XP_002866752.1| hypothetical protein ARALYDRAFT_496946 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43011.1| hypothetical protein ARALYDRAFT_496946 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG-  433
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G 
Sbjct  45   FTDAHNKARAMVGVSPLVWSQTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKGL  104

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             AVTP +A E WV++K FYNY ++ C   H  C  Y QVVW+ S ELGC+QATC K    
Sbjct  105  VAVTPSLAVETWVKEKPFYNYKSDTCAVNH-TCGVYKQVVWRNSKELGCAQATCTKESTV  163

Query  614  LTICFYNPPGNTVGEKPY  667
            LTICFYNPPGN +G+KPY
Sbjct  164  LTICFYNPPGNIIGQKPY  181



>ref|XP_009112312.1| PREDICTED: STS14 protein [Brassica rapa]
Length=183

 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 94/137 (69%), Gaps = 1/137 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G 
Sbjct  48   FTDAHNKARAMVGVSPLVWSQTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWAKGL  107

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            AVTP +A E WV++K FY+Y ++ C   H  C  Y QVVW+ S ELGC+QA C K    L
Sbjct  108  AVTPTLAVETWVKEKPFYDYKSDKCAPNH-TCGVYKQVVWRDSKELGCAQAMCTKESTVL  166

Query  617  TICFYNPPGNTVGEKPY  667
            TICFYNPPGN +G+KPY
Sbjct  167  TICFYNPPGNIIGQKPY  183



>emb|CDY18613.1| BnaA09g07820D [Brassica napus]
Length=183

 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 94/137 (69%), Gaps = 1/137 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G 
Sbjct  48   FTDAHNKARAMVGVSPLVWSQTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWAKGL  107

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            AVTP +A E WV++K FY+Y ++ C   H  C  Y QVVW+ S ELGC+QA C K    L
Sbjct  108  AVTPTLAVETWVKEKPFYDYKSDKCAPNH-TCGVYKQVVWRDSKELGCAQAMCTKESTVL  166

Query  617  TICFYNPPGNTVGEKPY  667
            TICFYNPPGN +G+KPY
Sbjct  167  TICFYNPPGNIIGQKPY  183



>ref|NP_001147033.1| pathogenesis-related protein PRB1-3 precursor [Zea mays]
 gb|ACG25182.1| pathogenesis-related protein PRB1-3 precursor [Zea mays]
 emb|CDX81386.1| BnaC09g07970D [Brassica napus]
Length=180

 Score =   164 bits (416),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 94/137 (69%), Gaps = 1/137 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G 
Sbjct  45   FTDAHNKARAMVGVPPLVWSQTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWAKGL  104

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            AVTP +A E WV++K FY+Y ++ C   H  C  Y QVVW+ S ELGC+QA C K    L
Sbjct  105  AVTPTLAVETWVKEKPFYDYKSDKCAPNH-TCGVYKQVVWRDSKELGCAQAMCTKESTVL  163

Query  617  TICFYNPPGNTVGEKPY  667
            TICFYNPPGN +G+KPY
Sbjct  164  TICFYNPPGNIIGQKPY  180



>gb|KDP31828.1| hypothetical protein JCGZ_12289 [Jatropha curcas]
Length=182

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = +2

Query  170  ICHGCaqgvppapptvaataaalpgsaqEFLDVHNQARADVGVDPLTWSPKLATAAGLKV  349
            ICHG + G        A   AALP +A+EFL  HNQARA VGV PL WS  LA A     
Sbjct  13   ICHGLSYGAAAPNSGGAPVPAALPTAAREFLQAHNQARAAVGVGPLKWSEMLANATSRVA  72

Query  350  RYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPR  529
            RYQR    C +A+L+  +YG NQ+ + G AVTP MA ++WVQQK +YN+ +N CV+ H +
Sbjct  73   RYQRIKMGCQFANLTNSKYGGNQLWASGVAVTPLMAVDHWVQQKIYYNHTDNSCVSNH-Q  131

Query  530  CRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPP  640
            C  YTQVVWKKSLELGC+QA+C K Q +LTICFYNPP
Sbjct  132  CGVYTQVVWKKSLELGCAQASCVKEQSSLTICFYNPP  168



>ref|XP_010103679.1| hypothetical protein L484_011731 [Morus notabilis]
 gb|EXB96691.1| hypothetical protein L484_011731 [Morus notabilis]
Length=173

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L  HN+ARA VGV PL WS  LA  +    RYQR+  +C +A+L+   YG+NQ+ + G
Sbjct  37   EYLGAHNEARAAVGVGPLRWSEALANISSRLARYQRNKMSCHFANLTNFRYGANQLWAGG  96

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A TPRMA E WV++K +YN+A+N C   H +C  YTQVVW+ S E+GC+QATC K + +
Sbjct  97   AAETPRMAVEKWVEEKQYYNHADNTCAPNH-QCGVYTQVVWRNSSEVGCAQATCVKEKTS  155

Query  614  LTICFYNPPGNTVGEKPY  667
            LTIC YNPPGN +GE PY
Sbjct  156  LTICLYNPPGNYIGESPY  173



>ref|XP_009379158.1| PREDICTED: STS14 protein-like [Pyrus x bretschneideri]
Length=156

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 102/138 (74%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL-SGGEYGSNQMLSD  430
            E+L VHNQARA VGV+PL WS  LA A    V+YQ+ NQ C++A+L SG +YG+NQ+ + 
Sbjct  20   EYLQVHNQARAAVGVEPLKWSESLANATSRLVKYQKINQACNFANLTSGSKYGANQLWAS  79

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G +V+P +  + WV++K FYN++ N CV  H RC   TQVVW+KSL+L C+QATC K Q 
Sbjct  80   GQSVSPTIV-DTWVKEKDFYNHSGNSCVPNH-RCGVCTQVVWRKSLKLRCAQATCVKDQS  137

Query  611  TLTICFYNPPGNTVGEKP  664
            +L+ICFYNPPGN +GE P
Sbjct  138  SLSICFYNPPGNVIGESP  155



>gb|EPS72456.1| hypothetical protein M569_02307, partial [Genlisea aurea]
Length=155

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E++D HN AR +VGV PL WS  LA A+GL VR QRD QNCS+A LS  EYG+NQ+ + G
Sbjct  18   EYVDAHNAARGEVGVPPLKWSAFLANASGLYVRLQRDKQNCSFADLSRIEYGANQIWTRG  77

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKG-QI  610
               +P  A  +W+ +K FYNY +N C A   RC  YTQ+VW+K+ +LGC+QA C    Q 
Sbjct  78   FTPSPTAAVGSWIAEKKFYNYTDNSCQADR-RCGVYTQIVWRKTTDLGCAQAVCSNAQQS  136

Query  611  TLTICFYNPPGNTVGEKPY  667
            +LTIC Y+PPGN +GEKPY
Sbjct  137  SLTICMYDPPGNVIGEKPY  155



>ref|XP_006393853.1| hypothetical protein EUTSA_v10004516mg [Eutrema salsugineum]
 gb|ESQ31139.1| hypothetical protein EUTSA_v10004516mg [Eutrema salsugineum]
Length=343

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 93/137 (68%), Gaps = 1/137 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            F D HN+ARA VGV PL WS  L  AA    RYQR+ + C +AS + G YG+NQ+ + G 
Sbjct  208  FTDAHNKARATVGVSPLVWSQTLEAAASRLARYQRNQKKCEFASPNPGRYGANQLWAKGL  267

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            AVTP +A E WV++K FY+Y +N C   H  C  Y QVVW+ S ELGC+QATC K    L
Sbjct  268  AVTPSLAVETWVKEKPFYDYKSNTCDGNH-TCGVYKQVVWRDSKELGCAQATCTKESTVL  326

Query  617  TICFYNPPGNTVGEKPY  667
            TICFYNPPGN VG+KPY
Sbjct  327  TICFYNPPGNIVGQKPY  343



>gb|KFK28335.1| hypothetical protein AALP_AA8G502600 [Arabis alpina]
Length=173

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 96/139 (69%), Gaps = 3/139 (2%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSG--GEYGSNQMLSD  430
            F + HN+AR+ VGV PL W+  L TAA    RYQR+ + C +ASL+   G+YG+NQ+ + 
Sbjct  36   FTEAHNKARSMVGVSPLVWNQTLETAARWMARYQREEKKCEFASLNPNPGKYGANQLWAK  95

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G AVTP +A E WV++K+FY+Y +N C   H  C  Y QVVW+ S +LGC+Q TC +   
Sbjct  96   GLAVTPSLAVETWVKEKAFYDYKSNTCAPKH-MCGVYKQVVWRDSKDLGCAQVTCAEEST  154

Query  611  TLTICFYNPPGNTVGEKPY  667
             LTICFYNPPGN +G+KPY
Sbjct  155  VLTICFYNPPGNVIGQKPY  173



>ref|XP_010243305.1| PREDICTED: STS14 protein [Nelumbo nucifera]
Length=183

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 96/141 (68%), Gaps = 4/141 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HNQARA VGV PL WS KLAT A L VRYQRD   C +A LS  +YGSNQM   G
Sbjct  44   EFLAGHNQARAAVGVGPLKWSMKLATDASLMVRYQRDKMGCKFADLSKSKYGSNQMWMSG  103

Query  434  --TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
              +  TP  A  +WV++K +Y++A N C+  H +C SYTQVVW  S +LGC+QATC K  
Sbjct  104  PVSLATPAAAVGSWVEEKKYYDHATNSCIPNH-QCLSYTQVVWNTSSDLGCAQATCVKPT  162

Query  608  -ITLTICFYNPPGNTVGEKPY  667
              T+TIC Y+PPGN +G+ PY
Sbjct  163  PTTITICLYDPPGNFIGQSPY  183



>ref|XP_009379189.1| PREDICTED: STS14 protein-like [Pyrus x bretschneideri]
Length=172

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 110/187 (59%), Gaps = 29/187 (16%)
 Frame = +2

Query  140  LSLSVIIALAIC---HGCaqgvppapptvaataaalpgsaqEFLDVHNQARADVGVDPLT  310
              L V++AL IC   HG                 A   +  ++++ HN+ARA VGV PL 
Sbjct  4    FPLVVVVALDICSSAHG-----------------AASATVIDYVEAHNRARAPVGVGPLK  46

Query  311  WSPKLATAAGLKVRYQRDNQNCSYA------SLSGGEYGSNQMLSDGTAVT--PRMAAEN  466
            WS  LATAA   V +QRDN +C  A      + S  +YG NQ  +     T  PRMA EN
Sbjct  47   WSESLATAATRVVIHQRDNNHCDLAADPKSLTYSDTKYGFNQFWTTVRTRTAMPRMAVEN  106

Query  467  WVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGN  646
            WV++K +Y++ NN C   H  CRSYTQVVW+KSLEL C++ATC K Q ++T+CFYNPPGN
Sbjct  107  WVEEKQYYDHDNNSCAPNH-ECRSYTQVVWRKSLELRCAEATCVKEQKSVTVCFYNPPGN  165

Query  647  TVGEKPY  667
              GE PY
Sbjct  166  FEGESPY  172



>gb|ABL97973.1| STS14 [Brassica rapa]
Length=126

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = +2

Query  290  VGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENW  469
            VGV PL WS  L  AA    RYQR+ + C +ASL+ G+YG+NQ+ + G AVTP +A E W
Sbjct  2    VGVPPLVWSQTLEAAANRLARYQRNQKKCEFASLNPGKYGANQLWAKGLAVTPTLAVETW  61

Query  470  VQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGNT  649
            V++K FY+Y ++ C   H  C  Y QVVW+ S ELGC+QA C K    LTICFYNPPGN 
Sbjct  62   VKEKPFYDYKSDKCAPNH-TCGVYKQVVWRDSKELGCAQAMCTKESTVLTICFYNPPGNI  120

Query  650  VGEKPY  667
            +G+KPY
Sbjct  121  IGQKPY  126



>ref|XP_004511992.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
PRB1-3-like [Cicer arietinum]
Length=283

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  284  ADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML--SDGTAVTPRMA  457
            ++VGV+PL WS KLA    L VRYQR+   C +A+L+  +YG NQ+   S   +VTP  A
Sbjct  154  SEVGVEPLEWSEKLAKDTSLLVRYQRNKMGCDFANLTESKYGGNQLWAGSAAASVTPSKA  213

Query  458  AENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCP-KGQITLTICFYN  634
             E WV++K FY +ANN CV  H  C  YTQVVW+KS +LGC+QATC  K Q +LTICFY+
Sbjct  214  VEEWVKEKEFYIHANNSCVENH-ECGVYTQVVWRKSAQLGCAQATCTVKKQASLTICFYD  272

Query  635  PPGNTVGEKPY  667
            PPGN VGE P+
Sbjct  273  PPGNVVGETPF  283



>gb|KFK28336.1| hypothetical protein AALP_AA8G502700 [Arabis alpina]
Length=174

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            F + HN+ARA VGV PL W+  L TAA    RYQ + + C   S +  +YG+NQ+ + G 
Sbjct  39   FTEAHNKARAMVGVSPLVWNQTLETAAYWLARYQGEVEKCEVTSFNPRKYGTNQLWTKGL  98

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            A+TP +A + WV +K+FY+Y +N C   H  C  Y +VVW+ + ELGC+QA C K    L
Sbjct  99   ALTPSLAVKAWVNEKAFYDYKSNTCAPKH-TCGVYKRVVWRGTKELGCAQAMCAKESALL  157

Query  617  TICFYNPPGNTVGEKPY  667
            TICFY P GN +G+KPY
Sbjct  158  TICFYYPAGNVIGQKPY  174



>ref|XP_006856163.1| hypothetical protein AMTR_s00059p00174680 [Amborella trichopoda]
 gb|ERN17630.1| hypothetical protein AMTR_s00059p00174680 [Amborella trichopoda]
Length=178

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 87/141 (62%), Gaps = 4/141 (3%)
 Frame = +2

Query  254  EFLDVHNQAR---ADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML  424
            EFL+ HN  R    D G+ PLTWS  LA+ AG   R+QRD   C     +  +YG NQ  
Sbjct  39   EFLEAHNGERDLFKDKGLKPLTWSQNLASDAGKFARFQRDKHGCGLVQSTAEKYGENQCW  98

Query  425  SDGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKG  604
              G  ++P  A  +W+++K+FY++ NN C   H  C  YTQ++WK + E+GC QA C KG
Sbjct  99   GSGRPMSPTEAVGSWIKEKAFYSFKNNTCQKEH-ECGVYTQLIWKSTAEVGCGQAFCKKG  157

Query  605  QITLTICFYNPPGNTVGEKPY  667
             +TLTIC+Y PPGN  GE+P+
Sbjct  158  AVTLTICYYFPPGNMQGERPF  178



>gb|ADE75973.1| unknown [Picea sitchensis]
Length=178

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (61%), Gaps = 1/138 (1%)
 Frame = +2

Query  257  FLDVHNQARAD-VGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            FLD HN+ RA  VGV PL W+  +A+ A    R QRD+ +C       G+YG N +   G
Sbjct  41   FLDAHNKERATLVGVPPLRWNNGIASYASRFARSQRDHDHCEMKQSGTGKYGENLLWGKG  100

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +TP  A ++W+ +K FY+Y  N C+     C  YTQVVWK S ELGC+  +C KG IT
Sbjct  101  RPMTPSEAVQSWIDEKKFYDYKTNSCLQADQHCGVYTQVVWKNSTELGCALVSCDKGDIT  160

Query  614  LTICFYNPPGNTVGEKPY  667
              +C Y+PPGN VGE+PY
Sbjct  161  FVVCNYSPPGNIVGERPY  178



>dbj|BAA34937.1| PR-1 like protein [Camellia sinensis]
Length=191

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 89/141 (63%), Gaps = 4/141 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGG-EYGSNQMLSD  430
            +F+D HN ARA+VGVDPL WS  LA AA   VRYQ++  +C +A ++G  +YGSNQM SD
Sbjct  52   QFVDAHNSARAEVGVDPLKWSYSLANAASRLVRYQKNYMHCEFADMTGQLQYGSNQMWSD  111

Query  431  GTAVTPRMAAENWVQQ-KSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             +A  PR   E WV   K  Y Y +N CV     C  Y QVVW+K+  +GC+Q  C    
Sbjct  112  YSAKPPREVVEYWVNSGKKHYRYTHNYCVRNQ-NCGPYKQVVWEKTEMVGCAQGVCGNNN  170

Query  608  ITLTICFYNP-PGNTVGEKPY  667
             +L+ICFY P PGN  G++PY
Sbjct  171  GSLSICFYYPHPGNLGGQRPY  191



>ref|XP_009415310.1| PREDICTED: STS14 protein-like [Musa acuminata subsp. malaccensis]
Length=189

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  H+QARA V V  L WS KL + A  +V  Q+  + C +A L    YG+NQ+ +  
Sbjct  55   QFLTGHDQARAAVAVGQLRWSAKLGSEAS-RVVAQQKEKGCGFADLESSPYGANQLWTS-  112

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              V P  A  +WV++  +++YANN C AGH  C +YTQVVW+ + E+GC+QA C     T
Sbjct  113  YPVKPAEAVRSWVEEGKYFSYANNSCAAGH-ECGTYTQVVWRNTAEVGCAQANCVGQGAT  171

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C YNPPGN  G+KPY
Sbjct  172  LTLCLYNPPGNIQGQKPY  189



>dbj|BAK07226.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HN+ARA VGV PL WS  L  AA      Q+  ++C++A +    YG+NQ  +  
Sbjct  58   EFLAPHNKARAAVGVAPLRWSADLTAAAAWTASQQQKQKSCAFADMGASPYGANQGWASY  117

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A  P     +WV Q  +Y +ANN C AG  +C +YTQVVW+++ E+GC+QA+C  G  T
Sbjct  118  RA-RPAEVVASWVAQGKYYAHANNTCAAGQ-QCGTYTQVVWRRTAEVGCAQASCASG-AT  174

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C YNP GN  G+ PY
Sbjct  175  LTLCLYNPHGNVQGQSPY  192



>dbj|BAJ90969.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HN+ARA VGV PL WS  L  AA      Q+  ++C++A +    YG+NQ  +  
Sbjct  58   EFLAPHNKARAAVGVAPLRWSADLTAAAAWTASQQQKQKSCAFADMGASPYGANQGWASY  117

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A  P     +WV Q  +Y +ANN C AG  +C +YTQVVW+++ E+GC+QA+C  G  T
Sbjct  118  RA-RPAEVVASWVAQGKYYAHANNTCAAGQ-QCGTYTQVVWRRTAEVGCAQASCASG-AT  174

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C YNP GN  G+ PY
Sbjct  175  LTLCLYNPHGNVQGQSPY  192



>ref|XP_009412303.1| PREDICTED: STS14 protein-like [Musa acuminata subsp. malaccensis]
Length=179

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN+AR  V V PL WS  L+++A   V +Q+ N++C +A L    YG+NQ  +  
Sbjct  44   QFLTGHNEARKAVLVGPLQWSANLSSSASALVSHQKQNRSCEFADLESSTYGANQAWTS-  102

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              V+P  A  +WV ++ +Y+Y NN C AGH  C +YTQVVW+K+ E+GC+QATC K   T
Sbjct  103  YPVSPEEAVRSWVGERKYYSYENNSCAAGH-ECGTYTQVVWRKTAEVGCAQATCGKRGST  161

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C Y P GN  G+KPY
Sbjct  162  LTLCLYLPHGNVQGQKPY  179



>ref|XP_003611865.1| Pathogenesis-related protein 1C [Medicago truncatula]
Length=282

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = +2

Query  284  ADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQM-LSDGTAVTPRMAA  460
            ++VGV+PL WS  LA    L VRYQR+   C  A+L+  +YG NQ+ +S G A+ P    
Sbjct  152  SEVGVEPLQWSENLAKDTSLLVRYQRNKMACGLANLTASKYGGNQLWVSIGEAIMPSSVV  211

Query  461  ENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATC-PKGQITLTICFYNP  637
            + WV++K  Y + N+ CV  H  C +Y QVVWKKS++LGCSQATC  K +  LTICFY+P
Sbjct  212  KLWVRKKELYIHVNDTCV-NHEFCHAYRQVVWKKSVQLGCSQATCTDKKEAGLTICFYDP  270

Query  638  PG--NTVGEKPY  667
            P     +GE P+
Sbjct  271  PAPRRVIGESPF  282



>ref|XP_008665360.1| PREDICTED: STS14 protein-like [Zea mays]
 tpg|DAA51181.1| TPA: hypothetical protein ZEAMMB73_781249 [Zea mays]
Length=203

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L  HNQARA VGV PL W+  LA+AA   V  QR    C++A +    YG+NQ  +  
Sbjct  69   EYLAPHNQARAAVGVAPLRWNAGLASAAAGTVAQQRRQGGCAFADVGASPYGANQGWASY  128

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A  P      WV +  +Y +ANN C AG  +C +YTQVVW+ + E+GC+QA+C  G  T
Sbjct  129  RA-RPAEVVALWVAEGRYYTHANNTCAAGR-QCGTYTQVVWRNTAEVGCAQASCATG-AT  185

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C YNP GN  G+ PY
Sbjct  186  LTLCLYNPHGNVQGQSPY  203



>ref|XP_003559460.2| PREDICTED: STS14 protein [Brachypodium distachyon]
Length=202

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HN+ARA+VGV  L WS  LA+AA      Q+    C++A +    YG+NQ  +  
Sbjct  68   EFLAPHNKARAEVGVAALRWSAGLASAAAKTTSQQQRQSGCAFADMGASAYGANQGWASY  127

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A  P     +WV Q  +Y +ANN C AG  +C +YTQVVW+++ ++GC+QATC  G  T
Sbjct  128  RA-RPGEVVGSWVAQARYYTHANNSCAAGQ-QCGTYTQVVWRRTTDVGCAQATCGTG-AT  184

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C Y+P GN  GE PY
Sbjct  185  LTLCLYDPHGNVKGESPY  202



>gb|KFK28334.1| hypothetical protein AALP_AA8G502500 [Arabis alpina]
Length=190

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 87/153 (57%), Gaps = 16/153 (10%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSG-GEYGSNQMLSD  430
            +F + HN+ RA  G+ PL WS  L  AA    RYQR+ + C++AS    G+YG NQ++  
Sbjct  39   DFTNEHNKVRATFGIPPLVWSQTLEAAAIRLARYQRNQRQCAFASPKDPGKYGVNQLIIQ  98

Query  431  GTA---VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPK  601
             +    VTP  A   WV Q++FY+Y +N C + H  C +Y Q+VW+ + E+GC+Q  C K
Sbjct  99   QSVLRLVTPSEAVRFWVNQRTFYDYESNTCESDH-WCNNYLQIVWRDTKEVGCAQVRCAK  157

Query  602  GQIT-----------LTICFYNPPGNTVGEKPY  667
                           LTIC YNPPGN + +KPY
Sbjct  158  ESTVFFFWKKKESSLLTICLYNPPGNVLDQKPY  190



>ref|XP_002463930.1| hypothetical protein SORBIDRAFT_01g009100 [Sorghum bicolor]
 gb|EER90928.1| hypothetical protein SORBIDRAFT_01g009100 [Sorghum bicolor]
Length=199

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L  HNQARA VGV PL WS  LA+AA   V  Q+    C++A +    YG+NQ  +  
Sbjct  65   EYLAPHNQARAAVGVAPLRWSADLASAAAKTVAQQQRQGGCAFADMGASPYGANQGWASY  124

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A  P      WV +  +Y +ANN C +G  +C +YTQVVW+++ ++GC+QA+C  G  T
Sbjct  125  RA-RPAEVVALWVAEGRYYTHANNTCASGR-QCGTYTQVVWRRTTDVGCAQASCATG-AT  181

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C YNP GN  G+ PY
Sbjct  182  LTLCLYNPHGNVQGQSPY  199



>gb|EAY91762.1| hypothetical protein OsI_13405 [Oryza sativa Indica Group]
Length=196

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 86/143 (60%), Gaps = 11/143 (8%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQ--NCSYASLSGGEYGSNQMLS  427
            EFL  HNQAR+ VG+ PL WS  LA  A      Q+  Q   C +A +SG  YG+NQ   
Sbjct  60   EFLAPHNQARSPVGLAPLRWSGDLAPPAARTTSQQQGGQGRRCGFADMSGSPYGANQ---  116

Query  428  DGTAVTPRMAAE---NWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCP  598
             G A  P   AE   +WV Q  +Y +ANN C  G  +C +YTQVVW+++ E+GC+QATC 
Sbjct  117  -GWASYPARPAEVVASWVAQGRYYAHANNSCAPGQ-QCGTYTQVVWRRTAEVGCAQATCT  174

Query  599  KGQITLTICFYNPPGNTVGEKPY  667
             G  TLTIC YNP GN  G+ PY
Sbjct  175  TG-ATLTICLYNPHGNVQGQSPY  196



>ref|XP_001778553.1| predicted protein [Physcomitrella patens]
 gb|EDQ56583.1| predicted protein [Physcomitrella patens]
Length=136

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 77/138 (56%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EF+  HN ARADV V PL WS KL   A      QRD+ NC+    S G YG N     G
Sbjct  2    EFVSAHNAARADVDVGPLVWSHKLEDYARKYGEEQRDHHNCAMVH-SRGPYGENLFWGYG  60

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             +  P  A  +WV +K  Y+Y +N C +G   C  YTQVVW  + E+GC+  TC   + T
Sbjct  61   KSFAPADAVRSWVDEKQHYDYDSNSCASG-KVCGHYTQVVWADTKEVGCASITC-HDKAT  118

Query  614  LTICFYNPPGNTVGEKPY  667
              IC YNPPGN VGE PY
Sbjct  119  FIICSYNPPGNFVGEWPY  136



>ref|XP_004981879.1| PREDICTED: STS14 protein-like [Setaria italica]
Length=204

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E+L  HNQARA VGV PL WS  LA+AA   V  Q+    C++A + G  YG+NQ  +  
Sbjct  70   EYLAPHNQARAAVGVAPLRWSGDLASAAAAVVVRQQRQGGCAFADMGGSPYGANQGWASY  129

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A  P     +WV    +Y +ANN C  G  +C +YTQVVW+++ E+GC+QATC  G  T
Sbjct  130  RAA-PGEVVASWVATGQYYTHANNTCAPGR-QCGTYTQVVWRRTAEVGCAQATCATG-AT  186

Query  614  LTICFYNPPGNTVGEKPY  667
            LT+C YNP GN  G+ PY
Sbjct  187  LTVCLYNPHGNVQGQSPY  204



>ref|XP_008805422.1| PREDICTED: pathogenesis-related protein PR-1-like [Phoenix dactylifera]
Length=167

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 77/139 (55%), Gaps = 5/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRY-QRDNQNCSYASLSGGEYGSNQMLSD  430
            +FL  HN AR+ + + PL W P+LA  A    RY  R   +C+    S G YG N     
Sbjct  33   QFLGPHNTARSALRLRPLIWDPRLARYA---ERYANRRRGDCALVH-SAGPYGENIFWGS  88

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G+  TP  A   WV ++ +Y Y +N C  G  +C  YTQ+VW+ +  LGC++  C  G+ 
Sbjct  89   GSGWTPAQAVAAWVSERQWYRYGSNSCAGGWEKCGHYTQIVWRTTRRLGCARVNCAGGRG  148

Query  611  TLTICFYNPPGNTVGEKPY  667
               +C Y+PPGN VGE+PY
Sbjct  149  VFIVCDYHPPGNFVGERPY  167



>gb|KHN00577.1| STS14 protein [Glycine soja]
Length=71

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = +2

Query  452  MAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFY  631
            MA E WV+QK FYN+A+N CV  H RC  YTQVVW+KSLELGC++ATC K Q +LTICFY
Sbjct  1    MAVEEWVKQKQFYNHADNSCVPNH-RCGVYTQVVWRKSLELGCARATCVKEQASLTICFY  59

Query  632  NPPGNTVGEKPY  667
            NPPGN +GE PY
Sbjct  60   NPPGNYIGESPY  71



>ref|XP_011079315.1| PREDICTED: pathogenesis-related protein PR-1-like [Sesamum indicum]
Length=167

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL + N ARA++G+ PL W P++A  A      +R   +C+    S G YG N     G
Sbjct  34   QFLSIQNAARANLGLAPLIWDPRIARYAAWYANMRR--ADCALEH-SNGPYGENIFWGSG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               TP  AA  WV ++  Y+Y +N C  G  +C  YTQ+VWK++  +GC++  C +G+  
Sbjct  91   DEWTPAQAAAEWVAERQGYDYRSNSCAHGE-QCGHYTQIVWKETRRVGCARVVCYEGRGV  149

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +GE+PY
Sbjct  150  FMICNYDPPGNYIGERPY  167



>ref|XP_003608313.1| Pathogenesis-related protein 1A [Medicago truncatula]
 gb|AES90510.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=159

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 85/142 (60%), Gaps = 14/142 (10%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LDVHN+ARA+VGV PL W+  LA+ A   + Y +          S G YG N  L++G
Sbjct  28   DYLDVHNKARAEVGVGPLVWNETLASYA---MNYAKSKHETCEMVHSQGPYGEN--LAEG  82

Query  434  TAVTPRMAAEN----WVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPK  601
            +   P+M A +    WV +K+FY+Y  N CV     CR YTQVVW  + +LGC++ +C  
Sbjct  83   S--DPQMNAADAVKLWVDEKAFYDYGTNACVKD--ECRHYTQVVWSNTKQLGCARESCKN  138

Query  602  GQITLTICFYNPPGNTVGEKPY  667
            G  T  IC Y PPGN VG+KPY
Sbjct  139  GW-TFFICSYYPPGNYVGDKPY  159



>gb|AHA43767.1| pathogenesis related protein 1 isoform 4 [Morus alba var. multicaulis]
 gb|AHW81905.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN+ARA VGV P+TW   +A  A     Y    Q       SGG YG N   S G
Sbjct  31   DFLDPHNRARAKVGVGPMTWDDSVAAYA---RNYANQRQGDCKLVHSGGPYGENIAWSSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR-CRSYTQVVWKKSLELGCSQATCPKGQI  610
              ++   A   WV +KS Y+Y +N CV  +P  C  YTQVVW+KS  LGC++  C  G  
Sbjct  88   D-LSAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLHYTQVVWRKSTRLGCAKVRCNSGG-  145

Query  611  TLTICFYNPPGNTVGEKPY  667
            +  IC YNPPGN +G++PY
Sbjct  146  SFVICNYNPPGNYIGQRPY  164



>gb|AHW81904.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN+ARA VGV P+TW   +A  A     Y    Q       SGG YG N   S G
Sbjct  31   DFLDPHNRARAKVGVGPMTWDDSVAAYA---RNYANQRQGDCKLVHSGGPYGENIAWSSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR-CRSYTQVVWKKSLELGCSQATCPKGQI  610
              ++   A   WV +KS Y+Y +N CV  +P  C  YTQVVW+KS  LGC++  C  G  
Sbjct  88   D-LSAAGAVGMWVAEKSLYDYYSNTCVGRNPMGCLHYTQVVWRKSTRLGCAKVRCNSGG-  145

Query  611  TLTICFYNPPGNTVGEKPY  667
            +  IC YNPPGN +G++PY
Sbjct  146  SFVICNYNPPGNYIGQRPY  164



>ref|XP_009402037.1| PREDICTED: pathogenesis-related protein PR-1-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            + L  HN ARA VG+ PL W  +LA  A  +    R  ++C+ A  SGG YG N     G
Sbjct  36   QLLRSHNAARAAVGLPPLAWDARLARYA--ESYGGRRRRDCALAH-SGGPYGENIFWGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                P  AA  WV ++ +Y+Y +N C A  P C  YTQ+VW+ +  LGC+  +C   +  
Sbjct  93   ARWRPAQAAAAWVGERRWYHYRSNSCSA--PECGHYTQIVWRSTRRLGCAMVSCSGRKGV  150

Query  614  LTICFYNPPGNTVGEKPY  667
            L +C Y+PPGN +GE+PY
Sbjct  151  LVVCEYDPPGNYIGERPY  168



>ref|XP_007148301.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
 gb|ESW20295.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
Length=183

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL+ HN AR+ VGV P+ W   +A+ A   V   + N  C     SGG YG N   S G
Sbjct  33   DFLNAHNTARSQVGVGPMRWDATVASFAQNYVNKLKGN--CKMVH-SGGPYGENLAWSSG  89

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A + WV +K +Y+Y +N CV G   CR YTQVVW+ S+ LGC++  C  G+ T
Sbjct  90   D-LTATAAVKLWVGEKPYYDYNSNTCVGG--ECRHYTQVVWRNSVRLGCAKVRCNDGRAT  146

Query  614  LTICFYNPPGNTVGEKPY  667
            +  C Y+PPGN +G++P+
Sbjct  147  IISCNYDPPGNYIGQRPF  164



>ref|XP_010914120.1| PREDICTED: pathogenesis-related protein PR-1 [Elaeis guineensis]
Length=163

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 75/139 (54%), Gaps = 5/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRY-QRDNQNCSYASLSGGEYGSNQMLSD  430
            +FL  HN  R+ + + PL W  +LA  A    RY  R   +C+    S G YG N     
Sbjct  29   QFLGPHNAPRSALRLRPLVWDARLARYA---ERYANRRRGDCALVH-SAGPYGENIFWGS  84

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G+  TP  A   WV ++ +Y Y +N C  G  RC  YTQ+VW+ +  LGC++  C  G+ 
Sbjct  85   GSGWTPAQAVAAWVSERKWYRYGSNSCAGGWERCGHYTQIVWRTTRRLGCARVNCAGGRG  144

Query  611  TLTICFYNPPGNTVGEKPY  667
               +C Y+PPGN VGE+PY
Sbjct  145  VFIVCDYDPPGNFVGERPY  163



>gb|AFK37568.1| unknown [Medicago truncatula]
 gb|KEH37178.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=183

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 84/138 (61%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L +HN+AR+DVGV P++W  K+A+ A   V   +   NC     S G YG N   S G
Sbjct  32   DYLKIHNKARSDVGVGPISWDAKVASYAETYV--NKLKANCKMVH-SKGPYGENLAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A   W+ +K +YNY +N C  G+ +C  YTQVVW+ S+ +GC++  C  G+ T
Sbjct  89   D-MTGTAAVTMWIGEKKYYNYNSNSCAVGY-QCGHYTQVVWRDSVRVGCAKVKCNDGRST  146

Query  614  LTICFYNPPGNTVGEKPY  667
            +  C Y+PPGN +G++P+
Sbjct  147  IISCNYDPPGNYIGQRPF  164



>ref|XP_002270128.1| PREDICTED: pathogenesis-related leaf protein 4 [Vitis vinifera]
 emb|CAN61902.1| hypothetical protein VITISV_012766 [Vitis vinifera]
Length=167

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN ARA+VGV P+TW  KLA  A   V  ++   +C+    SGG YG N      
Sbjct  28   DYLTAHNAARAEVGVQPMTWDKKLANYASQYVS-EKLIGDCNLEH-SGGPYGENLAARGA  85

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T      A + WV +K +YNY +N CV G   C  YTQVVW  S+ +GC++  C  G+  
Sbjct  86   TDFDGADAVKMWVSEKPYYNYDSNSCVGG--ECGHYTQVVWNTSVNVGCARVLCKNGEWW  143

Query  614  LTICFYNPPGNTVGEKPY  667
            +  C Y+PPGN  GE+PY
Sbjct  144  IVSCNYDPPGNYFGERPY  161



>ref|XP_010252392.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 83/139 (60%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L+ HN ARADVGV PLTW   +A  A  +        +C+    SGG YG N  L+ G
Sbjct  32   DYLNAHNAARADVGVGPLTWDDNVAAYA--QAYANERAGDCAMVH-SGGPYGEN--LATG  86

Query  434  T-AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            T +++   A E WV +K +Y+Y++N CV G   C  YTQVVW  S+ LGC++  C  G  
Sbjct  87   TPSLSGTAAVEGWVGEKQYYDYSSNSCVGG--ECLHYTQVVWSDSVRLGCAKVHCNSGW-  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN VG++PY
Sbjct  144  DFVICSYDPPGNYVGQRPY  162



>gb|KCW56841.1| hypothetical protein EUGRSUZ_I02509 [Eucalyptus grandis]
Length=164

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARA+VGV P+TW+  +A  A      +R + N  +   SGG YG N  L+ G
Sbjct  34   DFVDEHNAARAEVGVGPITWNRTVAAYARKYAEERRGDCNLEH---SGGPYGEN--LAKG  88

Query  434  TAV-TPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
              V + R + + WV ++  Y+Y++N CV G   CR YTQVVW+ S+ LGC++  C  G  
Sbjct  89   YGVLSGRDSVKMWVGEEDDYDYSSNSCVVG--ECRHYTQVVWRDSVHLGCARVKCDDGW-  145

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN  GE+PY
Sbjct  146  WFVICSYDPPGNYEGERPY  164



>gb|AFK93503.1| pathogenesis related protein 1 isoform 4 [Ficus pumila var. awkeotsang]
Length=169

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 76/138 (55%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN+ARA+VGV P+TW   +A  A  +    R   +C     SGG YG N     G
Sbjct  31   DFLAPHNRARAEVGVGPMTWDESVAAYA--RDYANRRKGDCKLIH-SGGPYGENIAWGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                 R A   WV +KS Y+Y NN C+     C  YTQVVW+KS  LGC++  C  G  T
Sbjct  88   DLSAAR-AVGMWVAEKSLYDYNNNKCIGDPWGCLHYTQVVWRKSTRLGCAKVRCVSGG-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
              IC YNPPGN  G++PY
Sbjct  146  FIICNYNPPGNYKGQRPY  163



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN+ARA+VGV P+TW   +A  A     Y    Q       SGG YG N   S G
Sbjct  24   DFLAPHNRARAEVGVGPMTWDDSVAAYA---RNYANQRQGDCKLVHSGGPYGENIAWSSG  80

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR-CRSYTQVVWKKSLELGCSQATCPKGQI  610
              ++   A   WV +KS Y+Y +N CV  +P  C  YTQVVW+KS  LGC++  C  G  
Sbjct  81   D-LSAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLHYTQVVWRKSTRLGCAKVRCNSGG-  138

Query  611  TLTICFYNPPGNTVGEKPY  667
            +  IC YNPPGN +G++PY
Sbjct  139  SFVICNYNPPGNYIGQRPY  157



>ref|XP_002981886.1| hypothetical protein SELMODRAFT_233855 [Selaginella moellendorffii]
 ref|XP_002986006.1| hypothetical protein SELMODRAFT_234936 [Selaginella moellendorffii]
 gb|EFJ12825.1| hypothetical protein SELMODRAFT_234936 [Selaginella moellendorffii]
 gb|EFJ16979.1| hypothetical protein SELMODRAFT_233855 [Selaginella moellendorffii]
Length=133

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 77/133 (58%), Gaps = 3/133 (2%)
 Frame = +2

Query  269  HNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTP  448
             N ARA +G+ PL W  KL   A      +    NC Y   S G YG N     G A +P
Sbjct  4    QNDARARLGLRPLIWDSKLQAFAEDWANQRARYGNC-YLQHSNGPYGENIFWGGGKAWSP  62

Query  449  RMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICF  628
              AA  W++++++YNY +N C +G  +C  YTQ+VW+ S  +GC++ TC  G + +T C 
Sbjct  63   AEAANAWIEERNWYNYGSNSCQSGQ-QCGHYTQIVWRDSERIGCARVTCSSGDVFMT-CN  120

Query  629  YNPPGNTVGEKPY  667
            Y+PPGN +GEKPY
Sbjct  121  YDPPGNYIGEKPY  133



>ref|XP_010941967.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +F+  HN ARA VGV P++W   +A  A         NQ      L  SGG YG N    
Sbjct  30   DFVSAHNAARAAVGVGPVSWDDTVAAYA-----QNYANQRIGDCKLVHSGGPYGENLFWG  84

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G   T   A  +WV +K +Y+Y  N C AG   C  YTQVVW+ S  +GC++ TC  G 
Sbjct  85   LGKEYTAADAVNSWVSEKQWYDYNTNTCAAG-KVCGHYTQVVWRDSTHIGCARVTCNSGA  143

Query  608  ITLTICFYNPPGNTVGEKPY  667
            I   IC YNPPGN VGE+PY
Sbjct  144  I-FIICNYNPPGNIVGERPY  162



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN+ARA+VGV P+TW   +A  A     Y    Q       SGG YG N   S G
Sbjct  31   DFLAPHNRARAEVGVGPMTWDDSVAAYA---RNYANQRQGDCKLVHSGGPYGENIAWSSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR-CRSYTQVVWKKSLELGCSQATCPKGQI  610
              ++   A   WV +KS Y+Y +N CV  +P  C  YTQVVW+KS  LGC++  C  G  
Sbjct  88   D-LSAAGAVGMWVAEKSLYDYYSNKCVGQNPMGCLHYTQVVWRKSTRLGCAKVRCNSGG-  145

Query  611  TLTICFYNPPGNTVGEKPY  667
            +  IC YNPPGN +G++PY
Sbjct  146  SFVICNYNPPGNYIGQRPY  164



>ref|XP_010904557.1| PREDICTED: pathogenesis-related protein 1-like [Elaeis guineensis]
Length=163

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+++HN ARA VGV P++W+  +A  A  +    +   +C     S G YG N     G
Sbjct  30   DFINLHNAARAAVGVGPVSWNDTVAAYA--QDYADKRKADCQLVH-SDGTYGENIFWGGG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T  +A  +WV ++ +Y+YA+N C  G   C  YTQVVW KS+ +GCS+  C  G  T
Sbjct  87   PGWTATVAVNDWVSERQYYDYASNSCAVGQ-VCGHYTQVVWAKSVHIGCSRVACDNGD-T  144

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE+PY
Sbjct  145  FITCNYDPPGNYVGERPY  162



>ref|XP_010691813.1| PREDICTED: pathogenesis-related protein 1C [Beta vulgaris subsp. 
vulgaris]
Length=167

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV+ + W+  LA  A L    Q  N +      S G YG N  +S+ 
Sbjct  33   DYLDAHNTARAAVGVENIVWNDTLAAYAQLYANSQAHNCDLEIEP-SHGPYGENLAVSNS  91

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +   A E W+ +K  YNY++N C  G  +C +YTQVVW+ SL +GC++  C  G + 
Sbjct  92   AIFSGVDAVELWLSEKVNYNYSSNTCAIG-TKCFTYTQVVWRASLHVGCARVQCFNGWV-  149

Query  614  LTICFYNPPGNTVGEKPY  667
            L +C Y+PPGN VG++P+
Sbjct  150  LVVCSYSPPGNIVGQRPF  167



>ref|XP_009342193.1| PREDICTED: pathogenesis-related protein PRMS-like [Pyrus x bretschneideri]
Length=175

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 76/139 (55%), Gaps = 4/139 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL VHN  R  +G+ PL W   LAT A +  + QR + +C     S G YG N     G
Sbjct  40   DFLKVHNNLRRKIGLPPLVWDENLATVARIYTK-QRASMDCRMVH-STGPYGENIFWGGG  97

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
                  R AA++W  +K FY+Y  + C  G   C  YTQ+VWK +  LGC++  C  G  
Sbjct  98   NQPWGARFAAKSWSHEKLFYDYQTDSCKTGQ-MCGHYTQMVWKDTKRLGCAREVCRNGAG  156

Query  611  TLTICFYNPPGNTVGEKPY  667
             L IC Y+PPGN VGEKPY
Sbjct  157  ELIICNYDPPGNWVGEKPY  175



>emb|CDY46098.1| BnaA03g52700D [Brassica napus]
Length=163

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HNQARA VGVDPL W   +A  A      +R +    ++S   G YG N   S G
Sbjct  32   DFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSS---GPYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +++ YNY +N C +G  +C  YTQ+VWK S+ LGC++ +C  GQ T
Sbjct  89   D-MSGVEAVNMWVNEQADYNYGSNTCASGK-QCGHYTQIVWKNSVSLGCAKVSCDNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN VGE PY
Sbjct  146  FITCNYDPQGNIVGEWPY  163



>ref|XP_010029887.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Eucalyptus 
grandis]
Length=173

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARA+VGV P+TW+  +A  A      +R + N  +   SGG YG N  L+ G
Sbjct  43   DFVDEHNAARAEVGVGPITWNRTVAAYARKYAEERRGDCNLEH---SGGPYGEN--LAKG  97

Query  434  TAV-TPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
              V + R + + WV ++  Y+Y++N CV G   CR YTQVVW+ S+ LGC++  C  G  
Sbjct  98   YGVLSGRDSVKMWVGEEDDYDYSSNSCVVG--ECRHYTQVVWRDSVHLGCARVKCDDGW-  154

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN  GE+PY
Sbjct  155  WFVICSYDPPGNYEGERPY  173



>gb|AAB05225.1| pathogenesis-related protein-1 [Nicotiana glutinosa]
Length=168

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 83/138 (60%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L+ HN ARADVGV+PLTW  ++A  A   V   +   +C+  + S G+YG N  +  G
Sbjct  36   DYLNAHNTARADVGVEPLTWDDEVAAYAQNYVS--QLAADCNLVT-SHGQYGENLAMGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVDEKQYYDHGSNHCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN VG+ PY
Sbjct  152  VS-CNYDPPGNFVGQSPY  168



>ref|XP_009388942.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 74/138 (54%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARADVGV P++W   +A  A     Y  +         SGG YG N     G
Sbjct  30   DFVDAHNSARADVGVGPVSWDDNVAAYAQ---NYANERIGDCQLVHSGGPYGENIFWGSG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T   A  +WV +K +Y+Y +N C  G   C  YTQVVW+ S  +GC++  C  G I 
Sbjct  87   ADFTAADAVNSWVDEKQYYDYDSNSCADGQV-CGHYTQVVWRDSTAIGCARVQCNSGAI-  144

Query  614  LTICFYNPPGNTVGEKPY  667
              IC YNP GN VG++PY
Sbjct  145  FIICNYNPAGNIVGKRPY  162



>emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum]
Length=153

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW   +A  A   V     + N  +   S G+YG N     G
Sbjct  21   DYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVH---SHGQYGENLAQGSG  77

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  78   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVKCNNGGYV  136

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ PY
Sbjct  137  VS-CNYDPPGNVIGQSPY  153



>ref|XP_002313936.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE87891.2| pathogenesis-related family protein [Populus trichocarpa]
Length=160

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV PLTW   +   A      +  + N     LSGG YG     S  
Sbjct  29   DYLDAHNAARAAVGVGPLTWDNTVQAYAQAYASQRAGDCNLV---LSGGPYGEILQWSSA  85

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+FY+Y +N C +G  +C SYTQVVW  S+ LGC++ TC  G  T
Sbjct  86   D-LSGTDAVKLWVDEKAFYDYNSNSCASGQ-QCVSYTQVVWGNSVSLGCAKVTCSAGG-T  142

Query  614  LTICFYNPPGNTVGEKPY  667
              +C Y+PPGN VG+KPY
Sbjct  143  FIVCNYDPPGNVVGQKPY  160



>ref|XP_002532413.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF29977.1| STS14 protein precursor, putative [Ricinus communis]
Length=179

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 75/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN ARA + + PL W  +LA  A      +R + +  +   S G YG N     G
Sbjct  46   QFLGPHNAARAALRMPPLIWDTRLANYAQWYANQRRFDCDLRH---SNGPYGENIFWGSG  102

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T  TP  A   WV ++ +YNY +N C  GH  C  YTQ+VW+K+  +GC++ TC      
Sbjct  103  TGWTPAQAVTAWVSERKWYNYWSNSCY-GHQECGHYTQIVWRKTRRIGCAKVTCSDDLGV  161

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN +GE+PY
Sbjct  162  FMTCNYDPPGNYIGERPY  179



>ref|XP_009119957.1| PREDICTED: pathogenesis-related protein 1 [Brassica rapa]
Length=174

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HNQARA+VGV PL W  ++A  A      QR +  CS    SGG YG N   S G
Sbjct  32   DFLAAHNQARAEVGVGPLRWDNQVAAYARNHAN-QRKSVGCSMEHSSGGPYGENIAWSSG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A E WV+++  Y+Y +N C A +  C  YTQVVW+ S++LGC++  C  G  T
Sbjct  91   N-LSGVEAVEMWVKEQFDYDYGSNTC-AWNKVCGHYTQVVWENSVKLGCAKVRCNNGN-T  147

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE PY
Sbjct  148  FITCNYDPPGNWVGEWPY  165



>emb|CAA29022.1| PR-1b protein [Nicotiana tabacum]
Length=164

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW   +A  A   V     + N  +   S G+YG N     G
Sbjct  32   DYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVH---SHGQYGENLAQGSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  89   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVKCNNGGYV  147

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ PY
Sbjct  148  VS-CNYDPPGNVIGQSPY  164



>ref|XP_008796970.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +F+  HN ARA VGV  ++W   +A  A         NQ  S   L  SGG YG N    
Sbjct  30   DFVSAHNAARAAVGVGSVSWDDTVAAYA-----QNYANQRISDCQLKHSGGPYGENLFGG  84

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G   T   A  +WV +K +Y+Y  N C AGH  C  YTQVVW+ S  +GC++ TC  G 
Sbjct  85   SGADFTAADAVNSWVDEKQWYDYNTNTCAAGH-ECGHYTQVVWRDSTNIGCARVTCNSGA  143

Query  608  ITLTICFYNPPGNTVGEKPY  667
            I   IC Y PPGN VG++PY
Sbjct  144  I-FIICDYKPPGNFVGQRPY  162



>ref|XP_007205909.1| hypothetical protein PRUPE_ppa011521mg [Prunus persica]
 gb|EMJ07108.1| hypothetical protein PRUPE_ppa011521mg [Prunus persica]
Length=207

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 75/139 (54%), Gaps = 4/139 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL VHN AR  +G+ PL W  KLA  A   V   R    C     S G YG N     G
Sbjct  72   DFLRVHNNARKQIGLPPLEWDEKLAEFARHYVNL-RAASGCGMIH-SNGPYGENIFWGGG  129

Query  434  TAV-TPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
              +   R A ++W  +K FYN+  N C+ G   C  YTQ+VWK +  +GC++A C  G  
Sbjct  130  KQLWGGRFAVQSWSHEKKFYNHKTNSCIPGQ-MCGHYTQIVWKDTKRVGCARAACTNGGG  188

Query  611  TLTICFYNPPGNTVGEKPY  667
             L IC Y+PPGN +GEKPY
Sbjct  189  QLIICNYDPPGNWLGEKPY  207



>gb|KFK28333.1| hypothetical protein AALP_AA8G502400 [Arabis alpina]
Length=189

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 76/147 (52%), Gaps = 17/147 (12%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLS-GGEYGSNQMLSD  430
            +F   HN  RA V + P  WS  L  AA    RYQR+ + C YASL    +YG+NQ+  +
Sbjct  40   DFTAAHNDYRATVYLPPFVWSQTLEAAAIRLARYQRNKRKCEYASLKYPSKYGANQLRVE  99

Query  431  G----TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCP  598
            G    T +TP     +W  +  +Y+Y +N C   H  CR + Q+ W+KS E+GC+QA C 
Sbjct  100  GRFLTTIMTPSQTVLSWANEMGYYDYKSNTCTPNH-TCRDFVQLFWRKSKEVGCAQARCV  158

Query  599  KGQ-----------ITLTICFYNPPGN  646
            K               LTIC YNPP N
Sbjct  159  KESTFFFFWKIKEPTVLTICLYNPPAN  185



>ref|XP_009605825.1| PREDICTED: pathogenesis-related protein 1B-like [Nicotiana tomentosiformis]
Length=177

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADV V+PLTW   +A  A   V     + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVAVEPLTWDDDVAAYAQNYVSQLAADCNLVH---SHGQYGENLAQGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y+Y +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVDEKQYYDYDSNTCAEGQV-CGHYTQVVWRNSVRVGCARVQCDNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ P+
Sbjct  152  VS-CNYDPPGNVIGQSPF  168



>ref|XP_009610821.1| PREDICTED: pathogenesis-related protein 1B [Nicotiana tomentosiformis]
 sp|P07053.1|PR1B_TOBAC RecName: Full=Pathogenesis-related protein 1B; Short=PR-1B; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35665.1| unnamed protein product [Nicotiana tabacum]
 dbj|BAA14221.1| PR1b protein precursor [Nicotiana tabacum]
 emb|CAA27183.1| PR-1b precursor; (aa -30-138) [Nicotiana tabacum]
 prf||1203245A protein 1b,pathogenesis related
Length=168

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW   +A  A   V     + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVH---SHGQYGENLAQGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVKCNNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ PY
Sbjct  152  VS-CNYDPPGNVIGQSPY  168



>ref|XP_009138205.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
 emb|CDY46096.1| BnaA03g52720D [Brassica napus]
Length=163

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HNQARA VGVDPL W   +A  A      +R +    ++S   G YG N   S G
Sbjct  32   DFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSS---GPYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +++ Y+Y +N C +G  +C  YTQ+VWK S+ LGC++ +C  GQ T
Sbjct  89   D-MSGVEAVNMWVNEQADYDYGSNTCASGK-QCGHYTQIVWKNSVSLGCAKVSCDNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN VGE PY
Sbjct  146  FITCNYDPQGNIVGEWPY  163



>emb|CDP12737.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LDVHN ARA V V P+ W  +LA  A     Y     N      SGG YG N     G
Sbjct  30   DYLDVHNAARAQVNVGPIAWDDRLAAYAQ---NYATQRMNDCQLMHSGGPYGENLAAGSG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T R A   WV ++ +Y+Y +N C  G   CR YTQVVW+ S   GC++  C      
Sbjct  87   D-FTARAAVNLWVNERQYYDYGSNSCTQGK-ECRHYTQVVWRNSARTGCARVQCTNSPSW  144

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +G++PY
Sbjct  145  FVICSYDPPGNYIGQRPY  162



>emb|CDX69000.1| BnaC01g04530D [Brassica napus]
Length=174

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HNQARA+VGV PLTW  ++A  A      QR +  CS    SGG YG N   S G
Sbjct  32   DFLAAHNQARAEVGVGPLTWDNQVAAYARNHAN-QRKSVGCSMEHSSGGPYGENIAWSSG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV+++  Y+Y +N C A +  C  YTQVVW+ S++LGC++  C  G  T
Sbjct  91   N-LSGVDAVRMWVKEQFDYDYESNTC-AWNKVCGHYTQVVWENSVKLGCAKVRCNNGN-T  147

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE PY
Sbjct  148  FITCNYDPPGNWVGEWPY  165



>ref|XP_006422707.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
 gb|ESR35947.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
Length=159

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN+ARA V V P+ W  K+A  A     Y    +       SGG YG N   S G
Sbjct  28   DYLRAHNEARASVRVGPMRWDNKVAAYAK---NYANQRKGDCRLVHSGGPYGENLAWSSG  84

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A + WV ++  YNY +N CV G   CR YTQVVW+ S+ LGC++  C   + T
Sbjct  85   D-LTGTAAVKLWVDERPKYNYNSNTCVGGE--CRHYTQVVWRNSVRLGCARVKCNNNRGT  141

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN  G++PY
Sbjct  142  FVICSYDPPGNVAGKRPY  159



>gb|EMT11012.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=166

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 75/139 (54%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARADVGV P+TW   +A  A      +R +    + +  G  YG N     G
Sbjct  29   DFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIH-TPDGRPYGENLFGGGG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGH-PRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            T  T   A  +WV +K +Y++ +N C A     C  YTQVVW+ S  +GC++  C  G  
Sbjct  88   TQWTAADAVSSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVCDSGDG  147

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC YNPPGN VG+ PY
Sbjct  148  VFIICSYNPPGNYVGQSPY  166



>ref|XP_010691524.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++++ HN ARA VGV  + W  ++A  A  +   QR        S  GG YG N  +S G
Sbjct  32   DYVNAHNAARAAVGVGNIQWDDQVAAFA-QQYANQRKADCALRHSGGGGRYGENIAVSSG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +++T   A + WV +K+FYNY  N C +G   C  YTQVVW+ S  LGC++  C  G + 
Sbjct  91   SSMTGTAAVKLWVDEKAFYNYNTNTCASG-KVCGHYTQVVWRNSNRLGCARVQCNNGGVF  149

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C Y+PPGN +G+KPY
Sbjct  150  VT-CNYSPPGNYIGQKPY  166



>ref|XP_006422714.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
 gb|ESR35954.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
Length=163

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++++ HN ARA VGV P+TW  ++A+ A      ++ + N  +   SGG YG N   S  
Sbjct  31   DYVNAHNAARAQVGVGPVTWDDRVASYAQNYANKRKGDCNLVH---SGGPYGENLAWSS-  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+ Y+Y +N C AG   C  YTQVVW+KS+ +GC++ TC   + T
Sbjct  87   AGLSGTDAVKLWVNEKADYDYNSNTCAAGKV-CGHYTQVVWRKSVRIGCAKVTCNNNKGT  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  146  FIGCNYDPPGNFVGEKPY  163



>ref|XP_006422719.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
 gb|ESR35959.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
Length=159

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN+ARA V V P+ W  K+A  A     Y    +       SGG YG N   S G
Sbjct  28   DYLRAHNEARASVRVGPMRWDNKVAAYAQ---NYANQRKGDCRLVHSGGPYGENLAWSSG  84

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A + WV ++  YNY +N CV G   CR YTQVVW+ S+ LGC++  C   + T
Sbjct  85   D-LTGTAAVKLWVDERPKYNYNSNTCVGGE--CRHYTQVVWRNSVRLGCARVKCNNNRGT  141

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN  G++PY
Sbjct  142  FVICSYDPPGNVAGKRPY  159



>ref|XP_001781201.1| predicted protein [Physcomitrella patens]
 gb|EDQ53986.1| predicted protein [Physcomitrella patens]
Length=169

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 72/137 (53%), Gaps = 4/137 (3%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            FL  HN AR+ VGV PL WS  LAT A      QR    C   + S G+YG N     G 
Sbjct  37   FLTPHNAARSRVGVPPLKWSNTLATYARKYAYSQRGK--CRPLTHSQGQYGENLFWGYGK  94

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            A TPR A   WV +   Y Y+ N C  G   C  YTQVVW+ + E+GC+   C   Q   
Sbjct  95   AWTPREAVNFWVGEAKDYRYSTNSCTPGK-MCGHYTQVVWRTTREVGCASVLC-SDQAIY  152

Query  617  TICFYNPPGNTVGEKPY  667
             IC YNPPGN +G +PY
Sbjct  153  IICSYNPPGNWIGRRPY  169



>gb|KFK27304.1| hypothetical protein AALP_AA8G365000 [Arabis alpina]
Length=202

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 4/137 (3%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            FLD HN AR+ +G+ PL W  KLAT A      +R +   S+++   G YG N     G+
Sbjct  70   FLDPHNAARSRLGLSPLVWDSKLATYATWWANQRRFDCAMSHST---GAYGENLFWGSGS  126

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            +  P  A ++W+ + S Y+Y +N C  G   C  YTQ+VW+ +  LGC+   C  G    
Sbjct  127  SWAPGFAVQSWIVEGSSYDYNSNSC-HGTGMCGHYTQIVWRDTKRLGCASVVCANGAGVF  185

Query  617  TICFYNPPGNTVGEKPY  667
              C Y+PPGN VGEKPY
Sbjct  186  ITCNYDPPGNYVGEKPY  202



>ref|XP_002993585.1| hypothetical protein SELMODRAFT_451245 [Selaginella moellendorffii]
 gb|EFJ05360.1| hypothetical protein SELMODRAFT_451245 [Selaginella moellendorffii]
Length=174

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL   N+AR  VGV PL W  +LA  A      ++ + NC Y   SGG YG N     G
Sbjct  40   QFLYGQNRARYSVGVPPLVWDNRLAAYAQWWANQKQASGNC-YLQHSGGPYGENIFWGRG  98

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +P  A + WV ++ +Y+Y +N C+  +  C  YTQ+VW+ S  +GC++ TC  G + 
Sbjct  99   KPWSPSEAVDAWVDERRWYDYYSNSCLF-NDDCGHYTQIVWRSSTRVGCARVTCADGDVF  157

Query  614  LTICFYNPPGNTVGEKPY  667
            + IC Y+PPGN +G++PY
Sbjct  158  M-ICNYDPPGNYIGQRPY  174



>ref|XP_006486820.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++++ HN ARA VGV P+TW  ++A+ A      ++ + N  +   SGG YG N   S  
Sbjct  31   DYVNAHNAARAQVGVGPVTWDDRVASYAQNYANQRKGDCNLVH---SGGPYGENLAWSS-  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+ Y+Y +N C AG   C  YTQVVW+KS+ +GC++ TC   + T
Sbjct  87   AGLSGTDAVKLWVNEKADYHYNSNTCAAG-KVCGHYTQVVWRKSVRIGCAKVTCNNNKGT  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  146  FIGCNYDPPGNFVGEKPY  163



>ref|XP_002992723.1| hypothetical protein SELMODRAFT_135802 [Selaginella moellendorffii]
 gb|EFJ06204.1| hypothetical protein SELMODRAFT_135802 [Selaginella moellendorffii]
Length=171

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL   N+AR  VGV PL W  +LA  A      ++ + NC Y   SGG YG N     G
Sbjct  37   QFLYGQNRARYSVGVPPLVWDNRLAAYAQWWANQKQASGNC-YLQHSGGPYGENIFWGRG  95

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +P  A + WV ++ +Y+Y +N C+  +  C  YTQ+VW+ S  +GC++ TC  G + 
Sbjct  96   KPWSPSEAVDAWVDERRWYDYYSNSCLF-NDDCGHYTQIVWRSSTRVGCARVTCADGDVF  154

Query  614  LTICFYNPPGNTVGEKPY  667
            + IC Y+PPGN +G++PY
Sbjct  155  M-ICNYDPPGNYIGQRPY  171



>ref|XP_002983458.1| hypothetical protein SELMODRAFT_234269 [Selaginella moellendorffii]
 gb|EFJ15359.1| hypothetical protein SELMODRAFT_234269 [Selaginella moellendorffii]
Length=153

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML-SDG  433
            FL+ HNQ R  +GV  L W  ++A  +     +Q+D ++C+    S G YG N    S G
Sbjct  21   FLEAHNQERMQMGVPALHWDDEVAAYSLWWTNHQKDYESCAMRH-SDGPYGENLFWGSPG  79

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +P  A ++WV +K  +NY  N C      C  YTQ+VW+ S +LGC+ ATCP G  T
Sbjct  80   KEWSPHDAVKSWVDEKQHFNYEGNSCAQ---MCGHYTQLVWRDSTKLGCATATCPNGD-T  135

Query  614  LTICFYNPPGNTVGEKPY  667
            L  C Y+PPGN +G++P+
Sbjct  136  LISCNYDPPGNYIGQRPF  153



>ref|XP_007041425.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97256.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=159

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 80/142 (56%), Gaps = 15/142 (11%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL----SGGEYGSNQM  421
            ++L VH+ ARA VGV P+TW P++A        Y +D  N   A      S G YG N +
Sbjct  29   DYLSVHDAARAQVGVGPMTWDPEVAA-------YAQDYANIRVADCGLVHSYGPYGEN-I  80

Query  422  LSDGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPK  601
                 A+T   A + WV +K +YNY  N+CV G   C  YTQVVW+ S  LGC++  C  
Sbjct  81   AEASYALTGAEAVQMWVDEKPYYNYDANICVGG--ECLHYTQVVWRNSTRLGCARVECNS  138

Query  602  GQITLTICFYNPPGNTVGEKPY  667
            G   +T C Y+PPGN VGE+PY
Sbjct  139  GWWFVT-CNYDPPGNYVGERPY  159



>ref|XP_002974034.1| hypothetical protein SELMODRAFT_100429 [Selaginella moellendorffii]
 gb|EFJ24989.1| hypothetical protein SELMODRAFT_100429 [Selaginella moellendorffii]
Length=153

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML-SDG  433
            FL+ HNQ R  +GV  L W  ++A  +     +Q+D ++C+    S G YG N    S G
Sbjct  21   FLEAHNQERMQMGVPALHWDDEVAAYSLWWTNHQKDYESCAMRH-SDGPYGENLFWGSPG  79

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +P  A ++WV +K  +NY  N C      C  YTQ+VW+ S +LGC+ ATCP G  T
Sbjct  80   KEWSPHDAVKSWVDEKQHFNYEGNSCAQ---MCGHYTQLVWRDSTKLGCATATCPNGD-T  135

Query  614  LTICFYNPPGNTVGEKPY  667
            L  C Y+PPGN +G++P+
Sbjct  136  LISCNYDPPGNYIGQRPF  153



>ref|XP_004301876.1| PREDICTED: STS14 protein-like [Fragaria vesca subsp. vesca]
Length=183

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 82/151 (54%), Gaps = 15/151 (10%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQ---------RDNQNCSYASLSGGEY  406
            EFL  HN+ARA VGV PL W+  LA  A   + +          +D+ +      +  ++
Sbjct  35   EFLGTHNKARAAVGVAPLKWNTTLADHA-FDIAWSMITDEMGECQDSLDPKSLHATAYDF  93

Query  407  GSNQMLSD-GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCS  583
            GS  M  D   +VT     E WV  K +YNYA N CV     C SYTQVVW+KSLELGC 
Sbjct  94   GSYNMHWDHNQSVTSGRVVERWVAMKKYYNYARNSCVRNF-NCASYTQVVWRKSLELGCD  152

Query  584  QATCPKGQ-IT--LTICFYNPPGNTVGEKPY  667
            Q  C     IT  +TIC Y+PPGN  GEKPY
Sbjct  153  QVRCLVSVGITNGVTICVYSPPGNIPGEKPY  183



>ref|XP_010048670.1| PREDICTED: pathogenesis-related protein PR-1 [Eucalyptus grandis]
Length=168

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 74/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN AR  + + PLTW  +LAT AG     +R  Q+C     S G YG N     G
Sbjct  35   QFLAPHNAARTAIRMPPLTWDSRLATYAGWWAAQRR--QDCDLRH-SNGPYGENIFWGSG  91

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T   P  A   W  ++ +Y+Y +N C  G   C  YTQ+VW+ +  +GC+   C K   T
Sbjct  92   TGWNPGQAVAAWASERRWYDYRSNACAEGQ-MCGHYTQIVWRSTRRVGCAVVVCFKDGGT  150

Query  614  LTICFYNPPGNTVGEKPY  667
              +C Y+PPGN +GE+PY
Sbjct  151  FMVCEYDPPGNYIGERPY  168



>emb|CAA30017.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAEGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVNEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C Y+PPGN  GE PY
Sbjct  152  VT-CNYDPPGNYRGESPY  168



>ref|XP_006401187.1| hypothetical protein EUTSA_v10014709mg [Eutrema salsugineum]
 gb|ESQ42640.1| hypothetical protein EUTSA_v10014709mg [Eutrema salsugineum]
Length=204

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 76/138 (55%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  KLA+ A      +R   +CS  + S G YG N     G
Sbjct  71   QFLDPHNALRSGLGLSPLVWDGKLASYATWWANQRR--YDCS-LTHSTGPYGENLFWGSG  127

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            ++  P  A ++WV + S YNY  N C  G+  C  YTQ+VW+ +  LGC+   C  G   
Sbjct  128  SSWAPEFAVQSWVVEGSSYNYNTNSC-DGNGMCGHYTQMVWRDTKRLGCASVVCENGAGV  186

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  187  FITCNYDPPGNYVGEKPY  204



>emb|CAA36790.1| unnamed protein product [Nicotiana tabacum]
Length=184

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A     Y            S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQ---NYASQLAADCMLVHSHGQYGENLAWGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++A C  G   
Sbjct  93   DFMTAAKAVEMWVNEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARAQCNSGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN VG+ PY
Sbjct  152  VS-CNYDPPGNFVGQSPY  168



>ref|NP_188603.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 dbj|BAB02556.1| pathogenesis-related protein-like [Arabidopsis thaliana]
 gb|ABN04774.1| At3g19690 [Arabidopsis thaliana]
 gb|AEE76276.1| putative pathogenesis-related protein [Arabidopsis thaliana]
Length=161

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 83/141 (59%), Gaps = 10/141 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL+ HN+AR +VG+DPL W  ++A  A      QR N +C+    S G +G N  +S G
Sbjct  28   QFLEAHNEARNEVGLDPLVWDDEVAAYAASYAN-QRIN-DCALVH-SNGPFGENIAMSSG  84

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR---CRSYTQVVWKKSLELGCSQATCPKG  604
              ++   AAE W+ +K +Y+Y +N C    P    C  YTQVVWK ++ LGC++  C  G
Sbjct  85   E-MSAEDAAEMWINEKQYYDYDSNTC--NDPNGGTCLHYTQVVWKNTVRLGCAKVVCNSG  141

Query  605  QITLTICFYNPPGNTVGEKPY  667
              T   C Y+PPGN +GEKP+
Sbjct  142  G-TFITCNYDPPGNYIGEKPF  161



>ref|WP_035693568.1| hypothetical protein, partial [Azospirillum halopraeferens]
Length=135

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 74/138 (54%), Gaps = 6/138 (4%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLAT-AAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
             +  HN  RA+VGV PL WS  LA  A G      R  + C+    SG  YG N   + G
Sbjct  3    IVAAHNAVRAEVGVPPLEWSQDLADRAQGWADTLGR--RGCAMEHSSGSGYGENLAWASG  60

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++PR   E W  ++  Y+YA N C  G   C  YTQVVW  +  +GC +ATC  G+  
Sbjct  61   ATMSPREVVERWAAERRHYDYAANACAPGEV-CGHYTQVVWDSTRRVGCGKATC--GREE  117

Query  614  LTICFYNPPGNTVGEKPY  667
            + +C Y+PPGN +G KPY
Sbjct  118  VWVCNYDPPGNIIGRKPY  135



>ref|XP_008382391.1| PREDICTED: pathogenesis-related protein 1A-like [Malus domestica]
Length=166

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 77/138 (56%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN+ARA+VGV P+ W+    T A    +Y            S G YG N     G
Sbjct  34   DFIDEHNKARAEVGVGPIKWN---ETVAAYAQKYADSKIETCEMVHSQGPYGENLAEGWG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            + +T   A + WV +K  Y+Y +N C AG   C  YTQVVW+ S  +GC++A C  G I 
Sbjct  91   SEMTGGQAVKFWVTEKPDYDYDSNSCTAGKV-CGHYTQVVWRNSTRVGCARAKCKNGMI-  148

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +GE+PY
Sbjct  149  FVICSYDPPGNWIGERPY  166



>ref|XP_004136927.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004155418.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43832.1| hypothetical protein Csa_7G070253 [Cucumis sativus]
Length=164

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 80/142 (56%), Gaps = 13/142 (9%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLS--  427
            +FLD HN ARA  GV+P+ W   +A+ A L+   QR N +CS    SGG YG N      
Sbjct  32   DFLDAHNTARAQDGVEPVQWDETVASFA-LQYANQRIN-DCSLVH-SGGPYGENIAWGMP  88

Query  428  --DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPK  601
               GTA     A E WV +K FY+Y +N C A    C  YTQVVW+ S+ +GC++  C  
Sbjct  89   DLSGTA-----AVEMWVNEKEFYDYGSNTCAASR-VCGHYTQVVWRNSVRIGCAKVICTN  142

Query  602  GQITLTICFYNPPGNTVGEKPY  667
               T   C Y+PPGN VG++PY
Sbjct  143  NGGTFITCNYDPPGNFVGQRPY  164



>ref|XP_009138206.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=163

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HNQARA VGVDPL W   +A  A      +R +    ++S   G YG N   S G
Sbjct  32   DFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSS---GPYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +++ Y+Y +N C +G  +C  YTQ+VWK S  LGC++ +C  GQ T
Sbjct  89   D-MSGVEAVNMWVNEQADYDYGSNTCASGK-QCGHYTQIVWKNSARLGCAKVSCDNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN VGE PY
Sbjct  146  FITCNYDPQGNIVGEWPY  163



>emb|CAA29023.1| PR-1c protein [Nicotiana tabacum]
Length=161

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  29   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAWGSG  85

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y + +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  86   DFLTAAKAVEMWVNEKQYYAHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYI  144

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ PY
Sbjct  145  VS-CNYDPPGNVIGKSPY  161



>ref|XP_007014137.1| STS14 protein, putative [Theobroma cacao]
 gb|EOY31756.1| STS14 protein, putative [Theobroma cacao]
Length=166

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 76/138 (55%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL   N ARA + V PL W  +LA  A      +R  ++C+    S G YG N     G
Sbjct  33   QFLAPQNAARAAIRVRPLVWDARLARYAQWYANQRR--KDCALRH-SNGPYGENIFWGSG  89

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               TP  AA  WV ++ +YNY +N C AG   C  YTQ+VW ++  +GC++ TC  G+  
Sbjct  90   NGWTPAQAAVAWVSERKWYNYWSNSC-AGGEECGHYTQIVWSRTRRVGCARVTCDGGRGV  148

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN +GE+PY
Sbjct  149  FMTCNYDPPGNYIGERPY  166



>ref|XP_006413271.1| hypothetical protein EUTSA_v10026254mg [Eutrema salsugineum]
 gb|ESQ54724.1| hypothetical protein EUTSA_v10026254mg [Eutrema salsugineum]
Length=207

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R  +G+ PL W  K+A+ A      +R   +CS  + S G YG N     G
Sbjct  75   QFLDPHNSVRTSLGLSPLVWDDKIASYATWWADQRR--YDCS-LTHSTGPYGENLFWGSG  131

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  TP  A E+W  +   YNY  N C  G   C  YTQ+VW+ +  LGC++  C  G   
Sbjct  132  SDWTPTFAVESWTVEAKSYNYMTNTCEGG--MCGHYTQIVWRDTKRLGCARVVCENGAGV  189

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE PY
Sbjct  190  FITCNYDPPGNYVGENPY  207



>ref|XP_008237375.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Prunus mume]
Length=172

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 78/141 (55%), Gaps = 8/141 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +FL VHN AR  +G+ PL W  KLA  A    R+  + +  S   +  S G YG N    
Sbjct  37   DFLRVHNNARKQIGLPPLEWDVKLAEFA----RHYANLRAVSGCGMIHSNGPYGENIFWG  92

Query  428  DGTAV-TPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKG  604
             G  +   R A ++W  +K FYN+  N CV G   C  YTQ+VWK +  +GC++A C  G
Sbjct  93   GGKQLWGGRFAVKSWSHEKKFYNHKTNSCVPGQ-MCGHYTQIVWKDTKRVGCARAACTNG  151

Query  605  QITLTICFYNPPGNTVGEKPY  667
               L +C Y+PPGN +GEKPY
Sbjct  152  GGQLIVCNYDPPGNWLGEKPY  172



>ref|XP_006845767.1| hypothetical protein AMTR_s00019p00250630 [Amborella trichopoda]
 gb|ERN07442.1| hypothetical protein AMTR_s00019p00250630 [Amborella trichopoda]
Length=158

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 74/138 (54%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
             FLD HNQARA VGV PL W P LAT A  +V   +   +C     +   +G N     G
Sbjct  26   HFLDSHNQARAKVGVPPLKWEPLLATYA--RVYSNQRRGDCQLIHSTSPYFGENIFWGQG  83

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  + R A E WV+++  Y+Y  N C    P C  YTQ+VW+ +  +GC++  C  G  T
Sbjct  84   SHWSARDAVEAWVREEQDYHYETNTCSG--PDCTHYTQLVWRNTQMVGCAKIICNSGD-T  140

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y PPGN VG +PY
Sbjct  141  FVTCEYYPPGNYVGSRPY  158



>emb|CAA31010.1| PR1c preprotein [Nicotiana tabacum]
Length=163

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  31   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAWGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y + +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  88   DFLTAAKAVEMWVNEKQYYAHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYI  146

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ PY
Sbjct  147  VS-CNYDPPGNVIGKSPY  163



>emb|CDO97325.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 82/139 (59%), Gaps = 7/139 (5%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +++D HN ARA VGV P+ W   +A  A      QR N +C+    SGG YG N  L++G
Sbjct  30   DYVDAHNAARAQVGVGPIAWDDTVAAYA-QNYANQRIN-DCNLVH-SGGRYGEN--LAEG  84

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            +  +T R A   WV +K +Y+Y +N C  G  +C  YTQVVW+ S+ LGC++  C     
Sbjct  85   SGDLTGRDAVNLWVSEKQYYDYNSNTCAQGQ-QCGHYTQVVWRDSVRLGCARVQCTNNGW  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN VG++PY
Sbjct  144  WFVICSYDPPGNYVGQRPY  162



>ref|XP_010904546.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=163

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F++ HN ARA VGV P++W+   A AA  +    +   +C     S G YG N     G
Sbjct  30   DFINPHNAARAAVGVGPVSWND--AVAAYAQDYANKRKADCQLVH-SNGPYGENIFWGGG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T  +A  +WV ++ +Y+YA+N C  G   C  YTQVVW KS+ +GC++  C  G  T
Sbjct  87   PGWTATVAVNDWVSERQYYDYASNSCAVGQ-VCGHYTQVVWAKSVHIGCARVACDNGD-T  144

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE+PY
Sbjct  145  FITCNYDPPGNYVGERPY  162



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L+ HN ARA VGV P+TW   +A  A    RY            SGG YG N  L++G
Sbjct  30   DYLNAHNAARAQVGVGPMTWDNNVAAYAQ---RYASSRMGDCNLVHSGGPYGEN--LAEG  84

Query  434  TAVTPRMAAEN-WVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
                   A  N WV +K +Y+Y +N CV G   CR YTQVVW+ S+ LGC++  C     
Sbjct  85   NGSFTGTAGVNLWVGEKPYYDYNSNSCV-GRKECRHYTQVVWRNSVRLGCARVQCTNNGW  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN +G++PY
Sbjct  144  WFVICSYDPPGNYIGQRPY  162



>ref|XP_010266628.1| PREDICTED: pathogenesis-related protein 1A-like [Nelumbo nucifera]
Length=162

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 6/137 (4%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            +LD HN ARA+VGVD LTW   +A  A      + D+  C+    SG  YG N   S G+
Sbjct  32   YLDAHNAARAEVGVDALTWDDTVAAYAQSYANKRADD--CTRVH-SGEPYGENLAGSTGS  88

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
             ++   A   WV +K +Y++ +N C+ G   CR YTQVVW+KS  +GC++  C  G  T 
Sbjct  89   -LSATDAVNLWVGEKQYYDHNSNSCI-GEQECRHYTQVVWRKSFRVGCAKVQCNNGG-TF  145

Query  617  TICFYNPPGNTVGEKPY  667
             IC Y+P GN VGE PY
Sbjct  146  VICNYDPAGNVVGELPY  162



>ref|XP_002272115.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN62956.1| hypothetical protein VITISV_018198 [Vitis vinifera]
Length=161

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +++D HN ARA VGV P+TW+  +A  A  +    R    CS  + SGG YG N     G
Sbjct  29   DYVDAHNAARAQVGVQPITWNETVAAYA-RRYASSRVAARCSMEN-SGGPYGENLAKVYG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T+V+   A E WV +K  Y+Y +N CV G   C  YTQ+VW  SL LGC+   C  G   
Sbjct  87   TSVSGSDAVEFWVTEKPNYDYNSNSCVGG--ECLHYTQIVWGDSLYLGCASVHCKNGWWF  144

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C Y+PPGN  G++PY
Sbjct  145  IT-CNYHPPGNMEGQRPY  161



>ref|XP_009769213.1| PREDICTED: pathogenesis-related protein 1C [Nicotiana sylvestris]
 sp|P09042.3|PR1C_TOBAC RecName: Full=Pathogenesis-related protein 1C; Short=PR-1C; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35666.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAWGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y + +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFLTAAKAVEMWVNEKQYYAHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYI  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G+ PY
Sbjct  152  VS-CNYDPPGNVIGKSPY  168



>ref|XP_002522065.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40265.1| STS14 protein precursor, putative [Ricinus communis]
Length=161

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++++ HN ARA VGV P+TW     T A     Y     N      SGG YG N   S G
Sbjct  30   DYINAHNAARAAVGVGPMTWDN---TVAAYAQNYANQRINDCRLVHSGGRYGENIAWSSG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+FYNY +N C AG  +C  YTQVVW+ S+ LGC++  C  G  T
Sbjct  87   D-LSGTAAVKLWVDEKAFYNYNSNTCAAGQ-QCGHYTQVVWRNSVRLGCAKVRCRNGG-T  143

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN V ++PY
Sbjct  144  FITCNYDPPGNFVNQRPY  161



>emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum]
Length=165

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  33   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAEGSG  89

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  90   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYV  148

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN  GE PY
Sbjct  149  VS-CNYDPPGNYRGESPY  165



>gb|AEL99925.1| pathogenesis-related protein 1 [Nicotiana benthamiana]
Length=160

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  28   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAEGSG  84

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  85   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYV  143

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN  GE PY
Sbjct  144  VS-CNYDPPGNYRGESPY  160



>ref|XP_008653595.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Zea mays]
 tpg|DAA59478.1| TPA: hypothetical protein ZEAMMB73_506198 [Zea mays]
Length=169

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 76/139 (55%), Gaps = 5/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML-SD  430
            + +D+HN ARADVGV P++W+  LAT A     Y    Q+      S G YG N    + 
Sbjct  35   DVVDLHNAARADVGVKPVSWNNSLATYAE---SYAETRQDDCQLKFSDGPYGENLFWGAA  91

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            GT  T       WV QK +Y++A+N C AG  +C +YTQVVW+ +  +GC+   C     
Sbjct  92   GTNWTAADVVGLWVAQKQYYDHASNTCAAGK-KCGAYTQVVWRGTTSIGCAAVVCSNEGG  150

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC YNPPGN  G+ PY
Sbjct  151  VFAICSYNPPGNLDGQSPY  169



>ref|XP_001784190.1| predicted protein [Physcomitrella patens]
 gb|EDQ50988.1| predicted protein [Physcomitrella patens]
Length=149

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 73/138 (53%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL  HN AR DVGVD L WS +L   A    + QRD  +C   + S G YG N     G
Sbjct  16   EFLTPHNNARKDVGVDALVWSKELEDYARSYAQSQRD--SCLPLTHSNGNYGENLFWGSG  73

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               TP  A   W  +K  YNY  N C A +  C  YTQVVW  +  +GC+   C    I 
Sbjct  74   QNWTPFEAVTAWNDEKVDYNYNTNTC-APNKVCGHYTQVVWNTTTHVGCASEMCSDDGIY  132

Query  614  LTICFYNPPGNTVGEKPY  667
            + IC Y+PPGN +GEKP+
Sbjct  133  I-ICSYDPPGNWIGEKPH  149



>gb|AID60095.1| CAP superfamily protein [Brassica napus]
 emb|CDX75376.1| BnaA01g03260D [Brassica napus]
Length=174

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HNQARA+VGV PL W  ++A  A      QR +  CS    SGG YG N     G
Sbjct  32   DFLAAHNQARAEVGVGPLRWDNQVAAYARNHAN-QRKSVGCSMEHSSGGPYGENIAWGSG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A E WV+++  Y+Y +N C A +  C  YTQVVW+ S++LGC++  C  G  T
Sbjct  91   N-LSGVEAVEMWVKEQFDYDYDSNTC-AWNQVCGHYTQVVWENSVKLGCAKVRCNNGN-T  147

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE PY
Sbjct  148  FITCNYDPPGNWVGEWPY  165



>ref|XP_009346545.1| PREDICTED: pathogenesis-related protein 1A-like [Pyrus x bretschneideri]
Length=166

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN+ARA+VGV P+ W+    T A    +Y            S G YG N     G
Sbjct  34   DFIDEHNKARAEVGVGPIKWN---ETVAAYAQKYADSKIETCEMVHSQGPYGENLAEGWG  90

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            + +T   A + WV +K  Y+Y +N C AG   C  YTQVVW+ S  +GC++A C K  + 
Sbjct  91   SEMTSGQAVKFWVTEKPDYDYDSNSCTAGKV-CGHYTQVVWRNSTRVGCARAKC-KNDMI  148

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +GE+PY
Sbjct  149  FVICSYDPPGNWIGERPY  166



>sp|P08299.1|PR1A_TOBAC RecName: Full=Pathogenesis-related protein 1A; Short=PR-1A; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA31233.1| unnamed protein product [Nicotiana tabacum]
 emb|CAA29392.1| PR-1a precursor (AA -30 to 138) [Nicotiana tabacum]
 emb|CAA29660.1| PR1a precursor (AA -30 to -1) [Nicotiana tabacum]
Length=168

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAEGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN  GE PY
Sbjct  152  VS-CNYDPPGNYRGESPY  168



>ref|XP_004146301.1| PREDICTED: pathogenesis-related protein PR-1-like [Cucumis sativus]
 ref|XP_004171071.1| PREDICTED: pathogenesis-related protein PR-1-like [Cucumis sativus]
 gb|KGN65424.1| hypothetical protein Csa_1G420610 [Cucumis sativus]
Length=170

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 74/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN AR  + + PL W PKLA  A      +R +    +   SGG YG N     G
Sbjct  37   QFLAPHNAARYALRLSPLVWDPKLARYAQSYANKRRGDCALRH---SGGPYGENIFWGSG  93

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               TP  A  +WV ++ +Y+Y  N CV G   C  YTQ+VW+ +  +GC++ TC  G+  
Sbjct  94   KDWTPAQAVADWVSERKWYSYWANSCVEGE-LCGHYTQIVWRSTRRIGCARVTCNDGKGV  152

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN +G +PY
Sbjct  153  FITCNYDPPGNYIGMRPY  170



>gb|AHE81273.1| pathogenesis-related protein 1-9, partial [Triticum aestivum]
Length=162

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARADVGV P+TW   +A  A      +R +    + +  G  YG N     G
Sbjct  25   DFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIH-TPDGRPYGENLFGGSG  83

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGH-PRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            T  T   A  +WV +K +Y++ +N C A     C  YTQVVW+ S  +GC++  C     
Sbjct  84   TQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVCDSSDD  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC YNPPGN VG+ PY
Sbjct  144  VFIICSYNPPGNYVGQSPY  162



>gb|AHE81252.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARADVGV P+TW   +A  A      +R +    + +  G  YG N     G
Sbjct  29   DFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIH-TPDGRPYGENLFGGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGH-PRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            T  T   A  +WV +K +Y++ +N C A     C  YTQVVW+ S  +GC++  C     
Sbjct  88   TQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVCDSSDD  147

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC YNPPGN VG+ PY
Sbjct  148  VFIICSYNPPGNYVGQSPY  166



>ref|XP_009138211.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=163

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HNQARA VGVDPL W   +A  A      +R +    ++S   G YG N   S G
Sbjct  32   DFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSS---GPYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +++ Y+Y +N C +G  +C  YTQ+VWK S+ LGC++ +C  GQ T
Sbjct  89   D-MSGVEAVNMWVNEQADYDYGSNTCASGK-QCGHYTQIVWKNSVRLGCAKVSCDNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN VG+ PY
Sbjct  146  FITCNYDPQGNFVGQWPY  163



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+  HN ARA VGV  ++W     T A     Y            SGG YG N     G
Sbjct  30   DFVSAHNAARAAVGVGSVSWDD---TVAAYAQNYANQRIGDCQLKHSGGPYGENLFWGSG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T   A ++WV +K +Y+Y  N C +GH +C  YTQVVW+ S  +GC++  C  G I 
Sbjct  87   ADFTAADAVKSWVDEKQWYDYNTNTCASGH-QCGHYTQVVWRDSTNIGCARVKCNSGAI-  144

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y PPGN VG++PY
Sbjct  145  FIICNYKPPGNIVGQRPY  162



>gb|AEH25624.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARADVGV P+TW   +A  A      +R +    + +  G  YG N     G
Sbjct  29   DFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIH-TPDGRPYGENLFGGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGH-PRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            T  T   A  +WV +K +Y++ +N C A     C  YTQVVW+ S  +GC++  C     
Sbjct  88   TQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVCDSSDD  147

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC YNPPGN VG+ PY
Sbjct  148  VFIICSYNPPGNYVGQSPY  166



>ref|XP_010265476.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Nelumbo 
nucifera]
Length=175

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 76/138 (55%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN+ RA +G+ PL WS KLA+ A      +RD+  C+    S   YG N     G
Sbjct  42   QYLSSHNRERAKLGLRPLQWSEKLASYANQWANQRRDD--CALIH-SNSNYGENIFWGSG  98

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                   A + W  +K +YNY +N CV  H  C  YTQ++WK+SL +GC + TC  G  T
Sbjct  99   RDWKSADAVKEWAAEKQYYNYQSNRCVQNHD-CLHYTQIIWKQSLYVGCGRVTCRSGD-T  156

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN +G+KP+
Sbjct  157  FITCNYDPHGNVIGQKPF  174



>ref|XP_002273199.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI25090.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +++D HN ARA VGV P+ W+  +A  A  +    R   +CS  + SGG YG N     G
Sbjct  29   DYVDAHNAARAQVGVQPIAWNETVAAYA-RRYASSRVAAHCSLEN-SGGPYGENLAKVYG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T+V+   A E WV +K  Y+Y +N CV G   C  YTQ+VW  SL LGC+   C  G   
Sbjct  87   TSVSGSDAVEFWVTEKPNYDYNSNSCVGG--ECLHYTQIVWGDSLYLGCASVHCKNGWWF  144

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C Y+PPGN  G++PY
Sbjct  145  IT-CNYHPPGNMEGQRPY  161



>ref|XP_006408913.1| hypothetical protein EUTSA_v10002159mg [Eutrema salsugineum]
 gb|ESQ50366.1| hypothetical protein EUTSA_v10002159mg [Eutrema salsugineum]
Length=177

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 76/138 (55%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E L VHN+ARA VGV P+ W+  LAT A  +   Q   ++C+    S G YG N     G
Sbjct  44   ETLAVHNKARALVGVGPMAWNETLATYA--QSYAQERARDCAMKH-SSGPYGENLAAGWG  100

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T   P +A E W+ +K  Y+Y  N C  G   C  YTQ+VW+ S+ LGC    C   +  
Sbjct  101  TMSGP-VATEYWMTEKENYDYDTNTCGGGDGVCGHYTQIVWRDSVRLGCGSVRCKNDEYI  159

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +G++PY
Sbjct  160  WVICSYDPPGNYIGQRPY  177



>ref|XP_006486819.1| PREDICTED: pathogenesis-related protein 1-like, partial [Citrus 
sinensis]
Length=154

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN+ARA V + P+ W  K+A  A     Y    +       SGG YG N   S G
Sbjct  23   DYLRAHNEARASVRIGPMRWDNKVAAYAQ---NYANQRKADCRLVHSGGPYGENLAWSSG  79

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A + WV ++  YNY +N CV G   CR YTQVVW  S+ LGC++  C   + T
Sbjct  80   D-LTGTAAVKLWVDERPKYNYNSNTCVGGE--CRHYTQVVWHNSVRLGCARVKCNNNRGT  136

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN  G++PY
Sbjct  137  FVICSYDPPGNVAGKRPY  154



>ref|XP_009803803.1| PREDICTED: pathogenesis-related protein 1C-like [Nicotiana sylvestris]
Length=184

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A     Y            S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQ---NYASQLAADCMLVHSHGQYGENLAWGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVNEKQYYDHDSNTCAQGQV-CGHYTQVVWRNSVRVGCARVQCNDGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN VG+ PY
Sbjct  152  VS-CNYDPPGNFVGQSPY  168



>ref|XP_010448371.1| PREDICTED: pathogenesis-related protein PR-1-like [Camelina sativa]
Length=208

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  K+A+ A      +R   +CS  + S G YG N     G
Sbjct  75   QFLDPHNTVRSGLGLPPLVWDEKIASYAAWWANQRR--YDCS-MTHSTGPYGENLFWGSG  131

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  TP  A E+W  +   YN+  N C  G   C  YTQ+VW+++  LGC++  C  G   
Sbjct  132  SDFTPTFAVESWTVEAQSYNHMTNSC-EGSGMCGHYTQIVWRETRLLGCARVVCENGAGV  190

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  191  FITCNYDPPGNYVGEKPY  208



>emb|CDY68552.1| BnaCnng59490D [Brassica napus]
Length=207

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 75/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  KLA+ A      +R   +CS  + S G YG N     G
Sbjct  74   QFLDPHNAIRSRLGLPPLVWDGKLASYATWWANQRR--YDCS-MTHSTGSYGENLFWGSG  130

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            ++  P  A ++WV + S YNY  N C  G   C  YTQ+VW+ +  LGC+   C  G   
Sbjct  131  SSWAPGFAVQSWVVEGSSYNYNTNSC-DGSGMCGHYTQIVWRDTKRLGCASVVCENGAGV  189

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  190  FITCNYDPPGNYVGEKPY  207



>gb|AEQ33601.1| pathogenesis-related protein 1a [Malus domestica]
Length=148

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 81/140 (58%), Gaps = 10/140 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            ++L  HN ARA VGV PLTW  K+A   G    Y   NQ+    +L  SGG YG N  +S
Sbjct  17   DYLKSHNDARAAVGVGPLTWDDKVA---GYAQNYA--NQHVGDCNLVHSGGPYGENLAMS  71

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G  ++   A + WV +K+ Y+Y +N C  G   C  YTQVVW+KS  +GC++  C  G 
Sbjct  72   TGD-MSGTAAVDMWVAEKADYSYESNSCADG-KVCGHYTQVVWRKSARVGCAKVRCSSGG  129

Query  608  ITLTICFYNPPGNTVGEKPY  667
             T   C Y+PPGN VGEKPY
Sbjct  130  -TFIGCNYDPPGNYVGEKPY  148



>ref|XP_010270273.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nelumbo 
nucifera]
Length=167

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L+ HN ARA VGV P+ W   +A  A  +    +  ++C+     GG YG N     G
Sbjct  30   DYLNAHNAARAQVGVGPMRWDNNVAAYA--RNYANQRIRDCNLVHSGGGLYGENLAKGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
             A T   A   WV++K FY+Y +N C+ G  +C  YTQVVW+ S+ LGC++  C  G   
Sbjct  88   -AFTGVDAVNLWVKEKPFYDYNSNSCIGG--QCLHYTQVVWRDSVRLGCARVRCNNGWFF  144

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C Y+PPGN +GE+PY
Sbjct  145  VT-CNYDPPGNFIGERPY  161



>dbj|BAA14220.1| PR1a protein precursor [Nicotiana tabacum]
 prf||1501385A pathogenesis related protein PR1a
Length=168

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAEGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW+ S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVDEKQYYDHDSNTCSQGQV-CGHYTQVVWRNSVRVGCARVQCNNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN  GE PY
Sbjct  152  VS-CNYDPPGNYRGESPY  168



>ref|XP_008364362.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Malus domestica]
Length=173

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 71/139 (51%), Gaps = 4/139 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL VHN  R  +G+ PL W  KLA  A +  +  R   +C     S G YG N     G
Sbjct  38   EFLKVHNNVRWKIGLPPLQWDEKLAAVARVYTK-TRATIDCRMVH-SMGRYGENIFWGGG  95

Query  434  T-AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
                  R A  +W  +K FY+Y  N C  G   C  YTQ+VWK +  LGC++  C  G  
Sbjct  96   KQPWGARFAVNSWSHEKLFYDYKTNSCKPGQ-MCGHYTQMVWKDTKRLGCAREVCSNGAG  154

Query  611  TLTICFYNPPGNTVGEKPY  667
             L IC Y+PPGN  GEKPY
Sbjct  155  ELVICNYDPPGNWAGEKPY  173



>ref|XP_009388943.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 74/140 (53%), Gaps = 9/140 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +F+D HN ARA VGV P++W   +A  A         NQ      L  SGG YG N    
Sbjct  30   DFVDAHNSARAAVGVGPVSWDDNVAAYA-----QNYANQRIGDCQLVHSGGPYGENLFGG  84

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
              T  T   A  +WV +K +Y+Y +N C  G   C  YTQVVW+ S  +GC++  C  G 
Sbjct  85   SSTEFTGIDAVNSWVDEKQYYDYDSNSCADGQV-CGHYTQVVWQDSTAIGCARVQCDNGG  143

Query  608  ITLTICFYNPPGNTVGEKPY  667
            I   IC YNP GN VGE+PY
Sbjct  144  I-FIICNYNPAGNIVGERPY  162



>emb|CDP02944.1| unnamed protein product [Coffea canephora]
Length=168

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL   N ARA + + PL W   LA  A      +R +  C+    S G YG N     G
Sbjct  35   QFLATQNAARAALRMRPLVWDANLARYAQSYANQRRFD--CALRH-SDGPYGENIFWGSG  91

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T  +P  AA  WV +K +YNY +N C  G   C  YTQ+VW+++  +GC++ TC  G+  
Sbjct  92   TGWSPAQAAAAWVVEKKWYNYWSNSCALGQ-ECGHYTQIVWRQTTRIGCARVTCFGGRGV  150

Query  614  LTICFYNPPGNTVGEKPY  667
               C YNPPGN +GE+PY
Sbjct  151  FMTCNYNPPGNYIGERPY  168



>ref|XP_009397726.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Musa acuminata 
subsp. malaccensis]
Length=240

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 76/136 (56%), Gaps = 4/136 (3%)
 Frame = +2

Query  260  LDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTA  439
            +D HN ARA VGV P++W   +A+ A  K   +R   +C     SGG YG N     G+A
Sbjct  82   VDAHNSARAAVGVGPVSWDDDIASYAQ-KFANKRVT-DCQLVH-SGGPYGENLFWGTGSA  138

Query  440  VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLT  619
             T   A   W+ +K +Y+Y NN C  G   CR YTQVVW+ +  +GC++  C  G     
Sbjct  139  FTLTDAVNTWIAEKQYYDYENNSCADGQV-CRHYTQVVWQNTTAIGCARTQCSDGNGIFI  197

Query  620  ICFYNPPGNTVGEKPY  667
            +C Y+P GN VG++PY
Sbjct  198  LCDYSPAGNLVGQRPY  213



>ref|XP_009138212.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
 emb|CDY49368.1| BnaA03g50570D [Brassica napus]
Length=163

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HNQARA VGVDPL W   +A  A      +R +    ++S   G YG N   S G
Sbjct  32   DFLDAHNQARAAVGVDPLAWDETVAAYAHDYANQRRGDCALEHSS---GPYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +++ Y+Y +N C +G  +C  YTQ+VWK S  LGC++ +C  GQ T
Sbjct  89   D-MSGVEAVNMWVSEQADYDYGSNTCASGK-QCGHYTQIVWKNSARLGCAKVSCDNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN VG+ PY
Sbjct  146  FITCNYDPQGNFVGQWPY  163



>ref|XP_009798466.1| PREDICTED: pathogenesis-related protein 1A [Nicotiana sylvestris]
Length=168

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARADVGV+PLTW  ++A  A         + N  +   S G+YG N     G
Sbjct  36   DYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVH---SHGQYGENLAEGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A E WV +K +Y++ +N C  G   C  YTQVVW  S+ +GC++  C  G   
Sbjct  93   DFMTAAKAVEMWVDEKQYYDHDSNTCAQGQV-CGHYTQVVWHNSVRVGCARVQCNNGGYV  151

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN  GE PY
Sbjct  152  VS-CNYDPPGNYRGESPY  168



>ref|XP_002965160.1| hypothetical protein SELMODRAFT_28101, partial [Selaginella moellendorffii]
 gb|EFJ33998.1| hypothetical protein SELMODRAFT_28101, partial [Selaginella moellendorffii]
Length=144

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 76/146 (52%), Gaps = 10/146 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVG----VDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQM  421
            +FLD HN ARA V     + PL+WS   A  A   +   RD +NC         YG N  
Sbjct  1    DFLDAHNSARASVSTSPRIPPLSWSTDAAAFATQWITSLRDTKNCGLVHSGNRAYGENLY  60

Query  422  LSDGTA----VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQA  589
               G+       P  A ++WV +++ Y YA N C AG   C  YTQVVW+ +  +GC+  
Sbjct  61   KWQGSPGLPPPNPAEAVKSWVSERTDYTYATNSCAAGK-VCGHYTQVVWRNTQRVGCASI  119

Query  590  TCPKGQITLTICFYNPPGNTVGEKPY  667
            TCP G   L  C Y+PPGN VG+KPY
Sbjct  120  TCP-GNALLVSCNYDPPGNWVGQKPY  144



>ref|XP_010438832.1| PREDICTED: pathogenesis-related protein PR-1-like [Camelina sativa]
Length=209

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  K+A+ A      +R   +CS  + S G YG N     G
Sbjct  76   QFLDPHNTVRSGLGLPPLVWDGKIASYAAWWANQRR--YDCS-LTHSTGPYGENLFWGSG  132

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  TP  A E+W  +   YN+  N C  G   C  YTQ+VW+++  LGC++  C  G   
Sbjct  133  SDFTPTFAVESWTVEAQSYNHMTNSC-EGSGMCGHYTQIVWRETRLLGCARVVCENGAGV  191

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  192  FITCNYDPPGNYVGEKPY  209



>gb|AFK93502.1| pathogenesis related protein 1 isoform 3, partial [Ficus pumila 
var. awkeotsang]
Length=152

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN+ARA VGVD +TW   +A  A  +    R   +C      GG YG N     G
Sbjct  13   DFLAPHNRARAQVGVDAITWDESVAAYA--RDYANRRRGDCKLIHF-GGPYGENVAWGSG  69

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +KS Y+Y +N C+     C  YTQVVW+KS  LGC++  C  G  T
Sbjct  70   D-LSAASAVGMWVAEKSLYDYNSNKCIGDAWGCLHYTQVVWRKSTRLGCAKVRCTSGG-T  127

Query  614  LTICFYNPPGNTVGEKPY  667
              IC YNPPGN  G++PY
Sbjct  128  FIICNYNPPGNYNGQRPY  145



>ref|XP_008455064.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Cucumis 
melo]
Length=164

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 79/144 (55%), Gaps = 17/144 (12%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +F++ HN ARA VGV P+ W  ++A+ A      Q  NQ  +   L  SGG YG N    
Sbjct  32   DFVNAHNAARAQVGVGPVHWDERVASFA-----RQYANQRINDCRLVHSGGPYGENIAWG  86

Query  428  ----DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATC  595
                 GTA     A + WV +K FYNY +N C AG   C  YTQVVW+ S+ +GC++  C
Sbjct  87   MPDLSGTA-----AVQMWVNEKQFYNYGSNTCAAGKV-CGHYTQVVWRNSVRIGCAKVRC  140

Query  596  PKGQITLTICFYNPPGNTVGEKPY  667
               + T  IC Y P GN +G+KPY
Sbjct  141  TNNRGTFIICNYEPRGNIIGQKPY  164



>ref|XP_011069885.1| PREDICTED: pathogenesis-related protein PR-1-like [Sesamum indicum]
Length=175

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 74/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL V N ARA + + PL W PK+A  A      +R +    +   S G YG N     G
Sbjct  42   QFLSVQNAARAALKLPPLVWDPKIARYAAWYANQRRADCELEH---SNGPYGENIFWGSG  98

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T   AA  WV ++  YNY +N CV G   C  YTQ+VWK +  +GC++  C  G+  
Sbjct  99   NRWTAAQAAAAWVSERREYNYWSNSCVYGQ-ECGHYTQIVWKDTRRMGCARVVCYGGRGV  157

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +GE+PY
Sbjct  158  FMICNYDPPGNYIGERPY  175



>ref|XP_002522071.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40271.1| STS14 protein precursor, putative [Ricinus communis]
Length=164

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV  + W   +AT A      +  + N  ++S   G YG N      
Sbjct  32   DYLDAHNAARAQVGVANIVWDNTVATYAQNYANSRIGDCNLVHSS---GSYGENLAKGSS  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +++T   A   WV +K +YNY +N C  G  +C  YTQVVW KS+ LGC++  C  G   
Sbjct  89   SSLTGTAAVNLWVAEKPYYNYTSNSCTGGQ-QCLHYTQVVWSKSVRLGCARVQCTNGWWF  147

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C Y+PPGN +G+KPY
Sbjct  148  VT-CNYDPPGNYIGQKPY  164



>ref|XP_006845590.1| hypothetical protein AMTR_s00019p00200490 [Amborella trichopoda]
 gb|ERN07265.1| hypothetical protein AMTR_s00019p00200490 [Amborella trichopoda]
Length=169

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 72/138 (52%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN ARA VG   L W  ++A  A      +RD+    +   S G YG N     G
Sbjct  36   QFLVPHNAARAAVGERQLVWDERIARYARWYAAQRRDDCALEH---SDGPYGENIFWGSG  92

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            T  TP  A + WV +  +YN  +N C  G   C  YTQ+VW+KSL LGC+   C  G+  
Sbjct  93   TGWTPSDAVQAWVGEARWYNPRSNACAYGQ-ECGHYTQMVWRKSLRLGCAVVVCDGGRGM  151

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN  GEKPY
Sbjct  152  FMTCNYDPPGNYFGEKPY  169



>ref|XP_002459308.1| hypothetical protein SORBIDRAFT_02g002130 [Sorghum bicolor]
 gb|EER95829.1| hypothetical protein SORBIDRAFT_02g002130 [Sorghum bicolor]
Length=172

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 78/137 (57%), Gaps = 9/137 (7%)
 Frame = +2

Query  266  VHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVT  445
            +HN+ARADVGV PL+W+  LAT A      ++D+ N +   LSGG YG N     G A  
Sbjct  42   LHNEARADVGVKPLSWNESLATYAANYAAARQDDCNLT---LSGGPYGENLFW--GAAGG  96

Query  446  PRMAAEN---WVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
               AA+    WV QK +Y++ +N C AG  RC SYTQVVW  +  +GC+   C       
Sbjct  97   NYSAADVVGLWVSQKQYYDHDSNTCAAGE-RCDSYTQVVWSGTTTIGCAAVECSNNAGVF  155

Query  617  TICFYNPPGNTVGEKPY  667
             IC YNPPGN  G+ PY
Sbjct  156  AICSYNPPGNLDGQSPY  172



>ref|XP_002313935.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
 gb|EEE87890.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
Length=160

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV PLTW   +   A      +  + N  +   SGG YG N   S  
Sbjct  29   DYLDAHNTARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVH---SGGPYGENIAWSSA  85

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV + ++Y+Y +N C +G  +C  YTQVVW  S+ LGC++ TC  G  T
Sbjct  86   D-LSGTDAVKMWVDEMAYYDYNSNSCASGQ-QCGHYTQVVWGNSVSLGCAKVTCSAGG-T  142

Query  614  LTICFYNPPGNTVGEKPY  667
              +C Y+PPGN VG+KPY
Sbjct  143  FIVCNYDPPGNVVGQKPY  160



>gb|KHN33603.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=161

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLDVHNQARA+VGV PL+W+  L   A    RY  +         S G +G N  L++G
Sbjct  31   DFLDVHNQARAEVGVGPLSWNHTLQAYAQ---RYANERIPDCNLEHSMGPFGEN--LAEG  85

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
               +    A + W+ +K +Y++ +N CV  H  C  YTQ+VW+ S+ LGC++A C  G +
Sbjct  86   YGEMKGSDAVKFWLTEKPYYDHYSNACV--HDECLHYTQIVWRDSVHLGCARAKCNNGWV  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN  GE+PY
Sbjct  144  -FVICSYSPPGNIEGERPY  161



>ref|XP_002522070.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40270.1| STS14 protein precursor, putative [Ricinus communis]
Length=162

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 10/140 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            ++L+ HN AR DVG+ PLTW  K+A+ A         NQ+ S  SL  S G YG N   S
Sbjct  30   DYLNAHNSARGDVGLGPLTWDDKVASYA-----QHHANQHKSDCSLVHSEGPYGENLAWS  84

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G  ++   A + W+ +K +Y+Y +N C +G   C  YTQVVW+ S+ LGC++ +C  G 
Sbjct  85   SGD-LSGTDAVKMWIDEKPYYDYNSNSCASGQ-ICGHYTQVVWRSSVRLGCAKVSCNNGG  142

Query  608  ITLTICFYNPPGNTVGEKPY  667
             T   C Y+PPGN +G++PY
Sbjct  143  -TFIGCNYDPPGNYIGQRPY  161



>emb|CDY49367.1| BnaA03g50560D [Brassica napus]
Length=163

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HNQARA VGVDPL W   +A  A      +R +    ++S   G YG N   S G
Sbjct  32   DFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRRGDCALEHSS---GPYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   WV +++ Y+Y +N C +G  +C  YTQ+VWK ++ LGC++ +C  GQ T
Sbjct  89   D-MSGVEAVNMWVNEQADYDYGSNTCASGK-QCGHYTQIVWKNTVRLGCAKVSCDNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN VG+ PY
Sbjct  146  FITCNYDPQGNFVGQWPY  163



>gb|AFM76999.1| pathogenesis related protein 1a, partial [Pyrus communis]
Length=153

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 80/140 (57%), Gaps = 10/140 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            ++L+ HN ARA VGV PLTW   +A   G    Y   NQ+    SL  SGG YG N  +S
Sbjct  22   DYLNSHNTARAAVGVGPLTWDDNVA---GYAQNYA--NQHVGDCSLVHSGGPYGENLAMS  76

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G  ++   A + WV +K+ YNY +N C  G   C  YTQVVW+ S  +GC++  C  G 
Sbjct  77   TGD-MSGTAAVDLWVAEKADYNYESNSCADG-KVCGHYTQVVWRNSARVGCAKVRCSSGG  134

Query  608  ITLTICFYNPPGNTVGEKPY  667
             T   C Y+PPGN VGEKPY
Sbjct  135  -TFIGCNYDPPGNYVGEKPY  153



>ref|XP_009132116.1| PREDICTED: pathogenesis-related protein PR-1-like [Brassica rapa]
 emb|CDX88632.1| BnaA03g10170D [Brassica napus]
Length=205

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 73/138 (53%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  KLA  A      +R   +CS    S G YG N     G
Sbjct  72   QFLDPHNALRSRLGLPPLVWDSKLANYAKWWANQRR--YDCSLTH-STGPYGENLFWGSG  128

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            ++  P  A ++WV + S YNY  N C  G   C  YTQ+VW+ +  LGC+   C  G   
Sbjct  129  SSWAPGFAVQSWVVEGSTYNYNTNSC-DGSGMCGHYTQMVWRDTKRLGCASLVCDNGAGV  187

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  188  FITCNYDPPGNYVGEKPY  205



>gb|KFK29089.1| hypothetical protein AALP_AA7G087400 [Arabis alpina]
Length=207

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R  +G+ PL W  K+A+ A      +R   +CS  + S G YG N     G
Sbjct  75   QFLDPHNSVRGGLGLPPLVWDGKIASYATWWANQRR--YDCS-LTHSTGPYGENLFWGSG  131

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  TP  A E+W  +   YN+  N C  G   C  YTQ+VW+++  LGC++  C  G   
Sbjct  132  SDFTPTFAVESWTVEAKSYNHMTNSCEGG--MCGHYTQIVWRETKRLGCARVVCENGAGV  189

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE PY
Sbjct  190  FITCNYDPPGNYVGENPY  207



>ref|XP_004230669.1| PREDICTED: pathogenesis-related leaf protein 6 [Solanum lycopersicum]
Length=164

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 79/140 (56%), Gaps = 9/140 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            ++L+ HN AR+ VGV  +TW+  L   A         NQ  S  +L  S G YG N    
Sbjct  32   DYLNTHNSARSQVGVGAITWNTTLENYAQ-----NYANQRISDCNLVHSNGPYGENIAKG  86

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G+ +T   A   WV +K +Y+Y +N C  G   CR YTQVVWK S++LGC++  C  G 
Sbjct  87   SGSFMTGTAAVNLWVGEKPYYDYNSNSCTGG-KECRHYTQVVWKNSIQLGCARVQCTNGW  145

Query  608  ITLTICFYNPPGNTVGEKPY  667
              +T C YNPPGN +G++PY
Sbjct  146  WFVT-CNYNPPGNYIGQRPY  164



>ref|XP_006486822.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 81/138 (59%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++++ HN ARA VGV P+TW  ++A+ A      ++ + N  +   SGG YG N   S  
Sbjct  31   DYVNAHNAARAQVGVGPVTWDDRVASYAQNYANQRKGDCNLVH---SGGPYGENLAWSS-  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+ Y+Y +N C  G   C  YTQVVW+ S+ +GC++ TC   + T
Sbjct  87   AGLSGTDAVKMWVNEKADYDYNSNTCAEGK-VCGHYTQVVWRNSVRIGCAKVTCNNNKGT  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  146  FIGCNYDPPGNFVGEKPY  163



>ref|NP_001234314.1| pathogenesis-related leaf protein 6 precursor [Solanum lycopersicum]
 sp|P04284.2|PR06_SOLLC RecName: Full=Pathogenesis-related leaf protein 6; Short=P6; 
AltName: Full=Ethylene-induced protein P1; AltName: Full=P14; 
AltName: Full=P14A; AltName: Full=PR protein; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA48672.1| P1(p14) protein [Solanum lycopersicum]
 gb|AAA03616.1| pathogenesis-related protein P6 [Solanum lycopersicum]
 emb|CAA70042.1| PR protein [Solanum lycopersicum]
Length=159

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 89/177 (50%), Gaps = 24/177 (14%)
 Frame = +2

Query  137  TLSLSVIIALAICHGCaqgvppapptvaataaalpgsaqEFLDVHNQARADVGVDPLTWS  316
            +L L+ ++ LAI H C     P                 ++L VHN ARA VGV P++W 
Sbjct  7    SLLLTCLMVLAIFHSCEAQNSPQ----------------DYLAVHNDARAQVGVGPMSWD  50

Query  317  PKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENWVQQKSFYNY  496
              LA+ A      +  +  C+      GE     +   G   T R A + WV ++  YNY
Sbjct  51   ANLASRAQNYANSRAGD--CNLIHSGAGE----NLAKGGGDFTGRAAVQLWVSERPSYNY  104

Query  497  ANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGNTVGEKPY  667
            A N CV G  +CR YTQVVW+ S+ LGC +A C  G   ++ C Y+P GN +G++PY
Sbjct  105  ATNQCVGG-KKCRHYTQVVWRNSVRLGCGRARCNNGWWFIS-CNYDPVGNWIGQRPY  159



>ref|XP_011092473.1| PREDICTED: pathogenesis-related leaf protein 6-like [Sesamum 
indicum]
Length=162

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 81/138 (59%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +++  HN ARA VGV P+ W  K+A  A   V  QR   +C+    +   YG N     G
Sbjct  31   DYVSAHNAARAQVGVGPIAWDEKVAAFARNYVN-QRIG-DCNLVHSTNRPYGENLAKGSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T R A E WV++K FY+Y++N CV G   C  YTQVVW+ S+ +GC++A C  G   
Sbjct  89   E-FTGRAAVELWVREKPFYDYSSNSCVGG--ECLHYTQVVWRNSVRVGCARARCNNGWWF  145

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+PPGN +G++PY
Sbjct  146  IS-CNYDPPGNYIGQRPY  162



>ref|NP_001237253.1| uncharacterized protein LOC100527778 precursor [Glycine max]
 gb|ACU16951.1| unknown [Glycine max]
Length=161

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLDVHNQARA+VGV PL+W+  L   A    RY  +         S G +G N  L++G
Sbjct  31   DFLDVHNQARAEVGVGPLSWNHTLQAYAQ---RYANERIPDCNLEHSMGPFGEN--LAEG  85

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
               +    A + W+ +K +Y++ +N CV  H  C  YTQ+VW+ S+ LGC++A C  G +
Sbjct  86   YGEMKGSDAVKFWLTEKPYYDHYSNACV--HDECLHYTQIVWRGSVHLGCARAKCNNGWV  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN  GE+PY
Sbjct  144  -FVICSYSPPGNIEGERPY  161



>emb|CDY11859.1| BnaC03g12850D [Brassica napus]
Length=205

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 72/138 (52%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  KLA  A      +R   +CS    S G YG N     G
Sbjct  72   QFLDPHNALRSRLGLPPLVWDSKLANYAKWWANQRR--YDCSLTH-STGPYGENLFWGSG  128

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            ++  P  A  +WV + S YNY  N C  G   C  YTQ+VW+ +  LGC+   C  G   
Sbjct  129  SSWAPGFAVHSWVVEGSTYNYNTNSC-DGSGMCGHYTQMVWRDTKRLGCASLVCDNGAGV  187

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  188  FITCNYDPPGNYVGEKPY  205



>ref|XP_006486833.1| PREDICTED: pathogenesis-related leaf protein 6-like [Citrus sinensis]
Length=159

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN+ RA V V P+ W  K+A  A     Y    +       SGG Y  N   S+G
Sbjct  28   DYLRAHNETRASVRVGPMRWDNKVAAYAQ---NYANQRKGDCRLVHSGGPYSENLAWSNG  84

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A + WV ++  YNY +N CV G   CR YTQVVW+ S+ LGC++  C   + T
Sbjct  85   D-LTGMAAVKLWVDERPKYNYNSNTCVGGE--CRHYTQVVWRNSVRLGCTRVKCNNNRGT  141

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN  G++PY
Sbjct  142  FVICNYDPPGNVAGQRPY  159



>emb|CDY59219.1| BnaCnng34480D [Brassica napus]
Length=178

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 76/138 (55%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            E L VHN+ARA VGV P+ W+  LAT A     Y+R  ++C     S G YG N     G
Sbjct  45   ETLAVHNKARALVGVGPMVWNETLATYA-QSYAYERA-RDCVMKH-SSGPYGENLAAGWG  101

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                P +A + W+ +K  Y YANN C  G   C  YTQ+VW+ S+ LGC    C   +  
Sbjct  102  MMNGP-VATKYWMTEKDNYEYANNTCDGGEGVCGHYTQIVWRDSVRLGCGSVRCKNDEYI  160

Query  614  LTICFYNPPGNTVGEKPY  667
              IC Y+PPGN +G++PY
Sbjct  161  WVICSYDPPGNYIGQRPY  178



>ref|XP_001759774.1| predicted protein [Physcomitrella patens]
 gb|EDQ75278.1| predicted protein [Physcomitrella patens]
Length=134

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 3/137 (2%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            FL   N+ARA +G+ PL W   LA  A      +R   +C     SGG YG N     G 
Sbjct  1    FLRPQNEARAQLGLSPLQWDQNLANYAQGWANQRRLYGDCR-LQHSGGPYGENIFWGSGK  59

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            A  P  AA  WV +K +Y Y +N CV  + +C  YTQ+VW+ + ++GC+++ C  G I +
Sbjct  60   AWQPVEAANAWVAEKQWYRYYSNSCVY-YNKCGHYTQIVWRGTTKVGCARSVCNDGNIFM  118

Query  617  TICFYNPPGNTVGEKPY  667
            T C Y PPGN VG++PY
Sbjct  119  T-CNYYPPGNWVGQRPY  134



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 80/138 (58%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++++ HN ARA VGV P+TW   +A  A  +    R   +C     SGG YG N   S G
Sbjct  29   DYVNAHNTARAAVGVGPVTWDNTVAAYA--RNYANRHIGDCRLVH-SGGPYGENLAGSSG  85

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+FYNY +N C AG   C  YTQVVW+ S+ +GC++  C  G  T
Sbjct  86   Y-LSGTAAVKLWVDEKAFYNYNSNTCAAGK-VCGHYTQVVWRNSVRIGCAKVKCNNGG-T  142

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VG++PY
Sbjct  143  FITCNYDPPGNYVGQRPY  160



>gb|EMS62872.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=166

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 73/139 (53%), Gaps = 2/139 (1%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARAD GV P+TW   +A  A      +R +    + +  G  YG N     G
Sbjct  29   DFVDPHNAARADAGVGPVTWDDNVAAYAQNYAEQRRGDCQLIH-TPDGRPYGENLFGGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGH-PRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            T  T   A  +WV +K +Y++ +N C A     C  YTQVVW+ S  +GC++  C     
Sbjct  88   TQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVCDSSDD  147

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC YNPPGN VG+ PY
Sbjct  148  VFIICSYNPPGNYVGQSPY  166



>ref|XP_008453637.1| PREDICTED: pathogenesis-related protein PR-1 [Cucumis melo]
Length=171

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 73/138 (53%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN AR  + + PL W  KLA  A      +R +    +   SGG YG N     G
Sbjct  38   QFLGPHNAARYALRLSPLVWDSKLARYAQWYANKRRGDCALRH---SGGPYGENIFWGSG  94

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               TP  A  +WV ++ +Y+Y  N CV G   C  YTQ+VW+ +  +GC++ TC  G+  
Sbjct  95   NEWTPAQAVADWVSERKWYSYWANSCVEGE-LCGHYTQIVWRSTRRIGCARVTCNDGKGV  153

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN +G +PY
Sbjct  154  FITCNYDPPGNYIGMRPY  171



>ref|XP_010688504.1| PREDICTED: pathogenesis-related protein PR-1-like [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 4/137 (3%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            +L   N ARA VGV PL+W  +LA  A      +R +    ++S   G YG N     G+
Sbjct  49   YLKAQNAARAAVGVPPLSWDSRLAAFAQWWANQRRYDCALRHSS---GPYGENIFWGSGS  105

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
            + +P  A ++WV +  +YNY +N C  G   C  YTQ+VW+ S  +GC++  C  G+   
Sbjct  106  SWSPTFAVQSWVVEGKYYNYYSNSCAYGKD-CGHYTQIVWRSSRRIGCAKVVCYNGRGVF  164

Query  617  TICFYNPPGNTVGEKPY  667
              C Y+PPGN +G +PY
Sbjct  165  ITCNYDPPGNYIGSRPY  181



>ref|XP_011002601.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=162

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV PLTW   +   A      +  + N  +   SGG YG N   S  
Sbjct  31   DYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVH---SGGPYGENLAWSSA  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K++Y+Y++N C AG  +C  YTQVVW+ S  LGC++  C  G  T
Sbjct  88   D-LSGTDAVKMWVDEKAYYDYSSNSCAAGQ-QCGHYTQVVWRNSARLGCAKVKCSTGG-T  144

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VG+KPY
Sbjct  145  FIGCNYDPPGNYVGQKPY  162



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 81/142 (57%), Gaps = 14/142 (10%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRD--NQNCSYASL--SGGEYGSNQM  421
            ++++ HN ARA VGV P+TW   +A        Y R+  NQ+     L  SGG YG N  
Sbjct  17   DYVNAHNTARAAVGVGPVTWDNTVAA-------YARNYANQHIGDCRLVHSGGPYGENLA  69

Query  422  LSDGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPK  601
             S G    P  A + WV +K+FY+Y +N C AG   C  YTQVVW+ S+ +GC++  C  
Sbjct  70   GSSGDLSDP-AAVKLWVDEKAFYDYNSNTCAAGK-VCGHYTQVVWRNSVRIGCAKVKCNN  127

Query  602  GQITLTICFYNPPGNTVGEKPY  667
            G  T   C Y+PPGN VG++PY
Sbjct  128  GG-TFITCNYDPPGNYVGQRPY  148



>ref|XP_002885324.1| hypothetical protein ARALYDRAFT_898358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61583.1| hypothetical protein ARALYDRAFT_898358 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 81/141 (57%), Gaps = 10/141 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFL+ HN+AR +VG+DPL W  ++A  A      QR N +C+    S G +G N  +S G
Sbjct  28   EFLEAHNEARNEVGLDPLVWDDEVAAYAASYAN-QRIN-DCALVH-SNGPFGENIAMSSG  84

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR---CRSYTQVVWKKSLELGCSQATCPKG  604
              +    AAE W+ +K +Y+Y +N C    P    C  YTQVVWK ++ LGC++  C  G
Sbjct  85   D-MPAEDAAEMWINEKQYYDYNSNTC--NDPNGGTCLHYTQVVWKNTVRLGCAKVVCNSG  141

Query  605  QITLTICFYNPPGNTVGEKPY  667
              T   C Y+PPGN +G+ PY
Sbjct  142  G-TFITCNYDPPGNYIGQNPY  161



>ref|XP_004289697.1| PREDICTED: pathogenesis-related protein 1C-like [Fragaria vesca 
subsp. vesca]
Length=164

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV PLTW  ++A  A        D+    +   S G+YG N  +  G
Sbjct  33   DYLDAHNAARAAVGVAPLTWDDQVARFAQDYANTHVDDCQLVH---SNGQYGENLAMGSG  89

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A   W+ +K+ Y+Y +N C AG   C  YTQVVW+ SL +GC++  C  G  T
Sbjct  90   D-LSGTDAVNLWIGEKADYDYNSNTCAAG-KVCGHYTQVVWRNSLHVGCAKVRCNSGG-T  146

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  147  FIGCNYDPPGNWVGEKPY  164



>ref|XP_008383442.1| PREDICTED: pathogenesis-related protein PR-1-like [Malus domestica]
Length=234

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 82/138 (59%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN  R+ +G+ PL W+ KL   A  +  +QR  ++CS    S  ++G N     G
Sbjct  102  QFLIPHNTQRSRLGLRPLKWNRKLEKYAS-RWAHQR-QEDCSLIH-SDSKFGENLFWGSG  158

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                P  A   W Q++S+YNY  N C A +  C  YTQ+VW++SL++GCS+ TC +G  T
Sbjct  159  RDWKPGDAVAAWAQERSYYNYWTNSC-AQNKDCWHYTQMVWRRSLKIGCSKVTC-RGGDT  216

Query  614  LTICFYNPPGNTVGEKPY  667
              +C Y+PPGN +G+KPY
Sbjct  217  FMVCVYDPPGNFIGQKPY  234



>ref|XP_010443455.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=205

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 4/137 (3%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            FLD HN  R+ +GV PL W  KLA+ A      +R   +CS  + S G YG N     G+
Sbjct  73   FLDPHNALRSRLGVSPLIWDSKLASYATWWANQRR--YDCS-MTHSTGPYGENLFWGSGS  129

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
              TP  A ++WV +   Y++ +N C  G   C  YTQ+VW+ +  LGC++  C  G    
Sbjct  130  DWTPTFAVQSWVVEGRSYDHNSNSC-GGSGMCGHYTQMVWRDTKRLGCARVVCENGAGVF  188

Query  617  TICFYNPPGNTVGEKPY  667
              C Y+PPGN VGEKPY
Sbjct  189  ITCNYDPPGNYVGEKPY  205



>ref|XP_010941969.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 73/140 (52%), Gaps = 9/140 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +F+  HN ARA VGV P++W   +A  A         NQ      L  SGG YG N    
Sbjct  30   DFVSAHNAARAAVGVGPVSWDNTVAAYA-----QNYANQRIGDCQLVHSGGPYGENLFWG  84

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G   T   A   WV +K +Y+Y+ N C AG   C  YTQVVW+ S  +GC++  C  G 
Sbjct  85   SGREYTAADAVNLWVSEKQWYDYSTNTCAAG-KVCGHYTQVVWRDSTHIGCARVKCNSGA  143

Query  608  ITLTICFYNPPGNTVGEKPY  667
            I   IC Y PPGN VG++PY
Sbjct  144  I-FIICNYKPPGNIVGQRPY  162



>gb|AAZ94265.1| pathogenesis-related 1a [Triticum monococcum]
Length=167

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 75/141 (53%), Gaps = 6/141 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARADVGV P+TW   +A  A      +R +    +   SGG+YG N     G
Sbjct  30   DFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLVH---SGGQYGENIYGGRG  86

Query  434  TAV--TPRMAAENWVQQKSFYNYANNMCVA-GHPRCRSYTQVVWKKSLELGCSQATCPKG  604
                 T   A + WV +K +Y++ +N C A     C  YTQVVW+ S  +GC++  C  G
Sbjct  87   GGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQVVWRDSTAIGCARVVCDGG  146

Query  605  QITLTICFYNPPGNTVGEKPY  667
                 IC YNPPGN  G+ PY
Sbjct  147  DGLFIICSYNPPGNYNGQSPY  167



>gb|EEE54618.1| hypothetical protein OsJ_01863 [Oryza sativa Japonica Group]
Length=147

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 73/139 (53%), Gaps = 5/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML-SD  430
            ++L   N AR+ VGV P++WS KL    G    Y R  +       SGG YG N    S 
Sbjct  13   DYLSPQNAARSAVGVGPMSWSTKLQ---GFAEDYARQRKGDCRLQHSGGPYGENIFWGSA  69

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G   T   A  +WV +K +YNYA+N C AG   C  YTQVVW+ S  +GC++  C   + 
Sbjct  70   GADWTAADAVRSWVDEKKYYNYASNSCAAGKV-CGHYTQVVWRDSTNVGCARVRCDANRG  128

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y P GN VG +PY
Sbjct  129  IFIICNYEPRGNIVGRRPY  147



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL  HN+ARA+VGV P+TW   +A  A    RY    +       S G YG N   S G
Sbjct  31   DFLTPHNRARAEVGVGPMTWDDSVAAYAQ---RYANQRRGDCKLIHSSGPYGENLAWSSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPR-CRSYTQVVWKKSLELGCSQATCPKGQI  610
              ++   A + WV +KS Y++ +N CV  +P  C  YTQVVW+ S  LGC++  C  G  
Sbjct  88   D-LSAAGAVKMWVAEKSLYDHNSNKCVGKNPMGCLHYTQVVWRDSTRLGCAKVRCNSGG-  145

Query  611  TLTICFYNPPGNTVGEKPY  667
            +  IC YNPPGN +G+ PY
Sbjct  146  SFVICNYNPPGNYIGQWPY  164



>ref|XP_008798895.1| PREDICTED: pathogenesis-related protein 1-like [Phoenix dactylifera]
Length=162

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 75/138 (54%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F++ HN ARA VGV P++W+   AT A     Y    +       S G YG N     G
Sbjct  30   DFINPHNAARAAVGVGPVSWN---ATVAAYAQDYANKRKADCELVHSNGPYGENIFWGGG  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T   A  +WV +K +Y+YA+N C A    C  YTQ VW KS+ +GC++ TC  G  T
Sbjct  87   PGWTAADAVNDWVSEKQYYDYASNSC-APSQVCGHYTQAVWAKSVYIGCARVTCDNGD-T  144

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE+PY
Sbjct  145  FITCNYDPPGNYVGERPY  162



>ref|XP_011045001.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Populus 
euphratica]
Length=186

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L  HN  RA +G+ PL WS KLA  A     +QR  ++C+    S  +YG N     G
Sbjct  54   QYLVPHNLERAKLGLPPLRWSKKLANFAS-SWAHQR-QKDCALIH-SNSDYGENLFWGSG  110

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                PR A   W ++K +YNY  N C A +  C  YTQ+VW+KSL++GC++  C  G  T
Sbjct  111  KDWKPRDAVATWAEEKGYYNYKTNTC-AHNKDCLHYTQIVWRKSLKVGCARVACRSGD-T  168

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN +G+KP+
Sbjct  169  FITCNYDPHGNVIGQKPF  186



>ref|XP_010452554.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=205

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 4/137 (3%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGT  436
            FLD HN  R+ +GV PL W  KLA+ A      +R   +CS  + S G YG N     G+
Sbjct  73   FLDPHNALRSRLGVSPLIWDSKLASYATWWANQRR--YDCS-MTHSTGPYGENLFWGSGS  129

Query  437  AVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITL  616
              TP  A ++WV +   Y++ +N C  G   C  YTQ+VW+ +  LGC++  C  G    
Sbjct  130  DWTPTFAVQSWVVEGRSYDHNSNSC-GGSGMCGHYTQMVWRDTKRLGCARVVCENGAGVF  188

Query  617  TICFYNPPGNTVGEKPY  667
              C Y+PPGN VGEKPY
Sbjct  189  ITCNYDPPGNYVGEKPY  205



>emb|CDO97323.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 80/141 (57%), Gaps = 13/141 (9%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            ++L+VHN AR+ VGV P+TW   +A  A         NQ  S  +L  S G YG N  L+
Sbjct  33   DYLNVHNSARSQVGVGPMTWDTTVAAYAQ-----NYANQRISDCNLVHSQGPYGEN--LA  85

Query  428  DGTAVTPRMAAEN-WVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKG  604
             GT      AA N WV +K +YNY +N CV G   C  YTQVVW+ S+ LGC++  C   
Sbjct  86   KGTGTFTGTAAANLWVAEKPYYNYTSNSCVGG--ECLHYTQVVWRDSVRLGCARVQCTNS  143

Query  605  QITLTICFYNPPGNTVGEKPY  667
                 IC Y+PPGN +G++PY
Sbjct  144  WW-FVICSYDPPGNYIGQRPY  163



>gb|ABK55610.1| pathogenesis-related protein PR1c [Oryza sativa Indica Group]
Length=167

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 73/139 (53%), Gaps = 5/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML-SD  430
            ++L   N AR+ VGV P++WS KL    G    Y R  +       SGG YG N    S 
Sbjct  33   DYLSPQNAARSAVGVGPMSWSTKLQ---GFAESYARQRKGDCRLQHSGGPYGENIFWGSA  89

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G   T   A  +WV +K +YNYA+N C AG   C  YTQVVW+ S  +GC++  C   + 
Sbjct  90   GADWTAADAVRSWVDEKKYYNYASNSCAAGKV-CGHYTQVVWRDSTNVGCARVRCDANRG  148

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y P GN VG +PY
Sbjct  149  VFIICNYEPRGNIVGRRPY  167



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN ARA+VGV P++W   +A  A      +  + N  +   SGG YG N  L+ G
Sbjct  31   DFLDAHNVARAEVGVGPMSWDNTVAAYAQNYTNQRIGDCNLVH---SGGPYGEN--LAWG  85

Query  434  TAVTPRMAAEN-WVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            +     + A N WV +K+ Y+Y +N CV G   CR YTQV+W+ SL LGC++A C  G  
Sbjct  86   SPSLTGIDAVNLWVGEKTNYDYNSNSCVGG--ECRHYTQVIWRNSLRLGCARAQCNSGGW  143

Query  611  TLTICFYNPPGNTVGEKPY  667
             +T C Y+PPGN VG++P+
Sbjct  144  FVT-CNYDPPGNYVGQRPF  161



>ref|XP_010065835.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Eucalyptus 
grandis]
 gb|KCW63505.1| hypothetical protein EUGRSUZ_G01135 [Eucalyptus grandis]
Length=161

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +++  HN AR+ VGV P+TW  ++A+ A  +   Q+  ++C+    SGG YG N   +  
Sbjct  29   DYVAAHNAARSQVGVGPITWDERVASYA--RDYAQKHARDCTRLVHSGGPYGENLAWAS-  85

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A   WV +K  YNY +N C  G   C  YTQVVW+ S+ +GC++A C  G  T
Sbjct  86   PDLTGTRAVNMWVGEKPDYNYNSNSCAPGK-VCGHYTQVVWRNSVRVGCAKAQCATGG-T  143

Query  614  LTICFYNPPGNTVGEKPY  667
            L  C Y+PPGN +G+KPY
Sbjct  144  LVTCNYDPPGNYIGQKPY  161



>emb|CDY22960.1| BnaC03g41090D [Brassica napus]
Length=168

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 81/143 (57%), Gaps = 14/143 (10%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            EFL+ HN+AR +VGV+PL WS ++A  A         NQ  S  ++  S G +G N   S
Sbjct  35   EFLEAHNEARHEVGVEPLVWSDEVAAYAS-----SYANQRVSDCAMVHSNGPFGENIAWS  89

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPR---CRSYTQVVWKKSLELGCSQATCP  598
             G  ++   A+E W+ +K +Y+Y +N C    P    C  YTQVVW+ S+ LGC++  C 
Sbjct  90   SGD-MSAEDASEMWIDEKKYYDYDSNTC--NDPNGGTCLHYTQVVWRNSIRLGCAKVVCN  146

Query  599  KGQITLTICFYNPPGNTVGEKPY  667
             G  T   C Y+PPGN  GEKPY
Sbjct  147  SGG-TFITCNYDPPGNYNGEKPY  168



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HNQARA VGV PL+W   +A  A      +  + N  +   SGG YG N   S  
Sbjct  32   DYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVH---SGGPYGENLAWSSA  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K++Y+Y +N C  G   C  YTQVVW+ S+ +GC++  C  G  T
Sbjct  89   E-LSGTDAVKMWVDEKAYYDYDSNSCSPGQ-MCGHYTQVVWRDSVRVGCAKVRCSNGG-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VG+KPY
Sbjct  146  FVTCNYDPPGNYVGQKPY  163



>ref|XP_006848057.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
 gb|ERN09638.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
Length=165

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L+ HN AR  + V PLTW   +A  A      +  + N  +   SGG YG N     G
Sbjct  33   DYLNPHNAARTRLNVGPLTWDDNVAAFAQNYANQRARDCNLIH---SGGPYGENLFGGSG  89

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +   A   WV +K+ Y+Y +N C AG  +C  YTQVVW+ S+ LGC++  C  G I 
Sbjct  90   ADFSAADAVNAWVNEKADYDYNSNTCAAG-KQCGHYTQVVWRNSVRLGCAKVRCNNGGIF  148

Query  614  LTICFYNPPGNTVGEKPY  667
            +T C YNPPGN +G+KPY
Sbjct  149  IT-CNYNPPGNFIGQKPY  165



>ref|XP_003610169.1| Pathogenesis-related protein PR-1 [Medicago truncatula]
 sp|Q40374.1|PR1_MEDTR RecName: Full=Pathogenesis-related protein PR-1; Flags: Precursor 
[Medicago truncatula]
 emb|CAA56174.1| PR-1 [Medicago truncatula]
 gb|AES92366.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
 gb|AFK39426.1| unknown [Medicago truncatula]
Length=173

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 71/138 (51%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL   N ARA VG+ PL W  KL   A      +R++  C+    S G YG N     G
Sbjct  40   QFLIPQNIARAAVGLRPLVWDDKLTHYAQWYANQRRND--CALEH-SNGPYGENIFWGSG  96

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
                P  A   WV +K FYNY +N CV G   C  YTQVVW  + ++GC+   C   + T
Sbjct  97   VGWNPAQAVSAWVDEKQFYNYWHNSCVDGE-MCGHYTQVVWGSTTKVGCASVVCSDDKGT  155

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN  GE+PY
Sbjct  156  FMTCNYDPPGNYYGERPY  173



>ref|XP_006285131.1| hypothetical protein CARUB_v10006471mg [Capsella rubella]
 gb|EOA18029.1| hypothetical protein CARUB_v10006471mg [Capsella rubella]
Length=208

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R  +G+ PL W  K+A+ A      +R   +CS  + S G YG N     G
Sbjct  75   QFLDPHNTVRGGLGLSPLVWDGKIASYATWWANQRR--YDCS-LTHSTGPYGENIFWGSG  131

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  TP  A E+W  +   YN+  N C  G   C  YTQ+VW+ +  +GC++  C  G   
Sbjct  132  SDFTPTFAVESWTVEAKSYNHMTNSC-EGSGMCGHYTQIVWRDTKRIGCARVVCENGAGV  190

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  191  FITCNYDPPGNYVGEKPY  208



>ref|NP_195098.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 gb|AAG40056.1|AF324705_1 AT4g33720 [Arabidopsis thaliana]
 gb|AAG42009.1|AF327419_1 putative pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 gb|AAK00381.1|AF339699_1 putative pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 emb|CAA20585.1| pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 emb|CAB80089.1| pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 gb|AAK62632.1| AT4g33720/T16L1_210 [Arabidopsis thaliana]
 gb|AAM65876.1| pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 gb|AAM91069.1| AT4g33720/T16L1_210 [Arabidopsis thaliana]
 gb|AEE86269.1| putative pathogenesis-related protein [Arabidopsis thaliana]
Length=163

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 77/138 (56%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL VHN+ARA+VGV PL W  K+A  A     Y    +       S G YG N   S G
Sbjct  32   DFLAVHNRARAEVGVGPLRWDEKVAAYAR---NYANQRKGDCAMKHSSGSYGENIAWSSG  88

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            + +T   A + WV ++  Y+Y +N C A   +C  YTQVVW+ S  LGC++  C  GQ T
Sbjct  89   S-MTGVAAVDMWVDEQFDYDYDSNTC-AWDKQCGHYTQVVWRNSERLGCAKVRCNNGQ-T  145

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGE PY
Sbjct  146  FITCNYDPPGNWVGEWPY  163



>emb|CDY58847.1| BnaA02g35230D [Brassica napus]
Length=207

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 73/138 (53%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  KLA+ A      +R   +CS  + S G YG N     G
Sbjct  74   QFLDPHNAIRSRLGLPPLVWDGKLASYATWWANQRR--YDCS-MTHSTGPYGENLFWGSG  130

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            ++  P     +WV + S YNY  N C  G   C  YTQ+VW+ +  LGC+   C  G   
Sbjct  131  SSWAPGFVVHSWVVEGSSYNYNTNSC-DGSGMCGHYTQIVWRDTKRLGCASVVCENGAGV  189

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  190  FITCNYDPPGNYVGEKPY  207



>gb|AFG50738.1| hypothetical protein 0_18914_01, partial [Pinus taeda]
 gb|AFG50739.1| hypothetical protein 0_18914_01, partial [Pinus taeda]
 gb|AFG50740.1| hypothetical protein 0_18914_01, partial [Pinus taeda]
 gb|AFG50741.1| hypothetical protein 0_18914_01, partial [Pinus taeda]
 gb|AFG50744.1| hypothetical protein 0_18914_01, partial [Pinus taeda]
Length=145

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 10/139 (7%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLSD  430
            FL +HN ARA VGV+ L W   +A  A         NQ  +  ++  SGG+YG N     
Sbjct  15   FLSLHNDARAQVGVEALEWDDNVAAYAQNYA-----NQRIADCAMQHSGGQYGENIYEEM  69

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G +    MA ++WV +K +Y++++N C      CR YTQVVWK S  LGC+QA C  G  
Sbjct  70   GYSDPVGMAMQSWVNEKQYYDHSSNSCTG--EECRHYTQVVWKDSKRLGCAQAQCNNG-W  126

Query  611  TLTICFYNPPGNTVGEKPY  667
            T  IC Y+P GN  G+ PY
Sbjct  127  TFVICNYDPRGNIDGQTPY  145



>ref|NP_001238109.1| uncharacterized protein LOC100499927 precursor [Glycine max]
 gb|ACU14207.1| unknown [Glycine max]
Length=161

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 83/139 (60%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLDVHNQARA+VGV PL+W+  L   A      +  + N  +   S G +G N  +S+G
Sbjct  31   DFLDVHNQARAEVGVGPLSWNHTLQAYAQSYANKRIPDCNLEH---SMGPFGEN--ISEG  85

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
             A +    A + W+ +K +Y++ +N CV  H  C  YTQ+VW+ S+ LGC++A C    +
Sbjct  86   YAEMKGSDAVKFWLTEKPYYDHHSNACV--HDECLHYTQIVWRDSVHLGCARAKCNNDWV  143

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y+PPGN  GE+PY
Sbjct  144  -FVICSYSPPGNIEGERPY  161



>ref|XP_011092472.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=158

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 77/141 (55%), Gaps = 15/141 (11%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL----SGGEYGSNQML  424
            FLD HN+ARA VGV PL W+  +A       RY  D  +  Y       S G YG N   
Sbjct  29   FLDAHNRARAQVGVRPLVWNETVA-------RYALDYAHKRYGDCELEHSQGPYGENLAE  81

Query  425  SDGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKG  604
              GT ++   A   WV +KS Y+Y++N CV G   C  YTQVVW  S+ LGC++  C  G
Sbjct  82   GWGT-LSGTDAVGMWVSEKSCYDYSSNSCVGG--ECLHYTQVVWNDSVHLGCARVQCRNG  138

Query  605  QITLTICFYNPPGNTVGEKPY  667
             +   IC Y+PPGN VG +PY
Sbjct  139  WL-FVICSYDPPGNYVGRRPY  158



>ref|XP_002273546.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN74267.1| hypothetical protein VITISV_000653 [Vitis vinifera]
 emb|CBI25096.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 7/138 (5%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LDVHN ARADVGV+P+TW   +A  A      +  + N  +   S G YG N  +  G
Sbjct  31   DYLDVHNAARADVGVEPMTWDDNVAAYARDYASQRSGDCNMVH---SNGPYGENLAMGSG  87

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               T   AA  WV +KS Y+Y +N CV G   C  YTQVVW+ S+ LGC++  C  G   
Sbjct  88   D-FTATDAANLWVGEKSNYDYNSNSCVGG--ECGHYTQVVWRNSVSLGCARVQCNNGWWF  144

Query  614  LTICFYNPPGNTVGEKPY  667
            ++ C Y+P GN +G+ PY
Sbjct  145  VS-CNYSPQGNIIGQHPY  161



>gb|AFG50742.1| hypothetical protein 0_18914_01, partial [Pinus taeda]
Length=145

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 77/139 (55%), Gaps = 10/139 (7%)
 Frame = +2

Query  257  FLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLSD  430
            FL +HN ARA VGV+ L W   +A  A         NQ  +  ++  SGG+YG N     
Sbjct  15   FLSLHNDARAQVGVEALEWDDNVADYAQNYA-----NQRIADCAMQHSGGQYGENIYEEM  69

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G +    MA ++WV +K +Y++++N C      CR YTQVVWK S  LGC+QA C  G  
Sbjct  70   GYSDPVGMAMQSWVNEKQYYDHSSNSCTG--EECRHYTQVVWKDSKRLGCAQAQCNNG-W  126

Query  611  TLTICFYNPPGNTVGEKPY  667
            T  IC Y+P GN  G+ PY
Sbjct  127  TFVICNYDPRGNIDGQTPY  145



>ref|XP_008455066.1| PREDICTED: basic form of pathogenesis-related protein 1 [Cucumis 
melo]
Length=164

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN ARA VGV P++W   +A  A    +Y   + N      S G YG N   S  
Sbjct  33   DFVDAHNAARAQVGVGPVSWDETVANYAQ---QYANQHINDCQMVHSNGPYGENLAWSSA  89

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K FY+YA+N CV     CR YTQVVWK S+++GC++  C     T
Sbjct  90   D-LSGTNAVQMWVNEKQFYDYASNSCVGS--ECRHYTQVVWKNSVKIGCAKVECNNNGGT  146

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+P GN V ++PY
Sbjct  147  FITCNYDPSGNYVNQRPY  164



>ref|NP_001043091.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAB84473.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAC10798.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF05005.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAH00320.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70685.1| hypothetical protein OsI_02026 [Oryza sativa Indica Group]
Length=167

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 73/139 (53%), Gaps = 5/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQML-SD  430
            ++L   N AR+ VGV P++WS KL    G    Y R  +       SGG YG N    S 
Sbjct  33   DYLSPQNAARSAVGVGPMSWSTKLQ---GFAEDYARQRKGDCRLQHSGGPYGENIFWGSA  89

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G   T   A  +WV +K +YNYA+N C AG   C  YTQVVW+ S  +GC++  C   + 
Sbjct  90   GADWTAADAVRSWVDEKKYYNYASNSCAAGKV-CGHYTQVVWRDSTNVGCARVRCDANRG  148

Query  611  TLTICFYNPPGNTVGEKPY  667
               IC Y P GN VG +PY
Sbjct  149  IFIICNYEPRGNIVGRRPY  167



>ref|XP_004289699.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=162

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 91/183 (50%), Gaps = 22/183 (12%)
 Frame = +2

Query  119  EEEMAKTLSLSVIIALAICHGCaqgvppapptvaataaalpgsaqEFLDVHNQARADVGV  298
            E      LSL  ++ALA+ H                +     S Q++L+ HN ARA VGV
Sbjct  2    ELSKISILSLISLVALALLH----------------STHAQNSPQDYLNAHNSARAAVGV  45

Query  299  DPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDGTAVTPRMAAENWVQQ  478
              LTW P LA  A    RY   +        S G YG N   S G  ++   A   WV +
Sbjct  46   GGLTWDPNLAAYA---QRYANSHYGDCNLVHSNGPYGENLAKSSGD-LSGTSAVNLWVGE  101

Query  479  KSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQITLTICFYNPPGNTVGE  658
            K++YNY +N C +G   C  YTQVVW+KS+ +GC++  C  G  T   C Y+P GN VG+
Sbjct  102  KAYYNYNSNTCASGRV-CGHYTQVVWRKSVRVGCARVKCMNGG-TFIGCNYDPRGNYVGQ  159

Query  659  KPY  667
            KPY
Sbjct  160  KPY  162



>ref|XP_008346349.1| PREDICTED: pathogenesis-related protein 1-like [Malus domestica]
Length=161

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 81/140 (58%), Gaps = 10/140 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            ++L+ HN ARA VGV PLTW   +A   G    Y   NQ+    +L  SGG YG N  +S
Sbjct  30   DYLNSHNAARAAVGVGPLTWDDNVA---GYAQNYA--NQHVGDCNLVHSGGPYGENLAMS  84

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G  ++   A + WV +K+ Y+Y +N C AG   C  YTQVVW+ S  +GC++  C  G 
Sbjct  85   TGD-MSGTAAVDLWVAEKADYSYESNSCAAG-KVCGHYTQVVWRNSARVGCAKVRCSSGG  142

Query  608  ITLTICFYNPPGNTVGEKPY  667
             T   C Y+PPGN VGEKPY
Sbjct  143  -TFIGCNYDPPGNYVGEKPY  161



>ref|XP_009126825.1| PREDICTED: pathogenesis-related protein PR-1-like [Brassica rapa]
Length=207

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 73/138 (53%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R+ +G+ PL W  KLA+ A      +R   +CS  + S G YG N     G
Sbjct  74   QFLDPHNAIRSRLGLPPLVWDGKLASYATWWANQRR--YDCS-MTHSTGPYGENLFWGSG  130

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            ++  P     +WV + S YNY  N C  G   C  YTQ+VW+ +  LGC+   C  G   
Sbjct  131  SSWAPGFVVHSWVVEGSSYNYNTNSC-DGSGMCGHYTQIVWRDTKRLGCASVVCENGAGV  189

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  190  FITCNYDPPGNYVGEKPY  207



>ref|XP_010095625.1| hypothetical protein L484_003726 [Morus notabilis]
 gb|EXB61532.1| hypothetical protein L484_003726 [Morus notabilis]
Length=167

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 81/140 (58%), Gaps = 9/140 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL--SGGEYGSNQMLS  427
            +FL+ HN ARA+VGV  +TW  K+A+ A      Q  N +    S+  SGG YG N   S
Sbjct  35   DFLNAHNSARAEVGVGQMTWDDKVASYA-----QQYANSHIGDCSMVHSGGPYGENLAWS  89

Query  428  DGTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQ  607
             G  ++   A   WV +K+ Y+Y +N C +G   C  YTQVVW+ S+ LGC++  C   +
Sbjct  90   SGD-LSGTDAVRMWVNEKADYDYGSNTCASGKV-CGHYTQVVWRNSVRLGCAKVRCNNNK  147

Query  608  ITLTICFYNPPGNTVGEKPY  667
             TL  C Y+P GN VG+KPY
Sbjct  148  GTLIGCNYDPRGNYVGQKPY  167



>ref|XP_002962245.1| hypothetical protein SELMODRAFT_76987 [Selaginella moellendorffii]
 gb|EFJ37505.1| hypothetical protein SELMODRAFT_76987 [Selaginella moellendorffii]
Length=195

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 75/146 (51%), Gaps = 10/146 (7%)
 Frame = +2

Query  254  EFLDVHNQARADVG----VDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQM  421
            +FLD HN ARA V     + PL+WS   A  A   +   RD +NC         YG N  
Sbjct  52   DFLDAHNSARASVSTSPRIPPLSWSTDAAAFATQWITSLRDTKNCGLVHSGNRAYGENLY  111

Query  422  LSDGTA----VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQA  589
               G+       P  A ++WV ++  Y YA N C AG   C  YTQVVW+ +  +GC+  
Sbjct  112  KWQGSPGLPPPNPAEAVKSWVSERKDYTYATNSCAAGK-VCGHYTQVVWRNTQRVGCASI  170

Query  590  TCPKGQITLTICFYNPPGNTVGEKPY  667
            TCP G   L  C Y+PPGN VG+KPY
Sbjct  171  TCP-GNAMLVSCNYDPPGNWVGQKPY  195



>gb|KCW78615.1| hypothetical protein EUGRSUZ_C00080 [Eucalyptus grandis]
Length=136

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 71/138 (51%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            EFLD HN AR  VGV PL W   L+T A  +V   +   +C      G  +G N     G
Sbjct  4    EFLDGHNAARKAVGVPPLAWDTSLSTYA--RVYANQRRADCRLVHSPGYAFGENLFWGQG  61

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
               +   A   WV +K +Y+YANN C      C  YTQVVW+ ++ +GCS+  C     T
Sbjct  62   RRWSAAEATAEWVAEKQWYHYANNSCSG--QECTHYTQVVWRTTIRVGCSKIICNSSD-T  118

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y PPGN +G++PY
Sbjct  119  FIACEYYPPGNYIGQRPY  136



>ref|XP_004487816.1| PREDICTED: pathogenesis-related protein 1-like [Cicer arietinum]
Length=199

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 5/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++L +HN+AR++VGV P+ W+  +A+ A       + N  C     S G YG N   S G
Sbjct  48   DYLKIHNKARSEVGVGPIYWASTVASYAQNYANQLKGN--CKMVH-SKGPYGENLAWSSG  104

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              +T   A   WV +K +Y+Y  N C  G+ +C  YTQVVW+ S+ LGC++  C  G+ T
Sbjct  105  D-LTATSAVTMWVGEKQYYDYNTNTCSNGY-KCGHYTQVVWRDSIRLGCAKVKCNDGRST  162

Query  614  LTICFYNPPGNTVGEKPY  667
            +  C Y+PPGN +G++P+
Sbjct  163  IISCNYDPPGNYIGQRPF  180



>ref|XP_010102995.1| hypothetical protein L484_022874 [Morus notabilis]
 gb|EXB94562.1| hypothetical protein L484_022874 [Morus notabilis]
Length=168

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (54%), Gaps = 6/139 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASL-SGGEYGSNQMLSD  430
            +FL   N  R  + + PL W P+L   A    R+  D +    A + S G YG N     
Sbjct  35   QFLGPQNAVRKALRMRPLVWDPRLEKYA----RWYADKRRYDCALVHSNGPYGENIFWGS  90

Query  431  GTAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
            G   TP  AAE WV ++ +Y Y +N C  G   C  YTQ+VW+++ ++GC++ TC  G+ 
Sbjct  91   GEGWTPAQAAEAWVAEQRWYRYWSNSCAGGEV-CGHYTQIVWRETRKIGCARVTCFGGKG  149

Query  611  TLTICFYNPPGNTVGEKPY  667
                C Y+PPGN VGE+PY
Sbjct  150  VFMTCNYDPPGNYVGERPY  168



>ref|XP_002867590.1| hypothetical protein ARALYDRAFT_492241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43849.1| hypothetical protein ARALYDRAFT_492241 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 74/138 (54%), Gaps = 4/138 (3%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FLD HN  R ++G+ PL W  K+A+ A      +R   +CS  + S G YG N     G
Sbjct  75   QFLDPHNTVRGNLGLPPLVWDVKIASYATWWANQRR--YDCS-LTHSTGPYGENLFWGSG  131

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
            +  T   A E+W  +   YN+  N C  G   C  YTQ+VW+++  LGC++  C  G   
Sbjct  132  SDFTSTFAVESWTVEAKSYNHMTNTC-EGDGMCGHYTQIVWRETRRLGCARVVCENGAGV  190

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VGEKPY
Sbjct  191  FITCNYDPPGNYVGEKPY  208



>ref|XP_010530683.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +F+D HN+ARA VGV P+ W   +A  A      +R +    ++S   G YG N   S G
Sbjct  26   DFVDAHNRARAAVGVGPIRWDETVAAYARDYANRRRGDCRLVHSS---GPYGENIAWSSG  82

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K+ YNY  N C AG   C  YTQVVW+KS+ LGC++  C  G  T
Sbjct  83   D-MSGVSAVQMWVNEKADYNYNTNTCRAGKV-CGHYTQVVWRKSVRLGCAKVRCNNGG-T  139

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN  GE+PY
Sbjct  140  FITCNYDPPGNFNGERPY  157



>ref|XP_006379156.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP56953.1| pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 6/138 (4%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            ++LD HN ARA VGV PLTW   +   A      +  + N  +   SGG YG N   S  
Sbjct  30   DYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLIH---SGGPYGENLAWSSA  86

Query  434  TAVTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQIT  613
              ++   A + WV +K++Y+Y +N C AG  +C  YTQVVW+ S  LGC++  C  G  T
Sbjct  87   D-LSGTDAVKMWVDEKAYYDYNSNSCAAGQ-QCGHYTQVVWRNSARLGCAKVKCSTGG-T  143

Query  614  LTICFYNPPGNTVGEKPY  667
               C Y+PPGN VG+KPY
Sbjct  144  FIGCNYDPPGNYVGQKPY  161



>gb|AFJ93090.1| pathogenesis-related protein 1 [Bacopa monnieri]
Length=176

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 80/139 (58%), Gaps = 9/139 (6%)
 Frame = +2

Query  254  EFLDVHNQARADVGVDPLTWSPKLATAAGLKVRYQRDNQNCSYASLSGGEYGSNQMLSDG  433
            +FL+ HN ARA VGV PL W+  +A+ A   + Y R          S G YG N  L++G
Sbjct  46   DFLNAHNHARAQVGVKPLVWNDTIASYA---LDYARKRYGDCELEHSDGPYGEN--LAEG  100

Query  434  TA-VTPRMAAENWVQQKSFYNYANNMCVAGHPRCRSYTQVVWKKSLELGCSQATCPKGQI  610
               ++   A   WV +KS Y+Y +N CV G   C  YTQVVW+ S  LGC++  C  G +
Sbjct  101  WGRLSAVDAVGMWVSEKSCYDYNSNSCVGG--ECLHYTQVVWRDSTHLGCARLQCHNGWL  158

Query  611  TLTICFYNPPGNTVGEKPY  667
             +T C Y+PPGN VGE+PY
Sbjct  159  FVT-CNYDPPGNYVGERPY  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776