BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22918_g1_i1 len=1997 path=[2139:0-415 2555:416-504 2643:505-512
@118@!:513-855 2989:856-862 2996:863-1996]

Length=1997
                                                                      Score     E

ref|XP_010654031.1|  PREDICTED: cytochrome P450 76A1                    811   0.0      
ref|XP_009793679.1|  PREDICTED: cytochrome P450 76A1                    808   0.0      
ref|XP_006341260.1|  PREDICTED: cytochrome P450 76A2-like               806   0.0      
gb|KCW47877.1|  hypothetical protein EUGRSUZ_K01623                     806   0.0      
ref|XP_010036342.1|  PREDICTED: cytochrome P450 76A1-like               805   0.0      
ref|XP_009626046.1|  PREDICTED: cytochrome P450 76A1                    802   0.0      
emb|CBI30225.3|  unnamed protein product                                811   0.0      
ref|XP_004246575.1|  PREDICTED: cytochrome P450 76A1-like               790   0.0      
ref|XP_010038981.1|  PREDICTED: cytochrome P450 76A1-like               784   0.0      
ref|XP_006439139.1|  hypothetical protein CICLE_v10033708mg             773   0.0      
ref|XP_007027586.1|  Cytochrome P450                                    789   0.0      
ref|XP_006482365.1|  PREDICTED: cytochrome P450 76A2-like               767   0.0      
ref|XP_008241321.1|  PREDICTED: cytochrome P450 76A1                    761   0.0      
ref|XP_011036815.1|  PREDICTED: cytochrome P450 76A1-like               760   0.0      
ref|XP_002528643.1|  cytochrome P450, putative                          756   0.0      Ricinus communis
ref|XP_007201998.1|  hypothetical protein PRUPE_ppa022979mg             755   0.0      
ref|XP_010112509.1|  Cytochrome P450 76A2                               754   0.0      
ref|XP_011101481.1|  PREDICTED: cytochrome P450 76A1                    753   0.0      
ref|XP_011036810.1|  PREDICTED: cytochrome P450 76A1-like               753   0.0      
gb|KDP29244.1|  hypothetical protein JCGZ_16633                         753   0.0      
gb|EYU38601.1|  hypothetical protein MIMGU_mgv1a004436mg                752   0.0      
ref|XP_006382524.1|  hypothetical protein POPTR_0005s02990g             749   0.0      
ref|XP_006382522.1|  hypothetical protein POPTR_0005s02960g             748   0.0      
ref|XP_006382520.1|  hypothetical protein POPTR_0005s02940g             741   0.0      
ref|XP_002528644.1|  cytochrome P450, putative                          740   0.0      Ricinus communis
ref|XP_006382521.1|  hypothetical protein POPTR_0005s02950g             739   0.0      
ref|XP_008392536.1|  PREDICTED: cytochrome P450 76A1                    735   0.0      
ref|XP_004303044.1|  PREDICTED: cytochrome P450 76A2-like               731   0.0      
ref|XP_003535793.1|  PREDICTED: cytochrome P450 76A2-like               724   0.0      
gb|KHN37270.1|  Cytochrome P450 76A2                                    722   0.0      
ref|XP_006382516.1|  hypothetical protein POPTR_0005s02900g             711   0.0      
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g             708   0.0      
ref|XP_003592855.1|  Cytochrome P450                                    707   0.0      
emb|CDP18467.1|  unnamed protein product                                696   0.0      
gb|AJD25184.1|  cytochrome P450 CYP76G16                                696   0.0      
ref|XP_002877896.1|  CYP76G1                                            674   0.0      
ref|NP_190865.2|  cytochrome P450, family 76, subfamily G, polype...    667   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42682.1|  putative cytochrome P450                               665   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497404.1|  PREDICTED: cytochrome P450 76A2-like               663   0.0      
ref|XP_010558964.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    662   0.0      
ref|XP_010431310.1|  PREDICTED: cytochrome P450 76A1-like               661   0.0      
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg             661   0.0      
ref|XP_010504051.1|  PREDICTED: cytochrome P450 76A1-like               660   0.0      
ref|NP_001190075.1|  cytochrome P450, family 76, subfamily G, pol...    657   0.0      
emb|CAB86901.1|  cytochrome P450-like protein                           655   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148756.1|  PREDICTED: cytochrome P450 76A1                    649   0.0      
ref|XP_004138005.1|  PREDICTED: cytochrome P450 76A2-like               644   0.0      
emb|CDX76245.1|  BnaA04g05090D                                          643   0.0      
ref|XP_004168914.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    642   0.0      
ref|XP_008442789.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    630   0.0      
ref|XP_006403743.1|  hypothetical protein EUTSA_v10010318mg             624   0.0      
ref|XP_010412744.1|  PREDICTED: cytochrome P450 76A1-like               609   0.0      
emb|CDP12472.1|  unnamed protein product                                540   0.0      
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like               499   1e-166   
emb|CAN76784.1|  hypothetical protein VITISV_028823                     497   9e-166   Vitis vinifera
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                    497   1e-165   Vitis vinifera
gb|KDP27487.1|  hypothetical protein JCGZ_20022                         496   2e-165   
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like               489   1e-162   
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase               488   3e-162   
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like               488   3e-162   
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like               487   7e-162   
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g             487   8e-162   Populus trichocarpa [western balsam poplar]
ref|XP_010112510.1|  Cytochrome P450 76A2                               485   5e-161   
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g             485   8e-161   
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                    483   5e-160   Vitis vinifera
ref|XP_002528645.1|  cytochrome P450, putative                          482   5e-160   Ricinus communis
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like               482   9e-160   
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like               480   5e-159   
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               480   5e-159   
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    480   6e-159   Vitis vinifera
gb|KHN18720.1|  Cytochrome P450 76A2                                    480   6e-159   
emb|CAN77399.1|  hypothetical protein VITISV_015277                     479   1e-158   Vitis vinifera
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like               479   2e-158   Vitis vinifera
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                     475   1e-157   
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like               476   2e-157   
gb|AHX24367.1|  CYP76A26-like protein                                   475   4e-157   
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                   475   5e-157   
emb|CBI30226.3|  unnamed protein product                                480   5e-157   
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg             473   3e-156   
dbj|BAC53892.1|  cytochrome P450                                        472   5e-156   Petunia x hybrida [garden petunia]
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like               472   7e-156   
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg                471   1e-155   
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like               471   2e-155   
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like               470   3e-155   
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like               470   4e-155   
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like               469   7e-155   
gb|KEH24104.1|  cytochrome P450 family protein                          469   7e-155   
ref|XP_002528647.1|  cytochrome P450, putative                          468   2e-154   Ricinus communis
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like               468   2e-154   
ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               468   2e-154   
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like               467   6e-154   
gb|AHX24364.1|  CYP76A26-like protein                                   467   8e-154   
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               464   5e-153   
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like               464   1e-152   
ref|XP_007027589.1|  Cytochrome P450 76A2                               466   3e-152   
gb|AHX24370.1|  CYP76A26                                                462   3e-152   
gb|AHK60833.1|  iridoid oxidase                                         462   4e-152   
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like               462   5e-152   
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like               462   5e-152   
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like               461   9e-152   
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                     459   2e-151   
gb|KDP26153.1|  hypothetical protein JCGZ_22834                         460   3e-151   
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg             460   4e-151   
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               459   5e-151   
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like               459   5e-151   
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like               459   1e-150   
gb|AHX24366.1|  CYP76A26-like protein                                   458   2e-150   
gb|AHX24369.1|  CYP76A26-like protein                                   457   3e-150   
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               457   3e-150   
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like               455   9e-150   
emb|CAN77400.1|  hypothetical protein VITISV_015278                     452   4e-149   Vitis vinifera
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like               454   5e-149   
gb|KDP43102.1|  hypothetical protein JCGZ_27051                         454   7e-149   
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like               452   2e-148   
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               451   7e-148   
gb|KDP20523.1|  hypothetical protein JCGZ_05069                         451   1e-147   
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                     450   1e-147   
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like               451   2e-147   
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                             450   2e-147   
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    450   2e-147   
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like               450   2e-147   
ref|XP_002528649.1|  cytochrome P450, putative                          448   1e-146   Ricinus communis
emb|CDY68641.1|  BnaCnng59890D                                          441   1e-146   
gb|AJD25180.1|  cytochrome P450 CYP76A36                                447   2e-146   
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like               446   8e-146   
gb|AHX24368.1|  CYP76A26-like protein                                   446   1e-145   
gb|KDP24880.1|  hypothetical protein JCGZ_25133                         445   1e-145   
gb|AHX24365.1|  CYP76A26-like protein                                   444   4e-145   
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like               444   5e-145   
gb|KDO61005.1|  hypothetical protein CISIN_1g0379902mg                  435   5e-145   
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    443   2e-144   
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                    442   2e-144   Vitis vinifera
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like               442   2e-144   
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               442   2e-144   
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like               442   2e-144   
ref|XP_002528653.1|  cytochrome P450, putative                          442   3e-144   Ricinus communis
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like               442   3e-144   
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like               442   3e-144   
sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    441   6e-144   Solanum melongena [aubergine]
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                   441   6e-144   
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    441   7e-144   
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like               441   8e-144   
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like               440   2e-143   Vitis vinifera
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like               440   2e-143   
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like               440   2e-143   
ref|XP_002528654.1|  cytochrome P450, putative                          440   2e-143   Ricinus communis
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               439   2e-143   
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg             439   4e-143   
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               439   5e-143   
gb|ABR17519.1|  unknown                                                 439   6e-143   Picea sitchensis
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               437   3e-142   
gb|KDP27489.1|  hypothetical protein JCGZ_20024                         434   5e-141   
gb|AGX93053.1|  geraniol 10-hydroxylase-like protein                    433   6e-141   
gb|KCW48764.1|  hypothetical protein EUGRSUZ_K02408                     430   1e-140   
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               432   1e-140   
ref|XP_006853497.1|  hypothetical protein AMTR_s00032p00215290          432   3e-140   
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like               431   5e-140   
sp|Q8VWZ7.1|C76B6_CATRO  RecName: Full=Geraniol 8-hydroxylase; Al...    430   9e-140   Catharanthus roseus [chatas]
gb|AGX93050.1|  geraniol 10-hydroxylase-like protein                    429   3e-139   
gb|AGX93054.1|  geraniol 10-hydroxylase-like protein                    426   2e-138   
dbj|BAP90522.1|  geraniol 10-hydroxylase                                426   4e-138   
ref|XP_006365964.1|  PREDICTED: geraniol 8-hydroxylase-like             425   7e-138   
gb|AGX93051.1|  geraniol 10-hydroxylase-like protein                    425   8e-138   
ref|XP_007040049.1|  Cytochrome P450, putative                          425   9e-138   
gb|AGX93052.1|  geraniol 10-hydroxylase-like protein                    424   1e-137   
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                     423   5e-137   
dbj|BAC53891.1|  cytochrome P450                                        423   6e-137   Petunia x hybrida [garden petunia]
ref|XP_010676619.1|  PREDICTED: geraniol 8-hydroxylase-like             423   2e-136   
ref|XP_010661587.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    421   2e-136   
ref|XP_011099226.1|  PREDICTED: geraniol 8-hydroxylase-like             421   2e-136   
ref|XP_011017516.1|  PREDICTED: geraniol 8-hydroxylase-like             421   2e-136   
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like             421   3e-136   Vitis vinifera
ref|XP_009780649.1|  PREDICTED: geraniol 8-hydroxylase-like             421   3e-136   
ref|XP_006360237.1|  PREDICTED: geraniol 8-hydroxylase-like             420   6e-136   
ref|XP_009624917.1|  PREDICTED: geraniol 8-hydroxylase-like             419   9e-136   
ref|XP_006365963.1|  PREDICTED: geraniol 8-hydroxylase-like             419   1e-135   
ref|XP_009613392.1|  PREDICTED: cytochrome P450 76A2-like               417   1e-135   
ref|XP_011013817.1|  PREDICTED: geraniol 8-hydroxylase-like             419   1e-135   
gb|KDP43097.1|  hypothetical protein JCGZ_27046                         419   2e-135   
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g             419   3e-135   Populus trichocarpa [western balsam poplar]
sp|D1MI46.1|C76BA_SWEMU  RecName: Full=Geraniol 8-hydroxylase; Al...    417   6e-135   Swertia mussotii
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               419   6e-135   
ref|XP_010691516.1|  PREDICTED: geraniol 8-hydroxylase-like             417   7e-135   
ref|XP_004248012.1|  PREDICTED: geraniol 8-hydroxylase-like             417   9e-135   
emb|CDP17802.1|  unnamed protein product                                417   1e-134   
ref|XP_010676979.1|  PREDICTED: geraniol 8-hydroxylase-like             417   1e-134   
ref|XP_010053037.1|  PREDICTED: geraniol 8-hydroxylase-like             416   2e-134   
ref|XP_010691514.1|  PREDICTED: geraniol 8-hydroxylase-like             416   2e-134   
ref|XP_009626597.1|  PREDICTED: geraniol 8-hydroxylase-like             415   6e-134   
ref|XP_002528650.1|  cytochrome P450, putative                          415   8e-134   Ricinus communis
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like             414   1e-133   
ref|XP_009777857.1|  PREDICTED: geraniol 8-hydroxylase-like             414   2e-133   
ref|XP_009780149.1|  PREDICTED: geraniol 8-hydroxylase-like             413   2e-133   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like             413   3e-133   
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    412   5e-133   
ref|XP_009782145.1|  PREDICTED: geraniol 8-hydroxylase-like             412   9e-133   
ref|XP_004233425.1|  PREDICTED: geraniol 8-hydroxylase-like             411   1e-132   
emb|CDP20559.1|  unnamed protein product                                410   3e-132   
ref|XP_009787971.1|  PREDICTED: geraniol 8-hydroxylase-like             410   4e-132   
ref|XP_009596429.1|  PREDICTED: geraniol 8-hydroxylase-like             409   8e-132   
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like             409   1e-131   
ref|XP_010508150.1|  PREDICTED: cytochrome P450 76C1 isoform X1         409   2e-131   
ref|NP_001268152.1|  ripening-related P-450 enzyme-like                 408   3e-131   
ref|XP_006360240.1|  PREDICTED: geraniol 8-hydroxylase-like             408   3e-131   
ref|XP_006360238.1|  PREDICTED: geraniol 8-hydroxylase-like             408   3e-131   
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...    408   3e-131   
ref|XP_010053039.1|  PREDICTED: geraniol 8-hydroxylase-like             408   3e-131   
ref|XP_006360236.1|  PREDICTED: geraniol 8-hydroxylase-like             407   6e-131   
ref|XP_004310057.1|  PREDICTED: geraniol 8-hydroxylase-like             407   6e-131   
ref|XP_006388387.1|  hypothetical protein POPTR_0201s00200g             407   6e-131   
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like             407   8e-131   
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               408   1e-130   
gb|AGI97015.1|  geraniol 10-hydroxylase                                 406   1e-130   
ref|XP_006853508.1|  hypothetical protein AMTR_s00032p00219670          406   2e-130   
ref|XP_010691493.1|  PREDICTED: geraniol 8-hydroxylase-like             406   2e-130   
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like               406   2e-130   
gb|AGX93055.1|  geraniol 10-hydroxylase-like protein                    405   2e-130   
ref|XP_002513347.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozym...    405   3e-130   Ricinus communis
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g             405   5e-130   Populus trichocarpa [western balsam poplar]
ref|XP_009794426.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    404   6e-130   
ref|XP_006358804.1|  PREDICTED: geraniol 8-hydroxylase-like             404   8e-130   
ref|XP_006494410.1|  PREDICTED: geraniol 8-hydroxylase-like             404   9e-130   
dbj|BAC53893.1|  cytochrome P450                                        405   1e-129   Petunia x hybrida [garden petunia]
ref|XP_002276094.1|  PREDICTED: geraniol 8-hydroxylase                  404   1e-129   Vitis vinifera
ref|XP_004241763.1|  PREDICTED: geraniol 8-hydroxylase-like             404   1e-129   
ref|XP_010544670.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    404   2e-129   
gb|EYU29984.1|  hypothetical protein MIMGU_mgv1a026778mg                403   2e-129   
ref|XP_004233427.1|  PREDICTED: geraniol 8-hydroxylase-like             403   2e-129   
ref|XP_010093536.1|  Cytochrome P450 76C4                               403   2e-129   
ref|XP_009613834.1|  PREDICTED: geraniol 8-hydroxylase-like             403   3e-129   
gb|KDO36667.1|  hypothetical protein CISIN_1g011040mg                   403   3e-129   
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                  403   3e-129   Vitis vinifera
gb|AAS92624.1|  cytochrome P450                                         403   3e-129   Hypericum androsaemum
ref|XP_002271652.1|  PREDICTED: geraniol 8-hydroxylase                  403   3e-129   Vitis vinifera
ref|XP_006360234.1|  PREDICTED: geraniol 8-hydroxylase-like             402   4e-129   
gb|AGT03776.1|  CYP76 hydroxylase                                       403   5e-129   
emb|CAN75686.1|  hypothetical protein VITISV_010578                     402   6e-129   Vitis vinifera
ref|XP_006358805.1|  PREDICTED: geraniol 8-hydroxylase-like             402   6e-129   
ref|XP_010523703.1|  PREDICTED: cytochrome P450 76C4-like               402   6e-129   
ref|XP_010518177.1|  PREDICTED: cytochrome P450 76C1-like               402   6e-129   
ref|XP_002301305.2|  cytochrome P450 family protein                     402   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    402   7e-129   
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...    400   8e-129   Solanum melongena [aubergine]
ref|XP_006423653.1|  hypothetical protein CICLE_v10028270mg             401   1e-128   
ref|XP_002301307.2|  cytochrome P450 family protein                     401   1e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010691517.1|  PREDICTED: geraniol 8-hydroxylase-like             401   1e-128   
gb|KDO57775.1|  hypothetical protein CISIN_1g011069mg                   401   1e-128   
ref|XP_004241762.2|  PREDICTED: geraniol 8-hydroxylase-like             416   1e-128   
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    402   2e-128   
emb|CDP04799.1|  unnamed protein product                                411   2e-128   
ref|XP_010544671.1|  PREDICTED: cytochrome P450 76C2-like isoform X2    401   2e-128   
ref|XP_009631781.1|  PREDICTED: geraniol 8-hydroxylase-like             400   2e-128   
ref|XP_006494538.1|  PREDICTED: geraniol 8-hydroxylase-like             409   2e-128   
ref|XP_006423672.1|  hypothetical protein CICLE_v10028278mg             400   2e-128   
ref|XP_006360239.1|  PREDICTED: geraniol 8-hydroxylase-like             400   3e-128   
ref|XP_006494407.1|  PREDICTED: geraniol 8-hydroxylase-like             400   3e-128   
ref|XP_006487694.1|  PREDICTED: geraniol 8-hydroxylase-like             400   3e-128   
gb|EPS67290.1|  hypothetical protein M569_07486                         400   3e-128   
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    400   3e-128   
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                  400   5e-128   Vitis vinifera
ref|XP_004233424.1|  PREDICTED: geraniol 8-hydroxylase-like             399   6e-128   
ref|NP_850439.1|  cytochrome P450 76C1                                  400   6e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506516.1|  PREDICTED: cytochrome P450 76C1-like               400   8e-128   
ref|XP_009610421.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    399   9e-128   
gb|KEH43873.1|  cytochrome P450 family protein                          399   9e-128   
emb|CBI33813.3|  unnamed protein product                                402   9e-128   
gb|ABR16112.1|  unknown                                                 397   1e-127   Picea sitchensis
ref|XP_006423671.1|  hypothetical protein CICLE_v10028269mg             399   1e-127   
ref|XP_003556053.1|  PREDICTED: geraniol 8-hydroxylase-like             399   1e-127   
ref|XP_007034575.1|  Cytochrome P450, putative                          400   1e-127   
ref|XP_010544668.1|  PREDICTED: cytochrome P450 76C1-like               399   2e-127   
gb|ACU20890.1|  unknown                                                 399   2e-127   Glycine max [soybeans]
gb|EYU44354.1|  hypothetical protein MIMGU_mgv11b004416mg               398   2e-127   
ref|XP_006451469.1|  hypothetical protein CICLE_v10008095mg             398   3e-127   
ref|XP_009626636.1|  PREDICTED: geraniol 8-hydroxylase-like             398   3e-127   
ref|XP_010687566.1|  PREDICTED: geraniol 8-hydroxylase-like             398   3e-127   
ref|XP_009757123.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    397   3e-127   
ref|XP_003521519.1|  PREDICTED: geraniol 8-hydroxylase-like             398   4e-127   
gb|KHG21745.1|  Cytochrome P450 protein                                 397   4e-127   
ref|XP_004233426.2|  PREDICTED: geraniol 8-hydroxylase-like             397   4e-127   
ref|XP_004496721.1|  PREDICTED: geraniol 8-hydroxylase-like             397   5e-127   
ref|XP_010692295.1|  PREDICTED: geraniol 8-hydroxylase-like             395   2e-126   
ref|XP_002301306.2|  hypothetical protein POPTR_0002s15150g             395   2e-126   
gb|AAQ05825.1|AF479661_1  cytochrome P450                               395   3e-126   
gb|EYU38602.1|  hypothetical protein MIMGU_mgv1a006828mg                393   3e-126   
ref|XP_010506515.1|  PREDICTED: cytochrome P450 76C4-like               396   4e-126   
emb|CDP11720.1|  unnamed protein product                                395   5e-126   
gb|KFK37346.1|  hypothetical protein AALP_AA4G244600                    395   5e-126   
ref|XP_011017515.1|  PREDICTED: geraniol 8-hydroxylase-like             394   6e-126   
ref|XP_002276121.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    392   1e-125   
ref|NP_182079.1|  cytochrome P450 76C4                                  394   1e-125   
gb|EYU36335.1|  hypothetical protein MIMGU_mgv1a004314mg                395   1e-125   
gb|AHK60842.1|  CYP76T24                                                393   2e-125   
ref|XP_010680509.1|  PREDICTED: geraniol 8-hydroxylase-like             393   2e-125   
ref|XP_009794425.1|  PREDICTED: geraniol 8-hydroxylase-like             393   2e-125   
ref|XP_006477329.1|  PREDICTED: geraniol 8-hydroxylase-like             392   5e-125   
gb|AJD25179.1|  cytochrome P450 CYP76A35                                392   5e-125   
gb|EPS66524.1|  hypothetical protein M569_08252                         392   7e-125   
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like             391   9e-125   
ref|XP_011069674.1|  PREDICTED: ferruginol synthase-like                391   1e-124   
ref|XP_010540267.1|  PREDICTED: geraniol 8-hydroxylase-like             391   1e-124   
ref|XP_006477330.1|  PREDICTED: geraniol 8-hydroxylase-like             391   1e-124   
ref|XP_010506518.1|  PREDICTED: cytochrome P450 76C2-like               392   1e-124   
ref|XP_009142346.1|  PREDICTED: cytochrome P450 76C4-like               391   1e-124   
emb|CDY37049.1|  BnaA04g26270D                                          391   1e-124   
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like             390   2e-124   
ref|XP_008222068.1|  PREDICTED: geraniol 8-hydroxylase-like             390   2e-124   
ref|XP_007209932.1|  hypothetical protein PRUPE_ppa004606mg             390   2e-124   
ref|XP_010680621.1|  PREDICTED: geraniol 8-hydroxylase-like             390   3e-124   
gb|KCW84353.1|  hypothetical protein EUGRSUZ_B01205                     387   3e-124   
ref|XP_002509653.1|  cytochrome P450, putative                          390   3e-124   
ref|XP_009757342.1|  PREDICTED: geraniol 8-hydroxylase-like             390   3e-124   
gb|KCW84356.1|  hypothetical protein EUGRSUZ_B01208                     387   4e-124   
emb|CBI30229.3|  unnamed protein product                                390   5e-124   
ref|XP_010518179.1|  PREDICTED: cytochrome P450 76C2-like               390   5e-124   
ref|XP_006360235.1|  PREDICTED: geraniol 8-hydroxylase-like             389   5e-124   
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg             389   5e-124   
ref|XP_011030061.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    390   6e-124   
ref|XP_006353352.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    389   8e-124   
ref|XP_004232059.1|  PREDICTED: geraniol 8-hydroxylase                  389   8e-124   
ref|XP_010540221.1|  PREDICTED: geraniol 8-hydroxylase-like             387   2e-123   
emb|CDY27377.1|  BnaC04g50280D                                          388   3e-123   
ref|XP_003528904.1|  PREDICTED: geraniol 8-hydroxylase-like             387   3e-123   
ref|XP_006419188.1|  hypothetical protein CICLE_v10030448mg             387   3e-123   
ref|XP_011069673.1|  PREDICTED: ferruginol synthase-like                388   3e-123   
gb|EMS49735.1|  Cytochrome P450 76C4                                    387   4e-123   
ref|XP_006440463.1|  hypothetical protein CICLE_v10019651mg             388   5e-123   
gb|KFK37347.1|  hypothetical protein AALP_AA4G244800                    387   6e-123   
gb|KHG26828.1|  Cytochrome P450 protein                                 386   7e-123   
ref|XP_006495031.1|  PREDICTED: geraniol 8-hydroxylase-like             385   8e-123   
ref|XP_011041604.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    386   1e-122   
ref|XP_006487474.1|  PREDICTED: geraniol 8-hydroxylase-like             386   1e-122   
ref|XP_006365980.1|  PREDICTED: geraniol 8-hydroxylase-like             385   1e-122   
ref|XP_011091126.1|  PREDICTED: geraniol 8-hydroxylase-like             385   1e-122   
ref|XP_006494719.1|  PREDICTED: geraniol 8-hydroxylase-like             385   1e-122   
emb|CDP17803.1|  unnamed protein product                                385   2e-122   
ref|XP_010103208.1|  Cytochrome P450 76C1                               386   2e-122   
ref|XP_010508144.1|  PREDICTED: cytochrome P450 76C2-like               386   2e-122   
ref|XP_009142348.1|  PREDICTED: cytochrome P450 76C4-like               386   2e-122   
ref|XP_006358811.1|  PREDICTED: geraniol 8-hydroxylase-like             385   2e-122   
gb|AJD25185.1|  cytochrome P450 CYP76S7                                 385   2e-122   
ref|XP_007225781.1|  hypothetical protein PRUPE_ppa004617mg             385   2e-122   
ref|XP_009372317.1|  PREDICTED: geraniol 8-hydroxylase-like             385   3e-122   
ref|XP_010911502.1|  PREDICTED: geraniol 8-hydroxylase-like             385   3e-122   
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like             385   3e-122   
ref|XP_011069677.1|  PREDICTED: ferruginol synthase-like                385   4e-122   
ref|XP_006423678.1|  hypothetical protein CICLE_v10028268mg             384   4e-122   
ref|XP_006338756.1|  PREDICTED: geraniol 8-hydroxylase-like             384   5e-122   
ref|XP_007224832.1|  hypothetical protein PRUPE_ppa023299mg             383   5e-122   
ref|XP_003589660.1|  Cytochrome P450 monooxygenase                      384   5e-122   
ref|XP_006494536.1|  PREDICTED: geraniol 8-hydroxylase-like             384   6e-122   
ref|XP_009777846.1|  PREDICTED: geraniol 8-hydroxylase-like             382   7e-122   
gb|KCW72821.1|  hypothetical protein EUGRSUZ_E01263                     382   9e-122   
ref|XP_009763140.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    383   1e-121   
ref|XP_006423673.1|  hypothetical protein CICLE_v10028257mg             383   1e-121   
gb|AES93118.1|  geraniol-10-hydroxylase                                 383   1e-121   
gb|AET02723.2|  cytochrome P450 family protein                          384   1e-121   
ref|XP_007227491.1|  hypothetical protein PRUPE_ppa004517mg             383   2e-121   
ref|XP_010692298.1|  PREDICTED: geraniol 8-hydroxylase-like             382   2e-121   
ref|XP_011069681.1|  PREDICTED: ferruginol synthase-like                382   2e-121   
ref|XP_006423715.1|  hypothetical protein CICLE_v10028276mg             382   3e-121   
ref|XP_008222093.1|  PREDICTED: geraniol 8-hydroxylase-like             382   3e-121   
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg             382   4e-121   
ref|XP_002318833.1|  hypothetical protein POPTR_0012s13580g             382   4e-121   
ref|XP_008222069.1|  PREDICTED: geraniol 8-hydroxylase-like             382   5e-121   
ref|XP_010648037.1|  PREDICTED: geraniol 8-hydroxylase-like             382   5e-121   
gb|ABF94963.1|  Cytochrome P450 family protein, expressed               382   5e-121   
gb|EYU32021.1|  hypothetical protein MIMGU_mgv1a005095mg                381   6e-121   
ref|XP_007224608.1|  hypothetical protein PRUPE_ppa026952mg             382   6e-121   
gb|AAZ07704.1|  cytochrome P450 monooxygenase isoform I                 381   7e-121   
ref|XP_010105779.1|  Cytochrome P450 76C4                               386   8e-121   
gb|ABK24553.1|  unknown                                                 381   1e-120   
ref|XP_006423660.1|  hypothetical protein CICLE_v10030225mg             380   1e-120   
gb|KCW77276.1|  hypothetical protein EUGRSUZ_D01633                     378   1e-120   
gb|EMT03552.1|  Cytochrome P450 76C4                                    381   1e-120   
ref|XP_009763139.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    381   1e-120   
ref|XP_011091100.1|  PREDICTED: geraniol 8-hydroxylase-like             380   1e-120   
emb|CBI38806.3|  unnamed protein product                                399   2e-120   
ref|XP_006423622.1|  hypothetical protein CICLE_v10028275mg             380   2e-120   
gb|EAY89257.1|  hypothetical protein OsI_10754                          380   2e-120   
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like             380   2e-120   
ref|XP_008437178.1|  PREDICTED: geraniol 8-hydroxylase-like             380   2e-120   
ref|XP_007226675.1|  hypothetical protein PRUPE_ppa021147mg             379   3e-120   
ref|XP_009803463.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    401   3e-120   
ref|XP_003610827.1|  Cytochrome P450                                    379   4e-120   
ref|XP_009372315.1|  PREDICTED: geraniol 8-hydroxylase-like             379   5e-120   
ref|XP_002882021.1|  CYP76C2                                            379   6e-120   
ref|XP_006338232.1|  PREDICTED: geraniol 8-hydroxylase-like             379   7e-120   
gb|KDP34502.1|  hypothetical protein JCGZ_11052                         378   9e-120   
ref|XP_010478790.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    378   1e-119   
ref|XP_010277464.1|  PREDICTED: geraniol 8-hydroxylase-like             378   1e-119   
ref|XP_009763141.1|  PREDICTED: geraniol 8-hydroxylase-like             378   1e-119   
ref|XP_010692294.1|  PREDICTED: geraniol 8-hydroxylase-like             377   2e-119   
ref|XP_009116769.1|  PREDICTED: cytochrome P450 76C3                    377   2e-119   
ref|XP_010662807.1|  PREDICTED: geraniol 8-hydroxylase                  377   3e-119   
ref|XP_011071574.1|  PREDICTED: geraniol 8-hydroxylase-like             377   3e-119   
emb|CDY37050.1|  BnaA04g26280D                                          377   4e-119   
ref|XP_006423714.1|  hypothetical protein CICLE_v10028277mg             377   4e-119   
ref|NP_182081.1|  cytochrome P450 76C2                                  377   4e-119   
ref|XP_011030058.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    377   4e-119   
gb|KHG20073.1|  Cytochrome P450 protein                                 376   5e-119   
ref|XP_006423661.1|  hypothetical protein CICLE_v10028273mg             376   5e-119   
ref|XP_010920218.1|  PREDICTED: geraniol 8-hydroxylase-like             376   6e-119   
ref|XP_010112571.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2    376   6e-119   
ref|XP_006487471.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    376   7e-119   
ref|XP_010544666.1|  PREDICTED: cytochrome P450 76C4-like               377   7e-119   
ref|XP_010499912.1|  PREDICTED: cytochrome P450 76C4-like               377   7e-119   
ref|XP_003610835.1|  Cytochrome P450                                    375   8e-119   
gb|EYU30850.1|  hypothetical protein MIMGU_mgv1a005599mg                375   8e-119   
ref|XP_006423676.1|  hypothetical protein CICLE_v10030057mg             375   8e-119   
ref|XP_010508143.1|  PREDICTED: cytochrome P450 76C2-like               376   8e-119   
ref|XP_003631468.1|  PREDICTED: geraniol 8-hydroxylase                  376   9e-119   
ref|XP_011030059.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    376   1e-118   
ref|XP_006649743.1|  PREDICTED: geraniol 8-hydroxylase-like             376   1e-118   
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg             374   1e-118   
ref|XP_003623781.1|  Cytochrome P450                                    375   1e-118   
gb|AES93793.2|  cytochrome P450 family 71 protein                       375   1e-118   
ref|XP_009372318.1|  PREDICTED: geraniol 8-hydroxylase-like             375   1e-118   
gb|EYU25446.1|  hypothetical protein MIMGU_mgv1a005044mg                375   2e-118   
ref|XP_003610828.1|  Cytochrome P450 monooxygenase                      374   2e-118   
ref|XP_004310184.1|  PREDICTED: geraniol 8-hydroxylase-like             375   2e-118   
ref|XP_011089001.1|  PREDICTED: geraniol 8-hydroxylase-like             375   2e-118   
ref|XP_004234365.2|  PREDICTED: probable (S)-N-methylcoclaurine 3...    375   2e-118   
ref|XP_004496849.1|  PREDICTED: geraniol 8-hydroxylase-like             375   2e-118   
ref|XP_006487449.1|  PREDICTED: geraniol 8-hydroxylase-like             375   2e-118   
ref|XP_006358802.1|  PREDICTED: geraniol 8-hydroxylase-like             374   2e-118   
ref|XP_003557080.2|  PREDICTED: geraniol 8-hydroxylase-like             374   3e-118   
gb|ADJ68324.1|  geraniol 10-hydroxylase                                 374   3e-118   
ref|XP_002318834.2|  hypothetical protein POPTR_0012s13620g             375   3e-118   
emb|CAN79423.1|  hypothetical protein VITISV_011260                     374   3e-118   
ref|XP_010324705.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    374   3e-118   
ref|XP_004492652.1|  PREDICTED: geraniol 8-hydroxylase-like             374   6e-118   
emb|CDP20560.1|  unnamed protein product                                373   7e-118   
ref|XP_004514899.1|  PREDICTED: geraniol 8-hydroxylase-like             374   8e-118   
gb|AET02720.2|  cytochrome P450 family protein                          374   9e-118   
ref|XP_011091088.1|  PREDICTED: ferruginol synthase-like                373   1e-117   
ref|XP_011091112.1|  PREDICTED: geraniol 8-hydroxylase-like             373   1e-117   
dbj|BAA28540.1|  cytochrome P450 monooxygenase                          373   1e-117   
ref|XP_002318835.2|  hypothetical protein POPTR_0012s13630g             373   1e-117   
ref|XP_006358837.1|  PREDICTED: geraniol 8-hydroxylase-like             371   1e-117   
sp|S4UX02.1|CYPH1_SALMI  RecName: Full=Ferruginol synthase; AltNa...    372   2e-117   
ref|XP_006353349.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    372   2e-117   
gb|AJD25181.1|  cytochrome P450 CYP76AH1                                372   2e-117   
ref|XP_008389819.1|  PREDICTED: geraniol 8-hydroxylase-like             373   2e-117   
ref|XP_011071197.1|  PREDICTED: geraniol 8-hydroxylase-like             372   2e-117   
ref|XP_009142349.1|  PREDICTED: cytochrome P450 76C3-like               373   2e-117   
ref|XP_009138804.1|  PREDICTED: cytochrome P450 76C4-like               372   2e-117   
emb|CDY52338.1|  BnaA09g38870D                                          372   2e-117   
ref|XP_002301302.2|  hypothetical protein POPTR_0002s15110g             369   3e-117   
ref|XP_006487435.1|  PREDICTED: geraniol 8-hydroxylase-like             372   3e-117   
ref|XP_006451465.1|  hypothetical protein CICLE_v10008099mg             372   3e-117   
ref|XP_006397736.1|  hypothetical protein EUTSA_v10001282mg             393   3e-117   
ref|XP_003558352.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...    372   3e-117   
ref|XP_011071509.1|  PREDICTED: geraniol 8-hydroxylase-like             372   3e-117   
emb|CAN81641.1|  hypothetical protein VITISV_036425                     370   4e-117   
ref|XP_007040766.1|  Cytochrome P450, putative                          385   5e-117   
ref|XP_004234364.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    371   5e-117   
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like             371   5e-117   
gb|EPS66962.1|  hypothetical protein M569_07814                         371   5e-117   
ref|XP_009142347.1|  PREDICTED: cytochrome P450 76C2-like               371   6e-117   
ref|XP_008390127.1|  PREDICTED: geraniol 8-hydroxylase-like             371   8e-117   
ref|XP_010108078.1|  Cytochrome P450 76C4                               370   9e-117   
ref|XP_010326943.1|  PREDICTED: geraniol 8-hydroxylase-like             370   1e-116   
ref|XP_008389814.1|  PREDICTED: geraniol 8-hydroxylase-like             370   1e-116   
ref|XP_007153084.1|  hypothetical protein PHAVU_003G005500g             370   1e-116   
ref|XP_010920219.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    370   1e-116   
gb|KEH43603.1|  cytochrome P450 family protein                          370   1e-116   
gb|ABR16821.1|  unknown                                                 370   2e-116   
ref|XP_009138803.1|  PREDICTED: cytochrome P450 76C4-like               370   2e-116   
ref|XP_004232060.1|  PREDICTED: geraniol 8-hydroxylase-like             370   2e-116   
emb|CDY37051.1|  BnaA04g26290D                                          384   2e-116   
gb|AET43292.1|  CYP76AD3                                                369   3e-116   
gb|AFK46798.1|  unknown                                                 370   3e-116   
ref|XP_006307271.1|  hypothetical protein CARUB_v10008885mg             370   3e-116   
ref|XP_010413500.1|  PREDICTED: cytochrome P450 76C3                    369   3e-116   
ref|XP_010069286.1|  PREDICTED: geraniol 8-hydroxylase-like             369   4e-116   
gb|KEH43874.1|  cytochrome P450 family protein                          369   4e-116   
emb|CAN83490.1|  hypothetical protein VITISV_001325                     369   6e-116   
ref|XP_002270541.1|  PREDICTED: geraniol 8-hydroxylase                  369   6e-116   
ref|XP_004147597.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...    367   7e-116   
ref|XP_007224897.1|  hypothetical protein PRUPE_ppa022132mg             368   8e-116   
ref|XP_009630529.1|  PREDICTED: geraniol 8-hydroxylase-like             368   1e-115   
ref|XP_003551637.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    368   1e-115   
ref|XP_010508139.1|  PREDICTED: cytochrome P450 76C3-like               368   1e-115   
ref|XP_008389839.1|  PREDICTED: geraniol 8-hydroxylase-like             367   2e-115   
gb|KFK37349.1|  hypothetical protein AALP_AA4G245200                    367   2e-115   
gb|AES79992.2|  cytochrome P450 family protein                          367   2e-115   
ref|XP_007222122.1|  hypothetical protein PRUPE_ppa004639mg             367   2e-115   
gb|AAF97287.1|AC010164_9  Putative cytochrome P450                      367   2e-115   
gb|KHG03596.1|  Cytochrome P450 protein                                 367   3e-115   
ref|XP_009774376.1|  PREDICTED: geraniol 8-hydroxylase-like             367   3e-115   
ref|XP_010105781.1|  7-ethoxycoumarin O-deethylase                      367   3e-115   
ref|XP_006358870.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    367   3e-115   
gb|KDP29429.1|  hypothetical protein JCGZ_18350                         366   3e-115   
ref|NP_174633.1|  cytochrome P450, family 76, subfamily C, polype...    367   4e-115   
ref|XP_010058414.1|  PREDICTED: geraniol 8-hydroxylase-like             364   4e-115   
ref|XP_004232063.1|  PREDICTED: geraniol 8-hydroxylase-like             366   4e-115   
ref|XP_004310205.1|  PREDICTED: geraniol 8-hydroxylase-like             377   5e-115   
ref|XP_007219031.1|  hypothetical protein PRUPE_ppa004503mg             366   7e-115   
ref|XP_002509713.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozym...    366   7e-115   



>ref|XP_010654031.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=515

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/509 (79%), Positives = 446/509 (88%), Gaps = 1/509 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YE+ G V+ L+ W  WAM+ ER HRRLEE+G LPPGPR WPVVGNIFQLGW PHVSF+
Sbjct  1     MEYEMVGIVIALVLWAVWAMVTERRHRRLEELGQLPPGPRSWPVVGNIFQLGWAPHVSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA KHGPIMTLWLGSMSTVVISS+E AREMFKNHDVVLAGRKIYEAMKGD GNEGS+IT
Sbjct  61    KLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRKIYEAMKGDRGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG  WRMLRRLCT+EFFVTSRLDA+RGVR  CID MV+++ EAG SGT AIDVGRF F
Sbjct  121   AQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFVTEAGTSGTHAIDVGRFIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SERGA+FFYHAGKVME AG+PNVADF P+LRW DPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVMELAGRPNVADFLPILRWFDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
              TQFHV +AF IAG ++KERME+M  G  + K KD++DVLL++RGD VE P+RFSSRTIN
Sbjct  241   KTQFHVERAFAIAGGFIKERMETMAKGSGEAKSKDFLDVLLEFRGDGVEEPSRFSSRTIN  300

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
             VI+FEMFTAGTDTTTSTLEWAM ELLH P  L KVQAELRSVV     KLEE  +E LPY
Sbjct  301   VIVFEMFTAGTDTTTSTLEWAMAELLHTPRILNKVQAELRSVV-KPGSKLEEKDMENLPY  359

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             L AVIKETLRLHPPLPFLVPHMAM+SC MLGY IPKETQ+LVNVWAIGRDPKTWKDPL F
Sbjct  360   LIAVIKETLRLHPPLPFLVPHMAMNSCKMLGYCIPKETQVLVNVWAIGRDPKTWKDPLVF  419

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
              PERFLEPNM D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LHSF+WVL  G+ 
Sbjct  420   MPERFLEPNMVDYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHSFNWVLPDGLN  479

Query  1701  PSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             P +MDM ERMGITLRK+ PL+A+PVPYKG
Sbjct  480   PKEMDMTERMGITLRKSVPLRAMPVPYKG  508



>ref|XP_009793679.1| PREDICTED: cytochrome P450 76A1 [Nicotiana sylvestris]
Length=506

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/509 (80%), Positives = 450/509 (88%), Gaps = 3/509 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YEI G VLLLL WVAWAM+ ER  RRLEE+G LPPGPR W +V NIFQ G+ PHVSF+
Sbjct  1     MEYEILGLVLLLLLWVAWAMVTERRQRRLEELGQLPPGPRWWQLVTNIFQSGFAPHVSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA+K+GPIMTLWLGSMSTVVISS++ AREMFKNHD+VLAGRKIYEAMKGDFGNEGSLIT
Sbjct  61    KLATKYGPIMTLWLGSMSTVVISSNDVAREMFKNHDMVLAGRKIYEAMKGDFGNEGSLIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
              QYG HWRMLRRL T EFFVTSRLDA+RG RTKCID MV+++ +AGN GT +IDVGRFFF
Sbjct  121   NQYGPHWRMLRRLSTKEFFVTSRLDAMRGTRTKCIDQMVQFIGDAGNFGTTSIDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+S RGAKFFYHAGKVMEFAGKPN+ADFFP+LR +DPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSNRGAKFFYHAGKVMEFAGKPNMADFFPILRCIDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
              TQFHV  AFDIAG +L+ERME M    ++E  KDY+DVLLQYRGD VEGP++FSSRTIN
Sbjct  241   KTQFHVKMAFDIAGGFLRERMEDMK--NDEEMNKDYLDVLLQYRGDGVEGPSKFSSRTIN  298

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
             VILFEM TAGTDTTTSTLEWAM ELLHNP++LQK+Q ELR ++  T KKLEE  ++KLPY
Sbjct  299   VILFEMLTAGTDTTTSTLEWAMAELLHNPTTLQKIQVELRKIINPT-KKLEEKDLDKLPY  357

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             L AVIKETLRLHPPLPFLVPHMAMDSC MLGYYIPKETQILVNVWAIGRDPKTWKDPLKF
Sbjct  358   LNAVIKETLRLHPPLPFLVPHMAMDSCTMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  417

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
             KPERFLEPNM D+KG HFEFIPFGSGRRMCPA+PL SR+LPLALGSVL  FDWVL  GM+
Sbjct  418   KPERFLEPNMVDYKGQHFEFIPFGSGRRMCPAIPLVSRVLPLALGSVLQKFDWVLADGMK  477

Query  1701  PSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             P  +DM ERMGITL+KA PLKAIP+ YKG
Sbjct  478   PEDLDMNERMGITLKKAIPLKAIPIAYKG  506



>ref|XP_006341260.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=509

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/507 (79%), Positives = 453/507 (89%), Gaps = 3/507 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YEI G VLLLLAWVAWA++ ER  RRLEE G LPPGPR W +V NIFQ G+ PHVSF+
Sbjct  1     MEYEILGLVLLLLAWVAWAILTERRQRRLEEYGRLPPGPRWWQLVTNIFQSGFAPHVSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA+KHGPIMTLWLGSM+TVVISS+E AREMFKNHD+VLAGRKIYE+MKGD GNEGSLIT
Sbjct  61    KLANKHGPIMTLWLGSMTTVVISSNEVAREMFKNHDIVLAGRKIYESMKGDIGNEGSLIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
              QYG  WRMLRRLCTTEFF+TSRLDA+RGVRTKCID M+++M +AGNSGT +IDVGRFFF
Sbjct  121   NQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTKCIDQMIKFMEDAGNSGTTSIDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LMSFNLIGNL+ SKDL+DP S+RGAKFFYHAGKVMEFAGKPN+AD+F +LR LDPQGIRR
Sbjct  181   LMSFNLIGNLLISKDLVDPTSDRGAKFFYHAGKVMEFAGKPNIADYFTILRCLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
              TQFHV +AFDIAG YL+ERM+ +  G  +E+KKDY+DVLLQYRGD VEGP+RFSS+TIN
Sbjct  241   KTQFHVRRAFDIAGGYLRERMDDIENG--EERKKDYLDVLLQYRGDGVEGPSRFSSQTIN  298

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
              ILFEMFTAGTDTTTSTLEWAM ELLHNP++LQKVQAELR V+  +  KLEE  ++KLPY
Sbjct  299   TILFEMFTAGTDTTTSTLEWAMAELLHNPTTLQKVQAELRRVINPS-NKLEEEDLDKLPY  357

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             L AVIKETLRLHPPLPFLVPHMAMDSC MLGY+IPKETQILVN+WAIGRDPKTWKDPLKF
Sbjct  358   LNAVIKETLRLHPPLPFLVPHMAMDSCTMLGYHIPKETQILVNIWAIGRDPKTWKDPLKF  417

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
             KPERFLEPNM D+KGHHFEFIPFGSGRRMCPA+PLASRMLPL LGSVLH FDWVL +G++
Sbjct  418   KPERFLEPNMIDYKGHHFEFIPFGSGRRMCPAVPLASRMLPLTLGSVLHKFDWVLANGVK  477

Query  1701  PSQMDMKERMGITLRKATPLKAIPVPY  1781
             P  +DM ERMG+TL+KA PLKAIP  Y
Sbjct  478   PENLDMNERMGMTLKKAIPLKAIPCLY  504



>gb|KCW47877.1| hypothetical protein EUGRSUZ_K01623, partial [Eucalyptus grandis]
Length=514

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/510 (78%), Positives = 448/510 (88%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYE+ G ++ LL WV WAM+ ER HRRLEE G LPPGPR WPVVGNIFQL WTPH SF+
Sbjct  1     MDYEVVGLIIALLLWVLWAMVTERCHRRLEERGRLPPGPRWWPVVGNIFQLSWTPHKSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA ++GPIMTLWLGSM TVVISSDE AREMFKNHDVVLAGRKIYEAMKGD+ NEGS+IT
Sbjct  61    NLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRKIYEAMKGDYSNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRL TTEFFV  RLDA   VR++C+D MVR++ +AG SGT +IDVGRFFF
Sbjct  121   AQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIEDAGESGTKSIDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+S+RGAKFFYHAGKVME AGKPNVADF P+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVMELAGKPNVADFLPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGG-NDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KERMESM  G   ++++KD++DVLL++RGD  E P++FSSRTI
Sbjct  241   NTQFHVERAFEIAGQFIKERMESMREGEVAEDRRKDFLDVLLEFRGDGAEEPSKFSSRTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTSTLEWAM ELLHNP +L KVQ+ELRS + G  +K EE  +E LP
Sbjct  301   NVIVFEMFTAGTDTTTSTLEWAMAELLHNPHTLAKVQSELRSTI-GLNRKFEEKDVEILP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVIKETLRLHPPLPFLVPHMAM SC MLGYYIPKETQ+LVNVWAIGRDPKTWK+PLK
Sbjct  360   YLKAVIKETLRLHPPLPFLVPHMAMSSCKMLGYYIPKETQVLVNVWAIGRDPKTWKEPLK  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPN AD+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LH+FDWVL  G 
Sbjct  420   FKPERFLEPNTADYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHAFDWVLAGGT  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P +MDM ERMGITLRKA PLKAIP+P+ G
Sbjct  480   KPEEMDMSERMGITLRKAVPLKAIPIPHGG  509



>ref|XP_010036342.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=523

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/510 (78%), Positives = 448/510 (88%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYE+ G ++ LL WV WAM+ ER HRRLEE G LPPGPR WPVVGNIFQL WTPH SF+
Sbjct  1     MDYEVVGLIIALLLWVLWAMVTERCHRRLEERGRLPPGPRWWPVVGNIFQLSWTPHKSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA ++GPIMTLWLGSM TVVISSDE AREMFKNHDVVLAGRKIYEAMKGD+ NEGS+IT
Sbjct  61    NLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRKIYEAMKGDYSNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRL TTEFFV  RLDA   VR++C+D MVR++ +AG SGT +IDVGRFFF
Sbjct  121   AQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIEDAGESGTKSIDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+S+RGAKFFYHAGKVME AGKPNVADF P+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVMELAGKPNVADFLPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGG-NDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KERMESM  G   ++++KD++DVLL++RGD  E P++FSSRTI
Sbjct  241   NTQFHVERAFEIAGQFIKERMESMREGEVAEDRRKDFLDVLLEFRGDGAEEPSKFSSRTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTSTLEWAM ELLHNP +L KVQ+ELRS + G  +K EE  +E LP
Sbjct  301   NVIVFEMFTAGTDTTTSTLEWAMAELLHNPHTLAKVQSELRSTI-GLNRKFEEKDVEILP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVIKETLRLHPPLPFLVPHMAM SC MLGYYIPKETQ+LVNVWAIGRDPKTWK+PLK
Sbjct  360   YLKAVIKETLRLHPPLPFLVPHMAMSSCKMLGYYIPKETQVLVNVWAIGRDPKTWKEPLK  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPN AD+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LH+FDWVL  G 
Sbjct  420   FKPERFLEPNTADYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHAFDWVLAGGT  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P +MDM ERMGITLRKA PLKAIP+P+ G
Sbjct  480   KPEEMDMSERMGITLRKAVPLKAIPIPHGG  509



>ref|XP_009626046.1| PREDICTED: cytochrome P450 76A1 [Nicotiana tomentosiformis]
Length=506

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/490 (80%), Positives = 437/490 (89%), Gaps = 3/490 (1%)
 Frame = +3

Query  318   MINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMST  497
             M+ ER  RRLEE+G LPPGPR W +V NIFQ G+ PHVSF++LA+K+GPIMTLWLGSMST
Sbjct  20    MVTERRQRRLEELGQLPPGPRWWQLVTNIFQSGFAPHVSFAKLATKYGPIMTLWLGSMST  79

Query  498   VVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFF  677
             VVISS++ AREMFKNHD+VLAGRKIYEAMKGDFGNEGSLIT QYG HWRMLRRL T EFF
Sbjct  80    VVISSNDVAREMFKNHDMVLAGRKIYEAMKGDFGNEGSLITNQYGPHWRMLRRLSTKEFF  139

Query  678   VTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             VTSRLD +RG RTKCID MV+++ +AGNSGT +IDVGRFFFLM+FNLIGNLMFSKDLLDP
Sbjct  140   VTSRLDVMRGTRTKCIDQMVKFIGDAGNSGTTSIDVGRFFFLMAFNLIGNLMFSKDLLDP  199

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
             +S RGAKFFYHAGKVMEFAGKPN+ADFFP+LR +DPQGIRR TQFHV  AFDIAG +LKE
Sbjct  200   KSNRGAKFFYHAGKVMEFAGKPNMADFFPILRSIDPQGIRRKTQFHVKMAFDIAGGFLKE  259

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
             RME M    ++E KKDY+DVLLQYRGD VEGP++FSSRTINVILFEMFTAGTDTTTSTLE
Sbjct  260   RMEDMK--NDEEMKKDYLDVLLQYRGDGVEGPSKFSSRTINVILFEMFTAGTDTTTSTLE  317

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WAM ELLHNP++LQKVQ ELR V+  T +KLEE  ++KLPYLKAVIKETLRLHPPLPFLV
Sbjct  318   WAMAELLHNPNTLQKVQVELRRVINPT-RKLEEEDLDKLPYLKAVIKETLRLHPPLPFLV  376

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             PHMAMDSC MLGYYIPKETQ+LVNVWAIGRDP TWK+PLKFKPERFL+PNM D+KG HFE
Sbjct  377   PHMAMDSCTMLGYYIPKETQVLVNVWAIGRDPTTWKNPLKFKPERFLKPNMVDYKGQHFE  436

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
             FIPFGSGRRMCPA+PLASR+LPLALGSVL  FDWVL  G++P  +DM ERMGITL+KA P
Sbjct  437   FIPFGSGRRMCPAIPLASRVLPLALGSVLQKFDWVLADGVKPEDLDMNERMGITLKKAIP  496

Query  1758  LKAIPVPYKG  1787
             LKAIP+ YKG
Sbjct  497   LKAIPIAYKG  506



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/509 (79%), Positives = 446/509 (88%), Gaps = 1/509 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YE+ G V+ L+ W  WAM+ ER HRRLEE+G LPPGPR WPVVGNIFQLGW PHVSF+
Sbjct  19    MEYEMVGIVIALVLWAVWAMVTERRHRRLEELGQLPPGPRSWPVVGNIFQLGWAPHVSFA  78

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA KHGPIMTLWLGSMSTVVISS+E AREMFKNHDVVLAGRKIYEAMKGD GNEGS+IT
Sbjct  79    KLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRKIYEAMKGDRGNEGSIIT  138

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG  WRMLRRLCT+EFFVTSRLDA+RGVR  CID MV+++ EAG SGT AIDVGRF F
Sbjct  139   AQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFVTEAGTSGTHAIDVGRFIF  198

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SERGA+FFYHAGKVME AG+PNVADF P+LRW DPQGIRR
Sbjct  199   LMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVMELAGRPNVADFLPILRWFDPQGIRR  258

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
              TQFHV +AF IAG ++KERME+M  G  + K KD++DVLL++RGD VE P+RFSSRTIN
Sbjct  259   KTQFHVERAFAIAGGFIKERMETMAKGSGEAKSKDFLDVLLEFRGDGVEEPSRFSSRTIN  318

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
             VI+FEMFTAGTDTTTSTLEWAM ELLH P  L KVQAELRSVV     KLEE  +E LPY
Sbjct  319   VIVFEMFTAGTDTTTSTLEWAMAELLHTPRILNKVQAELRSVV-KPGSKLEEKDMENLPY  377

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             L AVIKETLRLHPPLPFLVPHMAM+SC MLGY IPKETQ+LVNVWAIGRDPKTWKDPL F
Sbjct  378   LIAVIKETLRLHPPLPFLVPHMAMNSCKMLGYCIPKETQVLVNVWAIGRDPKTWKDPLVF  437

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
              PERFLEPNM D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LHSF+WVL  G+ 
Sbjct  438   MPERFLEPNMVDYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHSFNWVLPDGLN  497

Query  1701  PSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             P +MDM ERMGITLRK+ PL+A+PVPYKG
Sbjct  498   PKEMDMTERMGITLRKSVPLRAMPVPYKG  526


 Score =   478 bits (1230),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 236/471 (50%), Positives = 324/471 (69%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP+ GNIF LG  PH   + L   +G ++ L LG + T+V+ S +AA E+FKN
Sbjct  564   LPPGPPGWPIFGNIFDLGTLPHQKLAGLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKN  623

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  + R I+E M+    NE SL  A YG +WR LRRL T +     R++    +R KC
Sbjct  624   HDLSFSDRSIHETMRVHQYNESSLSLAPYGPYWRSLRRLVTVDMLTMKRINETVPIRRKC  683

Query  723   IDHMVRYMREA--GNSGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHA  893
             +D ++ ++ E   G  GTA  +++GRFFFL +FN+IGNLM S+DLLDP+S +G++FF   
Sbjct  684   VDDLLLWIEEEARGMDGTATGLELGRFFFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAM  743

Query  894   GKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDE  1073
                ME +G  N ADFFP L+WLDPQG+++  +  + K+ +IA  ++KERM    A   + 
Sbjct  744   RISMESSGHTNFADFFPWLKWLDPQGLKKRMEVDLGKSIEIASGFVKERMRQGRA--EES  801

Query  1074  KKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             K+KD++DVLL+++GD  +   + S + IN+ + EMF A ++TT+ST+EWAMTELL +P S
Sbjct  802   KRKDFLDVLLEFQGDGKDEATKISEKGINIFITEMFMAASETTSSTMEWAMTELLRSPES  861

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             + KV+AEL  V+ G ++KLEE  ++ LPYL AV+KETLRLHP  PFLVP  A++    +G
Sbjct  862   MTKVKAELGRVI-GEKRKLEESDLDDLPYLHAVVKETLRLHPAAPFLVPRRAVEDTKFMG  920

Query  1434  YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             Y+IPK TQ+ VNVWAIGR+ +TW D L FKPERF++ NM D+KG +FEFIPFG+GRR+C 
Sbjct  921   YHIPKGTQVFVNVWAIGREAETWDDALCFKPERFVDSNM-DYKGQNFEFIPFGAGRRICV  979

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKA  1766
              +PLA R+L   LGS+LH FDW L   + P  MDMKER GI + K  PLKA
Sbjct  980   GIPLAYRVLHFVLGSLLHHFDWQLERNVTPETMDMKERRGIVICKFHPLKA  1030



>ref|XP_004246575.1| PREDICTED: cytochrome P450 76A1-like [Solanum lycopersicum]
Length=514

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/507 (78%), Positives = 449/507 (89%), Gaps = 3/507 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YEI G +LLLLAW AWA++ ER  RRLEE G LPPGPR W ++ NIFQ G+ PHVSF+
Sbjct  1     MEYEILGLLLLLLAWAAWAILTERRQRRLEEYGRLPPGPRWWQLLANIFQSGFAPHVSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA+KHGP+MTLWLGSM+T+VISS+E AREMFKNHD+VLAGRKIYE+MKGD GNEGSLIT
Sbjct  61    KLANKHGPMMTLWLGSMTTIVISSNEVAREMFKNHDIVLAGRKIYESMKGDIGNEGSLIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
              QYG  WRMLRRLCTTEFF+TSRLDA+RGVRTKCID M+ +M +A NS T +IDVGRFFF
Sbjct  121   NQYGPQWRMLRRLCTTEFFITSRLDAMRGVRTKCIDQMLEFMEDAANSSTTSIDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LMSFNLIGNLM SKDL+DP S+RGAKFFYHAGKVME+AGKPN+AD+F +LR LDPQGIRR
Sbjct  181   LMSFNLIGNLMISKDLVDPTSDRGAKFFYHAGKVMEYAGKPNIADYFTILRCLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
              TQFHV +AF IAG+YL+ERME +    +DE+KKDY+DVLL+YRGD VEGP+RFSS+TIN
Sbjct  241   KTQFHVRRAFAIAGEYLRERMEDIE--NSDERKKDYLDVLLRYRGDGVEGPSRFSSQTIN  298

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
              ILFEMFTAGTDTTTSTLEWAM ELLHNP++LQKVQ ELR V+  + KKLEE  ++KL Y
Sbjct  299   TILFEMFTAGTDTTTSTLEWAMAELLHNPTTLQKVQDELRRVINPS-KKLEEEDLDKLSY  357

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             L AVIKETLRLHPPLPFLVPHMAMDSCNMLGY+IPKETQILVNVWAIGRDPKTWKDPLKF
Sbjct  358   LNAVIKETLRLHPPLPFLVPHMAMDSCNMLGYHIPKETQILVNVWAIGRDPKTWKDPLKF  417

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
             KPERFLEPNM D+KGHHFEFIPFGSGRRMCPA+PLASRMLPL LGS+LH FDWVL +G++
Sbjct  418   KPERFLEPNMVDYKGHHFEFIPFGSGRRMCPAVPLASRMLPLTLGSILHKFDWVLANGVK  477

Query  1701  PSQMDMKERMGITLRKATPLKAIPVPY  1781
             P  +DM ERMG+TL+KA PLKAIP  Y
Sbjct  478   PQDLDMNERMGMTLKKAIPLKAIPCLY  504



>ref|XP_010038981.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48371.1| hypothetical protein EUGRSUZ_K02081 [Eucalyptus grandis]
Length=523

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/510 (77%), Positives = 448/510 (88%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YE+ G ++ LL WV WAM+ ER HRRLEE G LPPGPR WPVVGNIFQL WTPH SF+
Sbjct  1     MNYEVVGLIIALLLWVLWAMVTERRHRRLEERGQLPPGPRWWPVVGNIFQLSWTPHKSFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA ++GPIMTLWLGSM TVVISSDE AREMF+NHDVVLAGRKIYEAMKGD+ NEGS+IT
Sbjct  61    NLAREYGPIMTLWLGSMCTVVISSDEVAREMFRNHDVVLAGRKIYEAMKGDYSNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRL TTEFFV  RLDA+  VR++C+D MVR++ +AG SGT +IDVGRFFF
Sbjct  121   AQYGPHWRMLRRLSTTEFFVARRLDAMESVRSRCVDRMVRFIEDAGESGTKSIDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+S+RGAKFFYHAGKVME AGKPNVADF P+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVMELAGKPNVADFLPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGG-NDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KERMESM  G   ++++KD++DVLL++RGD  E P+ FSSRTI
Sbjct  241   NTQFHVERAFEIAGQFIKERMESMREGEVAEDRRKDFLDVLLEFRGDGAEEPSEFSSRTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTSTLEWAM ELLHNP +L KVQ+ELRS + G  +K EE  +E LP
Sbjct  301   NVIVFEMFTAGTDTTTSTLEWAMAELLHNPHTLAKVQSELRSTI-GLNRKFEEKDVEILP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVIKETLRLHPPLPFLVPHMAM SC MLGYYIPKETQ+LVNVWAIGRDPKTWKDP+K
Sbjct  360   YLKAVIKETLRLHPPLPFLVPHMAMSSCKMLGYYIPKETQVLVNVWAIGRDPKTWKDPMK  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPN AD+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LH+FDWVL  G 
Sbjct  420   FKPERFLEPNTADYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHAFDWVLAGGT  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P +MDM ERMGITLRKA PLKAIP+P+ G
Sbjct  480   KPEEMDMSERMGITLRKAVPLKAIPIPHGG  509



>ref|XP_006439139.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
 gb|ESR52379.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
Length=512

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/499 (78%), Positives = 431/499 (86%), Gaps = 17/499 (3%)
 Frame = +3

Query  318   MINERSHRRLEEV--GALPPGPRRWPVVGNIFQLGWTP---HVSFSELASKHGPIMTLWL  482
             M+ +R HR  EE+    LPPGPR WPVVGNIFQLGW P   H SF+ LA KHGP+MTLWL
Sbjct  21    MVTKRRHRHKEELERQRLPPGPRWWPVVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWL  80

Query  483   GSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLC  662
             GSM TVV+SS+E AR+MFKNHDVVLAGRKIYEAMKGD+G EGS+IT+QYG HWRMLRRLC
Sbjct  81    GSMCTVVVSSNEVARDMFKNHDVVLAGRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLC  140

Query  663   TTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSK  842
             TTEFFVTSRLDA RGVR+KCID MV+++ EAG    A IDVGRF FLM+FNLIGNLMFSK
Sbjct  141   TTEFFVTSRLDATRGVRSKCIDRMVQFVEEAG--ACAPIDVGRFTFLMAFNLIGNLMFSK  198

Query  843   DLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAG  1022
             DLL P SERGAKF YHAGKVME AGKPNVADF P+LRWLDPQGIR+ TQFHV +AF+IAG
Sbjct  199   DLLGPESERGAKFSYHAGKVMELAGKPNVADFLPILRWLDPQGIRKKTQFHVERAFEIAG  258

Query  1023  DYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTT  1202
              ++KERME      N+EKKKD++DVLL +RGD V+ PA+FSSRTINVI+FEMFTAGTDTT
Sbjct  259   GFIKERMED-----NEEKKKDFLDVLLAFRGDGVDEPAKFSSRTINVIVFEMFTAGTDTT  313

Query  1203  TSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPP  1382
             TSTLEWAM ELLH+P +L+KVQ ELRSVV    KKLEE  IE+LPYLKAVIKETLRLHPP
Sbjct  314   TSTLEWAMAELLHDPETLKKVQDELRSVV-SPNKKLEEEDIEQLPYLKAVIKETLRLHPP  372

Query  1383  LPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPN----M  1550
             LPFLVPHMAMDSCNM GYYIPKETQILVNVWAIGRDPKTWKDPL FKPERFLEP     M
Sbjct  373   LPFLVPHMAMDSCNMQGYYIPKETQILVNVWAIGRDPKTWKDPLLFKPERFLEPTNYNMM  432

Query  1551  ADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERM  1730
              D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LHSFDWVL  G++P +MDM ERM
Sbjct  433   VDYKGHHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLHSFDWVLADGLKPEEMDMTERM  492

Query  1731  GITLRKATPLKAIPVPYKG  1787
             GITLRK+ PLKAIP+PY+G
Sbjct  493   GITLRKSVPLKAIPIPYRG  511



>ref|XP_007027586.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY08088.1| Cytochrome P450 [Theobroma cacao]
Length=1008

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/508 (77%), Positives = 449/508 (88%), Gaps = 2/508 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YEI G  + LL WVAWAM+  R HRRLEE+G LPPGPR WPVVGNIFQLGW PH SF+
Sbjct  1     MEYEILGLSITLLLWVAWAMVTGR-HRRLEELGQLPPGPRWWPVVGNIFQLGWAPHESFA  59

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA +HGPIMTLWLGSMSTVVISS+E AREMFKNHDVVLAGRKIYEAMKGDFG+EGSLIT
Sbjct  60    KLARQHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRKIYEAMKGDFGHEGSLIT  119

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             +QYG HWRMLRRLCTTEFFVTSRLDA++GVR +C+D MV+++  AG +GT ++DVGRFFF
Sbjct  120   SQYGSHWRMLRRLCTTEFFVTSRLDAMQGVRERCVDRMVQFVEGAGANGTNSVDVGRFFF  179

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNL+FSKDLLD +SERGAKFFYHAGKVME AGKPNVADF P LR LDPQGIRR
Sbjct  180   LMAFNLIGNLIFSKDLLDTKSERGAKFFYHAGKVMELAGKPNVADFLPFLRCLDPQGIRR  239

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
              TQFHV +AF+IAG+++KERMESM  G    K+KD++DVLL++RGD VE P++FSSRT+N
Sbjct  240   KTQFHVKRAFEIAGEFIKERMESMENGDYKGKRKDFLDVLLEFRGDGVEAPSKFSSRTVN  299

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
             VI+FEMFTAGTDTTTSTLEWAM ELLHNP +++ VQAELRS +    KKLEE  IEKLPY
Sbjct  300   VIVFEMFTAGTDTTTSTLEWAMAELLHNPKTMKVVQAELRSTL-DPGKKLEEKDIEKLPY  358

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             LKAVIKETLRLHPPLPFLVPHMAM+SC MLGY+IPKETQ+LVNVWAIGRD  TW++PL+F
Sbjct  359   LKAVIKETLRLHPPLPFLVPHMAMNSCKMLGYHIPKETQVLVNVWAIGRDSTTWQEPLEF  418

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
             KPERFLE N  D+KGHHFEFIPFGSGRRMCPA+PLASR+LP+ALGS+LHSFDW L  G++
Sbjct  419   KPERFLEANTVDYKGHHFEFIPFGSGRRMCPAVPLASRLLPMALGSLLHSFDWTLADGLK  478

Query  1701  PSQMDMKERMGITLRKATPLKAIPVPYK  1784
             P  +DM ERMGI+LRK+ PLKA+P+P+K
Sbjct  479   PEDVDMTERMGISLRKSVPLKAVPIPHK  506


 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 399/485 (82%), Gaps = 4/485 (1%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWT--PHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             R  +E G LPPGPRRWPV GNIFQL W   PH+S ++LA +HGPI TLWLGSM TVVISS
Sbjct  525   RHFQEPGQLPPGPRRWPVAGNIFQLSWREPPHLSITKLACQHGPITTLWLGSMCTVVISS  584

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRL  692
              E AREMFKNHDVVLAGRKIYE+MKG++GNEGS+IT+QYG HWRMLRRLCT EFFV+SRL
Sbjct  585   GEVAREMFKNHDVVLAGRKIYESMKGNYGNEGSIITSQYGSHWRMLRRLCTMEFFVSSRL  644

Query  693   DALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERG  872
             DA++GVR+KC+D MV +++ A   GT AID+GRFF L++FNLIGNL+FS DLLDP+SERG
Sbjct  645   DAMKGVRSKCVDQMVEFIQNASAFGTNAIDIGRFFLLLTFNLIGNLLFSYDLLDPKSERG  704

Query  873   AKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESM  1052
             A   YH GKV+EFAG PNVADFFP+L+  DPQGIRR  QFH+  AF I  ++++ER E+ 
Sbjct  705   ANLLYHTGKVIEFAGTPNVADFFPILKRFDPQGIRRKAQFHIEHAFRIVREFIEERTETT  764

Query  1053  NAGGNDEK-KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
               G N  K +KDY+DVLL++ GD +  P+RFSS TINVI+ EMFTAGTDTT  TLEWAM 
Sbjct  765   ENGYNGGKTRKDYLDVLLEFDGDDIGKPSRFSSTTINVIVLEMFTAGTDTTAGTLEWAMA  824

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELLHNP  L+K+QAELRS + G+ +KLEE  IE LPYL +VIKETLRLHPPLPFLVPHMA
Sbjct  825   ELLHNPPILKKLQAELRSTI-GSGRKLEEKDIENLPYLNSVIKETLRLHPPLPFLVPHMA  883

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
             M+SC MLGY IPKETQILVNVWAIG+DP TW DPL+FKPERFLE N  D+KG HFEFIPF
Sbjct  884   MNSCKMLGYKIPKETQILVNVWAIGQDPNTWDDPLEFKPERFLELNNMDYKGQHFEFIPF  943

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             GSGRRMCPA+ LASR+LPLALG++LHSFDW+L  G++P  MDM  RM +TLRK+ PL  I
Sbjct  944   GSGRRMCPAVSLASRVLPLALGTLLHSFDWILAGGLKPEDMDMTGRMAMTLRKSVPLNVI  1003

Query  1770  PVPYK  1784
              +PYK
Sbjct  1004  ALPYK  1008



>ref|XP_006482365.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=508

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/499 (77%), Positives = 429/499 (86%), Gaps = 17/499 (3%)
 Frame = +3

Query  318   MINERSHRRLEEV--GALPPGPRRWPVVGNIFQLGWTP---HVSFSELASKHGPIMTLWL  482
             M+ +R HR  EE+    LPPGPR WPVVGNIFQLGW P   H SF+ LA KHGP+MTLWL
Sbjct  17    MVTKRRHRHKEELERQRLPPGPRWWPVVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWL  76

Query  483   GSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLC  662
             GSM TVV+SS+E AR+MFKNHDVVLAGRKIYEAMKGD+G EGS+IT+QYG HWRMLRRLC
Sbjct  77    GSMCTVVVSSNEVARDMFKNHDVVLAGRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLC  136

Query  663   TTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSK  842
             TTEFFVTSRLDA RGVR+KCID MV+++ EA     A IDVGRF FLM+FNLIGNLMFSK
Sbjct  137   TTEFFVTSRLDATRGVRSKCIDRMVQFVEEA--EACAPIDVGRFIFLMAFNLIGNLMFSK  194

Query  843   DLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAG  1022
             DLL P SERGAKF YHAGKVME AGKPNVADF P+LRWLDPQGIR+ TQFHV +AF+IAG
Sbjct  195   DLLGPESERGAKFSYHAGKVMELAGKPNVADFLPILRWLDPQGIRKKTQFHVERAFEIAG  254

Query  1023  DYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTT  1202
              ++KERME      N+EKKKD++DVLL + GD V+ PA+FSSRTINVI+FEMFTAGTDTT
Sbjct  255   GFIKERMED-----NEEKKKDFLDVLLAFHGDGVDEPAKFSSRTINVIVFEMFTAGTDTT  309

Query  1203  TSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPP  1382
             TSTLEWAM ELLH+P +L+KVQ ELRSVV    KKLEE  IE+LPYLKAVIKETLRLHPP
Sbjct  310   TSTLEWAMAELLHDPETLKKVQDELRSVV-SPNKKLEEEDIEQLPYLKAVIKETLRLHPP  368

Query  1383  LPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPN----M  1550
             LPFLVPHMAMDSCNM GYYIPKETQILVNVWAIGRDPKTWKDPL FKPERFLEP     M
Sbjct  369   LPFLVPHMAMDSCNMQGYYIPKETQILVNVWAIGRDPKTWKDPLLFKPERFLEPTNYNMM  428

Query  1551  ADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERM  1730
              ++KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+LHSFDWVL  G++P +MDM ERM
Sbjct  429   VEYKGHHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLHSFDWVLADGLKPEEMDMTERM  488

Query  1731  GITLRKATPLKAIPVPYKG  1787
             GITLRK+ PLKAIP+PY+G
Sbjct  489   GITLRKSVPLKAIPIPYRG  507



>ref|XP_008241321.1| PREDICTED: cytochrome P450 76A1 [Prunus mume]
Length=516

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/499 (77%), Positives = 434/499 (87%), Gaps = 10/499 (2%)
 Frame = +3

Query  318   MINERSHRRLEEV-GALPPGPRRWPVVGNIFQLGW-TPHVSFSELASKHGPIMTLWLGSM  491
             ++     RRLEEV G LPPGPR WPVVGNIFQLG   PH SF+ LA  HGPIMTLWLGSM
Sbjct  13    LVTHLRRRRLEEVAGHLPPGPRWWPVVGNIFQLGLGPPHESFAILARNHGPIMTLWLGSM  72

Query  492   STVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTE  671
             STVVISS + AREMFKNHDVVLAGRKIYEAMKGD+GNEGSLITAQYG HWRMLRRLCTTE
Sbjct  73    STVVISSSQVAREMFKNHDVVLAGRKIYEAMKGDYGNEGSLITAQYGPHWRMLRRLCTTE  132

Query  672   FFVTSRLDALRGVRTKCIDHMVRYMREAG---NSGTAAIDVGRFFFLMSFNLIGNLMFSK  842
             FFVTSRLDA+  VR KCID MV+++ +A    ++ T  ID+GRF FLM+FNLIGNLMFSK
Sbjct  133   FFVTSRLDAMCRVRAKCIDGMVQFIEDAASEMSTKTDGIDLGRFIFLMAFNLIGNLMFSK  192

Query  843   DLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAG  1022
             DLLDP+SERGA FFYHAGKVME AGKPN+ADFFP+LRWLDPQGIRR TQFHV KAF+IAG
Sbjct  193   DLLDPKSERGAMFFYHAGKVMELAGKPNMADFFPILRWLDPQGIRRNTQFHVEKAFEIAG  252

Query  1023  DYLKERMESMNAGGND--EKKKDYMDVLLQYRGDLVEGPARF-SSRTINVILFEMFTAGT  1193
             ++++ERMESM  GG D  E+ KD++DVLL+YRGD V+ P+RF SSRT+NVI+FEMFTAGT
Sbjct  253   EFIRERMESMENGGYDGIERTKDFLDVLLEYRGDGVDEPSRFSSSRTVNVIVFEMFTAGT  312

Query  1194  DTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRL  1373
             DTTTSTLEWAM+ELL+NP +L+KVQAELRS +  ++ KL+E  IE LPYLKAVIKETLRL
Sbjct  313   DTTTSTLEWAMSELLNNPKTLKKVQAELRSTISSSD-KLQEKDIENLPYLKAVIKETLRL  371

Query  1374  HPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMA  1553
             HPPLPFLVPHMAMDSC MLG++IPK TQILVNVWAIGRDPKTW+DPL FKPERFLEPNMA
Sbjct  372   HPPLPFLVPHMAMDSCKMLGHHIPKGTQILVNVWAIGRDPKTWEDPLLFKPERFLEPNMA  431

Query  1554  -DFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERM  1730
              D+KG HF+FIPFGSGRRMCPA+PL SR+LPLALGS+LHSFDWVL  G+EP  MDM ERM
Sbjct  432   VDYKGQHFKFIPFGSGRRMCPAVPLVSRVLPLALGSLLHSFDWVLPEGLEPENMDMAERM  491

Query  1731  GITLRKATPLKAIPVPYKG  1787
             GITLRK+ PLK IP+PY+G
Sbjct  492   GITLRKSVPLKVIPIPYQG  510



>ref|XP_011036815.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=517

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/511 (76%), Positives = 440/511 (86%), Gaps = 3/511 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WVAWA++ ER +RR EE G LPPGPR  PVVGNIFQLGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVAWAVVTERRYRRSEEQGQLPPGPRPLPVVGNIFQLGWAPHESFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA  HGPIMT+WLGSMS VVISS E AREMFKNHD VLAGRKIYEAMKGDFGNEGS+IT
Sbjct  61    KLARVHGPIMTIWLGSMSNVVISSSEVAREMFKNHDAVLAGRKIYEAMKGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLD+++G RT+CID M++Y+ +   +GT+AID+GR+ F
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDSMQGARTRCIDGMLQYIEDGSANGTSAIDLGRYIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SERGAKFF HAGKVME AGKPN+ADF P+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSERGAKFFQHAGKVMELAGKPNMADFLPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGN--DEKKKDYMDVLLQYRGDLVEGPARFSSRT  1154
              TQFHV +AF+IAG ++KER ESM    N  D+K+KDY+DVLL++RGD VE P+RFSS T
Sbjct  241   KTQFHVARAFEIAGGFIKERTESMQKEINSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTT  300

Query  1155  INVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKL  1334
             INVI+FEMFTAGTDTTTSTLEWAM ELL NP  L+ VQ+ELRS + G  KKLE+  IE L
Sbjct  301   INVIVFEMFTAGTDTTTSTLEWAMAELLRNPKVLKTVQSELRSTI-GPNKKLEDKDIENL  359

Query  1335  PYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPL  1514
             PYLKAVI+ETLRLHPPLPFLVPHMAM+ C MLGYYIPKET ILVNVWAIGRD KTW DPL
Sbjct  360   PYLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPL  419

Query  1515  KFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHG  1694
              FKPERFLEPNM D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+L +FDW+L  G
Sbjct  420   VFKPERFLEPNMVDYKGHHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLLTFDWILPDG  479

Query  1695  MEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             ++P  MDM E+MGITLRK+ PLK IP PYKG
Sbjct  480   LKPEDMDMTEKMGITLRKSVPLKVIPTPYKG  510



>ref|XP_002528643.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33746.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/513 (74%), Positives = 436/513 (85%), Gaps = 6/513 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMIN-ERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSF  437
             MD  I G +L +L WVAW MI  ER +  +EE   LPPGPR  P+VGN+FQLGW+PH SF
Sbjct  1     MDITIPGLILAILIWVAWGMITKERRNHDMEEQTQLPPGPRWLPIVGNMFQLGWSPHESF  60

Query  438   SELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI  617
             ++LA  HGPIMT+WLGSM TVVISSD AA +MFKNHD+VLAGRKIYEAMKGD GNEGS+I
Sbjct  61    AKLARIHGPIMTIWLGSMCTVVISSDRAAHDMFKNHDMVLAGRKIYEAMKGDIGNEGSII  120

Query  618   TAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFF  797
             T+QYG HWRMLRRLC+TEFFVTSRLDA+RGVR++CID MV+++ EA  +GT AIDVGRFF
Sbjct  121   TSQYGSHWRMLRRLCSTEFFVTSRLDAMRGVRSRCIDGMVQFIEEASGNGTQAIDVGRFF  180

Query  798   FLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIR  977
             FLMSFNLIGNL+FSKDLLDP+SE+G+KFFYHAGKVME AG+PN+ADF P+ RW DPQGIR
Sbjct  181   FLMSFNLIGNLLFSKDLLDPKSEKGSKFFYHAGKVMELAGRPNIADFLPIFRWFDPQGIR  240

Query  978   RMTQFHVNKAFDIAGDYLKERMESMNAGGNDE---KKKDYMDVLLQYRGDLV-EGPARFS  1145
             R TQ HV KAF+IAG ++KER+E M  GG+ E   KKKD++DVLL +RGD V E   RFS
Sbjct  241   RNTQLHVRKAFEIAGGFIKERIEGMENGGDGETKKKKKDFLDVLLDFRGDDVKEKSYRFS  300

Query  1146  SRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHI  1325
             S TIN+I+FEMFTAGTDTTTSTLEWAM ELL NP  L+KVQAE+RS + G+ KKLEE  I
Sbjct  301   STTINIIVFEMFTAGTDTTTSTLEWAMAELLRNPKELKKVQAEIRSTI-GSNKKLEEKDI  359

Query  1326  EKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWK  1505
             + LPYLKAVIKETLRLHPPLPFLVPHMAM+SCNMLGY IPK TQILVNVWAIGRDPK W 
Sbjct  360   DNLPYLKAVIKETLRLHPPLPFLVPHMAMESCNMLGYRIPKGTQILVNVWAIGRDPKIWD  419

Query  1506  DPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVL  1685
             DPL F+PERFLEP M D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+L+SFDWVL
Sbjct  420   DPLIFRPERFLEPKMVDYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLNSFDWVL  479

Query  1686  GHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
               G+    MDM E+MGITLRK+ PL+AIPVPYK
Sbjct  480   ADGLRAENMDMSEKMGITLRKSVPLRAIPVPYK  512



>ref|XP_007201998.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
 gb|EMJ03197.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
Length=528

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/488 (77%), Positives = 426/488 (87%), Gaps = 9/488 (2%)
 Frame = +3

Query  348   EEVGALPPGPRRWPVVGNIFQLGW-TPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAA  524
             E  G LPPGPR WP+VGNIFQLG   PH SF+ LA  HGPIMTLWLGSMSTVVISS + A
Sbjct  36    EVAGHLPPGPRWWPMVGNIFQLGLGPPHESFAMLARNHGPIMTLWLGSMSTVVISSSQVA  95

Query  525   REMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALR  704
             REMFKNHDVVLAGRKIYEAMKGD+GNEGSLITAQYG HWRMLRRLCTTEFFVTSR+DA+ 
Sbjct  96    REMFKNHDVVLAGRKIYEAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTSRIDAMC  155

Query  705   GVRTKCIDHMVRYMREAG---NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGA  875
              VR KCID MV+++ +A    ++ T  ID+GRF FLM+FNLIGNLMFSKDLLDP+SERGA
Sbjct  156   RVRAKCIDGMVQFIEDAASEMSTKTDGIDLGRFIFLMAFNLIGNLMFSKDLLDPKSERGA  215

Query  876   KFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMN  1055
              FFYHAGKVME AGKPN+ADFFP+LRWLDPQGIRR TQFHV KAF+IAG++++ERMESM 
Sbjct  216   MFFYHAGKVMELAGKPNMADFFPILRWLDPQGIRRNTQFHVEKAFEIAGEFIRERMESME  275

Query  1056  AGGND--EKKKDYMDVLLQYRGDLVEGPARF-SSRTINVILFEMFTAGTDTTTSTLEWAM  1226
              GGND  E+ KD++DVLL+YRGD V+ P+RF SSRT+NVI+FEMFTAGTDTTTSTLEWAM
Sbjct  276   NGGNDGIERTKDFLDVLLEYRGDGVDEPSRFSSSRTVNVIVFEMFTAGTDTTTSTLEWAM  335

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
              ELL+NP +L+KVQAELRS +  ++ KL+E  IE LPYLKAVIKETLRLHPPLPFLVPHM
Sbjct  336   AELLNNPKTLKKVQAELRSTISSSD-KLQEKDIENLPYLKAVIKETLRLHPPLPFLVPHM  394

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNM-ADFKGHHFEFI  1583
             AMDSC MLG++IPK TQILVNVWAIGRDPKTW+DPL FKPERFLEPNM  D+KG HFEFI
Sbjct  395   AMDSCKMLGHHIPKGTQILVNVWAIGRDPKTWEDPLLFKPERFLEPNMDVDYKGQHFEFI  454

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFGSGRRMCPA+PL SR+LPLALGS+LHSFDWVL  G+EP  MDM ERMGITLRK+ PLK
Sbjct  455   PFGSGRRMCPAVPLVSRVLPLALGSLLHSFDWVLPEGLEPENMDMAERMGITLRKSVPLK  514

Query  1764  AIPVPYKG  1787
              IP+PY+G
Sbjct  515   VIPIPYQG  522



>ref|XP_010112509.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33897.1| Cytochrome P450 76A2 [Morus notabilis]
Length=517

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/516 (76%), Positives = 445/516 (86%), Gaps = 8/516 (2%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             M+YE+ G V L+L W+AWA++ ER HRR EE+G LPPGPR WPVVGNIFQL  TPH SF 
Sbjct  1     MNYEVLGLVTLVLLWIAWAVVIERRHRRPEELGRLPPGPRWWPVVGNIFQLDRTPHKSFV  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA  HGPIMTLWLGSMSTVVISS E AREMFKNHD+VLAGRKIYEAMKG+  NEGSLIT
Sbjct  61    KLAQTHGPIMTLWLGSMSTVVISSHEVAREMFKNHDMVLAGRKIYEAMKGEQSNEGSLIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLDA++GVR +CID MV ++ +A   GT+ +DVGRFFF
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDAMQGVRARCIDRMVNFIDDASAHGTSPVDVGRFFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LMSFNLIGNLMFSKDLLDP+SERGAKFF+HAGKVME AGKPNVADF P+LRW+DPQGIRR
Sbjct  181   LMSFNLIGNLMFSKDLLDPKSERGAKFFFHAGKVMELAGKPNVADFLPVLRWIDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMN-----AGGNDEK--KKDYMDVLLQYRGDLVEGPAR  1139
              TQFHV +AF+IAG ++KER ES          ND+K  ++D++DVLL++RG+ VE P++
Sbjct  241   KTQFHVERAFEIAGGFIKERTESTKNEQKVVETNDKKDEREDFLDVLLEFRGNGVEEPSK  300

Query  1140  FSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEY  1319
             FSSRTINVI+FEMFTAGTDTTTSTLEWAM ELLHNP +L KVQ+ELR  V G  KKL+E 
Sbjct  301   FSSRTINVIVFEMFTAGTDTTTSTLEWAMAELLHNPKTLNKVQSELRRTV-GPNKKLDES  359

Query  1320  HIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKT  1499
              IE LPYLKAVIKETLRLHPPLPFLVPHMAMDSC MLGYYIPKETQILVNVWAIGRDPKT
Sbjct  360   DIENLPYLKAVIKETLRLHPPLPFLVPHMAMDSCKMLGYYIPKETQILVNVWAIGRDPKT  419

Query  1500  WKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDW  1679
             W++PL+FKPERFL PNM DFKGH+FEFIPFGSGRRMCPA+PLASR+LPLALGS+L SFDW
Sbjct  420   WENPLEFKPERFLGPNMVDFKGHNFEFIPFGSGRRMCPAVPLASRVLPLALGSLLLSFDW  479

Query  1680  VLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             VL  G+ P  MDM ERMGITLRKA PLK +P+P+KG
Sbjct  480   VLAEGLMPDDMDMTERMGITLRKAVPLKVLPIPFKG  515



>ref|XP_011101481.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
 ref|XP_011101482.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
Length=511

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/512 (72%), Positives = 431/512 (84%), Gaps = 9/512 (2%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRL-EEVGALPPGPRRWPVVGNIFQL---GWTPH  428
             MDYEI G V+ LL W A   +  +  RRL EE+G LPPGPR WPVVGNIFQL    + PH
Sbjct  1     MDYEIAGLVMALLLWAAAWALLAQRTRRLQEELGRLPPGPRPWPVVGNIFQLLGAAFAPH  60

Query  429   VSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEG  608
              SF++LA KHGP+MTL LGSM+TVVISS EAAR MFKNHDVVLAGRKIYE+MK + GNEG
Sbjct  61    QSFAKLAKKHGPVMTLHLGSMTTVVISSSEAARVMFKNHDVVLAGRKIYESMKSEIGNEG  120

Query  609   SLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVG  788
             SLITAQYG  WRMLRRLCTTEFF  + LDA+RGVR KC+  MV+Y+R+A  +G   IDVG
Sbjct  121   SLITAQYGPRWRMLRRLCTTEFFAAAPLDAMRGVRAKCVHQMVQYIRDAAANGL-GIDVG  179

Query  789   RFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQ  968
             RFFFLM+FNLIGNL+FSKDLLDP SE GAKFFYHAGK MEFAGKPNVADF P+L+ +DPQ
Sbjct  180   RFFFLMAFNLIGNLIFSKDLLDPESETGAKFFYHAGKAMEFAGKPNVADFLPMLKRVDPQ  239

Query  969   GIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSS  1148
             GIRR TQFHV + FDIAG++LKERME       ++K++DY+DVLL+Y GD  E    F+ 
Sbjct  240   GIRRRTQFHVKRGFDIAGEFLKERME--KGSSVEKKRRDYLDVLLEYGGDGEEEHVGFAP  297

Query  1149  RTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIE  1328
              TIN+I+FEMF+AGTDTTTSTLEWAM ELLHNP +L KVQAELR+ +    KKL+E  +E
Sbjct  298   TTINIIVFEMFSAGTDTTTSTLEWAMAELLHNPQTLHKVQAELRTAI-PPGKKLQEEDLE  356

Query  1329  KLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKD  1508
              LPYL+AVIKETLRLHPPLPFLVPHMAMDSCNMLG+++PKETQILVNVWAIGRDPKTWKD
Sbjct  357   HLPYLRAVIKETLRLHPPLPFLVPHMAMDSCNMLGFHVPKETQILVNVWAIGRDPKTWKD  416

Query  1509  PLKFKPERFLEPNM-ADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVL  1685
             PL+F+PERFL+P+M AD+KG HFEFIPFGSGRR+CPALPLASR++PL LGSVLH+FDWVL
Sbjct  417   PLEFRPERFLDPDMAADYKGRHFEFIPFGSGRRICPALPLASRLMPLTLGSVLHAFDWVL  476

Query  1686  GHGMEPSQMDMKERMGITLRKATPLKAIPVPY  1781
               G++P++MDM+ERMGITLRKA P+KAIPVPY
Sbjct  477   ADGLKPAEMDMRERMGITLRKAVPVKAIPVPY  508



>ref|XP_011036810.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=516

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/510 (75%), Positives = 437/510 (86%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WV+WA++ ER +RR EE G LPPGPR  PVVGNIFQLGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVSWAVVTERRYRRSEEQGELPPGPRPLPVVGNIFQLGWAPHESFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
             +LA  HGPIMT+WLGSM  VV+SS E AREMFKNHD VLAGRKIYEAMKGDFGNEGS+IT
Sbjct  61    KLARVHGPIMTIWLGSMCNVVVSSSEVAREMFKNHDAVLAGRKIYEAMKGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLDA++G RT+CID M++Y+ +   +GT+AID+GR+ F
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIEDGSANGTSAIDLGRYIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SE+GAKFF HAGKVME AGKPN+ADF P+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVMELAGKPNMADFLPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG +++ER ESM      D+K+KDY+DVLL++RGD VE P+RFSS TI
Sbjct  241   KTQFHVARAFEIAGGFIEERTESMQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTST+EWAM ELL NP  L+ VQ+ELRS +G + KKLEE  IE LP
Sbjct  301   NVIVFEMFTAGTDTTTSTMEWAMAELLRNPKVLKTVQSELRSTIGPS-KKLEEKDIENLP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVI+ETLRLHPPLPFLVPHMAM+ C MLGYYIPKET ILVNVWAIGRD KTW DPL 
Sbjct  360   YLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLV  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPNM D+KG HFEFIPFGSGRRMCPA+PLASR+LPLALGS+L SFDW+L  G+
Sbjct  420   FKPERFLEPNMVDYKGSHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLLSFDWILPDGL  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P  +DM E+MGITLRK  PLK IP PYKG
Sbjct  480   KPEDIDMTEKMGITLRKNVPLKVIPAPYKG  509



>gb|KDP29244.1| hypothetical protein JCGZ_16633 [Jatropha curcas]
Length=518

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/517 (72%), Positives = 431/517 (83%), Gaps = 7/517 (1%)
 Frame = +3

Query  261   MDYEICGFvllllaw----vawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGW-TP  425
             MDY++ G   L            +I +R  R L+E   LPPGPRRWPVVGNIFQLG  +P
Sbjct  1     MDYQMVGLTALTSLLWITWAIVILITQRRRRHLKEKRPLPPGPRRWPVVGNIFQLGHRSP  60

Query  426   HVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNE  605
             H SF+ELA  HGPIMTLWLGSM T+V+SSD+ AREMFKNHD VLAGRKIYEAMKG+ G++
Sbjct  61    HESFTELALTHGPIMTLWLGSMCTIVVSSDKMAREMFKNHDAVLAGRKIYEAMKGNHGHD  120

Query  606   GSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDV  785
             GS+IT+QYG HWRMLRRL TTEFFVTSRLDA+R VR +CID +++++ EA  +G  A+DV
Sbjct  121   GSMITSQYGPHWRMLRRLATTEFFVTSRLDAMRTVRCRCIDELIKFIEEACGNGKNAVDV  180

Query  786   GRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDP  965
             GRFFFLM+FNLIGNLMFSKDLLDP+SE GA FFYHAGKVME AGKPN+ADFFP  RWLDP
Sbjct  181   GRFFFLMAFNLIGNLMFSKDLLDPKSETGATFFYHAGKVMEMAGKPNIADFFPFFRWLDP  240

Query  966   QGIRRMTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARF  1142
             QGIRR TQFHV KAF+IAG +++ERMES+      ++KKKD++DVLL++RGD VE P+RF
Sbjct  241   QGIRRNTQFHVEKAFEIAGGFIEERMESIKKENSKEDKKKDFLDVLLEFRGDGVEEPSRF  300

Query  1143  SSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYH  1322
             SSR INVI+FEMFTAGTDTTTSTLEWAM ELLHNP +L+KVQ ELRS +  + KKLEE  
Sbjct  301   SSRIINVIVFEMFTAGTDTTTSTLEWAMAELLHNPETLKKVQEELRSKISAS-KKLEEKD  359

Query  1323  IEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTW  1502
             IE LPYLKAVIKETLRLHPPLPFLVPH AMDSC MLGY+IPKETQILVNVWAIGRDPK W
Sbjct  360   IENLPYLKAVIKETLRLHPPLPFLVPHKAMDSCKMLGYHIPKETQILVNVWAIGRDPKIW  419

Query  1503  KDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWV  1682
              DPLKF+PERF EPNM D++GH+FEFIPFGSGRRMCPA+PLASR+LP  LGS+L SFDWV
Sbjct  420   NDPLKFRPERFFEPNMVDYRGHNFEFIPFGSGRRMCPAMPLASRVLPFTLGSLLLSFDWV  479

Query  1683  LGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG*C  1793
             L + ++P+ +DM ERMGITLRK+ PLKAIP+P K  C
Sbjct  480   LPNELKPNAIDMSERMGITLRKSIPLKAIPIPLKRCC  516



>gb|EYU38601.1| hypothetical protein MIMGU_mgv1a004436mg [Erythranthe guttata]
Length=527

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/520 (73%), Positives = 437/520 (84%), Gaps = 14/520 (3%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWT-----P  425
             MDYE+ G VL LL W AWA++ ER HRRLEE+G LPPGPR WPVVGN+ QL        P
Sbjct  1     MDYEVAGVVLALLLWAAWAVVTERRHRRLEELGRLPPGPRAWPVVGNMLQLAAAGSASAP  60

Query  426   HVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNE  605
             H SF+ELA +HG +MTL LGSM+TVV+SS EAAR MFKNHD VLAGRKIYE+MKGD GNE
Sbjct  61    HRSFAELAKQHGSVMTLHLGSMTTVVVSSSEAARVMFKNHDAVLAGRKIYESMKGDIGNE  120

Query  606   GSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNS-GTAAID  782
             GSLITAQ+G HWR LRRLCT EFF  + LDA+RGVR +C+D MV+Y+R+A ++ G  ++D
Sbjct  121   GSLITAQHGHHWRTLRRLCTAEFFAAAPLDAMRGVRARCVDQMVQYIRDASSAGGGGSVD  180

Query  783   VGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLD  962
             VG+FFFLM+FNLIGNLMFSKDLL P SERGAKFFYHAGKVMEFAGK NVADF P LRWLD
Sbjct  181   VGKFFFLMAFNLIGNLMFSKDLLGPESERGAKFFYHAGKVMEFAGKANVADFLPALRWLD  240

Query  963   PQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDE------KKKDYMDVLLQYRGDLV  1124
             PQ IRR TQFHV +AFD+AGD+L +R+  M   G+D       KKKDY+DVLL+YRGD V
Sbjct  241   PQRIRRRTQFHVKRAFDVAGDFLNDRIREMENSGDDVAESISIKKKDYLDVLLEYRGDDV  300

Query  1125  EGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEK  1304
               P+ FSS  INVI+FEMFTAGTDTTTSTLEWAM ELL  P +L++VQAELR+ +    K
Sbjct  301   AVPSIFSSTIINVIVFEMFTAGTDTTTSTLEWAMAELLRRPETLRRVQAELRATIPAG-K  359

Query  1305  KLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIG  1484
             KLEE ++EKLPYLKAVIKETLRLHPPLPFLVPH AMD+C M+GY+IPKETQILVNVWAIG
Sbjct  360   KLEEENLEKLPYLKAVIKETLRLHPPLPFLVPHKAMDTCKMMGYHIPKETQILVNVWAIG  419

Query  1485  RDPKTWKDPLKFKPERFLEP-NMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSV  1661
             RDPKTWKDPL+F+PERFL+P N AD+KGHHFEFIPFGSGRR+CPA+PLASR+LPLALGSV
Sbjct  420   RDPKTWKDPLEFRPERFLDPNNTADYKGHHFEFIPFGSGRRICPAVPLASRVLPLALGSV  479

Query  1662  LHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPY  1781
             LHSFDWVL  GM+P++MDM ERMGITLRKA PLKA+P+PY
Sbjct  480   LHSFDWVLADGMKPAEMDMGERMGITLRKAVPLKAVPIPY  519



>ref|XP_006382524.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
 gb|ERP60321.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
Length=516

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/509 (75%), Positives = 433/509 (85%), Gaps = 2/509 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WVAWA++ ER +RR EE G LPPGPR  PVVGNIFQLGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVAWAVVTERRYRRSEEQGQLPPGPRPLPVVGNIFQLGWAPHESFT  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA  HGPIMT+WLGSM  VVISS E AREMFKNHD VLAGRKIYEAMKGDFGNEGS+IT
Sbjct  61    NLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYEAMKGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLDA++G RT+CID M++Y+ +   +GT+AID+GR+ F
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIEDGSANGTSAIDLGRYIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SE+GAKFF HAGKVME AGKPN+ADF  +LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVMELAGKPNMADFLTILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KER ESM      D+K+KDY+DVLL++RGD VE P+RFSS TI
Sbjct  241   KTQFHVARAFEIAGGFIKERTESMQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTSTLEWAM ELL NP  L+ VQ+ELRS + G  KKLE+  IE LP
Sbjct  301   NVIVFEMFTAGTDTTTSTLEWAMAELLRNPKVLKTVQSELRSTI-GPNKKLEDKDIENLP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVI+ETLRLHPPLPFLVPHMAM+ C MLGYYIPKET ILVNVWAIGRD KTW DPL 
Sbjct  360   YLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLV  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLE NM D+KG HFEFIPFGSGRRMCPA+PLASR+LPLALGS+L SFDW+L  G+
Sbjct  420   FKPERFLESNMVDYKGRHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLLSFDWILPEGL  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             +P  MDM E+MGITLRK+ PLK IP PYK
Sbjct  480   KPEDMDMTEKMGITLRKSVPLKVIPTPYK  508



>ref|XP_006382522.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
 gb|ERP60319.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
Length=516

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/510 (75%), Positives = 436/510 (85%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WVAWA++ ER +RR EE G LPPGPR  PVVGNIFQLGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVAWAVVTERRYRRSEEQGQLPPGPRPLPVVGNIFQLGWAPHESFT  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA  HGPIMT+WLGSM  VVISS E AREMFKNHD VLAGRKIYEAMKGDFGNEGS+IT
Sbjct  61    NLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYEAMKGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFV+SRLDA++G RT+CID M++Y+ +   +GT AID+GR+ F
Sbjct  121   AQYGPHWRMLRRLCTTEFFVSSRLDAMQGARTRCIDGMLQYIEDGSANGTRAIDLGRYIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SE+GAKFF HAGKV E AGKPN+ADFFP+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVTELAGKPNMADFFPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KER ES+      D+K+KDY+DV+L++RGD VE P+RFSS TI
Sbjct  241   KTQFHVARAFEIAGGFIKERTESVQKENSRDDKRKDYLDVILEFRGDGVEEPSRFSSTTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTSTLEWAM ELL NP+ L+ VQ+ELRS++ G  KKLE+  +E LP
Sbjct  301   NVIVFEMFTAGTDTTTSTLEWAMAELLRNPTVLKTVQSELRSII-GPNKKLEDKDVENLP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVI+ETLRLHPPLPFLVPHMAM+ C MLGYY+PKET ILVNVWAIGRD KTW DPL 
Sbjct  360   YLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYVPKETTILVNVWAIGRDSKTWDDPLV  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLE NM D+KG HFEFIPFGSGRRMCPA+PLASR+LPLALGS+L SFDW+L  G+
Sbjct  420   FKPERFLEANMVDYKGRHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLLSFDWILPDGL  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P  MDM E++GITLRK+ PLK IP PYKG
Sbjct  480   KPENMDMTEKIGITLRKSVPLKVIPTPYKG  509



>ref|XP_006382520.1| hypothetical protein POPTR_0005s02940g [Populus trichocarpa]
 gb|ERP60317.1| hypothetical protein POPTR_0005s02940g [Populus trichocarpa]
Length=516

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/510 (74%), Positives = 432/510 (85%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WVAWA++ +R +RR EE G LPPGPR  PVVGNIF LGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVAWAVVTQRRYRRFEEQGQLPPGPRPLPVVGNIFLLGWAPHESFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA  HGPIMT+WLGSM  VVISS E AREMFKNHD VLAGRKIYEA++GDFGNEGS+IT
Sbjct  61    NLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYEAIRGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLDA++G RT+CID M++Y+ +   +GT+AID+GR+FF
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIEDDSANGTSAIDLGRYFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SE+GAKFF HAG V+E AGKPN+ADFFP+LRWLDPQG+RR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGIVLELAGKPNMADFFPILRWLDPQGVRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KER ES       D+K+KDY+DVLL++RGD VE P+RFSS TI
Sbjct  241   KTQFHVARAFEIAGGFIKERTESTQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             N I+ EMFTAGTDTTTSTLEWAM ELL NP+ ++ VQ+ELRS + G  KKLE+  IE LP
Sbjct  301   NAIVLEMFTAGTDTTTSTLEWAMAELLRNPNVMKTVQSELRSTI-GPNKKLEDKDIENLP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVI+ETLRLHPPLPFLVPHMAM+ C MLGYYIPKET ILVNVWAIGRD KTW DPL 
Sbjct  360   YLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLV  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPNM D+KG HFEFIPFGSGRRMCPA+PLASR+L LALGS+L SFDW+L  G+
Sbjct  420   FKPERFLEPNMVDYKGRHFEFIPFGSGRRMCPAMPLASRVLHLALGSLLLSFDWILPDGL  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P  MDM E++GITLRK  PLK IP PYKG
Sbjct  480   KPEDMDMTEKIGITLRKNVPLKVIPTPYKG  509



>ref|XP_002528644.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33747.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/510 (70%), Positives = 420/510 (82%), Gaps = 4/510 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSH-RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSF  437
             MDY+  G +L +   VAWAM+  R H    +E   LPPGPR  P+VGN+FQLG +P  SF
Sbjct  1     MDYQFAGLLLAIWILVAWAMVTRRHHYHSKKEQAQLPPGPRWLPIVGNMFQLGLSPQQSF  60

Query  438   SELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI  617
             ++LA  HGPIMT+WLGSM TVVISS+E AR+MFKNHD VLAGRKI EAMKG+  NEGS+I
Sbjct  61    AKLAGIHGPIMTIWLGSMCTVVISSNEVARDMFKNHDAVLAGRKILEAMKGEGNNEGSMI  120

Query  618   TAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFF  797
             TAQYGQHWRMLRRL TTEFF  SRLD+ +GVR++CID MV+++ EAG +GT AIDVGRF 
Sbjct  121   TAQYGQHWRMLRRLSTTEFFAASRLDSFQGVRSRCIDRMVQFVEEAGRNGTQAIDVGRFV  180

Query  798   FLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIR  977
             FLM+FNL+GNLMFSKDLLDP+SE+GAKFFYHAGKVME  G+PN+ADF P+ +W DPQGIR
Sbjct  181   FLMAFNLLGNLMFSKDLLDPKSEKGAKFFYHAGKVMELTGRPNIADFVPIFKWFDPQGIR  240

Query  978   RMTQFHVNKAFDIAGDYLKERMESMNAGGNDE-KKKDYMDVLLQYRGDLVEGPARFSSRT  1154
             R  QFHV +AF+IA  +++ERME+M  GG+DE KKKD++DVLL++RG   E   RFSS+T
Sbjct  241   RNAQFHVERAFEIASGFIRERMETMENGGSDEGKKKDFLDVLLEFRGH-NEETYRFSSKT  299

Query  1155  INVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKL  1334
             IN+I+FEMF AGTDTTTS LEWAM ELLHNP  L+ VQAE+RS +     KLEE  I+ L
Sbjct  300   INIIIFEMFMAGTDTTTSILEWAMAELLHNPKELENVQAEIRSTI-EPNNKLEEKDIDNL  358

Query  1335  PYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPL  1514
             PYLKAVIKE LRLHPPLPFLVPHMAMDSC M GYYIPKETQILVNVWAIGRDPK W  PL
Sbjct  359   PYLKAVIKEALRLHPPLPFLVPHMAMDSCKMQGYYIPKETQILVNVWAIGRDPKIWDKPL  418

Query  1515  KFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHG  1694
              FKPERFL   M D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLALGS+L++FDWVL  G
Sbjct  419   NFKPERFLGSKMLDYKGHHFEFIPFGSGRRMCPAVPLASRILPLALGSLLYAFDWVLADG  478

Query  1695  MEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             ++ S MDM E++GITLRK+ PL+AIP+P+K
Sbjct  479   LKVSDMDMSEKIGITLRKSIPLRAIPLPHK  508



>ref|XP_006382521.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
 gb|ERP60318.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
Length=516

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/510 (74%), Positives = 431/510 (85%), Gaps = 2/510 (0%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WVAWA++ +R +RR EE G LPPGPR  PVVGNIF LGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVAWAVVTQRRYRRSEEQGQLPPGPRPLPVVGNIFLLGWAPHESFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA  HGPIMT+WLGSM  VVISS E AREMFKNHD VLAGRKIYEA++GDFGNEGS+IT
Sbjct  61    NLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYEAIRGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLDA++G RT+CID M++Y+ +   +GT+AID+GR+ F
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIEDDSANGTSAIDLGRYIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SE+GAKFF HAGKV+E AGKPN+AD FP+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVVELAGKPNMADCFPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KER ES       D+K+KDY+DVLL++RGD VE P+RFSS TI
Sbjct  241   KTQFHVARAFEIAGGFIKERTESTQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             N I+ EMFTAGTDTTTSTLEWAM ELLHNP  ++ VQ+ELRS + G  KKLE+  IE LP
Sbjct  301   NAIVLEMFTAGTDTTTSTLEWAMAELLHNPKVMKTVQSELRSTI-GPNKKLEDKDIENLP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVI+ETLRLHPPLPFLV HMAM+ C MLGYYIPKET ILVNVWAIGRD KTW DPL 
Sbjct  360   YLKAVIRETLRLHPPLPFLVSHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLV  419

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPNM D+KG HFEFIPFGSGRRMCPA+PLASR+L LALGS+L SFDW+L  G+
Sbjct  420   FKPERFLEPNMVDYKGRHFEFIPFGSGRRMCPAMPLASRVLYLALGSLLLSFDWILPDGL  479

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P  MDM E++GITLRK+ PLK IP PYKG
Sbjct  480   KPEDMDMTEKIGITLRKSVPLKVIPTPYKG  509



>ref|XP_008392536.1| PREDICTED: cytochrome P450 76A1 [Malus domestica]
Length=529

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/497 (74%), Positives = 421/497 (85%), Gaps = 12/497 (2%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGW-TPHVSFSELASKHGPIMTLWLGSMSTVVI  506
             R  R  +  G LPPGPRRWPVVGNIFQLG   PH S + LA  HGPIMTLWLGSMSTVVI
Sbjct  30    RRWRSEDVAGQLPPGPRRWPVVGNIFQLGLGPPHESLAVLARNHGPIMTLWLGSMSTVVI  89

Query  507   SSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTS  686
             SS + AREMFKNHDV LAGRKIYEAMKGD+GNEGSLITAQYG HWRMLRRLCTTEFFVTS
Sbjct  90    SSSQVAREMFKNHDVALAGRKIYEAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTS  149

Query  687   RLDALRGVRTKCIDHMVRYMREAGN-------SGTAAIDVGRFFFLMSFNLIGNLMFSKD  845
             RLDA+RGVR KCID M++++ +A +       + T  ID+GRF FLM+FNLIGNL+FSKD
Sbjct  150   RLDAMRGVRGKCIDGMLQFIMDASSRTSSEISASTDGIDLGRFIFLMAFNLIGNLIFSKD  209

Query  846   LLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGD  1025
             LLDP+SERGA FFYHAGKVME AGKPN+ADFFP+LRWLDPQGIRR TQFHV KAF+IAG+
Sbjct  210   LLDPKSERGAMFFYHAGKVMELAGKPNMADFFPILRWLDPQGIRRNTQFHVEKAFEIAGE  269

Query  1026  YLKERMESMNAGGND--EKKKDYMDVLLQYRGDLVEGPARFSS-RTINVILFEMFTAGTD  1196
             ++KERMES   GG D  EK KD++DVLL+YRGD V+  +RF+S RTINVI+FEMFTAGTD
Sbjct  270   FIKERMESTENGGCDGIEKAKDFLDVLLEYRGDGVDEASRFTSPRTINVIVFEMFTAGTD  329

Query  1197  TTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLH  1376
             TTTSTLEWAM ELL +P +L+K QAELRS +     KL+E  IE LPYLK+VIKETLRLH
Sbjct  330   TTTSTLEWAMAELLTSPKALKKAQAELRSNIS-PGNKLQEKDIENLPYLKSVIKETLRLH  388

Query  1377  PPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMAD  1556
             PPLPFLVPHMAM+SC MLG++IPK+TQILVN WAIGRDPK W+DPL +KPERFL+P+M D
Sbjct  389   PPLPFLVPHMAMESCKMLGHHIPKDTQILVNAWAIGRDPKAWEDPLLYKPERFLKPDMVD  448

Query  1557  FKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGI  1736
             +KGH+FEFIPFGSGRR+CPA+PL SR+LPLALGS+LHSFDWVL  G++P  +DM ERMGI
Sbjct  449   YKGHNFEFIPFGSGRRICPAVPLVSRVLPLALGSLLHSFDWVLPSGLKPENIDMTERMGI  508

Query  1737  TLRKATPLKAIPVPYKG  1787
             TLRK+ PLK IP+PY G
Sbjct  509   TLRKSVPLKVIPIPYNG  525



>ref|XP_004303044.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=537

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/497 (75%), Positives = 421/497 (85%), Gaps = 17/497 (3%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTP-HVSFSELASKHGPIMTLWLGSMSTVVI  506
             R HR   ++  LPPGPR WPVVGNIFQLGW P H SF+ LA KHGPIMTLWLGSM+TVVI
Sbjct  27    RRHRS-GKLRQLPPGPRWWPVVGNIFQLGWAPPHESFAILARKHGPIMTLWLGSMTTVVI  85

Query  507   SSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTS  686
             SS   AREMFKNHDVVLAGRKIYEAMKGD+GNEGSLITAQYG HWRMLRRLC TEFFV+S
Sbjct  86    SSSNVAREMFKNHDVVLAGRKIYEAMKGDYGNEGSLITAQYGSHWRMLRRLCNTEFFVSS  145

Query  687   RLDALRGVRTKCIDHMVRYMREAGNSGTA-------AIDVGRFFFLMSFNLIGNLMFSKD  845
             RLDA+RGVR +CID MV+++ +A  S  +       +IDVGRFFFLM+FNLIGNLMFSKD
Sbjct  146   RLDAMRGVRGRCIDRMVQFIEDASTSDKSDNGVNVKSIDVGRFFFLMAFNLIGNLMFSKD  205

Query  846   LLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGD  1025
             LLDP+SERGA FFYHAG VME AGKPN+ADFFP+LRW DPQGIR+ TQ+HV +AF+IAG+
Sbjct  206   LLDPKSERGAGFFYHAGNVMEMAGKPNMADFFPVLRWFDPQGIRKNTQYHVERAFEIAGE  265

Query  1026  YLKERMESMNAGG---NDEKKKDYMDVLLQY--RGD-LVEGPARFSS-RTINVILFEMFT  1184
             ++KERMESMN+ G   + EK KD++DVLLQY  +GD L E   RF+S RTINVI+FEMFT
Sbjct  266   FIKERMESMNSDGSGVDTEKTKDFLDVLLQYDSQGDGLDEEAYRFTSPRTINVIVFEMFT  325

Query  1185  AGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKET  1364
             AGTDTTTSTLEWAM ELL+NP +L+KVQ ELRS +  + KKLEE  IE LPYLKAVIKET
Sbjct  326   AGTDTTTSTLEWAMAELLNNPKTLKKVQTELRSTIS-SGKKLEERDIENLPYLKAVIKET  384

Query  1365  LRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEP  1544
             LRLHPPLPFLVPHMAMDSC MLG +IPK+TQILVNVWAIGRD KTW+DPL FKPERFLEP
Sbjct  385   LRLHPPLPFLVPHMAMDSCEMLGRHIPKDTQILVNVWAIGRDSKTWEDPLIFKPERFLEP  444

Query  1545  NMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKE  1724
             NM D+KGHHFEFIPFGSGRRMCPA+PL S++LPLALGS+LHSFDWVL  G+ P  MDM E
Sbjct  445   NMVDYKGHHFEFIPFGSGRRMCPAVPLVSKVLPLALGSLLHSFDWVLPDGLMPENMDMAE  504

Query  1725  RMGITLRKATPLKAIPV  1775
             RMGITLRK+ PL+ + V
Sbjct  505   RMGITLRKSVPLELMYV  521



>ref|XP_003535793.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=510

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/509 (71%), Positives = 420/509 (83%), Gaps = 6/509 (1%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQL-GWTPHVSF  437
             M+YE+   + L +  + W M+ +R  +     G LPPGPR WPVVGNIFQL GW PH S 
Sbjct  1     MEYEVVSLLALTILILVWRMLMDRRRQH----GKLPPGPRCWPVVGNIFQLAGWLPHESL  56

Query  438   SELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI  617
             ++LA KHGPIMTLWLGSM TVVISS + AR MFKNHDV+LAGRKIYEAM+GD G+EGSLI
Sbjct  57    AKLAHKHGPIMTLWLGSMCTVVISSSQVARHMFKNHDVILAGRKIYEAMRGDHGSEGSLI  116

Query  618   TAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFF  797
             T+QY  HWRML+RLCTTE FVT+RLDA++GVR KCI  M+  +++AG SGT A+DVGRFF
Sbjct  117   TSQYNSHWRMLKRLCTTELFVTTRLDAMQGVRAKCIHRMLHLIQQAGQSGTCAVDVGRFF  176

Query  798   FLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIR  977
             FLM FNLIGNL+FSKDLLD   ERG  F+YHA KVME+AGKPNVADF P+L+ LDPQGIR
Sbjct  177   FLMDFNLIGNLIFSKDLLDSEMERGDCFYYHALKVMEYAGKPNVADFLPILKGLDPQGIR  236

Query  978   RMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
             R TQFHVN+AF+IAG ++KERME+  +    ++ KDY+DVLL +RGD V  P  FSSRTI
Sbjct  237   RNTQFHVNQAFEIAGLFIKERMENGCSETGSKETKDYLDVLLNFRGDGVTEPYTFSSRTI  296

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NVI+FEMFTAGTDTTTST+EWAM ELLHNP +L+KVQ ELRS + G ++ +EE  IE LP
Sbjct  297   NVIVFEMFTAGTDTTTSTIEWAMAELLHNPKALKKVQMELRSKI-GPDRNMEEKDIENLP  355

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YL+AVIKETLRLHPPLPFLVPHMAMDSCNMLGY IP+ +QILVNVWAIGRDPK W  PL 
Sbjct  356   YLQAVIKETLRLHPPLPFLVPHMAMDSCNMLGYNIPQGSQILVNVWAIGRDPKVWDAPLL  415

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             F PERFL+PN  D+KGHHFEFIPFGSGRRMCPA+PLASR+LPLA+GS+LHSFDWVL  G+
Sbjct  416   FWPERFLKPNTMDYKGHHFEFIPFGSGRRMCPAMPLASRVLPLAIGSLLHSFDWVLPDGL  475

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             +P +MDM E MGITLRKA PLK IPVPYK
Sbjct  476   KPEEMDMTEGMGITLRKAVPLKVIPVPYK  504



>gb|KHN37270.1| Cytochrome P450 76A2 [Glycine soja]
Length=491

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/482 (74%), Positives = 407/482 (84%), Gaps = 2/482 (0%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             R  + G LPPGPR WPVVGNIFQL GW PH S ++LA KHGPIMTLWLGSM TVVISS +
Sbjct  5     RRRQHGKLPPGPRCWPVVGNIFQLAGWLPHESLAKLAHKHGPIMTLWLGSMCTVVISSSQ  64

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
              AR MFKNHDV+LAGRKIYEAM+GD G+EGSLIT+QY  HWRML+RLCTTE FVT+RLDA
Sbjct  65    VARHMFKNHDVILAGRKIYEAMRGDHGSEGSLITSQYNSHWRMLKRLCTTELFVTTRLDA  124

Query  699   LRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAK  878
             ++GVR KCI  M+  +++AG SGT A+DVGRFFFLM FNLIGNL+FSKDLLD   ERG  
Sbjct  125   MQGVRAKCIHRMLHLIQQAGQSGTCAVDVGRFFFLMDFNLIGNLIFSKDLLDSEMERGDC  184

Query  879   FFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA  1058
             F+YHA KVME+AGKPNVADF P+L+ LDPQGIRR TQFHVN+AF+IAG ++KERME+  +
Sbjct  185   FYYHALKVMEYAGKPNVADFLPILKGLDPQGIRRNTQFHVNQAFEIAGLFIKERMENGCS  244

Query  1059  GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELL  1238
                 ++ KDY+DVLL +RGD V  P  FSSRTINVI+FEMFTAGTDTTTST+EWAM ELL
Sbjct  245   ETGSKETKDYLDVLLNFRGDGVTEPYTFSSRTINVIVFEMFTAGTDTTTSTIEWAMAELL  304

Query  1239  HNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
             HNP +L+KVQ ELRS + G ++ +EE  IE LPYL+AVIKETLRLHPPLPFLVPHMAMDS
Sbjct  305   HNPKALKKVQMELRSKI-GPDRNMEEKDIENLPYLQAVIKETLRLHPPLPFLVPHMAMDS  363

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
             CNMLGY IP+ +QILVNVWAIGRDPK W  PL F PERFL+PN  D+KGHHFEFIPFGSG
Sbjct  364   CNMLGYNIPQGSQILVNVWAIGRDPKVWDAPLLFWPERFLKPNTMDYKGHHFEFIPFGSG  423

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             RRMCPA+PLASR+LPLA+GS+LHSFDWVL  G++P +MDM E MGITLRKA PLK IPVP
Sbjct  424   RRMCPAMPLASRVLPLAIGSLLHSFDWVLPDGLKPEEMDMTEGMGITLRKAVPLKVIPVP  483

Query  1779  YK  1784
             YK
Sbjct  484   YK  485



>ref|XP_006382516.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
 gb|ERP60313.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
Length=505

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/510 (72%), Positives = 421/510 (83%), Gaps = 13/510 (3%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDYEI G VL +L WVAWA++ +R +RR EE G LPPGPR  PVVGNIF LGW PH SF+
Sbjct  1     MDYEIAGLVLAVLLWVAWAVVTQRRYRRSEEQGQLPPGPRPLPVVGNIFLLGWAPHESFA  60

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA  HGPIMT+WLGSM  VVISS E AREMFKNHD VLAGRKIYEAM+GDFGNEGS+IT
Sbjct  61    NLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYEAMRGDFGNEGSIIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG HWRMLRRLCTTEFFVTSRLDA++G RT+CID M+ Y+ +   +GT+AID+GR+ F
Sbjct  121   AQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLLYIEDGSANGTSAIDLGRYIF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFSKDLLDP+SE+GAKFF HAGKVME AGKPN+ADF P+LRWLDPQGIRR
Sbjct  181   LMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVMELAGKPNMADFLPILRWLDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTI  1157
              TQFHV +AF+IAG ++KER ES       D+K+KDY+DVLL++RGD VE P+RFSS TI
Sbjct  241   KTQFHVARAFEIAGGFIKERTESTQKENSRDDKRKDYLDVLLEFRGDGVEEPSRFSSTTI  300

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             N I+ EMFTAGTDTTTSTLEWAM ELL NP  ++ VQ+ELRS + G  KKLE+  IE LP
Sbjct  301   NAIVLEMFTAGTDTTTSTLEWAMAELLRNPKVMKTVQSELRSTI-GLNKKLEDKDIENLP  359

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLK  1517
             YLKAVI+ETLRLHPPLPFLVPHMAM+ C MLGYYIPKET IL           TW DPL 
Sbjct  360   YLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTIL-----------TWDDPLV  408

Query  1518  FKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGM  1697
             FKPERFLEPNM D+KG HFEFIPFGSGRRMCPA+PLASR+LPLALGS+L SFDW+L  G+
Sbjct  409   FKPERFLEPNMVDYKGRHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLLSFDWILPVGL  468

Query  1698  EPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             +P  MDM E++GITLRK+ PLK IP PYKG
Sbjct  469   KPEDMDMTEKIGITLRKSVPLKVIPTPYKG  498



>ref|XP_007142620.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
 gb|ESW14614.1| hypothetical protein PHAVU_007G003100g [Phaseolus vulgaris]
Length=520

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/480 (73%), Positives = 405/480 (84%), Gaps = 4/480 (1%)
 Frame = +3

Query  351   EVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAARE  530
             E G LPPGPR WPVVGN+FQLGW+PH SF++LA KHGPIMTLWLGSM TVVISS E A E
Sbjct  38    EHGKLPPGPRCWPVVGNMFQLGWSPHESFAKLAQKHGPIMTLWLGSMCTVVISSSEVAGE  97

Query  531   MFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGV  710
             MFKNHDVVLAGRKIYEAM+G+ G+EGS++T+QY  HWRMLRRLCTTEFFVTSRLDA+RGV
Sbjct  98    MFKNHDVVLAGRKIYEAMRGENGSEGSIVTSQYNSHWRMLRRLCTTEFFVTSRLDAMRGV  157

Query  711   RTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             R KCI  M++ + EAG SGT A+DVGRF FLM FNLIGNL+FSKDLL+  +ERG +F+YH
Sbjct  158   RAKCIHRMLQLIEEAGESGTRAVDVGRFLFLMDFNLIGNLIFSKDLLESETERGDRFYYH  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
             A KVME+AGKPN+ADF P+L+W DPQGIRR TQFHVN+AFDIAG ++ ERME+ ++G  +
Sbjct  218   ALKVMEYAGKPNMADFLPILKWFDPQGIRRKTQFHVNQAFDIAGTFINERMENGHSGSKE  277

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                KDY+DVLL +RGD       FS RTINV +FEMFTAGTDTTTST+EWAM ELL+NP 
Sbjct  278   --IKDYLDVLLSFRGDSSSQHYTFSPRTINVTIFEMFTAGTDTTTSTIEWAMAELLNNPR  335

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L+KVQ ELR+ + G+++K+EE  IE LPYL+AVIKETLRLHPPLP +VPHMAMDS N L
Sbjct  336   TLKKVQMELRNKI-GSDRKMEEKDIENLPYLQAVIKETLRLHPPLPLMVPHMAMDSFNFL  394

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEP-NMADFKGHHFEFIPFGSGRRM  1607
             GY IPKE+QILVNVW+IGRD K W  PL F PERFLEP  + D+KG HFEFIPFGSGRRM
Sbjct  395   GYNIPKESQILVNVWSIGRDCKVWDAPLLFWPERFLEPKTVVDYKGRHFEFIPFGSGRRM  454

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             CPA+PLASR+L LALGS+LHSFDWVL  G++P +MDM E MGITLRKA PLKAIPVPY+G
Sbjct  455   CPAMPLASRVLTLALGSLLHSFDWVLPDGLKPEEMDMTEGMGITLRKAIPLKAIPVPYRG  514



>ref|XP_003592855.1| Cytochrome P450 [Medicago truncatula]
 gb|AES63106.1| cytochrome P450 family protein [Medicago truncatula]
Length=522

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/488 (73%), Positives = 412/488 (84%), Gaps = 7/488 (1%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLGWTP-HVSFSELASKHGPIMTLWLGSMSTVVISS  512
             H R++    LPPGPR WPVVGNIFQLG +P H SF+ L+ +HGPIMTLWLGSM TVV+SS
Sbjct  25    HIRVKLGHQLPPGPRCWPVVGNIFQLGLSPPHESFTILSRRHGPIMTLWLGSMCTVVVSS  84

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDF--GNEGSLITAQYGQHWRMLRRLCTTEFFVTS  686
              EAAR+MFKN+D  LAGRK+YEAMKG+   G+EGSLIT+QY  HWRMLRRL TTEFFVTS
Sbjct  85    CEAARDMFKNNDAALAGRKVYEAMKGNHNHGSEGSLITSQYDAHWRMLRRLSTTEFFVTS  144

Query  687   RLDALRGVRTKCIDHMVRYMREAG-NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
             RLDA++GVR KCID MV  + EA   S   A+DVG+FFFLM+FNLIGNL+FSKDLLDP  
Sbjct  145   RLDAMQGVRAKCIDRMVHLIDEAAAESSNCAVDVGKFFFLMAFNLIGNLIFSKDLLDPEM  204

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             ERGA+F+YHA KVM++AGKPNVADFFP+L+WLDPQGIRR TQFHV +AF+IAG ++K+RM
Sbjct  205   ERGARFYYHAIKVMKYAGKPNVADFFPILKWLDPQGIRRNTQFHVERAFEIAGWFIKQRM  264

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             E+   G  + K  D++DVLLQ+RGD V GP  F+SRTINV++FEMFTAGTDTTTSTLEWA
Sbjct  265   ENDIVGNGNSK--DFLDVLLQFRGDGVSGPYSFTSRTINVVVFEMFTAGTDTTTSTLEWA  322

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             M ELLHNP +L KVQ ELRS +  +++K+EE  IE LPYLKAVIKETLRLHPPLPFLVPH
Sbjct  323   MAELLHNPRTLSKVQMELRSKIS-SDRKMEEKDIESLPYLKAVIKETLRLHPPLPFLVPH  381

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
             MAMDSC +  Y+IPKETQILVNVWAIGRDPK W  PL F PERF++PNM D+KGHHFE+I
Sbjct  382   MAMDSCMIGDYFIPKETQILVNVWAIGRDPKVWDAPLLFWPERFMQPNMVDYKGHHFEYI  441

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFGSGRRMCPALPLASR+LPLALGS+L+SFDW+L  G++P +MDM E MGITLRKA PLK
Sbjct  442   PFGSGRRMCPALPLASRVLPLALGSLLNSFDWILSDGLKPEEMDMTEGMGITLRKAVPLK  501

Query  1764  AIPVPYKG  1787
              IPVPYKG
Sbjct  502   VIPVPYKG  509



>emb|CDP18467.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/446 (77%), Positives = 385/446 (86%), Gaps = 8/446 (2%)
 Frame = +3

Query  468   MTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRM  647
             MTLWLGSM TVVISS+E AREMFKNHDVVLAGRKIYEAMKGD GNEGSLITAQYG HWRM
Sbjct  1     MTLWLGSMCTVVISSNEVAREMFKNHDVVLAGRKIYEAMKGDIGNEGSLITAQYGPHWRM  60

Query  648   LRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGN  827
             LRRLCT EFFVTSRLDA   VR KCID MV+Y+  AG SG   IDVG+FFFL++FNLIGN
Sbjct  61    LRRLCTAEFFVTSRLDATVDVRAKCIDQMVKYIEAAGGSGANGIDVGKFFFLLAFNLIGN  120

Query  828   LMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKA  1007
             LMFSKDLLDP SERGAKFFYHAGKVME+AGKPN+ADF PLL+WLDPQGIRR TQ+HV +A
Sbjct  121   LMFSKDLLDPSSERGAKFFYHAGKVMEYAGKPNIADFLPLLKWLDPQGIRRSTQYHVKRA  180

Query  1008  FDIAGDYLKERMESMNAGGND-----EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILF  1172
             FDIAG YLKER+   N    D     ++++DY+DVLL YRG+  E P  FS  TIN+I+F
Sbjct  181   FDIAGLYLKERIIESNGDETDHPSPEKRRRDYLDVLLHYRGESAEEPPEFSPTTINIIVF  240

Query  1173  EMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVG-GTEKKLEEYHIEKLPYLKA  1349
             EMFTAGTDTTTSTLEWA  ELL +P +L+KVQAELRSV+  GT  KLEE H++ LPYLKA
Sbjct  241   EMFTAGTDTTTSTLEWATAELLRSPKTLEKVQAELRSVISLGT--KLEEKHLDNLPYLKA  298

Query  1350  VIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPE  1529
             V+KETLRLHPPLPFLVPHMAMDSC MLGY+IPKETQILVNVWAIGRDPKTW++PL+FKPE
Sbjct  299   VVKETLRLHPPLPFLVPHMAMDSCKMLGYHIPKETQILVNVWAIGRDPKTWENPLEFKPE  358

Query  1530  RFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQ  1709
             RFLEP+ ADFKGHHFEFIPFGSGRR+CPA+PLASR+LP+ALGS+LH FDW L  G++P +
Sbjct  359   RFLEPSTADFKGHHFEFIPFGSGRRICPAVPLASRVLPMALGSILHLFDWSLADGIKPEE  418

Query  1710  MDMKERMGITLRKATPLKAIPVPYKG  1787
             +DM ERMGITLRKA PLKAIPVP +G
Sbjct  419   LDMGERMGITLRKAVPLKAIPVPLQG  444



>gb|AJD25184.1| cytochrome P450 CYP76G16 [Salvia miltiorrhiza]
Length=508

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/512 (72%), Positives = 425/512 (83%), Gaps = 14/512 (3%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWT---PHV  431
             M+YEI G V+ LL W AWA+  ER HRRL      PPGPR WPVVGN+ QL  +   PH 
Sbjct  1     MEYEIAGIVVALLLWAAWAVSTERRHRRL------PPGPRPWPVVGNMLQLARSASAPHQ  54

Query  432   SFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGS  611
             SF+ELA KHG +MTLWLGSM+TVV+SS EAAR MFK+HD  LAGRKIYE+MKGD GNEGS
Sbjct  55    SFAELAGKHGAVMTLWLGSMTTVVVSSAEAARAMFKHHDAALAGRKIYESMKGDVGNEGS  114

Query  612   LITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMRE-AGNSGTAAIDVG  788
             LITAQYG HWR LRRLCT EFF    LDA+RGVR +C+  M+ Y+RE A     A  DVG
Sbjct  115   LITAQYGPHWRTLRRLCTAEFFAAGPLDAMRGVRARCVAQMLHYVREAAAADDGAGTDVG  174

Query  789   RFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQ  968
             RFFFLM+FNLIGNLMFSKDLLDP SERGA+FFYHAGK MEFAGKPN+AD+FP LRW DPQ
Sbjct  175   RFFFLMAFNLIGNLMFSKDLLDPASERGAEFFYHAGKTMEFAGKPNMADYFPALRWADPQ  234

Query  969   GIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSS  1148
              IRR TQFHV +AF++AG++L+ERM       + EKKKDY+DVLL+Y+GD VEGPA FSS
Sbjct  235   RIRRRTQFHVKQAFNVAGEFLRERMREREE--DVEKKKDYLDVLLEYKGDGVEGPAVFSS  292

Query  1149  RTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIE  1328
               INVI+FEMFTAGTDTTTSTLEWAM ELL NP +L+KVQAELR V+G  EK  EE  +E
Sbjct  293   TIINVIVFEMFTAGTDTTTSTLEWAMAELLRNPDALRKVQAELRGVIGAGEKVEEEK-LE  351

Query  1329  KLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKD  1508
             +LPYLK+VIKETLRLHPPLPFLVPH AM+SC MLG++IPKETQILVNVWAIGRDPK WKD
Sbjct  352   ELPYLKSVIKETLRLHPPLPFLVPHKAMESCEMLGFHIPKETQILVNVWAIGRDPKRWKD  411

Query  1509  PLKFKPERFLEPNM-ADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVL  1685
             P +FKPERF++ +  AD+KGHHFEFIPFGSGRRMCPA+PLA+R+LPLALGSVLHSFDWVL
Sbjct  412   PQEFKPERFMDGDTAADYKGHHFEFIPFGSGRRMCPAVPLAARVLPLALGSVLHSFDWVL  471

Query  1686  GHGMEPSQMDMKERMGITLRKATPLKAIPVPY  1781
             G GM+ ++MDM+ERMGITLRKA PL+AIP+PY
Sbjct  472   GGGMKAAEMDMRERMGITLRKAVPLRAIPIPY  503



>ref|XP_002877896.1| CYP76G1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54155.1| CYP76G1 [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/480 (68%), Positives = 396/480 (83%), Gaps = 5/480 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GN+FQL G  PH S ++L+ +HGPIM+L + SM TVVISS E ARE+FK
Sbjct  36    LPPGPNPWPVIGNMFQLAGSPPHDSLTKLSRRHGPIMSLRIASMLTVVISSSEVAREIFK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD VLAGRKIYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAVLAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C+D M+R++ E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++FFYH GK
Sbjct  156   CVDQMLRFVEEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGK  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++ER E      +DEK 
Sbjct  216   VMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRERTEVREKEKSDEKT  275

Query  1080  KDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             KDY+DVLL++RG   + E P+ FSSR INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP +
Sbjct  276   KDYLDVLLEFRGGDGVDEEPSSFSSRDINVIVFEMFTAGTDTTTSTLEWALAELLHNPRT  335

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K+Q ELR+    T +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++  
Sbjct  336   LTKLQTELRTYFKSTNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFD  395

Query  1434  YY-IPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRM  1607
              Y IPKETQ+LVNVWAIGRDP+TW DP+ FKPERF+  PN  DFKG  +EF+PFGSGRRM
Sbjct  396   QYTIPKETQVLVNVWAIGRDPETWIDPIMFKPERFISNPNARDFKGQDYEFLPFGSGRRM  455

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             CPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+PY+G
Sbjct  456   CPALPLASRVLPLAIGSMVRSFDWALANGLNAEEMDMGERIGITLKKAVPLEAIPIPYRG  515



>ref|NP_190865.2| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE79019.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/480 (69%), Positives = 397/480 (83%), Gaps = 5/480 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GNIFQL G  PH S ++L+ +HGPIMTL +GSM TVVISS E ARE+FK
Sbjct  36    LPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C+D M+R++ E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++FFYH GK
Sbjct  156   CVDQMLRFVEEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGK  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++ER E      +DEK 
Sbjct  216   VMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRERTEVREREKSDEKT  275

Query  1080  KDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             KDY+DVLL++RG   + E P+ FSSR INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP +
Sbjct  276   KDYLDVLLEFRGGDGVDEEPSSFSSRDINVIVFEMFTAGTDTTTSTLEWALAELLHNPRT  335

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K+Q ELR+    + +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++  
Sbjct  336   LTKLQTELRTYFKSSNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFD  395

Query  1434  YY-IPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRM  1607
              Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +P+  DFKG  +EF+PFGSGRRM
Sbjct  396   QYTIPKETQVLVNVWAIGRDPKTWIDPIMFKPERFISDPDARDFKGQDYEFLPFGSGRRM  455

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             CPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+PY+G
Sbjct  456   CPALPLASRVLPLAIGSMVRSFDWALENGLNAEEMDMGERIGITLKKAVPLEAIPIPYRG  515



>dbj|BAC42682.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=516

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/480 (68%), Positives = 397/480 (83%), Gaps = 5/480 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GNIFQL G  PH S ++L+ +HGPIMTL +GSM TVVISS E ARE+FK
Sbjct  36    LPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGR+IYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAALAGREIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C+D M+R++ E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++FFYH GK
Sbjct  156   CVDQMLRFVEEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGK  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++ER E      +DEK 
Sbjct  216   VMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRERTEVREREKSDEKT  275

Query  1080  KDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             KDY+DVLL++RG   + E P+ FSSR INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP +
Sbjct  276   KDYLDVLLEFRGGDGVDEEPSSFSSRDINVIVFEMFTAGTDTTTSTLEWALAELLHNPRT  335

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K+Q ELR+    + +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++  
Sbjct  336   LTKLQTELRTYFKSSNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFD  395

Query  1434  YY-IPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRM  1607
              Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +P+  DFKG  +EF+PFGSGRRM
Sbjct  396   QYTIPKETQVLVNVWAIGRDPKTWVDPIMFKPERFISDPDARDFKGQDYEFLPFGSGRRM  455

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             CPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+PY+G
Sbjct  456   CPALPLASRVLPLAIGSMVRSFDWALENGLNAEEMDMGERIGITLKKAVPLEAIPIPYRG  515



>ref|XP_004497404.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=516

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/494 (68%), Positives = 392/494 (79%), Gaps = 18/494 (4%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLG----WTPHVSFSELASKHGPIMTLWLGSMSTVV  503
             ++RL+    LPP P  WP+VGNI QL       PH SF+ LA KHGPIMTLWLGSM TVV
Sbjct  21    NKRLKFGNKLPPAPTCWPIVGNILQLARLSSSPPHESFAILARKHGPIMTLWLGSMCTVV  80

Query  504   ISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGN---EGSLITAQYGQHWRMLRRLCTTEF  674
             +SS E AR+MFKN+DVVLAGRK+YEAMKG++ N   EGSLIT+QY  HWRML+RL T EF
Sbjct  81    VSSSEVARQMFKNNDVVLAGRKVYEAMKGNYENGIIEGSLITSQYNSHWRMLKRLATHEF  140

Query  675   FVTSRLDALRGVRTKCIDHMVRYMR-EAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLL  851
             FVTSRLDA+R VR KC+D M+  +  E+ NS    +DVG F F MSFNLIGNL+FSKDLL
Sbjct  141   FVTSRLDAMRDVRAKCVDRMLNLIEHESVNSVGVGVDVGNFLFTMSFNLIGNLIFSKDLL  200

Query  852   DP--RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGD  1025
              P    ERG +F YH  K+ME+ GKPNVAD+FP+LRWLDPQG+RR T+FHV +AF+IAG 
Sbjct  201   GPGMEMERGGRFHYHTVKIMEYTGKPNVADYFPMLRWLDPQGLRRNTKFHVEEAFEIAGW  260

Query  1026  YLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTT  1205
             ++K+RM+    G +D   KD++DVLLQ+RGD   GP  F+S+TINV++ EMFTAGTDTTT
Sbjct  261   FIKQRMK----GSSDGNTKDFLDVLLQFRGDAATGPYHFTSKTINVVVLEMFTAGTDTTT  316

Query  1206  STLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPL  1385
             ST+EWAM ELLH+P +L+KVQ ELRS +G    K+EE  IE LPYLKAVIKETLRLHPPL
Sbjct  317   STIEWAMAELLHSPRTLKKVQMELRSKIG----KIEENDIENLPYLKAVIKETLRLHPPL  372

Query  1386  PFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKG  1565
             PFLVPH AMDSCN+  YYIPKETQILVNVWAIGRDPK W DPL F PERF+EPNM D+KG
Sbjct  373   PFLVPHKAMDSCNIQEYYIPKETQILVNVWAIGRDPKVWDDPLLFLPERFMEPNMVDYKG  432

Query  1566  HHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLR  1745
              HFEFIPFGSGRRMCPA+PL SR+LP+ALGS+L  FDW+L  G++P +MDM E  GITLR
Sbjct  433   QHFEFIPFGSGRRMCPAMPLVSRVLPMALGSLLKYFDWILPDGIKPEEMDMTEGTGITLR  492

Query  1746  KATPLKAIPVPYKG  1787
             KA PLKAIPVPY G
Sbjct  493   KAIPLKAIPVPYTG  506



>ref|XP_010558964.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1 [Tarenaya 
hassleriana]
Length=514

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/475 (69%), Positives = 395/475 (83%), Gaps = 12/475 (3%)
 Frame = +3

Query  390   VVGNIFQLGWTP---HVSFSELA-SKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVL  557
             VVGN+FQL  +P   H + S+LA   HGP MTL LGSM TVV SS  AARE+ ++ DV L
Sbjct  42    VVGNMFQLAISPLPPHQTLSKLARGVHGPFMTLRLGSMLTVVASSSSAAREVLRDCDVAL  101

Query  558   AGRKIYEAMKGDFG--NEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDH  731
             AGRKIYEAMKG+ G  +EGSLITAQYG +WRMLRRLCTT+FFVT RLD++  VR +C+D 
Sbjct  102   AGRKIYEAMKGERGKSSEGSLITAQYGAYWRMLRRLCTTQFFVTRRLDSMCNVRARCMDQ  161

Query  732   MVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEF  911
             MVR++ EAG +GT  +D+GR+FFLM+FNLIGNLMFSKDLLDP S++G+KFFYHAGKVMEF
Sbjct  162   MVRFVEEAGQNGTKTVDIGRYFFLMAFNLIGNLMFSKDLLDPDSKQGSKFFYHAGKVMEF  221

Query  912   AGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYM  1091
             AG+PNV+DFFPLLR+LDPQGIRR TQFHV +AF+IAG++++ERME M + G DEK KDY+
Sbjct  222   AGRPNVSDFFPLLRFLDPQGIRRQTQFHVERAFEIAGEFIRERMEVMKSKGRDEKAKDYL  281

Query  1092  DVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQA  1271
             DVLL++RGD  E P++FSSRTINVI+FEMFTAGTDTTTSTLEWA+ ELLHNP +L K+Q 
Sbjct  282   DVLLEFRGDGPEEPSKFSSRTINVIVFEMFTAGTDTTTSTLEWALAELLHNPRTLTKLQN  341

Query  1272  ELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG--YYIP  1445
             ELR+    T + L+E  +  LPYL+AVIKETLRLHPPLPFLVPH AM +C++L   Y IP
Sbjct  342   ELRT---STSQTLQEQDLPNLPYLQAVIKETLRLHPPLPFLVPHKAMSTCHILNGQYTIP  398

Query  1446  KETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             KETQ+LVNVWAIGRDP TW DP+ F+PERFL  PN  DFKGH FEF+PFGSGRRMCPALP
Sbjct  399   KETQVLVNVWAIGRDPDTWPDPMIFRPERFLSNPNPRDFKGHDFEFLPFGSGRRMCPALP  458

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             LA+R+LP+ALGS++ SFDW L  G+ P ++DM ERMGITLRKA PL+AIP+ +KG
Sbjct  459   LATRVLPMALGSMVRSFDWALADGLRPEELDMSERMGITLRKAIPLEAIPISFKG  513



>ref|XP_010431310.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=515

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/481 (69%), Positives = 397/481 (83%), Gaps = 6/481 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP+ WPV+GN+FQL G  PH S ++L+ +HGPIMTL LGSM TVVISS E ARE+FK
Sbjct  35    LPPGPKPWPVIGNMFQLAGSPPHHSLTKLSRRHGPIMTLRLGSMLTVVISSSEVAREIFK  94

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++ SLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR+K
Sbjct  95    KHDAALAGRKIYEAMKGRKSSDTSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSK  154

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C++ M+++++E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++FFYH GK
Sbjct  155   CVEQMLQFVKEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGK  214

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++ER E     G+DE  
Sbjct  215   VMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRERSEVREREGSDENT  274

Query  1080  KDYMDVLLQYR-GDLV--EGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             KDY+DVLL++R GD V  E P  FS+R INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP 
Sbjct  275   KDYLDVLLEFRGGDGVDQEEPCSFSARDINVIVFEMFTAGTDTTTSTLEWALAELLHNPR  334

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L K+Q ELR+ +    +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++ 
Sbjct  335   TLTKLQTELRTYLKSPNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIF  394

Query  1431  G-YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRR  1604
             G Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +PN  DFKG  FEF+PFGSGRR
Sbjct  395   GKYTIPKETQVLVNVWAIGRDPKTWIDPVMFKPERFISDPNPRDFKGQDFEFLPFGSGRR  454

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             MCPALPLASR+LPLA+GS++ SFDW L +G    +MDM ER+GITL+KA PL+AIP+PY 
Sbjct  455   MCPALPLASRILPLAIGSMVRSFDWALENGANAEEMDMGERIGITLKKALPLEAIPIPYL  514

Query  1785  G  1787
             G
Sbjct  515   G  515



>ref|XP_006293048.1| hypothetical protein CARUB_v10019335mg [Capsella rubella]
 gb|EOA25946.1| hypothetical protein CARUB_v10019335mg [Capsella rubella]
Length=517

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/481 (68%), Positives = 394/481 (82%), Gaps = 7/481 (1%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMF  536
             +LPPGP  WPV+GN+FQL G  PH S ++L+ ++GPIM L LGSM TVVISS E ARE+F
Sbjct  34    SLPPGPNPWPVIGNMFQLAGSPPHHSLTKLSGRYGPIMALRLGSMLTVVISSSEVAREIF  93

Query  537   KNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             K HD  LAGRKIYEAMKG   ++ SLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR+
Sbjct  94    KKHDAALAGRKIYEAMKGRDNSDASLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSAVRS  153

Query  717   KCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             +C++ M+R++ E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++FFYH G
Sbjct  154   ECVEQMLRFVMEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTG  213

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
             KVMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG +++ER E      +DEK
Sbjct  214   KVMEFAGKPNVADFFPLLRFLDPQGIRRTTQFHVEKAFEIAGQFIRERSEVREREESDEK  273

Query  1077  KKDYMDVLLQYRG----DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHN  1244
              KDY+DVLL++RG    D  E P RFS+R INVI+FEMFTAGTDTTTSTLEWA+ ELLHN
Sbjct  274   TKDYLDVLLEFRGGDGVDEEEEPCRFSARDINVIVFEMFTAGTDTTTSTLEWALAELLHN  333

Query  1245  PSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCN  1424
             P +L K+Q ELR+     ++KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C+
Sbjct  334   PRTLTKLQTELRTYFKSPDQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCH  393

Query  1425  MLG-YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSG  1598
             + G Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +PN  DFKG  FEF+PFGSG
Sbjct  394   IFGKYTIPKETQVLVNVWAIGRDPKTWIDPIMFKPERFISDPNPRDFKGQDFEFLPFGSG  453

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             RRMCPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+P
Sbjct  454   RRMCPALPLASRILPLAIGSMVRSFDWALENGLNAEEMDMSERIGITLKKAVPLEAIPIP  513

Query  1779  Y  1781
             Y
Sbjct  514   Y  514



>ref|XP_010504051.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=516

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/481 (69%), Positives = 396/481 (82%), Gaps = 6/481 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GN+FQL G  PH S ++L+ +HGPIMTL LGSM TVVISS E ARE+FK
Sbjct  36    LPPGPNPWPVIGNMFQLAGSPPHHSLTKLSRRHGPIMTLRLGSMLTVVISSSEVAREIFK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++ SLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR+K
Sbjct  96    KHDAALAGRKIYEAMKGRKSSDTSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSK  155

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C++ M+R+++E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLD  S+RG++FFYH GK
Sbjct  156   CVEQMLRFVKEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDADSKRGSEFFYHTGK  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++ER E     G++EK 
Sbjct  216   VMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRERSEVREREGSNEKT  275

Query  1080  KDYMDVLLQYR-GDLV--EGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             KDY+DVLL++R GD V  E P  FS+R INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP 
Sbjct  276   KDYLDVLLEFRGGDGVDQEEPCSFSARDINVIVFEMFTAGTDTTTSTLEWALAELLHNPR  335

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L K+Q ELR+      +KL+E  I  LPYL AVI ETLRLHPPLPFLVPH A+ +C++ 
Sbjct  336   TLTKLQTELRTYFKSPNQKLQEEDISNLPYLSAVIMETLRLHPPLPFLVPHKAISTCHIF  395

Query  1431  G-YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRR  1604
             G Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +PN  DFKG  FEF+PFGSGRR
Sbjct  396   GKYTIPKETQVLVNVWAIGRDPKTWIDPVMFKPERFISDPNPRDFKGQDFEFLPFGSGRR  455

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             MCPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+PY 
Sbjct  456   MCPALPLASRILPLAIGSMVRSFDWALENGVNAEEMDMGERIGITLKKAVPLEAIPIPYL  515

Query  1785  G  1787
             G
Sbjct  516   G  516



>ref|NP_001190075.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE79020.1| cytochrome P450, family 76, subfamily G, polypeptide 1 [Arabidopsis 
thaliana]
Length=530

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/494 (67%), Positives = 397/494 (80%), Gaps = 19/494 (4%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GNIFQL G  PH S ++L+ +HGPIMTL +GSM TVVISS E ARE+FK
Sbjct  36    LPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSG--------------TAAIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             C+D M+R++ E G +G              T  IDVGR+FFLM+FNLIGNLMFS+DLLDP
Sbjct  156   CVDQMLRFVEEGGQNGMYYTINNIMTCIICTKTIDVGRYFFLMAFNLIGNLMFSRDLLDP  215

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
              S+RG++FFYH GKVMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++E
Sbjct  216   DSKRGSEFFYHTGKVMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRE  275

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTST  1211
             R E      +DEK KDY+DVLL++RG   + E P+ FSSR INVI+FEMFTAGTDTTTST
Sbjct  276   RTEVREREKSDEKTKDYLDVLLEFRGGDGVDEEPSSFSSRDINVIVFEMFTAGTDTTTST  335

Query  1212  LEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPF  1391
             LEWA+ ELLHNP +L K+Q ELR+    + +KL+E  +  LPYL AVI ETLRLHPPLPF
Sbjct  336   LEWALAELLHNPRTLTKLQTELRTYFKSSNQKLQEEDLPNLPYLSAVIMETLRLHPPLPF  395

Query  1392  LVPHMAMDSCNMLGYY-IPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKG  1565
             LVPH AM +C++   Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +P+  DFKG
Sbjct  396   LVPHKAMSTCHIFDQYTIPKETQVLVNVWAIGRDPKTWIDPIMFKPERFISDPDARDFKG  455

Query  1566  HHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLR  1745
               +EF+PFGSGRRMCPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+
Sbjct  456   QDYEFLPFGSGRRMCPALPLASRVLPLAIGSMVRSFDWALENGLNAEEMDMGERIGITLK  515

Query  1746  KATPLKAIPVPYKG  1787
             KA PL+AIP+PY+G
Sbjct  516   KAVPLEAIPIPYRG  529



>emb|CAB86901.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=512

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/480 (68%), Positives = 393/480 (82%), Gaps = 9/480 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GNIFQL G  PH S ++L+ +HGPIMTL +GSM TVVISS E ARE+FK
Sbjct  36    LPPGPNPWPVIGNIFQLAGLPPHDSLTKLSRRHGPIMTLRIGSMLTVVISSSEVAREIFK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAALAGRKIYEAMKGGKSSDGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C+D M+R++ E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++FFYH GK
Sbjct  156   CVDQMLRFVEEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFFYHTGK  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR+LDPQGIRR TQFHV KAF+IAG++++ER E      +DEK 
Sbjct  216   VMEFAGKPNVADFFPLLRFLDPQGIRRKTQFHVEKAFEIAGEFIRERTEVREREKSDEKT  275

Query  1080  KDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             KDY+DVLL++RG   + E P+ FSSR IN    EMFTAGTDTTTSTLEWA+ ELLHNP +
Sbjct  276   KDYLDVLLEFRGGDGVDEEPSSFSSRDIN----EMFTAGTDTTTSTLEWALAELLHNPRT  331

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K+Q ELR+    + +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++  
Sbjct  332   LTKLQTELRTYFKSSNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFD  391

Query  1434  YY-IPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRM  1607
              Y IPKETQ+LVNVWAIGRDPKTW DP+ FKPERF+ +P+  DFKG  +EF+PFGSGRRM
Sbjct  392   QYTIPKETQVLVNVWAIGRDPKTWIDPIMFKPERFISDPDARDFKGQDYEFLPFGSGRRM  451

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             CPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+PY+G
Sbjct  452   CPALPLASRVLPLAIGSMVRSFDWALENGLNAEEMDMGERIGITLKKAVPLEAIPIPYRG  511



>ref|XP_009148756.1| PREDICTED: cytochrome P450 76A1 [Brassica rapa]
Length=516

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/480 (68%), Positives = 389/480 (81%), Gaps = 5/480 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GN+FQL G  PH S + L+ +HGPIMTL LGSM TVVISS E ARE+ K
Sbjct  36    LPPGPNPWPVIGNMFQLAGLPPHHSLTNLSRRHGPIMTLRLGSMLTVVISSSEVAREILK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAALAGRKIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C+D M+R++ E G +GT  IDVGR+FFLM+FNLIGNLMFS+DLLDP S+RG++F YH GK
Sbjct  156   CVDQMLRFVEEGGQNGTKTIDVGRYFFLMAFNLIGNLMFSRDLLDPDSKRGSEFLYHTGK  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR++DPQGIRR TQFHV +AF+IAG+++KER E      +DEK 
Sbjct  216   VMEFAGKPNVADFFPLLRFIDPQGIRRKTQFHVERAFEIAGEFIKERAEVRERERSDEKT  275

Query  1080  KDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             KDY+DVLL +RG   + E PARFS+R INV +FEMFTAGTDTTTSTLEWA+ ELLHNP +
Sbjct  276   KDYLDVLLGFRGGDGVDEEPARFSARDINVTVFEMFTAGTDTTTSTLEWALAELLHNPRT  335

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K+Q  LR+      +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++  
Sbjct  336   LTKLQNLLRTYFKSPNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFD  395

Query  1434  -YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRM  1607
              Y IPKETQ+LVNVWAIGRDP TW DP  FKPERF+ +PN  DFKG  +EF+PFGSGRRM
Sbjct  396   KYTIPKETQVLVNVWAIGRDPATWVDPNMFKPERFITDPNPRDFKGQDYEFLPFGSGRRM  455

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             CPALPLASR+LPLA+GS++ SFDW L  G++  +MDM E++GITL+KA PL+AIP+PY+G
Sbjct  456   CPALPLASRVLPLAIGSMVRSFDWALADGLKGEEMDMGEKIGITLKKAVPLEAIPIPYRG  515



>ref|XP_004138005.1| PREDICTED: cytochrome P450 76A2-like [Cucumis sativus]
 gb|KGN59047.1| hypothetical protein Csa_3G748270 [Cucumis sativus]
Length=523

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/488 (66%), Positives = 388/488 (80%), Gaps = 15/488 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WPVVGN+ QL ++ H SF++LA+K+GPIMTL LGSM TVV+SS   AREMFK 
Sbjct  32    LPPGPPCWPVVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVVSSSTVAREMFKT  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HDV L+GR IYEAMKG+ G +GSLIT+QYG HWRMLRRL T+EFFV  +L++++ VR  C
Sbjct  92    HDVPLSGRMIYEAMKGNHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHC  151

Query  723   IDHMVRYMREAGN-SGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ID M+R++ E  +  G A A+DVG+F F+M FNLIGNL+FSKDLL+  S+RG +F+YH  
Sbjct  152   IDAMIRHVEEGCDPCGNAPALDVGKFVFVMGFNLIGNLIFSKDLLEANSKRGKEFYYHTR  211

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM-----ESMNAG  1061
             KVME AGKPNVADF P LRWLDPQGIRR TQFHVNKAF+IAG+++KER+       +   
Sbjct  212   KVMEMAGKPNVADFLPALRWLDPQGIRRKTQFHVNKAFEIAGEFIKERLLIREKRDIIND  271

Query  1062  GNDEK-----KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAM  1226
              +DEK     KKDY+DVLL++RGD VE P+RFSS  INVI+ EMFTAGTDTTTSTLEWAM
Sbjct  272   DDDEKKEESGKKDYLDVLLEFRGDGVEEPSRFSSWIINVIVLEMFTAGTDTTTSTLEWAM  331

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
              ELLHNP+SLQK+QAELR+ +   +  LEE H++ LPYL AV+KETLRLHPPLPFL P M
Sbjct  332   AELLHNPASLQKLQAELRATIAPND-NLEETHLQNLPYLDAVVKETLRLHPPLPFLFPRM  390

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMA--DFKGHHFEF  1580
             AM  CN+LGY IP ETQ+LVN WAIGRDPK WKD L F PERF +P+    DFKG HF+F
Sbjct  391   AMKPCNILGYRIPAETQVLVNFWAIGRDPKNWKDALVFSPERFFDPSSGSKDFKGQHFDF  450

Query  1581  IPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             IPFGSGRRMCPA+PLASR+LP+ALGS++ SFDW L  G+ P +MDM E+MGITLRK  PL
Sbjct  451   IPFGSGRRMCPAVPLASRVLPMALGSLILSFDWALPDGVSPKEMDMSEQMGITLRKKVPL  510

Query  1761  KAIPVPYK  1784
             KAIP P+K
Sbjct  511   KAIPTPHK  518



>emb|CDX76245.1| BnaA04g05090D [Brassica napus]
Length=530

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/494 (66%), Positives = 390/494 (79%), Gaps = 19/494 (4%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GN+FQL G  PH S + L+ +HGPIMTL LGSM TVVISS E ARE+ K
Sbjct  36    LPPGPNPWPVIGNMFQLAGLPPHHSLTNLSRRHGPIMTLRLGSMLTVVISSSEVAREILK  95

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   ++GSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR++
Sbjct  96    KHDAALAGRKIYEAMKGGKSSDGSLITAQYGPYWRMLRRLCTTQFFVTRRLDAMSDVRSR  155

Query  720   CIDHMVRYMREAGNSGT--------------AAIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             C+D M+R++ E G +GT                IDVGR+FFLM+FNLIGNLMFS+DLLDP
Sbjct  156   CVDQMLRFVEEGGQNGTLWNTVVFTARYSCTKTIDVGRYFFLMAFNLIGNLMFSRDLLDP  215

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
              S+RG++F YH GKVMEFAGKPNVADFFPLLR++DPQGIRR TQFHV +AF+IAG+++KE
Sbjct  216   DSKRGSEFLYHTGKVMEFAGKPNVADFFPLLRFIDPQGIRRKTQFHVERAFEIAGEFIKE  275

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTST  1211
             R E      +DEK KDY+DVLL +RG   + E PARFS+R INV +FEMFTAGTDTTTST
Sbjct  276   RAEVRERERSDEKTKDYLDVLLGFRGGDGVDEEPARFSARDINVTVFEMFTAGTDTTTST  335

Query  1212  LEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPF  1391
             LEWA+ ELLHNP +L K+Q  LR+      +KL+E H+  LPYL AVI ETLRLHPPLPF
Sbjct  336   LEWALAELLHNPRTLTKLQNLLRTYFKSPNQKLQEEHLPNLPYLSAVIMETLRLHPPLPF  395

Query  1392  LVPHMAMDSCNMLG-YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKG  1565
             LVPH AM +C++   Y IPKETQ+LVNVWAIGRDP TW DP  FKPERF+ +PN  DFKG
Sbjct  396   LVPHKAMSTCHIFDKYTIPKETQVLVNVWAIGRDPATWVDPNMFKPERFITDPNPRDFKG  455

Query  1566  HHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLR  1745
               +EF+PFGSGRRMCPALPLASR+LPLA+GS++ SFDW L  G++  +MDM E++GITL+
Sbjct  456   QDYEFLPFGSGRRMCPALPLASRVLPLAIGSMVRSFDWALADGLKGEEMDMGEKIGITLK  515

Query  1746  KATPLKAIPVPYKG  1787
             KA PL+AIP+PY+G
Sbjct  516   KAVPLEAIPIPYRG  529



>ref|XP_004168914.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A2-like [Cucumis 
sativus]
Length=523

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/488 (66%), Positives = 387/488 (79%), Gaps = 15/488 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WPVVGN+ QL ++ H SF++LA+K+GPIMTL LGSM TVV+SS   AREMFK 
Sbjct  32    LPPGPPCWPVVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVVSSSTVAREMFKT  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HDV L+GR IYEAMKG+ G +GSLIT+QYG HWRMLRRL T+EFFV  +L++++ VR  C
Sbjct  92    HDVPLSGRMIYEAMKGNHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLESMKHVRRHC  151

Query  723   IDHMVRYMREAGN-SGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ID M+R++ E  +  G A A+DVG+F F+M FNLIGN +FSKDLL+  S+RG +F+YH  
Sbjct  152   IDAMIRHVEEGCDPCGNAPALDVGKFVFVMGFNLIGNXIFSKDLLEANSKRGKEFYYHTR  211

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM-----ESMNAG  1061
             KVME AGKPNVADF P LRWLDPQGIRR TQFHVNKAF+IAG+++KER+       +   
Sbjct  212   KVMEMAGKPNVADFLPALRWLDPQGIRRKTQFHVNKAFEIAGEFIKERLLIREKRDIIND  271

Query  1062  GNDEK-----KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAM  1226
              +DEK     KKDY+DVLL++RGD VE P+RFSS  INVI+ EMFTAGTDTTTSTLEWAM
Sbjct  272   DDDEKKEESGKKDYLDVLLEFRGDGVEEPSRFSSWIINVIVLEMFTAGTDTTTSTLEWAM  331

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
              ELLHNP+SLQK+QAELR+ +   +  LEE H++ LPYL AV+KETLRLHPPLPFL P M
Sbjct  332   AELLHNPASLQKLQAELRATIAPND-NLEETHLQNLPYLDAVVKETLRLHPPLPFLFPRM  390

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMA--DFKGHHFEF  1580
             AM  CN+LGY IP ETQ+LVN WAIGRDPK WKD L F PERF +P+    DFKG HF+F
Sbjct  391   AMKPCNILGYRIPAETQVLVNFWAIGRDPKNWKDALVFSPERFFDPSSGSKDFKGQHFDF  450

Query  1581  IPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             IPFGSGRRMCPA+PLASR+LP+ALGS++ SFDW L  G+ P +MDM E+MGITLRK  PL
Sbjct  451   IPFGSGRRMCPAVPLASRVLPMALGSLILSFDWALPDGVSPKEMDMSEQMGITLRKKVPL  510

Query  1761  KAIPVPYK  1784
             KAIP P+K
Sbjct  511   KAIPTPHK  518



>ref|XP_008442789.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A2 [Cucumis 
melo]
Length=519

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/495 (65%), Positives = 390/495 (79%), Gaps = 14/495 (3%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             RR      LPPGP  +PVVGN+ QL ++ H SF++LA+K+GPIMTL LGSM TVVISS  
Sbjct  21    RRAGAREQLPPGPPCFPVVGNLLQLSFSAHESFTKLAAKYGPIMTLQLGSMKTVVISSST  80

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
             AAREMFK HD  L+GR IYEAMKGD G +GSLIT+QYG HWRMLRRL T+EFFV  +L++
Sbjct  81    AAREMFKTHDAPLSGRMIYEAMKGDHGTQGSLITSQYGPHWRMLRRLATSEFFVARQLES  140

Query  699   LRGVRTKCIDHMVRYMREAGN-SGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERG  872
             ++ VR  CID M+R+++E  +  G A A+DVG+F F+MSFNLIGNL+FSKDLL+  S+RG
Sbjct  141   MKHVRRHCIDAMIRHVQEGCDPCGNAQALDVGKFMFVMSFNLIGNLIFSKDLLEANSKRG  200

Query  873   AKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM---  1043
              +F+YH  KVME AGKPNVADF P LRWLDPQGIRR TQFHVNKAF+IAG+++KER+   
Sbjct  201   KEFYYHTRKVMEMAGKPNVADFLPALRWLDPQGIRRKTQFHVNKAFEIAGEFIKERLLIR  260

Query  1044  -------ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTT  1202
                       +     ++KKDY+DVLL++RGD VE P+ FSS  INVI+FEMFTAGTDTT
Sbjct  261   GKKDIINNDDDDEKXKKRKKDYLDVLLEFRGDGVEEPSCFSSWIINVIVFEMFTAGTDTT  320

Query  1203  TSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPP  1382
             TSTLEWAM ELLHNP++LQK+QAELR+ +   E  LEE H++ LPYL AV+KETLRLHPP
Sbjct  321   TSTLEWAMAELLHNPAALQKLQAELRTTIAPNE-NLEETHLQNLPYLDAVVKETLRLHPP  379

Query  1383  LPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMA-DF  1559
             LPFL P MAM  CN+LGY IP ETQ+LVN WAIGRDPK W+D L F PERF +P+   DF
Sbjct  380   LPFLFPRMAMKPCNILGYRIPAETQVLVNFWAIGRDPKNWEDALVFSPERFFDPSGGKDF  439

Query  1560  KGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGIT  1739
             KG HF+FIPFGSGRRMCPA+PLASR+LP+ALGS++ SFDW L  G+ P +MDM E+MGIT
Sbjct  440   KGQHFDFIPFGSGRRMCPAVPLASRVLPMALGSLILSFDWALPDGVLPKEMDMSEQMGIT  499

Query  1740  LRKATPLKAIPVPYK  1784
             LRK  PLKAIP P+K
Sbjct  500   LRKKVPLKAIPTPHK  514



>ref|XP_006403743.1| hypothetical protein EUTSA_v10010318mg [Eutrema salsugineum]
 gb|ESQ45196.1| hypothetical protein EUTSA_v10010318mg [Eutrema salsugineum]
Length=496

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/479 (65%), Positives = 376/479 (78%), Gaps = 24/479 (5%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP  WPV+GN+FQL G  PH S ++L+ +HGPIMTL LGSM TVVISS + ARE+FK
Sbjct  35    LPPGPNPWPVIGNMFQLAGSPPHDSLTKLSRRHGPIMTLRLGSMLTVVISSSQVAREIFK  94

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              HD  LAGRKIYEAMKG   +EGSLITAQYG +WRMLRRLCTT+FFVT RLDA+  VR+K
Sbjct  95    KHDAALAGRKIYEAMKGGKSSEGSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSK  154

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             C+D M+R++ E G +                   GNLMFS+DLLDP S+RG++FFYH GK
Sbjct  155   CVDQMLRFVEEGGQN-------------------GNLMFSRDLLDPDSKRGSEFFYHTGK  195

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             VMEFAGKPNVADFFPLLR++DPQGIRR TQFHV  AF IAG+++KER E      +DE+ 
Sbjct  196   VMEFAGKPNVADFFPLLRFIDPQGIRRKTQFHVESAFKIAGEFIKERTEVREREMSDERT  255

Query  1080  KDYMDVLLQYRG--DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             KDY+DVLL++RG     E P+RFS+R INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP +
Sbjct  256   KDYLDVLLEFRGGDGDDEEPSRFSARDINVIVFEMFTAGTDTTTSTLEWALAELLHNPRT  315

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K+Q ELR+      +KL+E  +  LPYL AVI ETLRLHPPLPFLVPH AM +C++  
Sbjct  316   LTKLQTELRTYFKSPNQKLQEEDLPNLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFN  375

Query  1434  YY-IPKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRM  1607
              Y IPKETQ+LVNVWAIGRDP+TW DP+ FKPERF+ +PN  DFKG  FEF+PFGSGRRM
Sbjct  376   QYTIPKETQVLVNVWAIGRDPETWIDPILFKPERFISDPNPRDFKGQDFEFLPFGSGRRM  435

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             CPALPLASR+LPLA+GS++ SFDW L +G+   +MDM ER+GITL+KA PL+AIP+PY+
Sbjct  436   CPALPLASRVLPLAIGSMVRSFDWALANGLNAEEMDMGERIGITLKKAVPLEAIPIPYR  494



>ref|XP_010412744.1| PREDICTED: cytochrome P450 76A1-like [Camelina sativa]
Length=514

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/515 (62%), Positives = 386/515 (75%), Gaps = 54/515 (10%)
 Frame = +3

Query  402   IFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             +FQL G  PH S ++L+ +HGPIMTL LGSM TVVISS E ARE+FK HD  LAGRKIYE
Sbjct  1     MFQLAGSPPHHSLTKLSRRHGPIMTLRLGSMLTVVISSSEVAREIFKKHDAPLAGRKIYE  60

Query  579   AMKG-----------DFG-----------------------------------NEGSLIT  620
             AMKG            +G                                   ++ SLIT
Sbjct  61    AMKGRKSSDTSLITAQYGAYWRMLRRLCTTQFFVTRRLDAMSDIYEAMKGRKSSDTSLIT  120

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
             AQYG +WRMLRRLCTT+FFVT RLDA+  VR+KC++ M+R+++E G +GT  IDVGR+FF
Sbjct  121   AQYGAYWRMLRRLCTTQFFVTRRLDAMSDVRSKCVEQMLRFVKEGGQNGTKTIDVGRYFF  180

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
             LM+FNLIGNLMFS++LLDP S+RG++FFYH  KVMEFAGKPNVADFFPLLR++DPQGIRR
Sbjct  181   LMAFNLIGNLMFSRELLDPDSKRGSEFFYHTRKVMEFAGKPNVADFFPLLRFIDPQGIRR  240

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRG----DLVEGPARFSS  1148
              TQFHV KAF+I G++++ER E     G+DEK KDY+DVLL++RG    DL E P  FS+
Sbjct  241   KTQFHVEKAFEITGEFIRERSEVREREGSDEKTKDYLDVLLEFRGGDGVDL-EEPCSFSA  299

Query  1149  RTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIE  1328
             R INVI+FEMFTAGTDTTTSTLEWA+ ELLHNP +L K+Q ELR+     ++KL+E  + 
Sbjct  300   RDINVIVFEMFTAGTDTTTSTLEWALAELLHNPRTLTKLQTELRTYFKSPDQKLQEEDLP  359

Query  1329  KLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG-YYIPKETQILVNVWAIGRDPKTWK  1505
              LPYL AVI ETLRLHPPLPFLVPH AM +C++ G Y IPKETQ+LVNVWAIGRDPKTW 
Sbjct  360   NLPYLSAVIMETLRLHPPLPFLVPHKAMSTCHIFGKYTIPKETQVLVNVWAIGRDPKTWI  419

Query  1506  DPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWV  1682
             DP+ FKPERF+ + N  DFKG  FEF+PFGSGRRMCPALPLASR+LPLA+GS++ SFDW 
Sbjct  420   DPVMFKPERFISDSNPRDFKGQDFEFLPFGSGRRMCPALPLASRILPLAIGSMVRSFDWA  479

Query  1683  LGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             L +G+   +MDM ER+GITL+K+ PL+AIP+PY G
Sbjct  480   LENGLSAEEMDMGERIGITLKKSVPLEAIPIPYLG  514



>emb|CDP12472.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/557 (54%), Positives = 346/557 (62%), Gaps = 137/557 (25%)
 Frame = +3

Query  348   EEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAR  527
             E++  LPPGPRRW VVGN+FQLGW+ H SF+ LASK GPIMTLWLGSM TVVISS+E AR
Sbjct  34    EKLERLPPGPRRWSVVGNMFQLGWSGHESFAILASKQGPIMTLWLGSMCTVVISSNEVAR  93

Query  528   EMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR------  689
             EMFKNHDVVL GRKIYEAM+GD GNEG+LITAQYG  WRMLRRLCT +FF   +      
Sbjct  94    EMFKNHDVVLVGRKIYEAMEGDIGNEGTLITAQYGPRWRMLRRLCTAKFFCLEKIISNGY  153

Query  690   --LDALRGVRTKC-------------------------------------IDHMVRYMRE  752
               L+ L  V   C                                     ID MV+Y+  
Sbjct  154   IKLEKLHLVARFCLTCEKIFKMTSLMNCSILNLVSNAINHSQFGLMQQLIIDQMVKYIEA  213

Query  753   AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVA  932
             AG SG   IDVG+FFFL++FNLIGNLMFSKDLLDP SERGAKFF                
Sbjct  214   AGGSGANGIDVGKFFFLLAFNLIGNLMFSKDLLDPSSERGAKFF----------------  257

Query  933   DFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND-----EKKKDYMDV  1097
                                       DIAG YL ER+   N    D     ++++DY+DV
Sbjct  258   --------------------------DIAGLYLIERIIESNRDETDHPSPEKRRRDYLDV  291

Query  1098  LLQYRGDLVEGPARFSSRTINVILF-----------------------EMFTAGTDTTTS  1208
             LL Y+G+  E P  FS  TIN+I+F                       EMFT GTD TTS
Sbjct  292   LLHYQGESAEEPPEFSPTTINIIVFRKTLCFLSNIKFGSYHVINLRTHEMFTVGTDMTTS  351

Query  1209  TLEWAMTELLHNPSSLQKVQAELRSVVG-GTEKKLEEYHIEKLPYLKAVIKETLRLHPPL  1385
              LEWAM ELL NP +L+KVQAELRS +  GT  KLEE H++ L YLK V+KETLRLHPPL
Sbjct  352   ILEWAMAELLRNPKTLEKVQAELRSAICLGT--KLEEKHLDNLSYLKVVVKETLRLHPPL  409

Query  1386  PFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKG  1565
             PFLVPHMAMDS   LG               IGRDPKTW++PL+FKPERFLEP+ ADF+G
Sbjct  410   PFLVPHMAMDS-KYLG---------------IGRDPKTWENPLEFKPERFLEPSTADFQG  453

Query  1566  HHFEFIPFGSGRRMCPALPLAS---RMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGI  1736
             HHFEFIPFGSGRR+CPA+ LAS    +LP+ALGS+LH FDW L  G++P ++DM ERMGI
Sbjct  454   HHFEFIPFGSGRRICPAVSLASMVRHLLPMALGSILHLFDWSLADGIKPEELDMGERMGI  513

Query  1737  TLRKATPLKAIPVPYKG  1787
             TLRKA PLKAI VP +G
Sbjct  514   TLRKAVPLKAILVPLQG  530



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   499 bits (1285),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 320/474 (68%), Gaps = 6/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNI  LG TPH +     +KHGP+  L LGS++T+VI S +AA E FK 
Sbjct  30    LPPQPPAWPVIGNILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKG  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A RK   AM     ++GSL   +YG +WR+LRRLC+ E  VT R++    +R KC
Sbjct  90    HDFAFADRKCPHAMTALNYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRVNETAHLRQKC  149

Query  723   IDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D+MV Y+ E       +    ID+  F  LM FN++GN++ S+DL DP+S+ G +FF  
Sbjct  150   VDNMVAYLEEEMAVKQVTTEQGIDLSHFLLLMGFNVVGNMVLSRDLWDPKSKDGPEFFDA  209

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               + ME+AGKPNVADF P L+WLDPQGI+      + +A +IA  ++KER+E     G  
Sbjct  210   MNRFMEWAGKPNVADFLPWLKWLDPQGIKASMAKDMGRAMNIAEGFVKERLEERKLRGEM  269

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D +L Y GD  EGP + SS+ + +I+ EMF AG++TT+ST+EW M ELL  P 
Sbjct  270   RTTNDFLDAVLDYEGDGKEGPRKISSQNVIIIILEMFFAGSETTSSTIEWEMAELLRQPE  329

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  VVG T +KLEE   EK+P+L+AV+KETLRLHPPLPFLVP  A+   N +
Sbjct  330   SMKKAKDEIDQVVGLT-RKLEENDTEKMPFLQAVVKETLRLHPPLPFLVPRNALKETNFM  388

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VNVW IGRDP  W+DPL FKPERFL  N  DFKG +FE IPFGSGRRMC
Sbjct  389   GFDIPKDTQVFVNVWGIGRDPDAWEDPLAFKPERFLGSN-TDFKGQNFELIPFGSGRRMC  447

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L ++L+ F+W LG G+ P  +DM+ER+GITLRK  PLK +P
Sbjct  448   IGLSLAHRVLHLGLATLLYHFNWELGGGLTPETLDMRERIGITLRKLHPLKVVP  501



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score =   497 bits (1280),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 325/474 (69%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP+ WP++GNIF LG  PH +   L S++GP++ L LG+++TVVI S + A E+FKNH
Sbjct  33    PPGPQGWPILGNIFDLGTMPHQTLYRLRSQYGPVLWLQLGAINTVVIQSAKVAAELFKNH  92

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  + RK+  A+     N+GS+  + YG +WR LR++C++E  V  R++ +  +R KC+
Sbjct  93    DLPFSDRKVPCALTALNYNQGSMAMSNYGTYWRTLRKVCSSELLVIKRINEMAPLRHKCV  152

Query  726   DHMVRYMREAG-----NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M++++ +         G+  ++V    F ++FNLI NLM S+D  D + + G +F+  
Sbjct  153   DRMIQWIEDDATMARVQGGSGEVEVSHLVFCVAFNLIANLMLSRDFFDMKPKEGNEFYBA  212

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K+ME AGKPN ADFFP L+WLDPQGI+R     + +A DI   ++KER+E    G   
Sbjct  213   MNKIMELAGKPNTADFFPFLKWLDPQGIKRNMVRELGRAMDIIAGFVKERVEERQTGIEK  272

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E K+D++DVLL+YR D  EG  + S R +N+I+ EMF  GT+TT+ST+EWAMTELL  P 
Sbjct  273   E-KRDFLDVLLEYRRDGKEGSEKLSERNMNIIILEMFFGGTETTSSTIEWAMTELLRKPK  331

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++KV+ EL  VV G ++K+EE  I++L YL+AV+KETLRLHP LP L+P  A+   N +
Sbjct  332   SMRKVKEELDRVV-GPDRKVEESDIDELLYLQAVVKETLRLHPALPLLIPRNALQDTNFM  390

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+IP+ TQ+ VN W+IGRDP+ W  PL FKP RFL  ++ D+KG +FE IPFGSGRRMC
Sbjct  391   GYFIPQNTQVFVNAWSIGRDPEAWHKPLSFKPRRFLGSDI-DYKGQNFELIPFGSGRRMC  449

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               +P A +++P  L S+LH FDW LG  + P  +DM ER+G+TLRK  PLKAIP
Sbjct  450   IGMPFAHKVVPFVLASLLHCFDWELGSNLTPETIDMNERVGLTLRKLVPLKAIP  503



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score =   497 bits (1279),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 325/474 (69%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP+ WP++GNIF LG  PH +   L S++GP++ L LG+++TVVI S + A E+FKNH
Sbjct  33    PPGPQGWPILGNIFDLGTMPHQTLYRLRSQYGPVLWLQLGAINTVVIQSAKVAAELFKNH  92

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  + RK+  A+     N+GS+  + YG +WR LR++C++E  V  R++ +  +R KC+
Sbjct  93    DLPFSDRKVPCALTALNYNQGSMAMSNYGTYWRTLRKVCSSELLVIKRINEMAPLRHKCV  152

Query  726   DHMVRYMREAG-----NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M++++ +         G+  ++V    F ++FNLI NLM S+D  D + + G +F+  
Sbjct  153   DRMIQWIEDDATMARVQGGSGEVEVSHLVFCVAFNLIANLMLSRDFFDMKPKEGNEFYDA  212

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K+ME AGKPN ADFFP L+WLDPQGI+R     + +A DI   ++KER+E    G   
Sbjct  213   MNKIMELAGKPNTADFFPFLKWLDPQGIKRNMVRELGRAMDIIAGFVKERVEERQTGIEK  272

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E K+D++DVLL+YR D  EG  + S R +N+I+ EMF  GT+TT+ST+EWAMTELL  P 
Sbjct  273   E-KRDFLDVLLEYRRDGKEGSEKLSERNMNIIILEMFFGGTETTSSTIEWAMTELLRKPK  331

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++KV+ EL  VV G ++K+EE  I++L YL+AV+KETLRLHP LP L+P  A+   N +
Sbjct  332   SMRKVKEELDRVV-GPDRKVEESDIDELLYLQAVVKETLRLHPALPLLIPRNALQDTNFM  390

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+IP+ TQ+ VN W+IGRDP+ W  PL FKP RFL  ++ D+KG +FE IPFGSGRRMC
Sbjct  391   GYFIPQNTQVFVNAWSIGRDPEAWHKPLSFKPRRFLGSDI-DYKGQNFELIPFGSGRRMC  449

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               +P A +++P  L S+LH FDW LG  + P  +DM ER+G+TLRK  PLKAIP
Sbjct  450   IGMPFAHKVVPFVLASLLHCFDWELGSNLTPETIDMNERVGLTLRKLVPLKAIP  503



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score =   496 bits (1277),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/471 (50%), Positives = 330/471 (70%), Gaps = 5/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
              PPGP  WP++GN+  LG  PH + ++L  K+G ++ L LGS++T+VI S + A E+FK 
Sbjct  32    FPPGPPGWPILGNLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNTMVILSAKPASELFKY  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  A R I E M+    NEGSL  A YG +WR+LRRL T +  V  R++    +R KC
Sbjct  92    HDLSFAERNITETMRSHGYNEGSLAIAPYGSYWRVLRRLVTVDMLVNKRINETASIRRKC  151

Query  723   IDHMVRYMREAG-NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             +D M+R+++E    +    I + RF FLM+FN +GNLMFSKDL+DP S+ G++FF     
Sbjct  152   VDDMLRWIKEETYEANDHGIHLARFVFLMTFNSLGNLMFSKDLVDPESKEGSEFFTAMMG  211

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             +ME +G  NVAD+FP LRWLDPQG++R     + KA +IA  ++KER+E     G  +++
Sbjct  212   LMETSGYANVADYFPWLRWLDPQGLKRRMDKELGKALEIASKFVKERIEEKKVVG--DRR  269

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
             KD++DVLL++ G+  + PA+ S R  N+ + E+F AG++TT+ST+EWAMTELL NP S+ 
Sbjct  270   KDFLDVLLEFEGNGKDEPAKISDRDTNIFILEIFMAGSETTSSTIEWAMTELLCNPESMT  329

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             K +AEL SV+ G  +K+EE  I+ LP+L+A++KETLRLHPP+PFLVP  AM +   +GY 
Sbjct  330   KAKAELASVI-GPNRKVEETDIDNLPFLQAIVKETLRLHPPIPFLVPRRAMHNTKFMGYE  388

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             IP  TQ+LVN WAIGRDP  W +PL FKPERF+  N+ D+KG ++EFIPFG+GRRMC  +
Sbjct  389   IPVNTQVLVNAWAIGRDPNVWDEPLCFKPERFIGSNV-DYKGQNYEFIPFGAGRRMCAGV  447

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              L  R+L L LGS+LH FDW L   + P ++DM++R+GIT+RK  PL A+P
Sbjct  448   TLGHRVLHLILGSLLHHFDWELEANVNPEKVDMRDRLGITMRKLEPLIAVP  498



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score =   489 bits (1259),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/474 (50%), Positives = 321/474 (68%), Gaps = 7/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP+ GN+F LG  PH + + L  K+GP++ L LGS+ T+VI S   A E FKN
Sbjct  35    LPPGPPGWPIFGNMFNLGMMPHRTLAGLRQKYGPVIWLRLGSIDTMVILSSRVATEFFKN  94

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  A R + + M+    +EGS+  A YG +WRM RRL T +  V  RL+    +R KC
Sbjct  95    QDLNFAERTVTDLMRSHDYHEGSVALAPYGSYWRMSRRLLTVDMLVAKRLNETAPIRRKC  154

Query  723   IDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             ID M+ ++ EA ++        I + RF FL +FNL+GNLM S+DL DP S+ G+ FF  
Sbjct  155   IDKMLTWIGEAASAEKVRLGEGIHLARFVFLTTFNLLGNLMLSRDLFDPDSKVGSDFFVA  214

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
                +ME+ G  N+AD FP LRWLDPQG+RR     + KA  IA D+++ER+E    G  D
Sbjct  215   MAGLMEWTGHANIADLFPWLRWLDPQGLRRKMDRDMGKAMRIASDFVRERIEERKIGRED  274

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             + ++D++DVLL++ G+  + PA+ S + IN  + E+F AG +TT+ST+EWA+TELL NP 
Sbjct  275   D-RRDFLDVLLEFEGNGKDEPAKLSEKQINTFILEIFLAGAETTSSTIEWAITELLLNPE  333

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S+ KV++EL  VV G+ +K++E  I++LPYL+AV+KET RLHPP+PFLVP  AM     +
Sbjct  334   SMVKVKSELSQVV-GSARKVQEADIDQLPYLQAVVKETFRLHPPIPFLVPRRAMRDTVFM  392

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK TQ+ VN WAIGRDP  W DP+ FKPERF+   + D+KG HFEFIPFG+GRRMC
Sbjct  393   GYDIPKNTQVFVNTWAIGRDPDVWMDPMVFKPERFIGSKL-DYKGQHFEFIPFGAGRRMC  451

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               +PLA R+L LA GS+LH FDW      +P  +DM++R+G+T+RK  PL A+P
Sbjct  452   AGVPLAHRVLHLAFGSLLHEFDWEFNGRKDPKTIDMRDRLGVTMRKYEPLLAVP  505



>gb|AJD20226.1| putative N-methylcoclaurine 3-hydroxylase [Podophyllum peltatum]
 gb|AJD20230.1| corytuberine synthase [Podophyllum peltatum]
Length=510

 Score =   488 bits (1257),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 325/463 (70%), Gaps = 7/463 (2%)
 Frame = +3

Query  396   GNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIY  575
             GN+F LG TP+ + + L+ K+GP++ L LG  +T+VISS EAA EMFKNHD+    R I 
Sbjct  49    GNMFDLGSTPNEALANLSKKYGPVLWLRLGLQNTIVISSTEAAMEMFKNHDLTFVNRNIT  108

Query  576   EAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM-RE  752
             EA++    ++G++ T  YG +WRMLRR+ TTE F  +R+D    +R KC+D+M++++  E
Sbjct  109   EALRVHSYHQGAISTMNYGPYWRMLRRITTTELFSNNRIDNSENLRQKCVDNMIKWISNE  168

Query  753   AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVA  932
             +   G   +++  F  LMSFN+IGNLM S+DL+DP S R A+FF  A KV++  G PN+A
Sbjct  169   SMEKG--VVEIAHFISLMSFNVIGNLMLSRDLVDPSSIRAAEFFTAAEKVVQCIGAPNMA  226

Query  933   DFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYR  1112
             D FP LRWLDPQGI++  +  + KA  +A  ++KER+    +   +   KD +DVLL+++
Sbjct  227   DLFPFLRWLDPQGIKKKMKQSLGKALQVATGFVKERIAQRESKSEESNNKDLLDVLLEFQ  286

Query  1113  GDLVEG-PARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVV  1289
             G+  +G PA  S   IN+++ E+FTA TDT TST+EWA+TELL NPS+++KV+ EL  +V
Sbjct  287   GNQKDGEPATISETNINILMLELFTAATDTITSTMEWAITELLRNPSTMKKVEDELEHIV  346

Query  1290  GGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVN  1469
             G   KK+EE  IEKL +L+AV+KETLRLHPP+P L+P  +M+   ++GY IPK TQ+LVN
Sbjct  347   GKN-KKVEEGDIEKLHFLQAVVKETLRLHPPVPLLIPRRSMEDRELMGYSIPKNTQVLVN  405

Query  1470  VWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLA  1649
             VWA+GRDP +W DPL FKPERFL  ++ D+KG HF+ +PFGSGRRMC  LPLA R+L  A
Sbjct  406   VWAMGRDPSSWDDPLVFKPERFLGSDI-DYKGQHFQLLPFGSGRRMCVGLPLAHRVLHFA  464

Query  1650  LGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             L S++ SF+W L  G++P  MDM    G  LRKA PLK +  P
Sbjct  465   LASLIQSFEWALEEGVKPEGMDMTGTFG-ALRKAQPLKVVVQP  506



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score =   488 bits (1257),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 233/475 (49%), Positives = 323/475 (68%), Gaps = 6/475 (1%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
              LP GP  WP+ GNIF LG  PH + + L  K+GP++ L LGS+ T+VI S   A E FK
Sbjct  34    VLPRGPSGWPIFGNIFSLGTMPHRTLAGLREKYGPMIWLRLGSIDTMVILSSRVAAEFFK  93

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             N D+  A R + + ++    +EGS+  A YG +WR++RRL TT+  VT RL+ +  +R K
Sbjct  94    NQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVTKRLNEMAPIRRK  153

Query  720   CIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFY  887
             C+++M+ ++ EA +S  A     I + RF FLM+FNL+ NLM S+DL DP S+ G++FF 
Sbjct  154   CVENMLAWIGEAASSDKARVGEGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFT  213

Query  888   HAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGN  1067
                 +ME +G+PNV D FP LR LDPQG+RR     + KA  IA + ++ER+E     G 
Sbjct  214   AMNGLMELSGQPNVVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGG  273

Query  1068  DEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNP  1247
             D+ ++D++DVLL++ G+  + PA+ S + IN  + E+F AGT+TT+ST+EWA+TELL NP
Sbjct  274   DDDRRDFLDVLLEFEGNGKDEPAKLSEKQINTFILEIFMAGTETTSSTIEWALTELLLNP  333

Query  1248  SSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNM  1427
              S  KV+AEL  VVG   K LE   I++LPYL+AV+KET+RLHPP+PFLVP  A+     
Sbjct  334   DSKVKVEAELSRVVGSNGKVLET-DIDQLPYLQAVVKETMRLHPPVPFLVPRRAIRDTIF  392

Query  1428  LGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRM  1607
             +GY IP+ TQ+ VN WAIGRDP  W+DP+ FKPERF+   + D+KG H+EFIPFG+GRRM
Sbjct  393   MGYNIPENTQVFVNAWAIGRDPDVWEDPMAFKPERFIGSKL-DYKGQHYEFIPFGAGRRM  451

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             C  L LA R+L LALGS+LH FDW     ++P  +DM++R+G+  RK  PL  +P
Sbjct  452   CAGLSLAHRVLHLALGSLLHEFDWEFDGRIDPKTIDMRDRVGLATRKYVPLLVVP  506



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score =   487 bits (1254),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 233/475 (49%), Positives = 321/475 (68%), Gaps = 6/475 (1%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
              LPPGP  WP+ GNIF LG  PH + + L  K+GP + L LGS+ T+VI S   A E FK
Sbjct  34    VLPPGPSGWPIFGNIFSLGTMPHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFK  93

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             N D+  A R + + ++    +EGS+  A YG +WR++RRL TT+  V  RL+    VR K
Sbjct  94    NQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLNETALVRRK  153

Query  720   CIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFY  887
             C+++M+ ++ EA +S  A     I + RF FLM+FNL+ NLM S+DL DP S+ G++FF 
Sbjct  154   CVENMLAWIGEAASSDKAQVGEGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFT  213

Query  888   HAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGN  1067
                 +ME +G+PNV D FP LR LDPQG+RR     + KA  IA + ++ER+E     G 
Sbjct  214   AMNGLMELSGQPNVVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGG  273

Query  1068  DEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNP  1247
             D+ ++D++DVLL++ G+  + PA+ S + IN  + E+F AGT+TT+ST+EWA+TELL NP
Sbjct  274   DDDRRDFLDVLLEFEGNGKDEPAKLSEKQINTFILEIFMAGTETTSSTIEWALTELLLNP  333

Query  1248  SSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNM  1427
              S  KV+AEL  VVG   K LE   I++LPYL+AV+KET+RLHPP+PFL+P  A+     
Sbjct  334   DSKVKVEAELSRVVGSNRKVLET-DIDQLPYLQAVVKETMRLHPPVPFLLPRRAIRDTIF  392

Query  1428  LGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRM  1607
             +GY IP+ TQ+ VN WAIGRDP  W+DP+ FKPERF+   + D+KG H+EFIPFG+GRRM
Sbjct  393   MGYNIPENTQVFVNAWAIGRDPDVWEDPMAFKPERFIGSKL-DYKGQHYEFIPFGAGRRM  451

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             C  L LA R+L LALGS+LH FDW     ++P  +DM++R+G+  RK  PL  +P
Sbjct  452   CAGLSLAHRVLHLALGSLLHEFDWEFDGRIDPKTIDMRDRVGLATRKYVPLLVVP  506



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score =   487 bits (1254),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 238/471 (51%), Positives = 329/471 (70%), Gaps = 6/471 (1%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN+F LG  PH + +++  K+G ++ L LG+M+T+VI S +AA E FKNH
Sbjct  36    PPGPSGWPIFGNLFDLGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNH  95

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  A R I E M+    ++GSL  A YG +WR+LRRL T +  VT R++    +R KC+
Sbjct  96    DLSFADRTITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASIRRKCV  155

Query  726   DHMVRYM-REAGNSGTAA-IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             D M++++  E+   G AA I V RF FLM+FN++GNLM S+DLLDP S+ G++FF     
Sbjct  156   DDMLQWIEEESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMG  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             +ME++G  N+ADFFP LR LD QG+R+  +  + KA +IA  ++KER+E        + +
Sbjct  216   LMEWSGHANLADFFPWLRRLDLQGLRKNMERDLGKAMEIASKFVKERVEDKIV--TSDSR  273

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
             KD++DVLL++RG   + P + S R +N+ + E+F AG++TT+ST+EWA+TELL NP S+ 
Sbjct  274   KDFLDVLLEFRGSGKDEPDKLSERDVNIFILEIFLAGSETTSSTVEWALTELLCNPESMI  333

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             KV+AEL  VV  + KK+EE  +E LP+L+AV+KETLRLHPP+PFLVP  AM   N +GY 
Sbjct  334   KVKAELAQVVRAS-KKVEESDMENLPFLQAVVKETLRLHPPIPFLVPRRAMQDTNFMGYD  392

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             IPK TQ+LVN WAIGRDP  W DP  F PERF+   + D++G   EFIPFG+GRRMC  +
Sbjct  393   IPKNTQVLVNAWAIGRDPDAWDDPSCFMPERFIGKRV-DYRGQDLEFIPFGAGRRMCAGV  451

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             PLA R+L L LGS+LH FDW     + P+ +D K+RMGIT+RK+ PL A+P
Sbjct  452   PLAHRVLHLILGSLLHHFDWEFEANVNPASVDKKDRMGITVRKSEPLMAVP  502



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score =   485 bits (1248),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 243/484 (50%), Positives = 325/484 (67%), Gaps = 11/484 (2%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSD  515
             HRRL      PPGP  WPV GN F LG  PH S ++L  K+G ++ L LG+++T+VI S 
Sbjct  30    HRRL------PPGPPGWPVFGNTFDLGPMPHRSLAQLRHKYGDVLWLKLGAINTMVILSS  83

Query  516   EAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLD  695
             +AA E FKNHD+    R + E  +    ++GS+  A YG +WR++RRL T E  V  R+ 
Sbjct  84    KAAAEFFKNHDLSFVERTVTETSRVYGYHKGSVALANYGSYWRVMRRLVTVEMLVNKRIR  143

Query  696   ALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGA  875
                 +R KC+D M+ ++ E        + V RF FLM+FNL+GNLM SKDL  P SE G+
Sbjct  144   ETAFLRRKCVDDMLLWIEEEAGKANCGVHVARFVFLMTFNLLGNLMLSKDLFGPDSEEGS  203

Query  876   KFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMN  1055
             +FF     +ME+ G  N++D FP LR LDPQG+RR  +  + KA  IA  ++KER  S +
Sbjct  204   EFFVAMEGIMEWGGHANMSDIFPWLRRLDPQGLRRKMERDMGKAMKIASKFVKERKNSTD  263

Query  1056  AGGND-EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTE  1232
                 + E+KKD++DVLL+Y G+  + PA+ S   +N+ + E+F AG++TT+ST+EWA+TE
Sbjct  264   QQYVERERKKDFLDVLLEYEGNGNDEPAKISDDELNIFILEIFLAGSETTSSTIEWALTE  323

Query  1233  LLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAM  1412
             L+ +P ++ K + EL  VV G   K+EE  IEKLPYL+AVIKETLRLHPP+PFLVP  A 
Sbjct  324   LIRSPKAMNKAKTELTQVV-GPNGKVEESDIEKLPYLQAVIKETLRLHPPIPFLVPRRAK  382

Query  1413  DSCNMLGYYIPKETQILVNVWAIGRDPKTWKD-PLKFKPERFL-EPNMA-DFKGHHFEFI  1583
             +  N +GY+IPK TQ+ VN WAIGRDP  W D P+ FKPERF+  PN + D+KG HFEFI
Sbjct  383   NDTNFMGYFIPKNTQVFVNAWAIGRDPDVWADEPMCFKPERFMVGPNSSTDYKGQHFEFI  442

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFG+GRRMC  +PLA R+L L LGS+LH FDW L   ++   MDMK+R+GIT+RK  PL 
Sbjct  443   PFGAGRRMCAGVPLAHRVLHLVLGSLLHHFDWELDASVDVETMDMKDRLGITVRKFEPLL  502

Query  1764  AIPV  1775
             AIP 
Sbjct  503   AIPT  506



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score =   485 bits (1248),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 232/472 (49%), Positives = 320/472 (68%), Gaps = 6/472 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP+ GN+FQLG  PH + ++L +KHGP++ L +G+M T+VI S +AA   FK+
Sbjct  35    LPPGPPGWPIFGNLFQLGDMPHRTLADLRAKHGPVVWLQIGAMKTMVILSADAASVFFKH  94

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A R I E M+    N+ SL  A YG +WR++RRL T +  V  R++    VR KC
Sbjct  95    HDHAFADRTITETMRAHNYNKSSLALAPYGPYWRLMRRLVTVDMLVAKRINETASVRRKC  154

Query  723   IDHMVRYM-REAGNSGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ++ M+ ++ +EAG       + V RF FLMSFNL GNLM S+DL DP SE G++FF    
Sbjct  155   VNDMITWLSKEAGKLEEGDGVYVARFVFLMSFNLFGNLMLSRDLFDPESETGSEFFAAMA  214

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              ++E+ G  NVAD FP L+WLDPQG+R+     + KA +IA  ++K+R+E       D++
Sbjct  215   GLLEWTGHANVADMFPWLKWLDPQGLRKKMDRDMGKALEIASKFVKQRLEEQR---RDKE  271

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              +D++DVL+ ++    E     S + +N+ + E+F AG++TT+S +EWAMTELL N   L
Sbjct  272   TRDFLDVLIDFQSSNTEEALTISDKDLNIFILEIFMAGSETTSSIIEWAMTELLRNRECL  331

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
             +KV++EL  VVG   +++EE  I+ LPYL+AV+KETLRLHPP+P LVP  A+     +GY
Sbjct  332   EKVKSELDGVVGNG-REIEESDIDNLPYLQAVVKETLRLHPPIPLLVPRKAIKDTQFMGY  390

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              IPK+TQ+LVN WAIGRDP  W  PL FKP+RF++ N  D+KGHHF FIPFG+GRRMC  
Sbjct  391   DIPKDTQVLVNAWAIGRDPSFWDQPLDFKPQRFVDCNNIDYKGHHFGFIPFGAGRRMCAG  450

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +PLA R+L L LGS+LH F W L   + PS +DMKE++GIT+RK  PL  +P
Sbjct  451   VPLAHRILHLVLGSLLHRFHWELQTHVTPSTVDMKEKLGITMRKLQPLLLVP  502



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score =   483 bits (1242),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/473 (50%), Positives = 326/473 (69%), Gaps = 7/473 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP+ GNIF LG  PH   + L   +G ++ L LG + T+V+ S +AA E+FKN
Sbjct  34    LPPGPPGWPIFGNIFDLGTLPHQKLAGLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKN  93

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  + R I+E M+    NE SL  A YG +WR LRRL T +     R++    +R KC
Sbjct  94    HDLSFSDRSIHETMRVHQYNESSLSLAPYGPYWRSLRRLVTVDMLTMKRINETVPIRRKC  153

Query  723   IDHMVRYMREA--GNSGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHA  893
             +D ++ ++ E   G  GTA  +++GRFFFL +FN+IGNLM S+DLLDP+S +G++FF   
Sbjct  154   VDDLLLWIEEEARGMDGTATGLELGRFFFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAM  213

Query  894   GKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDE  1073
                ME +G  N ADFFP L+WLDPQG+++  +  + K+ +IA  ++KERM    A   + 
Sbjct  214   RISMESSGHTNFADFFPWLKWLDPQGLKKRMEVDLGKSIEIASGFVKERMRQGRA--EES  271

Query  1074  KKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
             K+KD++DVLL+++GD  +   + S + IN+ + EMF A ++TT+ST+EWAMTELL +P S
Sbjct  272   KRKDFLDVLLEFQGDGKDEATKISEKGINIFITEMFMAASETTSSTMEWAMTELLRSPES  331

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             + KV+AEL  V+ G ++KLEE  ++ LPYL AV+KETLRLHP  PFLVP  A++    +G
Sbjct  332   MTKVKAELGRVI-GEKRKLEESDLDDLPYLHAVVKETLRLHPAAPFLVPRRAVEDTKFMG  390

Query  1434  YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             Y+IPK TQ+ VNVWAIGR+ +TW D L FKPERF++ NM D+KG +FEFIPFG+GRR+C 
Sbjct  391   YHIPKGTQVFVNVWAIGREAETWDDALCFKPERFVDSNM-DYKGQNFEFIPFGAGRRICV  449

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              +PLA R+L   LGS+LH FDW L   + P  MDMKER GI + K  PLKA+P
Sbjct  450   GIPLAYRVLHFVLGSLLHHFDWQLERNVTPETMDMKERRGIVICKFHPLKAVP  502



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score =   482 bits (1241),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 230/481 (48%), Positives = 327/481 (68%), Gaps = 7/481 (1%)
 Frame = +3

Query  336   HRRLEEV--GALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             HRR   V     PPGP  WP++GN+  LG  PH + ++L  K+G I+ L LG+++TVVI 
Sbjct  23    HRRRNSVLNSRFPPGPPGWPILGNLLDLGSVPHSTLTDLRQKYGDILGLRLGAINTVVIL  82

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
             S +AA E+FKNHD+  A R +   M+    ++GSL  A YG +WR+++RL T +  V+ +
Sbjct  83    SAKAASELFKNHDLTFAERFLTITMRVHGYDQGSLALAPYGSYWRVMKRLVTVDMLVSKK  142

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
             ++    VR KC+D M+R++      G  +  V RF FLMS NL+GNLM S +L+DP S  
Sbjct  143   INETAFVRRKCMDDMLRWIEGESYKGCGS-QVARFVFLMSTNLLGNLMLSCNLVDPESRE  201

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
             G +FF     + E +G  NVAD+ P L+WLDPQG++   +  + KA +IA  ++KER+E 
Sbjct  202   GTQFFRSITGLTEASGYANVADYLPWLKWLDPQGLKSKMERELGKALEIASQFVKERIEE  261

Query  1050  MNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
                G  ++K+KD++DVLL++ G+  + P + S R +N+ + E+F AG +TT+S++EWAMT
Sbjct  262   KKLG--EDKRKDFLDVLLEHEGNGKDEPDKISDRDLNIFILEIFIAGAETTSSSIEWAMT  319

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELL NP  ++K +AEL SV+G   +K+EE  I+ LP+L+AV+KETLRLHPP+PFLVP  A
Sbjct  320   ELLCNPEPMRKAKAELASVIGAN-RKVEESDIDNLPFLQAVVKETLRLHPPIPFLVPRRA  378

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
                   +GY+IP+ TQ+LVN WAIGRD   W DPL FKPERF+  N+ D+KG H+EFIPF
Sbjct  379   TQDTKFMGYHIPENTQVLVNAWAIGRDKDVWNDPLSFKPERFMGSNV-DYKGQHYEFIPF  437

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             G+GRRMC  + LA R+L L LGS+LH FDW L   + P  +DM++R+G+T+RK  PL A+
Sbjct  438   GAGRRMCAGVSLAHRILHLTLGSLLHHFDWELEANVTPDTLDMRDRLGVTMRKLEPLLAV  497

Query  1770  P  1772
             P
Sbjct  498   P  498



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score =   482 bits (1240),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 237/471 (50%), Positives = 327/471 (69%), Gaps = 6/471 (1%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WPV+GN+F LG  PH + + +  K+G ++ L LG+M+T+VI S +AA E FKNH
Sbjct  36    PPGPSGWPVLGNLFDLGSMPHRTLTGMRQKYGDVIWLRLGAMNTMVILSAKAATEFFKNH  95

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  A R I E M+    ++GSL  A YG +WR+LRRL T +  VT R++     R KC+
Sbjct  96    DLSFADRTITETMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASTRRKCV  155

Query  726   DHMVRYM-REAGNSGTAA-IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             D M++++  E+   G AA I V RF FLM+FN++GNLM S+DLLDP S+ G++FF     
Sbjct  156   DDMLQWIEEESCKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMG  215

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             +ME++G  N+ADFFP LR LD QG+R+  +  + KA +IA  ++KER+E        + +
Sbjct  216   LMEWSGHANLADFFPWLRRLDLQGLRKNMERDLGKAMEIASKFVKERVEDKKV--TTDSR  273

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
             KD++DVLL++RG   + P + S R +N+ + E+F AG++TT+ST+EWA+TELL N  S+ 
Sbjct  274   KDFLDVLLEFRGSGKDEPDKLSERDLNIFILEIFLAGSETTSSTIEWALTELLCNQESMI  333

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             KV+AEL  VV  + KK+EE  +E LP+L+AV+KETLRLHPP+PFLVP  AM   N +GY 
Sbjct  334   KVKAELAQVVRAS-KKVEESDMENLPFLQAVVKETLRLHPPIPFLVPRRAMQDTNFMGYD  392

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             IPK TQ+LVN WAIGRDP  W DP  F PERF+   + D++G   EFIPFG+GRRMC  +
Sbjct  393   IPKNTQVLVNAWAIGRDPDAWDDPSCFMPERFIGKEV-DYRGQDLEFIPFGAGRRMCAGV  451

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             PLA R+L L LGS+LH FDW     + P+ +D K+RMG+T+RK+ PL A+P
Sbjct  452   PLARRVLHLILGSLLHHFDWEFEAHVNPASVDKKDRMGVTVRKSEPLIAVP  502



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score =   480 bits (1236),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 236/472 (50%), Positives = 317/472 (67%), Gaps = 4/472 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WPV GN+FQLG  PH + + L  K GP++ L +G+M+T+ I S EAA   FK+
Sbjct  40    LPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAILSAEAATVFFKH  99

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A R I E M+    ++ SL  A YG +WR++RRL T +  V+ R++    +R KC
Sbjct  100   HDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRINDTASIRRKC  159

Query  723   IDHMVRYM-REAGNSGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ++ M+ ++ +EA  S     + V RF FLM+FNL GNLM S+DL DP SE G++FF    
Sbjct  160   VNDMINWVAKEASKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDGSEFFSAMM  219

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME+ G  NV D FP L WLDPQG+RR     + KA  IA  ++K+R+E     G + K
Sbjct  220   GLMEWTGHANVTDLFPWLSWLDPQGLRRKMDRDMGKALGIASRFVKQRLEQQLHRGTN-K  278

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              +D++DVL+ ++    +     S + +N+ + EMF AG++TT+ST+EWAMTELL N   L
Sbjct  279   SRDFLDVLIDFQSTNSQEALNVSDKDLNIFILEMFLAGSETTSSTIEWAMTELLCNRECL  338

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              KV+ EL  VVG   +++EE  I+KLPYL+ V+KETLRLHPP+P LVP  A +    +GY
Sbjct  339   LKVKRELSWVVG-CGREVEESDIDKLPYLQGVVKETLRLHPPIPLLVPRKATEDTEFMGY  397

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
             YIPK+TQ+ VN WAIGRDP  W +PL FKPERF E N  D+KGHHFEFIPFG+GRRMC  
Sbjct  398   YIPKDTQVFVNAWAIGRDPSAWDEPLVFKPERFSENNNIDYKGHHFEFIPFGAGRRMCAG  457

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +PLA R+L L LGS+LH FDW L   + PS MDM++++GIT+RK  PL A+P
Sbjct  458   VPLAHRVLHLVLGSLLHRFDWELDCHVTPSTMDMRDKLGITMRKFQPLLAVP  509



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   480 bits (1235),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 231/464 (50%), Positives = 319/464 (69%), Gaps = 7/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             + GN+F LG  P+ + +    K+GPI+   +GS+ T+ I S + A E FKNHD   A RK
Sbjct  42    IFGNMFNLGTLPYQTIASFKHKYGPIVWFNIGSVKTMSILSAKTAAEFFKNHDFAFAERK  101

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
             I + M     N+GSL  A YG +WR+LRR+CT E FV  R++A   +R KC+D M++++ 
Sbjct  102   IMDTMLVHDYNKGSLAIAPYGTYWRVLRRICTVEMFVNKRINATVHIRQKCVDDMLQWIE  161

Query  750   EAGNS---GTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
             E  N      + I+V RF FL +FN++GNLMFS+DL+ P S++ ++FF    ++ME++G 
Sbjct  162   EEANVVEIKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIMEWSGN  221

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
             PNV+D FP LR  D QG+++     + KA +IA  ++KER++    GG  EKKKD++DVL
Sbjct  222   PNVSDIFPCLRRFDLQGLKKKMHREMGKALEIASTFVKERIKEREDGG--EKKKDFLDVL  279

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L + G   + PA+ +   IN+ + EMF AG++TT+S++EW +TELL +P ++ KV+AE+ 
Sbjct  280   LDFEGSGKDEPAKLTEHQINIFILEMFLAGSETTSSSVEWTLTELLCHPEAMAKVKAEIS  339

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              +VG   +KLEE  I+ LPY++AVIKE LRLHPPLPFLVP  A+     +GY IP+ TQ+
Sbjct  340   EIVGKN-RKLEESDIDNLPYMQAVIKEALRLHPPLPFLVPRRAIHDTKFMGYDIPENTQV  398

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
              VNVW+IGRDP+ W DPL FKPERFL   + DFKG  FEF+PFG+GRRMC  LPL +RML
Sbjct  399   FVNVWSIGRDPEYWDDPLDFKPERFLNSKI-DFKGQCFEFLPFGAGRRMCVGLPLGNRML  457

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              L LGS+LH FDW L   + P  MDMKERMG+T+RK  PLKA+P
Sbjct  458   HLVLGSLLHEFDWELPETITPKSMDMKERMGMTVRKFQPLKAVP  501



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   480 bits (1235),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 237/483 (49%), Positives = 323/483 (67%), Gaps = 8/483 (2%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSD  515
             HRR      LPPGP  WPV GN+F LG  PH + + L  K+G ++ L LG++ T V+ S 
Sbjct  25    HRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSS  84

Query  516   EAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLD  695
             +AA E+FKN D+  + R I E M+    +E SL  A YG HWR LRRL T E  VT R++
Sbjct  85    KAAAELFKNQDLCFSDRTITETMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRIN  144

Query  696   ALRGVRTKCIDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
                GVR KC+D M+ ++ E     G  G   I V  F FL SFN++GNLM S DLL P S
Sbjct  145   ETAGVRRKCVDDMLSWIEEEARGVGGEGRG-IQVAHFVFLASFNMLGNLMLSCDLLHPGS  203

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             + G++FF    +VME+ G PN ADFFP LRW+DPQG+R+  +  +  A  IA  +++ER+
Sbjct  204   KEGSEFFEVMVRVMEWPGHPNSADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERI  263

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             +   A   ++ KKD++DVLL ++G     P + S + +N+I+ E+F AG++TT+ST+EWA
Sbjct  264   KRGPAA--EDHKKDFLDVLLDFQGSGKNEPPQISDKDLNIIILEIFMAGSETTSSTVEWA  321

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             +TELL +P  + KV+AEL  VVG +  KLEE HI+ L YL+AV+KET RLHPP+PFLVP 
Sbjct  322   LTELLRHPECMAKVKAELGRVVGAS-GKLEERHIDDLQYLQAVVKETFRLHPPIPFLVPR  380

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
              A+   N +GY+IPK TQ+ VNVWAIGR+ + W++P  FKPERFL+ N  D+KG HF+ I
Sbjct  381   KAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPERFLDLNHIDYKGQHFQLI  440

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFG+GRRMC  +PLA RM+ L LGS+++ FDW L   +    MDM+E + + +RK  PLK
Sbjct  441   PFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSITLETMDMRENLAMVMRKLEPLK  500

Query  1764  AIP  1772
             A+P
Sbjct  501   ALP  503



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score =   480 bits (1235),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 236/472 (50%), Positives = 317/472 (67%), Gaps = 4/472 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WPV GN+FQLG  PH + + L  K GP++ L +G+M+T+ I S EAA   FK+
Sbjct  40    LPPGPPGWPVFGNMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAIFSAEAATVFFKH  99

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A R I E M+    ++ SL  A YG +WR++RRL T +  V+ R++    +R KC
Sbjct  100   HDHAFADRTITEIMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRINDTASIRRKC  159

Query  723   IDHMVRYM-REAGNSGTA-AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ++ M+ ++ +EA  S     + V RF FLM+FNL GNLM S+DL DP SE G++FF    
Sbjct  160   VNDMINWVAKEASKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDGSEFFSAMM  219

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME+ G  NV D FP L WLDPQG+RR     + KA  IA  ++K+R+E     G + K
Sbjct  220   GLMEWTGHANVTDLFPWLSWLDPQGLRRKMDRDMGKALGIASRFVKQRLEQQLHRGTN-K  278

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              +D++DVL+ ++    +     S + +N+ + EMF AG++TT+ST+EWAMTELL N   L
Sbjct  279   SRDFLDVLIDFQSTNSQEALNVSDKDLNIFILEMFLAGSETTSSTIEWAMTELLCNRECL  338

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              KV+ EL  VVG   +++EE  I+KLPYL+ V+KETLRLHPP+P LVP  A +    +GY
Sbjct  339   LKVKRELSWVVG-CGREVEESDIDKLPYLQGVVKETLRLHPPIPLLVPRKATEDTEFMGY  397

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
             YIPK+TQ+ VN WAIGRDP  W +PL FKPERF E N  D+KGHHFEFIPFG+GRRMC  
Sbjct  398   YIPKDTQVFVNAWAIGRDPSAWDEPLVFKPERFSENNNIDYKGHHFEFIPFGAGRRMCAG  457

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +PLA R+L L LGS+LH FDW L   + PS MDM++++GIT+RK  PL A+P
Sbjct  458   VPLAHRVLHLVLGSLLHRFDWELDCHVTPSTMDMRDKLGITMRKFQPLLAVP  509



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score =   479 bits (1233),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/483 (49%), Positives = 322/483 (67%), Gaps = 8/483 (2%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSD  515
             HRR      LPPGP  WPV GN+F LG  PH + + L  K+G ++ L LG++ T V+ S 
Sbjct  25    HRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSS  84

Query  516   EAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLD  695
             +AA E+FKN D+  + R I E M+    +E SL  A YG HWR LRRL T E  VT R++
Sbjct  85    KAAAELFKNXDLCFSDRTITETMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRIN  144

Query  696   ALRGVRTKCIDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
                GVR KC+D M+ ++ E     G  G   I V  F FL SFN++GNLM S DLL P S
Sbjct  145   ETAGVRRKCVDDMLSWIEEEARGVGGEGRG-IQVAHFVFLASFNMLGNLMLSCDLLHPGS  203

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             + G++FF    +VME+ G PN ADFFP LRW+DPQG+R+  +  +  A  IA  +++ER+
Sbjct  204   KEGSEFFEVMVRVMEWPGHPNSADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERI  263

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             +   A   ++ KKD++DVLL ++G     P + S + +N+I+ E+F AG++TT+ST+EWA
Sbjct  264   KRGPAA--EDHKKDFLDVLLDFQGSGKNEPPQISDKDLNIIILEIFMAGSETTSSTVEWA  321

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             +TELL +P  + KV+AEL  VVG    KLEE HI+ L YL+AV+KET RLHPP+PFLVP 
Sbjct  322   LTELLRHPECMAKVKAELGRVVGAX-GKLEERHIDDLQYLQAVVKETFRLHPPIPFLVPR  380

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
              A+   N +GY+IPK TQ+ VNVWAIGR+ + W++P  FKPERFL+ N  D+KG HF+ I
Sbjct  381   KAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPERFLDLNHIDYKGQHFZLI  440

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFG+GRRMC  +PLA RM+ L LGS+++ FDW L   +    MDM+E + + +RK  PLK
Sbjct  441   PFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSITLETMDMRENLAMVMRKLEPLK  500

Query  1764  AIP  1772
             A+P
Sbjct  501   ALP  503



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score =   479 bits (1232),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/474 (50%), Positives = 320/474 (68%), Gaps = 8/474 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WPV GN+F LG  PH + + L  K+G ++ L LG++ T V+ S +AA E+FKN
Sbjct  44    LPPGPPGWPVFGNMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKN  103

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R I E M+    +E SL  A YG HWR LRRL T E  VT R++   GVR KC
Sbjct  104   KDLCFSDRTITETMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKC  163

Query  723   IDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D M+ ++ E     G  G   I V  F FL SFN++GNLM S DLL P S+ G++FF  
Sbjct  164   VDDMLSWIEEEARGVGGEGRG-IQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEV  222

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               +VME++G PN ADFFP LRW+DPQG+R+  +  +  A  IA  +++ER++   A   +
Sbjct  223   MVRVMEWSGHPNFADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAA--E  280

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             + KKD++DVLL ++G     P + S + +N+I+ E+F AG++TT+ST+EWA+TELL +P 
Sbjct  281   DHKKDFLDVLLDFQGSGKNEPPQISDKDLNIIILEIFMAGSETTSSTVEWALTELLRHPE  340

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
              + KV+AEL  VVG    KLEE HI+ L YL+AV+KET RLHPP+PFLVP  A+   N +
Sbjct  341   CMAKVKAELGRVVGAN-GKLEENHIDDLQYLQAVVKETFRLHPPIPFLVPRKAVRDTNFM  399

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+IPK TQ+ VNVWAIGR+ + W++P  FKPERFL+ N  D+KG HFE IPFG+GRRMC
Sbjct  400   GYHIPKNTQLFVNVWAIGREAELWEEPSSFKPERFLDLNHIDYKGQHFELIPFGAGRRMC  459

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               +PLA RM+ L LGS+++ FDW L   +    MDM+E + + +RK  PLKA+P
Sbjct  460   AGVPLAHRMVHLVLGSLVYHFDWQLDSSITLETMDMRENLAMVMRKLEPLKALP  513



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score =   475 bits (1223),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 317/475 (67%), Gaps = 6/475 (1%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
              L PGP  WP+ GNIF LG  PH   + L+ K+GP++ L LGS+ T+VI S   A E FK
Sbjct  5     VLRPGPSGWPIFGNIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFK  64

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             N D+  A R + + ++    +EGS+  A YG +WR++RRL TT+  V  RL     +R K
Sbjct  65    NQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLKETAPIRRK  124

Query  720   CIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFY  887
             C+++M+ ++ EA  S  A     I + R  FLM+FNL+GNLM S+DL DP S+ G++FF 
Sbjct  125   CVENMLAWIGEAAPSDKARVGEGIHLARIVFLMNFNLLGNLMLSRDLFDPDSKVGSEFFT  184

Query  888   HAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGN  1067
                 +ME +G+PNV D FP LR LDPQG+RR     + KA  IA + ++ER+E     G 
Sbjct  185   AMNGLMELSGQPNVVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGG  244

Query  1068  DEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNP  1247
             D+ ++D++DVLL++ G+  + PA+ S + IN  + E+F AGT+TT+ST+EWA+TELL NP
Sbjct  245   DDDRRDFLDVLLEFEGNGKDEPAKLSEKQINTFILEIFMAGTETTSSTIEWALTELLLNP  304

Query  1248  SSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNM  1427
              S  KV+AEL  VVG   K LE   I++LPYL+AV+KET+RLHPP+PFLVP  A+     
Sbjct  305   DSKVKVEAELSRVVGSNRKVLET-DIDQLPYLQAVVKETMRLHPPVPFLVPRRAIRDTIF  363

Query  1428  LGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRM  1607
             +G  +PK TQ+ VN WAIGRDP  W+DP+ FKPERF+   + D+KG H+EFIPFG+GRRM
Sbjct  364   MGCNVPKNTQVFVNAWAIGRDPDVWEDPMAFKPERFIGSKL-DYKGQHYEFIPFGAGRRM  422

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                L LA R+L LALGS+LH FDW     ++P  +DM++R+G+  RK  PL  +P
Sbjct  423   YAGLSLAHRVLHLALGSLLHEFDWEFDGRIDPKTIDMRDRVGLATRKYVPLLVVP  477



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score =   476 bits (1224),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 317/475 (67%), Gaps = 6/475 (1%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
              L PGP  WP+ GNIF LG  PH   + L+ K+GP++ L LGS+ T+VI S   A E FK
Sbjct  34    VLRPGPSGWPIFGNIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFK  93

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             N D+  A R + + ++    +EGS+  A YG +WR++RRL TT+  V  RL     +R K
Sbjct  94    NQDLNFADRTVIDVLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLKETAPIRRK  153

Query  720   CIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFY  887
             C+++M+ ++ EA  S  A     I + R  FLM+FNL+GNLM S+DL DP S+ G++FF 
Sbjct  154   CVENMLAWIGEAAPSDKARVGEGIHLARIVFLMNFNLLGNLMLSRDLFDPDSKVGSEFFT  213

Query  888   HAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGN  1067
                 +ME +G+PNV D FP LR LDPQG+RR     + KA  IA + ++ER+E     G 
Sbjct  214   AMNGLMELSGQPNVVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGG  273

Query  1068  DEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNP  1247
             D+ ++D++DVLL++ G+  + PA+ S + IN  + E+F AGT+TT+ST+EWA+TELL NP
Sbjct  274   DDDRRDFLDVLLEFEGNGKDEPAKLSEKQINTFILEIFMAGTETTSSTIEWALTELLLNP  333

Query  1248  SSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNM  1427
              S  KV+AEL  VVG   K LE   I++LPYL+AV+KET+RLHPP+PFLVP  A+     
Sbjct  334   DSKVKVEAELSRVVGSNRKVLET-DIDQLPYLQAVVKETMRLHPPVPFLVPRRAIRDTIF  392

Query  1428  LGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRM  1607
             +G  +PK TQ+ VN WAIGRDP  W+DP+ FKPERF+   + D+KG H+EFIPFG+GRRM
Sbjct  393   MGCNVPKNTQVFVNAWAIGRDPDVWEDPMAFKPERFIGSKL-DYKGQHYEFIPFGAGRRM  451

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                L LA R+L LALGS+LH FDW     ++P  +DM++R+G+  RK  PL  +P
Sbjct  452   YAGLSLAHRVLHLALGSLLHEFDWEFDGRIDPKTIDMRDRVGLATRKYVPLLVVP  506



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score =   475 bits (1223),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 325/474 (69%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN+F LG  PH +  +L SK+GPI+ L LGS++T+V+ +  +A E+FK H
Sbjct  38    PPGPPGWPIFGNMFDLGDLPHQTLYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKH  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             DV    RK+ + +     N+GSL    YG HWR+LRRLC+ EF V  R++    +R +  
Sbjct  98    DVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIE  157

Query  726   DHMVRYMRE-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D+MVR++ E         GT A+ + RF FLM+FNL+GNLM S+DLLD +   G +FF  
Sbjct  158   DNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPEGREFFDC  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               +++E AG PN+ADF P L+ LDP G+++    ++++   I+  +++ER+++  +G   
Sbjct  218   MNEILELAGTPNIADFLPFLKKLDPLGMKKRMIDNMSRTMKISSKFVQERLDNRKSGKFS  277

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++DV+L+Y+GD  +GP +F+ + +N+++ EMF AG++TT+ ++EW  TELL NP 
Sbjct  278   E-KKDFLDVMLEYQGDGKDGPDKFTEKHVNIVIMEMFFAGSETTSISIEWGFTELLRNPR  336

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             + +KV+ EL  VV G  + +EE  +E LPYL+AV+KETLRLHP LP L+P   M+    +
Sbjct  337   AFKKVREELDRVV-GVNRMVEETDMENLPYLQAVVKETLRLHPALPMLLPRNTMEDTEYM  395

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY +PK TQ+ VN WAIGRD + W DPL FKPERFL  ++ ++KG HFE IPFGSGRR+C
Sbjct  396   GYLVPKGTQVFVNAWAIGRDSEYWDDPLTFKPERFLNSSV-EYKGQHFELIPFGSGRRIC  454

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                PLA R++ L L +++ +FDW LG G++P  +D++ER+G+TLRK  PLK IP
Sbjct  455   VGFPLAHRVVHLTLATLVQAFDWDLGAGVKPEDIDLEERLGLTLRKKNPLKVIP  508



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score =   475 bits (1223),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 234/461 (51%), Positives = 318/461 (69%), Gaps = 12/461 (3%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+F LG  PH + +EL  K+G ++ L  G+++T+VI S +AA + FKNHD   A RK+ E
Sbjct  60    NMFDLGTVPHRTLTELRQKYGDVIWLKFGAINTMVILSAKAATDFFKNHDSTFAERKVTE  119

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
              M+    ++ SL  A YG  WR+LRRL T E  VT R++    VR KC++ M+ ++ +  
Sbjct  120   TMRVHGYDKSSLALAPYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEA  179

Query  759   NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADF  938
                 + + V R  FL +FNL+GNLM S+DLLD  S  GA+FF     +ME++G  N+ADF
Sbjct  180   ----SGVHVARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLMEWSGHANLADF  235

Query  939   FPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMN---AGGNDEKKKDYMDVLLQY  1109
             FP+LR LDPQG+RR  +  V KA +IA  ++KER+E  +    G +DEK+KD++DV+L +
Sbjct  236   FPILRRLDPQGLRRKMERDVGKALEIASKFVKERLEQKDKNVTGTSDEKRKDFLDVMLDF  295

Query  1110  RGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVV  1289
              G+  + PA+ S + +N+ + E+F AG++TT+ST+EWA+TELL NP SL K +AEL   V
Sbjct  296   EGNGKDEPAKVSEKDLNIFILEIFLAGSETTSSTIEWALTELLTNPESLNKAKAELAQAV  355

Query  1290  GGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVN  1469
             G  ++  EE  I+ LPYLKAVIKETLRLHPP+PFLVP  AM+  N  GY+IPK+TQ+LVN
Sbjct  356   GA-DRTFEEDDIDNLPYLKAVIKETLRLHPPIPFLVPRRAMEDTNFQGYHIPKDTQVLVN  414

Query  1470  VWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLA  1649
              WAIGRDP+ W +P  FKPERFL  +  D+KG ++E IPFG+GRRMC  +PLA RML L 
Sbjct  415   AWAIGRDPEVWDEPWSFKPERFL-GSTVDYKGQNYELIPFGAGRRMCAGVPLAHRMLHLI  473

Query  1650  LGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LGS+LH FDW L    E   +DM +RMGIT+RKA PL A+P
Sbjct  474   LGSLLHQFDWELDCKEE---IDMNDRMGITVRKAEPLIAVP  511



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   480 bits (1236),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 237/483 (49%), Positives = 323/483 (67%), Gaps = 8/483 (2%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSD  515
             HRR      LPPGP  WPV GN+F LG  PH + + L  K+G ++ L LG++ T V+ S 
Sbjct  25    HRRRSGSVRLPPGPPGWPVFGNMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSS  84

Query  516   EAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLD  695
             +AA E+FKN D+  + R I E M+    +E SL  A YG HWR LRRL T E  VT R++
Sbjct  85    KAAAELFKNQDLCFSDRTITETMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRIN  144

Query  696   ALRGVRTKCIDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
                GVR KC+D M+ ++ E     G  G   I V  F FL SFN++GNLM S DLL P S
Sbjct  145   ETAGVRRKCVDDMLSWIEEEARGVGGEGRG-IQVAHFVFLASFNMLGNLMLSCDLLHPGS  203

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             + G++FF    +VME+ G PN ADFFP LRW+DPQG+R+  +  +  A  IA  +++ER+
Sbjct  204   KEGSEFFEVMVRVMEWPGHPNSADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERI  263

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             +   A   ++ KKD++DVLL ++G     P + S + +N+I+ E+F AG++TT+ST+EWA
Sbjct  264   KRGPAA--EDHKKDFLDVLLDFQGSGKNEPPQISDKDLNIIILEIFMAGSETTSSTVEWA  321

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             +TELL +P  + KV+AEL  VVG +  KLEE HI+ L YL+AV+KET RLHPP+PFLVP 
Sbjct  322   LTELLRHPECMAKVKAELGRVVGAS-GKLEERHIDDLQYLQAVVKETFRLHPPIPFLVPR  380

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
              A+   N +GY+IPK TQ+ VNVWAIGR+ + W++P  FKPERFL+ N  D+KG HF+ I
Sbjct  381   KAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPERFLDLNHIDYKGQHFQLI  440

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFG+GRRMC  +PLA RM+ L LGS+++ FDW L   +    MDM+E + + +RK  PLK
Sbjct  441   PFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSITLETMDMRENLAMVMRKLEPLK  500

Query  1764  AIP  1772
             A+P
Sbjct  501   ALP  503



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score =   473 bits (1217),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 233/461 (51%), Positives = 316/461 (69%), Gaps = 12/461 (3%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+F LG  PH + +EL  K+G ++ L  G+++T+ I S +AA + FKNHD   A RK+ E
Sbjct  60    NMFDLGTVPHRTLTELRQKYGDVLWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTE  119

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
              M+    ++ SL  A YG  WR+LRRL T E   T R++    VR KC++ M+ ++ +  
Sbjct  120   TMRVHGYDKSSLALAPYGAFWRVLRRLVTVEMLATKRINETASVRRKCVNDMLLWIEQEA  179

Query  759   NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADF  938
                 + + V R  FL +FNL+GNLM S+DLLD  S  GA+FF     +ME++G  N+ADF
Sbjct  180   ----SGVHVARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLMEWSGHANLADF  235

Query  939   FPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMN---AGGNDEKKKDYMDVLLQY  1109
             FP+LR LDPQG+RR  +  V KA +IA  ++KER+E  +    G +DEK+KD++DVLL +
Sbjct  236   FPILRRLDPQGLRRKMERDVGKALEIASKFVKERLEKKDKYITGTSDEKRKDFLDVLLDF  295

Query  1110  RGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVV  1289
              G+  + PA+ S + +N+ + E+F AG++TT+ST+EWA+TELL NP SL K +AEL   V
Sbjct  296   EGNGKDEPAKVSEKDLNIFILEIFLAGSETTSSTIEWALTELLTNPESLNKAKAELAQAV  355

Query  1290  GGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVN  1469
             G  ++  EE  I+ LPYLKAVIKETLRLHPP+PFLVP  AM+  N  GY+IPK+TQ+LVN
Sbjct  356   GA-DRTFEEDDIDNLPYLKAVIKETLRLHPPIPFLVPRRAMEDTNFQGYHIPKDTQVLVN  414

Query  1470  VWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLA  1649
              WAIGRDP+ W +P  FKPERFL  +  D+KG ++E IPFG+GRRMC  +PLA RML L 
Sbjct  415   AWAIGRDPEVWDEPWSFKPERFL-GSTVDYKGQNYELIPFGAGRRMCAGVPLAHRMLHLI  473

Query  1650  LGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LGS+LH FDW L    E   +DM +RMGIT+RKA PL A+P
Sbjct  474   LGSLLHQFDWELDCKEE---IDMNDRMGITVRKAEPLIAVP  511



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   472 bits (1215),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 227/475 (48%), Positives = 325/475 (68%), Gaps = 8/475 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP+ GN+F LG  PH + + +  ++GP++ L +GS+ T+ I S + A E FKN
Sbjct  33    LPPGPPGWPIFGNLFDLGTLPHQTIAGMKLRYGPVVLLRIGSVKTIAILSAKVATEFFKN  92

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A RKI + M     N+ SL+ A YG +WR+LRR+CT E F   R++    +R KC
Sbjct  93    HDACFADRKIIDTMLVHNYNKSSLVLAPYGTYWRVLRRICTVEMFTNKRINETAHLRQKC  152

Query  723   IDHMVRYMREAGNS--GTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ID M++++ +   S    + I+V RF FL SFN++GNLM S+DL+DP S++ ++FF    
Sbjct  153   IDSMLQWIDKEAKSMKKGSGIEVARFIFLASFNMMGNLMLSRDLVDPESKKASEFFTAME  212

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME++G+PN++D FP LRWLD QG+R+     + KA ++A  ++KER++    G   E 
Sbjct  213   GLMEWSGQPNISDIFPCLRWLDIQGLRQKAGRDMGKAIEVASTFVKERLKEHKEG---EY  269

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
             KKD+++VLL++ G   + PA+ S   IN+ + EMF AG++T++S++EWA+ ELL NP ++
Sbjct  270   KKDFLEVLLEFEGSGKDEPAKLSEHQINIFILEMFIAGSETSSSSVEWALAELLCNPEAM  329

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              +V+AE+  VV G+ +K EE  I+ L Y++AV+KETLRLHPP P LVP  A+   + +GY
Sbjct  330   TRVKAEINEVV-GSNRKFEESDIDNLHYMQAVVKETLRLHPPAPLLVPRRAIQDTSFMGY  388

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLE--PNMADFKGHHFEFIPFGSGRRMC  1610
              I ++TQ+ VN WAIGRDP+ W+DP  FKPERFL       DFKG +FEFIPFG+GRRMC
Sbjct  389   DISEDTQVFVNAWAIGRDPECWEDPWAFKPERFLNLSSKTTDFKGQNFEFIPFGAGRRMC  448

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
               LPL +RM  L LGS+LH+FDW L   + P  MDMKERMG+T+RK  PL+ +P+
Sbjct  449   AGLPLGNRMSHLLLGSLLHAFDWELPSNVTPKSMDMKERMGMTVRKLQPLQVVPI  503



>ref|XP_009603940.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=511

 Score =   472 bits (1214),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 328/471 (70%), Gaps = 4/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+ WPV GN+F+LG  PH +   L  K+G ++ L LGS++T+VI S EAA E FKN
Sbjct  37    LPPGPQGWPVFGNMFELGNEPHKTLMSLKQKYGSVVWLKLGSINTMVILSAEAAAEFFKN  96

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HDV  A R + E MK    ++GSL  A YG +WR+++R+ T +  V  R++    +R KC
Sbjct  97    HDVAFAERSVTEVMKSHGYHKGSLALAPYGTYWRIMKRIMTVQMLVNKRINETVDIRRKC  156

Query  723   IDHMVRYMREAGN-SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             ID +  ++   G  + +  I V +F FL SFN++GNL+ S++L+DP+SE+G++FF    +
Sbjct  157   IDDLTEWINNEGRINSSGGIHVAKFIFLASFNMLGNLLLSRELVDPKSEKGSEFFTAMVE  216

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             +ME +G  N+ D FP LRW+DPQG+R+     + K  +I   +L ER E +   G  EKK
Sbjct  217   LMECSGHQNIVDVFPWLRWIDPQGLRKKMDRGLGKTIEIVSGFLNERFEELERTG--EKK  274

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
             KD+++VLL+Y G   + P + S + + +I+ E+F AG++TT+S++EWAMTELL NP ++ 
Sbjct  275   KDFLEVLLEYEGKGKDEPEKLSDQELILIILEIFLAGSETTSSSIEWAMTELLSNPEAMD  334

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             KV+AEL  V+G T KK EE +I+ L YL+AV+KETLRLHPP+PFLVP  A+     LGY 
Sbjct  335   KVKAELTEVLGNTNKKFEETNIDNLKYLQAVVKETLRLHPPIPFLVPRKAIQETEFLGYN  394

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             IPK+TQ+ VNVWAIGRDP+ WKDP  FKPERFL+    +++G +FEFIPFG+GRR+C  +
Sbjct  395   IPKDTQVFVNVWAIGRDPECWKDPFDFKPERFLDLK-TEYRGQNFEFIPFGAGRRICAGI  453

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             PLA RML L LGS+LH FDW + + +    +D ++RMG+T+RK  PLKAIP
Sbjct  454   PLAHRMLHLLLGSLLHEFDWEIDNSLLDEVLDTQDRMGVTVRKLKPLKAIP  504



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score =   471 bits (1212),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 228/483 (47%), Positives = 322/483 (67%), Gaps = 12/483 (2%)
 Frame = +3

Query  336   HRRLEEVGA-LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             HRR     A LPPGPR WPV GN+FQLG  PH + + L S +GP++ L +GS++T+ + +
Sbjct  21    HRRYSTTRANLPPGPRGWPVFGNMFQLGSMPHKTIAGLKSHYGPVVWLRIGSINTMALLT  80

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRL  692
               AA E+FKNHD   A R I + M     ++ +L  + YG +WR ++R+ T E  V  R+
Sbjct  81    AGAAAELFKNHDASFAERTITDVMTSHNFHKAALSLSPYGPYWRSMKRMMTVEMLVHKRI  140

Query  693   DALRGVRTKCIDHMVRYMR-EAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
                  +R +C+ +MV++++ E+ +SG   + V RF FL SFN++GNLM S+DL+ P SE 
Sbjct  141   VETEPIRRRCVSNMVQWIQNESSSSGGHGVHVARFVFLASFNMLGNLMLSRDLVSPESEE  200

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
             G++FF     +ME++G PN+ D FP ++W+DPQG+RR  +  + K   I G +++ER  S
Sbjct  201   GSEFFAAMIDMMEWSGHPNIGDLFPWMKWMDPQGLRRNAERGMGKILKIVGGFVEERQSS  260

Query  1050  MNAGGNDEKKKDYMDVLLQYRGD--LVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
                   +   KD+++VLL+Y GD   ++   + S   +N+I+ E+F AG++TT+ST EWA
Sbjct  261   ------NANNKDFLEVLLKYEGDGGKIDDQRQISDHDLNIIIMEVFLAGSETTSSTTEWA  314

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             M ELL +P ++ K + EL  VVG      EE HI+KLPYL+AV+KETLRLHPP+PFLVP 
Sbjct  315   MVELLSHPEAMNKAKVELDEVVG-KGNTFEESHIDKLPYLQAVLKETLRLHPPIPFLVPR  373

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
              A+   + +GY IPK+TQ+ VN W IGRDP+ W DPL FKPERFL   + DFKGHHFE I
Sbjct  374   RAIHETDFMGYRIPKDTQLFVNAWVIGRDPECWDDPLSFKPERFLGSKI-DFKGHHFELI  432

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFG+GRR+C  +PLA RML L LG++LH FDW +        +D +ER+G+T+RK  PLK
Sbjct  433   PFGAGRRICAGIPLAHRMLHLVLGTLLHEFDWRVDEIERKGMIDTRERIGVTVRKLVPLK  492

Query  1764  AIP  1772
             AIP
Sbjct  493   AIP  495



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score =   471 bits (1211),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 316/461 (69%), Gaps = 12/461 (3%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+F LG  PH + +EL  K+G ++ L  G+++T+ I S +AA + FKNHD   A RK+ E
Sbjct  45    NMFDLGTVPHRTLTELRQKYGDVIWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTE  104

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
              M+    ++ SL  A YG  WR+LRRL T E  VT R++    VR KC++ M+ ++ +  
Sbjct  105   TMRVHGYDKSSLALAPYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEA  164

Query  759   NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADF  938
                 + + V R  FL +FNL+GNLM S+DLLD  S  GA+FF     +ME++G  N+ADF
Sbjct  165   ----SGVHVARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLMEWSGHANLADF  220

Query  939   FPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMN---AGGNDEKKKDYMDVLLQY  1109
             FP+LR LDPQG+RR  +  V KA +IA  ++KER+E  +    G +DEK+KD++DV+L +
Sbjct  221   FPILRRLDPQGLRRKMERDVGKALEIASKFVKERLEQKDKNVTGTSDEKRKDFLDVMLDF  280

Query  1110  RGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVV  1289
              G+  + PA+ S + +N+ + E+F AG++TT+ST+EWA+TELL NP SL K +AEL   V
Sbjct  281   EGNGKDEPAKVSEKDLNIFILEIFLAGSETTSSTIEWALTELLSNPESLNKAKAELGQAV  340

Query  1290  GGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVN  1469
             G  ++  EE  I+ LPYLKAVIKETLRLHPP+P LVP  AM+  N  GY+IPK+TQ+LVN
Sbjct  341   GA-DRTFEEDDIDNLPYLKAVIKETLRLHPPIPLLVPRRAMEDTNFQGYHIPKDTQVLVN  399

Query  1470  VWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLA  1649
              WAIGRDP+ W +P  FKPERFL  +  D+KG ++E IPFG+GRRMC  +PLA RML L 
Sbjct  400   AWAIGRDPEVWDEPWSFKPERFL-GSTVDYKGQNYELIPFGAGRRMCAGVPLAHRMLHLI  458

Query  1650  LGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LGS+LH FDW L       ++DM +RMGIT+RKA PL A+P
Sbjct  459   LGSLLHQFDWELDC---KEKIDMNDRMGITVRKAEPLIAVP  496



>ref|XP_010037101.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   470 bits (1210),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 234/485 (48%), Positives = 330/485 (68%), Gaps = 14/485 (3%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             RSHR       LPPGP RWP+ GN+F LG  PH + + L  K+GP++ L LGS+ T+VI 
Sbjct  31    RSHR-------LPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGPVIWLRLGSIDTMVIL  83

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
             S   A E FKNHD+    R I + M+     +GS+  A YG +WR+ RRL T +  V  R
Sbjct  84    SSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWRVSRRLLTADMLVARR  143

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             L+    ++ KC+D M+ ++ EA ++        + + RF FLM+FNL+GNLM S+DLLDP
Sbjct  144   LNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDP  203

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
              S+ G++FF     +ME++G   +AD FP LRWL PQG+RR     + KA  IA D+++E
Sbjct  204   DSKVGSEFFEAMSGLMEWSGHVTIADLFPWLRWLGPQGLRRKMDRDMGKAMRIASDFVRE  263

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
             R+E    GGND+ ++D++DVLL++ G+  + PA+ S + I   + EMF AG +T++ST+E
Sbjct  264   RIEEKKIGGNDD-RRDFLDVLLEFEGNGKDEPAKLSEKQIKTFILEMFLAGAETSSSTVE  322

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WA+TELL +P+S+ KVQAEL  VV G+ +K++E  I++L YL+AV+KETLRLHPPLPFLV
Sbjct  323   WALTELLRDPNSMAKVQAELSRVV-GSNRKVQETDIDQLSYLQAVVKETLRLHPPLPFLV  381

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             P  AM +   +GY IPK TQ+ VN WAIGR+P  W+DP+ FKPERF+   + D+KG H+E
Sbjct  382   PRKAMANTIFMGYDIPKNTQVFVNSWAIGREPDVWEDPMAFKPERFIGSKL-DYKGQHYE  440

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
             FIPFG+GRRMC  +PLA R+L LAL S+LH F+W     ++   +DM++R+G+T+RK  P
Sbjct  441   FIPFGAGRRMCAGMPLAHRVLHLALSSLLHEFNWEFDSRIDAKTIDMRDRVGMTMRKYVP  500

Query  1758  LKAIP  1772
             L  +P
Sbjct  501   LLVVP  505



>ref|XP_010037099.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   470 bits (1209),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/485 (48%), Positives = 328/485 (68%), Gaps = 14/485 (3%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             RSHR       LPPGP RWP+ GN+F LG  PH + + L  K+GP++ L LGS+ T+VI 
Sbjct  31    RSHR-------LPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGPVIWLRLGSIDTMVIL  83

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
             S   A E FKNHD+    R I + M+     +GS+  A YG +WR+ RRL T +  V  R
Sbjct  84    SSRVAAEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWRVSRRLLTADMLVARR  143

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             L+    ++ KC+D M+ ++ EA ++        + + RF FLM+FNL+GNLM S+DLLDP
Sbjct  144   LNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDP  203

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
              S+ G++FF     +ME++G   +AD FP LRWL PQG+RR     + KA  IA D+++E
Sbjct  204   DSKVGSEFFEAMSGLMEWSGHVTIADLFPWLRWLGPQGLRRKMDRDMGKAMRIASDFVRE  263

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
             R+E    GGND+ ++D++DVLL++ G+  + PA+ S + I   + EMF AG  T++ST+E
Sbjct  264   RIEEKKIGGNDD-RRDFLDVLLEFEGNGKDEPAKLSEKQIKTFILEMFLAGARTSSSTVE  322

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WA+TELL  P+S+ KVQAEL  VV G+ +K++E  I++L YL+AV+KETLRLHPPLPFLV
Sbjct  323   WALTELLREPNSMAKVQAELSRVV-GSNRKVQETDIDQLSYLQAVVKETLRLHPPLPFLV  381

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             P  AM +   +GY IPK TQ+ VN WAIGRDP  W+DP+ FKPERF+   + D+KG H+E
Sbjct  382   PRKAMANTIFMGYDIPKNTQVFVNSWAIGRDPDVWEDPMAFKPERFIGSKL-DYKGQHYE  440

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
             FIPFG+GRRMC  +PLA R+L LAL S+LH F+W     ++   +DM++R+G+T+RK  P
Sbjct  441   FIPFGAGRRMCAGMPLAHRVLHLALSSLLHEFNWEFDSRIDAKTIDMRDRVGMTMRKYVP  500

Query  1758  LKAIP  1772
             L  +P
Sbjct  501   LLVVP  505



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score =   469 bits (1208),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 228/492 (46%), Positives = 322/492 (65%), Gaps = 13/492 (3%)
 Frame = +3

Query  318   MINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMST  497
             ++N R      +   LPPGP  WP+ GN+FQLG  PH + + L  K+GPI+ L +G+++T
Sbjct  21    LLNRRRKISATKNRRLPPGPPGWPIFGNMFQLGEMPHRTLTNLREKYGPILWLKIGAVNT  80

Query  498   VVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFF  677
             + I S + A   FKNHD   + R + E M+    ++ SL  A YG +WR++RRL T +  
Sbjct  81    MAILSAKEATIFFKNHDHAFSDRTVIETMRVHNYDKSSLALAPYGSYWRLMRRLVTVDML  140

Query  678   VTSRLDALRGVRTKCIDHMVRYMREAGNS----GTAAIDVGRFFFLMSFNLIGNLMFSKD  845
             V  R++    +R KC++ M+ ++ +   +        + V RF F MSFN+ GNLM S+D
Sbjct  141   VLKRINDTVSIRRKCVNDMLAWVAKEARARELEDGRGLHVARFIFFMSFNMFGNLMLSRD  200

Query  846   LLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGD  1025
             L D  SE G++FF     +ME+ G  NVAD FP LRWLDPQG+RR     + KA +IA  
Sbjct  201   LFDMESENGSEFFAAVMGMMEWTGHANVADLFPWLRWLDPQGLRRKMDRDMGKALEIAST  260

Query  1026  YLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTT  1205
             ++KER+E       DE  +D++DVLL+++ +  +     S + +N+ + EMF AG++TTT
Sbjct  261   FVKERLEV----ERDEVSRDFLDVLLEFQRNENQHALNISDKDLNIFILEMFLAGSETTT  316

Query  1206  STLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPL  1385
             ST+EWAMTELL N + + KV+ EL S++G   K +EE  I+KLPYL+A++KETLRLHPP+
Sbjct  317   STIEWAMTELLCNSNCMLKVKTELSSLIG--TKDVEESDIDKLPYLQAIVKETLRLHPPI  374

Query  1386  PFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNM---AD  1556
             P LVP  A+   + +GY+IPK+TQ+ VN WAIGRDP  W +PL FKPERF   N+    D
Sbjct  375   PLLVPRKAVQDTDFIGYFIPKDTQVFVNTWAIGRDPDVWDEPLVFKPERFYGCNINNKID  434

Query  1557  FKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGI  1736
             +KG ++E IPFG+GRRMC  +PLA R+L L LGS+LH FDW L   + PS +DMK+R+GI
Sbjct  435   YKGQNYELIPFGAGRRMCAGVPLAHRVLHLVLGSLLHRFDWELDSNVTPSTIDMKDRLGI  494

Query  1737  TLRKATPLKAIP  1772
             T+RK  PL A+P
Sbjct  495   TMRKFQPLLAVP  506



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score =   469 bits (1208),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 223/473 (47%), Positives = 317/473 (67%), Gaps = 7/473 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP+ GN+FQLG  PH + + L  K+GP++ L +G+++T+ I S + A   FKN
Sbjct  46    LPPGPPGWPIFGNMFQLGEMPHRTLTNLRQKYGPVLWLKIGAVNTMAILSAKEATIFFKN  105

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   + R + E M+    ++ SL  A YG +WR++RRL T +  V  R++    +R +C
Sbjct  106   HDHNFSDRTVIETMRAHNYDKSSLALAPYGPYWRLMRRLVTVDMLVMKRINDTASIRRRC  165

Query  723   IDHMVRYMREAGNSGTAA--IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ++ M+ ++ +      A   + V RF F MSFNL GNLM S+D+ D +SE G++FF    
Sbjct  166   VNDMLTWIAKEARELEAGRGLHVSRFVFFMSFNLFGNLMLSRDMFDMKSESGSEFFTAVM  225

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              ++E+ G  NV+D FP LRWLDPQG+RR     + KA +IA  ++KER++       DEK
Sbjct  226   GLLEWTGHANVSDLFPWLRWLDPQGLRRKMDRDMGKAIEIASTFVKERLDL--EVERDEK  283

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              +D++DVLL+++ +  +     S + +NV + EMF AG++TT+ST+EWAMTELL N   +
Sbjct  284   SRDFLDVLLEFQRNENQDAVNISDKDLNVFILEMFLAGSETTSSTIEWAMTELLCNRDCM  343

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              K++ EL SV+G   K +EE  I+KLPYL+ V+KETLRLHPP+P LVP  A+     +GY
Sbjct  344   LKLKTELSSVIG--TKDVEESDIDKLPYLQGVVKETLRLHPPIPLLVPRKAVQDTEFMGY  401

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLE-PNMADFKGHHFEFIPFGSGRRMCP  1613
             ++PK+TQ+ VN WAIGRDP  W +PL FKPERF +  N +D++G H+EFIPFG+GRRMC 
Sbjct  402   FVPKDTQVFVNTWAIGRDPDVWDEPLVFKPERFCDINNKSDYRGQHYEFIPFGAGRRMCA  461

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              +PLA R+L L LGS+LH FDW L   + P  MDMK+R+GIT+RK  PL A+P
Sbjct  462   GIPLAHRILHLVLGSLLHRFDWELDCNITPLTMDMKDRLGITMRKFQPLLAVP  514



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   468 bits (1205),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 307/474 (65%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WPV+GNIF LG  PH +  +L  K+GP++ L LGS +T+VI S  AA E+FKNH
Sbjct  34    PPGPPGWPVIGNIFDLGTMPHQTLYKLRFKYGPVLWLRLGSKNTMVIQSAAAAEELFKNH  93

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D     R   + +      +GSL   +YG  WR+LRR+CT E     R++    +R KCI
Sbjct  94    DSSFCDRSSLDVLTSHNYCKGSLAIGRYGPFWRVLRRICTMELMTNKRVNETAPLRRKCI  153

Query  726   DHMVRYMREAGNSGTA-----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M++Y+ E   + +A      +D+    FL +FN++GNL  S+DLLDP  + G  F+  
Sbjct  154   DQMIKYIEENVAAASAREEATEVDLVHLLFLTAFNVVGNLTLSRDLLDPHCKEGHDFYKA  213

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K M + G+PN+ADF P  +W+DPQG++R     + +A  I   ++KER+E  N  G +
Sbjct  214   MDKFMVWVGRPNIADFLPFFKWIDPQGLKRNMNRDLGQAIRIISGFVKERIEE-NKLGKE  272

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
              K KD++DVLL ++GD  E P +     + +I+ EMF AG++TT++T+EWAM ELL +P 
Sbjct  273   RKTKDFLDVLLDFKGDGKEAPQKIPYDKVIIIVLEMFFAGSETTSTTMEWAMAELLRSPD  332

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
              ++K++ EL  VVG    K+EE  I+KLPYL+AV+KETLRLHP +P L+P  AM   N +
Sbjct  333   KMKKLKEELDEVVG-ENNKVEESDIDKLPYLQAVVKETLRLHPAIPLLLPRNAMQDTNFM  391

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+IPK TQ+ VN WAIGRDP +WKDPL FKPERFL  N+ D+KG  F+ IPFGSGRR+C
Sbjct  392   GYHIPKNTQVFVNAWAIGRDPDSWKDPLTFKPERFLGSNI-DYKGQDFQLIPFGSGRRIC  450

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               + L  R++ L L S++H FDW +G       +DM ER GIT+RK  PLK +P
Sbjct  451   VGMLLGQRVIHLGLASLIHYFDWEMGSNSNSETIDMNERTGITVRKLDPLKLVP  504



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   468 bits (1204),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/470 (49%), Positives = 322/470 (69%), Gaps = 4/470 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR WPV G++ +LG  PH +  +L  K+GP++ L LGS++T+VI S +AA E F+N
Sbjct  35    LPPGPRGWPVFGSMLELGNEPHKTLMDLKQKYGPVVWLKLGSINTMVILSAKAAGEFFRN  94

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  A R + E MK    ++GSL  A YG +WR+++R+ T +  V  R+     VR KC
Sbjct  95    HDMAFAERSVTEVMKSHGYDKGSLALAPYGTYWRIMKRIMTVQMLVNKRITETVEVRRKC  154

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             ID ++ ++     S +  I V +F FL SFN++G L+ S++L+DP+SE+G +FF     +
Sbjct  155   IDDLIEWIENREFSSSEGIHVAKFVFLASFNMLGKLVLSRELVDPKSEKGTEFFAAMVGL  214

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME +G  N+ D FP LRWLDPQG+RR     + K  +I   +LKER E     G  EKKK
Sbjct  215   MECSGHQNIVDVFPWLRWLDPQGLRRKMDRGLGKTIEIVSGFLKERFEERERTG--EKKK  272

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D+++VLL+Y G   + P + S + + +I+ E+F AG++TT+S++EWAMTELL NP ++ K
Sbjct  273   DFLEVLLEYEGKGKDEPEKISDQELILIILEIFLAGSETTSSSIEWAMTELLCNPEAMDK  332

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ EL  V+G T KK EE  I+   YL+AV+KETLRLHPP+PFLVP  A+     +GY+I
Sbjct  333   VKTELSEVLGDT-KKFEENDIDNHKYLQAVVKETLRLHPPIPFLVPRKAIQDTEFVGYHI  391

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK TQ+ VN WAIGRDP+ WKDPL FKPERFL+ N+ +++G +FEFIPFG+GRR+C  +P
Sbjct  392   PKGTQVFVNTWAIGRDPECWKDPLDFKPERFLDLNI-EYRGQNFEFIPFGAGRRICAGIP  450

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA RML L LG++L  FDW +   +    +D ++RMG+T+RK  PLKAIP
Sbjct  451   LAHRMLHLVLGALLSEFDWEIDVSVLDEALDTRDRMGVTVRKLKPLKAIP  500



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   468 bits (1204),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 316/469 (67%), Gaps = 8/469 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             + GN+F LG  P+ + +    K+GPI+   +GS+ T+ I S + A + FKNHD   A RK
Sbjct  42    IFGNMFDLGTLPYQTIASFKHKYGPIVWFNIGSVKTMSILSAKTAADFFKNHDFAFAERK  101

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
             I + M     N+GSL  A YG +WR+LRR+CT E FV  R++    +R KC+  M++++ 
Sbjct  102   IIDTMLVHDYNKGSLALAPYGTYWRVLRRICTVEMFVNKRINETVDIRRKCVHDMLQWIE  161

Query  750   EAGNS---GTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
             +  N      + I+V RF FL +FN++GNLMFS+DL+ P S++ ++FF    ++ME++G 
Sbjct  162   DEANVVEIKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIMEWSGN  221

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
             PNV+D FP LR  D QG+ +  Q  +  A +IA  ++KERM+    GG   +KKD++DVL
Sbjct  222   PNVSDIFPCLRRFDLQGLNKKMQRDMGNALEIASTFVKERMKEREDGG---EKKDFLDVL  278

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L + G   + PA+ +   IN+ + EMF AG++TT+S++EW +TE+L +P ++ KV+AE+ 
Sbjct  279   LDFEGSGKDEPAKLTEHQINIFILEMFLAGSETTSSSIEWTLTEILRHPEAMAKVKAEIS  338

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              VVG   KKLEE  I+ LPY++AVIKE LRLHPPLPFLVP  A+     +GY IP++TQ+
Sbjct  339   EVVGKN-KKLEESDIDNLPYMQAVIKEALRLHPPLPFLVPRRAIHDTKFMGYDIPEDTQV  397

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
              VNVW+IGRD + W DPL FKPERFL   + DFKG  FEF+PFG+GRRMC  LPL +RML
Sbjct  398   FVNVWSIGRDSEYWDDPLNFKPERFLNSKI-DFKGQCFEFLPFGAGRRMCVGLPLGNRML  456

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
              + LGS+LH FDW L   + P  MDMKERMG+T+RK  PLKA+P    G
Sbjct  457   HVVLGSLLHEFDWELPENVTPKSMDMKERMGMTVRKFQPLKAVPRKTSG  505



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   467 bits (1202),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 227/486 (47%), Positives = 326/486 (67%), Gaps = 10/486 (2%)
 Frame = +3

Query  336   HRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSD  515
              +R+     LPPGPR  P++GN+F LG  PH + ++L +KHGP++ L LGS   +VI + 
Sbjct  24    QQRIRTTRRLPPGPRGLPIIGNMFDLGTMPHRALAKLGTKHGPVIWLRLGSQRIMVILTA  83

Query  516   EAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLD  695
             E A E FK+HD+    R I E M+    ++GSLI A YG HWR++++LC  E   + R+ 
Sbjct  84    EIAAEFFKHHDLSFVDRNINETMRVLDYHKGSLILAPYGPHWRVMKKLCVIEMLTSKRIR  143

Query  696   ALRGVRTKCIDHMVRYMREAG----NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
                 VR KC+  +++++ +A     +    AI+V  F FL  FNL+GNL+ SK+LLDP S
Sbjct  144   ESASVREKCVADLIKWIEDAARVDDDGEIQAIEVAHFVFLAEFNLLGNLLLSKNLLDPSS  203

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
              RG++F+     + ++ G PNVADFFP L+WLD QG+++ T+  + K FDI    +KER+
Sbjct  204   MRGSEFYAAMNGLTQWTGLPNVADFFPWLKWLDLQGLQQKTKRDMRKLFDILTQLMKERI  263

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE--  1217
             +       +  KKD +D+LL++ GD  E P + S   I++ + E F AGT++TTST+E  
Sbjct  264   QEKEM-RTENGKKDILDLLLEFEGDGKEEPQKLSDYHISIFMLEFFMAGTESTTSTIESK  322

Query  1218  -WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFL  1394
              WA+TELL N  S+ KV+ EL  +V G +++ +E +I++LPYL+AVIKETLRLHPP+PFL
Sbjct  323   QWALTELLANVDSMSKVKYELDQIV-GQQREFQEANIDELPYLQAVIKETLRLHPPVPFL  381

Query  1395  VPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHF  1574
             VP  A++  N +GY IP  TQ+ VNVWAIGRDP++W DPL+F PERFL     D+KG H+
Sbjct  382   VPRKAVEDVNFMGYDIPCGTQVFVNVWAIGRDPESWDDPLRFMPERFLGSE-TDYKGQHY  440

Query  1575  EFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKAT  1754
             E IPFG+GRRMC  +PL+ +ML L LG++LH+FDW L   + P  +D ++R+G+T +K T
Sbjct  441   ELIPFGAGRRMCAGVPLSHKMLNLILGALLHNFDWELESHITPETIDWEDRIGLTAKKLT  500

Query  1755  PLKAIP  1772
             PLK IP
Sbjct  501   PLKVIP  506



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score =   467 bits (1201),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 322/469 (69%), Gaps = 3/469 (1%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WPV GN+F+LG  PH +  +L SK+GP++ L LGS+ T+V+ S  AA E+FK H
Sbjct  38    PPGPTGWPVFGNMFELGDLPHQTMYKLRSKYGPLVWLRLGSIHTLVVQSPAAAAELFKKH  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             DV  + RK+ +A+     N GSL    YG HWR+LRRLC+ EF V  R++    +R + +
Sbjct  98    DVAFSDRKVPDALTAFNFNAGSLGMNAYGGHWRVLRRLCSMEFLVNKRMNDTTALRRRIM  157

Query  726   DHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVM  905
             D+MV ++ E    GT  + + RF FLM+FNL+GNLM S+DLL+     G +FF    KV+
Sbjct  158   DNMVHWIEEESQGGTREVQLSRFLFLMAFNLVGNLMLSRDLLNAGDPEGREFFDSMNKVL  217

Query  906   EFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKD  1085
             E AG PN+ADF P L+WLDP GI++     + K   I+  +++ER++   +G  ++  KD
Sbjct  218   ELAGTPNIADFLPFLKWLDPLGIKKRMVEDMGKTMKISSRFVQERLQERKSGKVND-TKD  276

Query  1086  YMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKV  1265
             ++D LL+Y+GD  +GP   + + +N+++ EMF AG++TT+ ++EW   ELL NP++L+ V
Sbjct  277   FLDTLLEYKGDGKDGPDEITEKNVNIVILEMFFAGSETTSISIEWGFAELLRNPAALKNV  336

Query  1266  QAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIP  1445
             + E+  VV G E+K+EE  ++ LPYL+AV+KETLRLHP LP L+P   M   N +GY IP
Sbjct  337   REEIDRVV-GRERKVEESDMDNLPYLQAVVKETLRLHPALPLLLPRNTMQETNYMGYLIP  395

Query  1446  KETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPL  1625
             K+TQ+ VN WAIGRDP +W+DPL FKPERFL  N+ ++KG HFEFIPFGSGRR+C   PL
Sbjct  396   KDTQVFVNAWAIGRDPDSWEDPLTFKPERFLTSNI-EYKGQHFEFIPFGSGRRICIGFPL  454

Query  1626  ASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             A R++ LAL +++ SFDW    G  P  +DM ER+G+TLRK  P+KAIP
Sbjct  455   AHRVVHLALATLVQSFDWEFPAGEGPKTLDMDERLGLTLRKKNPVKAIP  503



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   464 bits (1195),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 310/466 (67%), Gaps = 7/466 (2%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+F LG  P+ + +E   K+GP++   +GS+ T+ I S   A E FKNHD   A RKI +
Sbjct  46    NMFDLGTLPYQTIAEFKQKYGPVVWFKIGSVKTMSILSANTATEFFKNHDFAFAERKIID  105

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
              M     N GSL  A+YG +WR+LRR+CT E FV  R++    +R KC+D M+ ++ +  
Sbjct  106   TMLVHDYNLGSLAIARYGTYWRVLRRICTVEMFVHKRINETVDIRRKCVDDMIHWIEKEV  165

Query  759   NS---GTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNV  929
             NS     + I+V RF FL +FN++GNLMFS+DL+ P S++ ++FF    ++M  +G PN+
Sbjct  166   NSVEVKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIMILSGTPNI  225

Query  930   ADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQY  1109
             +D FP LR  D QG+++     +  A  IA  ++KERM+    G  +EKK D++DVLL++
Sbjct  226   SDIFPRLRRFDLQGLKKKMHREMGIALGIASTFVKERMKEREDG--EEKKNDFLDVLLEF  283

Query  1110  RGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVV  1289
              G   + PA+ S   I + + EMF AG++TT+S++EW +TELL +P ++ +V+AE+  +V
Sbjct  284   EGSGKDEPAKLSEHQITIFILEMFLAGSETTSSSVEWTLTELLRHPEAMARVKAEIFQIV  343

Query  1290  GGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVN  1469
             G   KK EE  I+ LPY++AV+KE LRLHPPLPFLVP  AM   N +GY IP++TQ+ VN
Sbjct  344   G-QNKKFEESDIDNLPYMQAVVKEVLRLHPPLPFLVPRRAMHDTNFMGYDIPEDTQVFVN  402

Query  1470  VWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLA  1649
             VWAIGRDP+ W DPL FKPERFL     DFKG  +EF+PFG+GRRMC  LPL +RML   
Sbjct  403   VWAIGRDPEYWDDPLDFKPERFLNSK-TDFKGQCYEFLPFGAGRRMCVGLPLGNRMLHFV  461

Query  1650  LGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             LGS+LH FDW L   + P  MDMKERMG+T+RK  PL A+P    G
Sbjct  462   LGSLLHEFDWELPSNVTPKSMDMKERMGMTVRKFNPLTAVPTKTSG  507



>ref|XP_008392600.1| PREDICTED: cytochrome P450 76A2-like [Malus domestica]
Length=513

 Score =   464 bits (1194),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/474 (48%), Positives = 324/474 (68%), Gaps = 7/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+ WPV+GN+F LG  PH + ++L  K GP++ L LG  +T+ + S +AA E FKN
Sbjct  40    LPPGPKGWPVIGNMFDLGTMPHRTLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKN  99

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+    R + E  +    ++GSL  A YG HWR++RRL T E  V  R++    +R KC
Sbjct  100   HDLSFVERTVNENARVHDYHKGSLAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKC  159

Query  723   IDHMVRYMREAGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ID+M  ++ E  +       + V RF FLM+FNL+GNLM S+DL+DP SE G +FF    
Sbjct  160   IDNMQLWIEEEASKVKEGRGVHVARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMN  219

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME+ G  NV DFFP LRWLDPQG++R  +  + KA  IA  ++K R++    GG  EK
Sbjct  220   GLMEWNGSGNVVDFFPWLRWLDPQGLKRKMKRDLGKAIQIASKFVKXRIQEREVGG--EK  277

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              KD++DVLL++ G+ ++ PA+ S   +N+ + E+F AG++TT+ST EWA+TELL NP++L
Sbjct  278   TKDFLDVLLEFEGNGIDEPAKISDHDLNIFILEIFMAGSETTSSTTEWALTELLCNPATL  337

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              + +AEL  V+G + +K+EE  I+ LPYL+ +IKETLRLHPP+PFLVP  AM   + +GY
Sbjct  338   VEAKAELNRVIGPS-RKIEESDIDNLPYLQGIIKETLRLHPPIPFLVPRKAMHDTSFMGY  396

Query  1437  YIPKETQILVNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             ++PK+TQ+ VN +AIGRDP  W+D P  FKPERF+  +  D++G ++E +PFG+GRRMC 
Sbjct  397   FVPKDTQVFVNAYAIGRDPDAWRDEPTLFKPERFIG-SKTDYRGQNYELVPFGAGRRMCA  455

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
              +PLA RML L LG++LH FDW L   +    MD K+++GIT+RK+ PL A+P 
Sbjct  456   GVPLAHRMLHLTLGTLLHQFDWSLDANVTRETMDWKDKLGITMRKSEPLLAVPT  509



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score =   466 bits (1198),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 226/472 (48%), Positives = 325/472 (69%), Gaps = 10/472 (2%)
 Frame = +3

Query  384   WPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAG  563
             WP++GN+F LG  PH + + L  K+GP++ L LG+++T+V+ S +AA E+FKNHD+  A 
Sbjct  129   WPIIGNMFDLGTMPHRTLTCLRDKYGPVIWLRLGTVNTMVLLSTKAATELFKNHDLSFAE  188

Query  564   RKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRY  743
             R I E M+    ++ SL  A YG +WR+LRRL T +  V  R++    +R KC+D M+ +
Sbjct  189   RNITEIMRAHDYHKSSLALAPYGSYWRVLRRLVTVDMLVNKRINETTCIRRKCVDDMLLW  248

Query  744   M-----REAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVME  908
             +     ++ G+S    I V RF FL++FNL+GNLM S+DL DP S+ G++ F    ++ME
Sbjct  249   IEDEARKKQGDSHRDGIHVARFVFLLTFNLLGNLMLSRDLFDPDSKEGSELFMVMLRLME  308

Query  909   FAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDY  1088
             ++G+ N+ADFFP LRWLDPQG++R  +  + KA +IA  ++KE+++    G   E K+D+
Sbjct  309   WSGQGNIADFFPWLRWLDPQGLKRKMEKDLGKAIEIASKFVKEKLQQKKVG---EDKRDF  365

Query  1089  MDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQ  1268
             +D+L+++ G+  + PA+ S   +N+ + E+F AG++TT+ST+EWA  ELL NP ++ K +
Sbjct  366   LDLLIEFEGNGKDEPAKLSDHELNIFILEIFLAGSETTSSTIEWAFAELLCNPDAMIKAK  425

Query  1269  AELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPK  1448
             AEL  VV G  KK+EE  IE L YL AV+KET RLHPPLPFL+P  AM   N +GY+IPK
Sbjct  426   AELTRVV-GPNKKVEERDIENLHYLHAVVKETFRLHPPLPFLIPRKAMQDTNFMGYHIPK  484

Query  1449  ETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLA  1628
              TQ+ VN WAIGRDP+ W DPL FKPERF+   + ++KGHH+E IPFG+GRRMC  + LA
Sbjct  485   NTQVFVNAWAIGRDPEVWDDPLLFKPERFIGSKI-EYKGHHYELIPFGAGRRMCAGVALA  543

Query  1629  SRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
              R+L L LGS+LH FDW LG  +    +DMK+ +G+T+RK  PL A+P   K
Sbjct  544   DRVLRLVLGSLLHHFDWELGGNVTKETIDMKDNLGVTMRKLEPLLAVPKKCK  595


 Score =   127 bits (319),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +3

Query  1176  MFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVI  1355
             MFTAGTDTT+ TLEWAM ELLHNP +L+KVQAELRS+     KK+EE  IE LPYL+AVI
Sbjct  1     MFTAGTDTTSGTLEWAMAELLHNPRTLEKVQAELRSI--NPSKKIEENDIENLPYLQAVI  58

Query  1356  KETLRLHPPLPFLVPHMAMDSCNML  1430
             K TLRLHPPLPFLVPH A +SC ML
Sbjct  59    KGTLRLHPPLPFLVPHNAKNSCKML  83



>gb|AHX24370.1| CYP76A26 [Catharanthus roseus]
Length=515

 Score =   462 bits (1190),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 328/474 (69%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN+F LG  PH +  +L SK+GPI+ L LGS++T+V+ +  +A E+FK H
Sbjct  39    PPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVWLQLGSINTMVVQNAVSAAELFKKH  98

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             DV    RK+ + +     N+GSL    YG HWR+LRRLC+ EF V  R++    +R +  
Sbjct  99    DVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIE  158

Query  726   DHMVRYMRE-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D+MVR++ E         GT A+ + RF FLM+FNL+GNLM S+DL+D +   G +FF  
Sbjct  159   DNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLMDNKDPEGREFFDC  218

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               +++E AG PN+ADF PLL+ LDP G+++    ++++   I+  +++ER+++  AG  +
Sbjct  219   MNEILELAGTPNIADFLPLLKKLDPLGMKKRMVDNMSRTMKISSKFVQERLDNRKAGKIN  278

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++DV+L+Y+GD  +GP +F+ + +N+++ EMF AG++TT+ ++EW  TELL NP 
Sbjct  279   E-KKDFLDVMLEYQGDGKDGPDKFTEQHVNIVIMEMFFAGSETTSISIEWGFTELLRNPH  337

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             + +KV+ E+  VV G  + +EE  +E LPYL+AV+KETLRLHP LP L+P   M+    +
Sbjct  338   AFKKVREEIDRVV-GVNRMVEESDMENLPYLQAVVKETLRLHPALPMLLPRNTMEDTEYM  396

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK TQ+ VN WAIGRDP+ W+DPL FKPERF+  ++ ++KG HFE IPFGSGRR+C
Sbjct  397   GYLIPKGTQVFVNAWAIGRDPEYWQDPLSFKPERFINSSV-EYKGQHFELIPFGSGRRIC  455

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                PLA R++ L L +++ +FDW LG G++P  +D++ER+G+TLRK  PL  IP
Sbjct  456   VGFPLAHRVVHLTLATLVQAFDWDLGAGVKPQDIDLEERLGLTLRKKNPLNVIP  509



>gb|AHK60833.1| iridoid oxidase [Catharanthus roseus]
Length=515

 Score =   462 bits (1190),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 328/474 (69%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN+F LG  PH +  +L SK+GPI+ L LGS++T+V+ +  +A E+FK H
Sbjct  39    PPGPPGWPIFGNMFDLGDLPHQTLYKLKSKYGPIVWLQLGSINTMVVQNAVSAAELFKKH  98

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             DV    RK+ + +     N+GSL    YG HWR+LRRLC+ EF V  R++    +R +  
Sbjct  99    DVPFCDRKVPDTLTAFNFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIE  158

Query  726   DHMVRYMRE-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D+MVR++ E         GT A+ + RF FLM+FNL+GNLM S+DL+D +   G +FF  
Sbjct  159   DNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLMDNKDPEGREFFDC  218

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               +++E AG PN+ADF PLL+ LDP G+++    ++++   I+  +++ER+++  AG  +
Sbjct  219   MNEILELAGTPNIADFLPLLKKLDPLGMKKRMVDNMSRTMKISSKFVQERLDNRKAGKIN  278

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++DV+L+Y+GD  +GP +F+ + +N+++ EMF AG++TT+ ++EW  TELL NP 
Sbjct  279   E-KKDFLDVMLEYQGDGKDGPDKFTEQHVNIVIMEMFFAGSETTSISIEWGFTELLRNPH  337

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             + +KV+ E+  VV G  + +EE  +E LPYL+AV+KETLRLHP LP L+P   M+    +
Sbjct  338   AFKKVREEIDRVV-GVNRMVEETDMENLPYLQAVVKETLRLHPALPMLLPRNTMEDTEYM  396

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK TQ+ VN WAIGRDP+ W+DPL FKPERF+  ++ ++KG HFE IPFGSGRR+C
Sbjct  397   GYLIPKGTQVFVNAWAIGRDPEYWQDPLSFKPERFINSSV-EYKGQHFELIPFGSGRRIC  455

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                PLA R++ L L +++ +FDW LG G++P  +D++ER+G+TLRK  PL  IP
Sbjct  456   VGFPLAHRVVHLTLATLVQAFDWDLGAGVKPQDIDLEERLGLTLRKKNPLNVIP  509



>ref|XP_009350795.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009350796.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   462 bits (1189),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 322/474 (68%), Gaps = 7/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+ WPV+GN+F LG  PH + ++L  K GP++ L LG  +T+ + S +AA E FKN
Sbjct  40    LPPGPKGWPVIGNMFDLGTMPHRTLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKN  99

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+    R + E  +    ++GSL  A YG HWR++RRL T E  V  R++    +R KC
Sbjct  100   HDLSFVERTVNENARVHDYHKGSLAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKC  159

Query  723   IDHMVRYMREAGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ID+M  ++ E  +       + V RF FLM+FNL+GNLM S+DL+DP SE G +FF    
Sbjct  160   IDNMQLWIEEEASKVKEGRGVHVARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMN  219

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +M++ G  NV DFFP LRWLDPQG++R  +  + KA  IA  ++KER +    GG  EK
Sbjct  220   GLMKWNGSGNVVDFFPWLRWLDPQGLKRKMKRDLGKAIQIASKFVKERFQERELGG--EK  277

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              KD++DVLL++ G+ ++ PA+ S   +N+ + E+F AG++TT+ST EWA+TELL NP++L
Sbjct  278   TKDFLDVLLEFEGNGIDEPAKISDHDLNIFILEIFLAGSETTSSTTEWALTELLCNPATL  337

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              + +AEL  V+G + +K+EE  I+ LPYL+ +IKETLRLHPP+PFLVP  AM   + +GY
Sbjct  338   VEAKAELNRVIGPS-RKIEESDIDNLPYLQGIIKETLRLHPPIPFLVPRKAMHDTSFMGY  396

Query  1437  YIPKETQILVNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             ++PK+TQ+ VN +AIGRDP  W D P  FKPERF+  +  D+KG ++E IPFG+GRRMC 
Sbjct  397   FVPKDTQVFVNAYAIGRDPDVWCDEPTLFKPERFIG-SKTDYKGQNYELIPFGAGRRMCA  455

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
              +PLA RML L LG++LH FDW L   +    MD K+ +GIT+RK+ PL A+P 
Sbjct  456   GVPLAHRMLHLTLGTLLHQFDWSLDANVTRETMDWKDNLGITMRKSEPLLAVPT  509



>ref|XP_009334561.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009342774.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   462 bits (1189),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 322/474 (68%), Gaps = 7/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+ WPV+GN+F LG  PH + ++L  K GP++ L LG  +T+ + S +AA E FKN
Sbjct  40    LPPGPKGWPVIGNMFDLGTMPHRTLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKN  99

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+    R + E  +    ++GSL  A YG HWR++RRL T E  V  R++    +R KC
Sbjct  100   HDLSFVERTVNENARVHDYHKGSLAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKC  159

Query  723   IDHMVRYMREAGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             ID+M  ++ E  +       + V RF FLM+FNL+GNLM S+DL+DP SE G +FF    
Sbjct  160   IDNMQLWIEEEASKVKEGRGVHVARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMN  219

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +M++ G  NV DFFP LRWLDPQG++R  +  + KA  IA  ++KER +    GG  EK
Sbjct  220   GLMKWNGSGNVVDFFPWLRWLDPQGLKRKMKRDLGKAIQIASKFVKERFQERELGG--EK  277

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              KD++DVLL++ G+ ++ PA+ S   +N+ + E+F AG++TT+ST EWA+TELL NP++L
Sbjct  278   TKDFLDVLLEFEGNGIDEPAKISDHDLNIFILEIFMAGSETTSSTTEWALTELLCNPATL  337

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              + +AEL  V+G + +K+EE  I+ LPYL+ +IKETLRLHPP+PFLVP  AM   + +GY
Sbjct  338   VEAKAELNRVIGPS-RKIEESDIDNLPYLQGIIKETLRLHPPIPFLVPRKAMHDTSFMGY  396

Query  1437  YIPKETQILVNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             ++PK+TQ+ VN +AIGRDP  W D P  FKPERF+  +  D+KG ++E IPFG+GRRMC 
Sbjct  397   FVPKDTQVFVNAYAIGRDPDVWCDEPTLFKPERFIG-SKTDYKGQNYELIPFGAGRRMCA  455

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
              +PLA RML L LG++LH FDW L   +    MD K+ +GIT+RK+ PL A+P 
Sbjct  456   GVPLAHRMLHLTLGTLLHQFDWSLDANVTRETMDWKDNLGITMRKSEPLLAVPT  509



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   461 bits (1187),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 221/479 (46%), Positives = 312/479 (65%), Gaps = 10/479 (2%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             A PPGP  WP++GN+  LG  PH + +EL  + G ++ L LG  +T+VI S +AA E FK
Sbjct  33    AFPPGPPGWPILGNMLDLGAMPHKTLTELRHRFGSVLWLRLGVRNTMVIQSAKAATEFFK  92

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             NHD+    R I    +    ++GSL  A YG  WR+LRRL T +     R++    +R K
Sbjct  93    NHDLTFVERNINIGARVHDYHKGSLALAPYGTQWRVLRRLVTVDMLTNKRINETASIRRK  152

Query  720   CIDHMVRYMREAGN------SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             C+++M +++ E         S +  + V RF FLM+FNL+GNLM S+DL+DP S+ G +F
Sbjct  153   CVENMQKWIEEEATKLEENGSSSEGVHVARFVFLMTFNLLGNLMLSRDLVDPNSKEGLEF  212

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
             F     +ME  G  N+AD+FP LRWLDPQG++R  + HV KA +IA  ++K RM+     
Sbjct  213   FDAMRGLMETNGHGNIADYFPWLRWLDPQGVKRRMKKHVGKALEIASCFVKARMKERKLV  272

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
             G  EK KD++DVLL +  +  +  A+ S   +N+ + E+F AG++TT+ST EWA+TELL 
Sbjct  273   GG-EKTKDFLDVLLDFEDNENDESAKISDHHLNIFILEIFMAGSETTSSTTEWALTELLC  331

Query  1242  NPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSC  1421
             NP +L K ++EL  V+ G  +K+EE  ++ LPYL+ +IKET RLHPP+PFLVP  A+   
Sbjct  332   NPETLNKAKSELNRVI-GPNRKIEESDVDNLPYLQCIIKETFRLHPPIPFLVPRKAVQDT  390

Query  1422  NMLGYYIPKETQILVNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               +GY++PK+TQ+ VN +AIGRDP+ W D P  FKPERF+   + D+KG H+E IPFG+G
Sbjct  391   KFMGYFVPKDTQVFVNAYAIGRDPEVWTDEPESFKPERFIGSKI-DYKGQHYELIPFGAG  449

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RRMC  +PL  RML L LGS+LH FDW LG  +    M+  + +GIT+RK+ PL A+P 
Sbjct  450   RRMCAGVPLGHRMLHLTLGSLLHQFDWALGRNVSKESMNWNDNLGITMRKSEPLLAVPT  508



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 307/454 (68%), Gaps = 6/454 (1%)
 Frame = +3

Query  423   PHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGN  602
             PH + + L  K+GP + L LGS+ T+VI S   A E FKN D+  A R + + ++    +
Sbjct  2     PHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDYH  61

Query  603   EGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTA---  773
             EGS+  A YG +WR++RRL TT+  V  RL+    VR KC+++M+ ++ EA +S  A   
Sbjct  62    EGSVAVAPYGTYWRVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAASSDKAQVG  121

Query  774   -AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLL  950
               I + RF FLM+FNL+ NLM S+DL DP S+ G++FF     +ME +G+PNV D FP L
Sbjct  122   EGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFTAMNGLMELSGQPNVVDLFPWL  181

Query  951   RWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEG  1130
             R LDPQG+RR     + KA  IA + ++ER+E     G D+ ++D++DVLL++ G+  + 
Sbjct  182   RRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGGDDDRRDFLDVLLEFEGNGKDE  241

Query  1131  PARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKL  1310
             PA+ S + IN  + E+F AGT+TT+ST+EWA+TELL NP S  KV+AEL  VVG   K L
Sbjct  242   PAKLSEKQINTFILEIFMAGTETTSSTIEWALTELLLNPDSKVKVEAELSRVVGSNRKVL  301

Query  1311  EEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRD  1490
             E   I++LPYL+AV+KET+RLHPP+PFL+P  A+     +GY IP+ TQ+ VN WAIGRD
Sbjct  302   ET-DIDQLPYLQAVVKETMRLHPPVPFLLPRRAIRDTIFMGYNIPENTQVFVNAWAIGRD  360

Query  1491  PKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHS  1670
             P  W+DP+ FKPERF+   + D+KG H+EFIPFG+GRRMC  L LA R+L LALGS+LH 
Sbjct  361   PDVWEDPMAFKPERFIGSKL-DYKGQHYEFIPFGAGRRMCAGLSLAHRVLHLALGSLLHE  419

Query  1671  FDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             FDW     ++P  +DM++R+G+  RK  PL  +P
Sbjct  420   FDWEFDGRIDPKTIDMRDRVGLATRKYVPLLVVP  453



>gb|KDP26153.1| hypothetical protein JCGZ_22834 [Jatropha curcas]
Length=510

 Score =   460 bits (1183),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 310/470 (66%), Gaps = 12/470 (3%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP RWP+VGNIF LG   H    EL  K+GP++ L +GS+ TVVI S +AA E+FKNH
Sbjct  36    PPGPPRWPLVGNIFDLGTLAHRILYELKFKYGPVLRLRIGSVDTVVIQSAKAAMELFKNH  95

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D     R +          EGSL   ++G +WR LRR+C  E     R++    +R KCI
Sbjct  96    DASFCARTVPCVFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCI  155

Query  726   DHMVRYMREAGNSGTAAIDVGR-----FFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M+R + +   +G A+ + G+     + FLMSFNLIGNLM SKDL D + + G +FF  
Sbjct  156   DVMIRSIEDDMAAGKASGESGKVHIPHYLFLMSFNLIGNLMLSKDLFDSKCKEGYEFFEA  215

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               KVM +AG PN+ADF P L+WLDPQG++R     + +A DI   ++KER+E     G  
Sbjct  216   MDKVMVWAGTPNLADFLPFLQWLDPQGLKRNMSRDMGRAKDIVAGFVKERIEDYKM-GKK  274

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             +  KD++DVLL++ GD  E   +     + +I+ EMF AG++TT+ST+EW M EL  NP 
Sbjct  275   KANKDFLDVLLEFEGDGKEWEGKIPYDKMIIIILEMFFAGSETTSSTMEWVMAELFSNPE  334

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L+KV+ EL +VV G  +K+EE  I+KLPYL+AVIKET+RLHP +P L+P   ++  N +
Sbjct  335   ALRKVKDELDAVV-GENRKVEESDIDKLPYLQAVIKETVRLHPVIPLLIPRNTIEDTNFM  393

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+I + TQ+LVN WAIGRDP++W+DP+ FKPERFL  N+ D+KG +FE IPFGSGRR+C
Sbjct  394   GYHISEGTQVLVNAWAIGRDPESWEDPMNFKPERFLGSNI-DYKGQNFELIPFGSGRRIC  452

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
               + LA R++PL + S+LH+F+W L        +DM ERM IT+RK  PL
Sbjct  453   VGMGLAQRVVPLGVASLLHNFEWDL----HSQTLDMSERMAITVRKLIPL  498



>ref|XP_007203742.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
 gb|EMJ04941.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
Length=509

 Score =   460 bits (1183),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 231/464 (50%), Positives = 319/464 (69%), Gaps = 7/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             V GN+F LG  PH + ++L  K GP++ L LG+ +T+VI S +AA ++FK+HD+  AGR 
Sbjct  45    VFGNMFDLGTMPHKTLTDLTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRT  104

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
               EA +    ++GSL  A YG HWRMLRRL T E  V  R++    +R KC+D++  ++ 
Sbjct  105   TTEASRVLDYHKGSLALAPYGAHWRMLRRLMTVEMLVNKRINETTFIRRKCLDNLQLWIE  164

Query  750   EAGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKP  923
             E  +       + V RF FLMSFNL+GNLM S+DL+DP S  G +FF     +ME+ G  
Sbjct  165   EEASKLEEGHGVHVARFVFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLMEWNGHA  224

Query  924   NVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLL  1103
             N+ADFFP LRWLDPQG++R  +  + KA +IA  +++ERME    GG   + +D++DVLL
Sbjct  225   NMADFFPWLRWLDPQGLKRKMKRDLGKALEIASKFVEERMEEKQVGG--VRARDFLDVLL  282

Query  1104  QYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRS  1283
             ++ G+ ++ PA+ S R +N+ + E+F AG++TT+ST+EWA+TELL NP +L K +AEL  
Sbjct  283   EFEGNGIDEPAKISHRDVNIFILEIFLAGSETTSSTIEWALTELLCNPETLTKAKAELTQ  342

Query  1284  VVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQIL  1463
             V+ G  +K+EE  IEKLPYL+ +IKETLRLHPP+PFL+P  AM+    +GY+IPK TQ+ 
Sbjct  343   VI-GPNRKVEETDIEKLPYLQGIIKETLRLHPPIPFLIPRKAMEYTKFMGYFIPKNTQVF  401

Query  1464  VNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             VN +AIGRDP  W D P  FKPERF+  +  D+KG H+EFIPFG+GRR+C  LPLA RML
Sbjct  402   VNAYAIGRDPDVWVDEPNAFKPERFI-GSKTDYKGQHYEFIPFGAGRRVCAGLPLAHRML  460

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              L LG +LH FDW L   +    MD KE++GIT+RK+ PL  +P
Sbjct  461   HLTLGLLLHQFDWSLDGSVTRGTMDWKEKLGITMRKSQPLLVVP  504



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   459 bits (1182),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 222/467 (48%), Positives = 311/467 (67%), Gaps = 7/467 (1%)
 Frame = +3

Query  396   GNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIY  575
             GN+F LG  P+ + ++   K+GPI+   +GS+ T+ I S + A E FKNHD V A RKI 
Sbjct  45    GNMFDLGALPYQTIAQYKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAERKIM  104

Query  576   EAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREA  755
             + M     N GSL  A+YG +WR+LRR+CT E FV  R++    +R KC+D M+ ++   
Sbjct  105   DTMLVHDYNLGSLAIARYGTYWRVLRRICTVEMFVHKRINETMDIRRKCVDDMIHWIENE  164

Query  756   GNSGT---AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPN  926
              +S     + I+V RF FL +FN++GNLMFS+DL+ P S++ ++FF    ++M  +  PN
Sbjct  165   VSSKEVKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIMVLSSIPN  224

Query  927   VADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQ  1106
             ++D FP LR  D QG+++     +  A  IA  ++KERM+    G  + KKKD++DVLL+
Sbjct  225   ISDIFPCLRRFDLQGLKKKMHREIGIALGIASTFVKERMKEREHG--EVKKKDFLDVLLE  282

Query  1107  YRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSV  1286
             + G   + P++ S   I + + EMF AG++TT+S++EW +TELL +P ++ +V+AE+  +
Sbjct  283   FEGSGKDEPSKLSEHQITIFILEMFLAGSETTSSSVEWTLTELLRHPEAMGRVKAEISRI  342

Query  1287  VGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILV  1466
             V   +KK EE  I+ LPY++AV+KE LRLHPPLPFLVP  AM   N +GY IP++TQ+ V
Sbjct  343   VV-QKKKFEESEIDNLPYMQAVVKEVLRLHPPLPFLVPRRAMHDTNFMGYDIPEDTQVFV  401

Query  1467  NVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPL  1646
             NVWAIGRDP+ W DPL FKPERFL     DFKG  +EF+PFG+GRRMC  LPL +RML  
Sbjct  402   NVWAIGRDPEYWDDPLDFKPERFLNSK-TDFKGQCYEFLPFGAGRRMCVGLPLGNRMLHF  460

Query  1647  ALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
              LGS+LH FDW L   + P  MDMKERMG+T+RK  PL A+P    G
Sbjct  461   VLGSLLHEFDWELPSNVTPVSMDMKERMGMTVRKFNPLTAVPTKTSG  507



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   459 bits (1182),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 238/474 (50%), Positives = 318/474 (67%), Gaps = 6/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNI  LG TPH +     +KHGP+  L LGS++T+VI S +AA E FK 
Sbjct  30    LPPQPPAWPVIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAATEFFKG  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A RK   A+     ++GSL   +YG +WR+LRRLC+ EF VT R++    +R KC
Sbjct  90    HDFAFADRKCPHALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETAHLRQKC  149

Query  723   IDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D+MV Y+ E       +    ID+  F FLM+FN++GNL+ S+DLLDP+S+ G +FF  
Sbjct  150   VDNMVVYLEEEMAVKQVTTEQGIDLSHFLFLMAFNVVGNLVLSRDLLDPKSKDGPEFFDA  209

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               + ME+AGKPNVADF P L+WLDPQGI+      + +A  IA  ++KER+E     G  
Sbjct  210   MNRFMEWAGKPNVADFLPWLKWLDPQGIKASMAKDMGRAMKIAEGFVKERLEERKQRGEM  269

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D +L Y G+  EGP + SS+ I +I+ EMF AG++TT+ST+EWAM ELLH P 
Sbjct  270   RTTNDFLDAVLDYEGNGKEGPRKISSQNIIIIILEMFFAGSETTSSTIEWAMAELLHQPV  329

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  +V G  +KLEE   EK+P+L+AV+KETLRLHPPLP L+P  A+   N +
Sbjct  330   SMKKAKDEINQIV-GLNRKLEESDTEKMPFLQAVVKETLRLHPPLPLLIPRNAIKETNFM  388

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VNVW IGR P  W++PL FKPERFL   + D+KG +F+ IPFGSGRRMC
Sbjct  389   GFDIPKDTQVFVNVWGIGRYPDAWENPLTFKPERFLGSKI-DYKGQNFDLIPFGSGRRMC  447

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L  +L+ FDW L  G+ P  +DM+ER GI LRK  PLK IP
Sbjct  448   VGLSLADRVLHLGLAKLLYHFDWELSDGLTPETLDMRERAGIALRKLHPLKVIP  501



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   459 bits (1180),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 316/474 (67%), Gaps = 6/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNI  LG TPH +     +KHGP+  L LGS++T+VI S +AA E FK 
Sbjct  30    LPPQPPAWPVIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKG  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A RK   A+     ++GSL   +YG +WR+LRRLC+ EF VT R++    +R KC
Sbjct  90    HDFAFADRKCPHALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETVHLRQKC  149

Query  723   IDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D+++ Y+ E       +    ID+  F FLM+FN++GN++ S+DLLDP+S+ G +FF  
Sbjct  150   VDNVIVYLEEEMAVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDA  209

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               + ME+AGKPNVADF P L+WLDPQGI+      + +A  IA  ++KER+E     G  
Sbjct  210   MNRFMEWAGKPNVADFLPWLKWLDPQGIKASMAKDMGRAMKIAEGFVKERLEERKLRGEM  269

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D +L Y GD  EGP + SS+ + +I+ EMF AG++TT+ST+EWAM ELL  P 
Sbjct  270   RTTNDFLDAVLDYEGDGKEGPRKISSQNVIIIILEMFFAGSETTSSTIEWAMAELLRQPV  329

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  +V G  +KLEE   EK+ +L+AV+KETLRLHPPLP L+P  A+   N +
Sbjct  330   SMKKAKDEINQIV-GLNRKLEESDTEKMRFLQAVVKETLRLHPPLPLLIPRNAIKETNFM  388

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VNVW IGRDP  W+DPL FKPERFL   + D+KG +FE IPFGSGRRMC
Sbjct  389   GFDIPKDTQVFVNVWGIGRDPDAWEDPLAFKPERFLGSKI-DYKGQNFELIPFGSGRRMC  447

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L  +L+ FDW L  G+    +DM+ER+GI LRK   LK IP
Sbjct  448   VGLSLADRVLHLGLAKLLYHFDWELSDGLTSETLDMRERVGIALRKLHSLKVIP  501



>gb|AHX24366.1| CYP76A26-like protein [Amsonia hubrichtii]
Length=514

 Score =   458 bits (1178),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 222/474 (47%), Positives = 327/474 (69%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN+F LG  PH +  +  SK+GP++ L LGS++T+V+ +  +A E+FK H
Sbjct  38    PPGPPGWPIFGNMFDLGDLPHQTLYKFRSKYGPVVWLRLGSINTMVVQNAVSAAELFKKH  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             DV  + RK+ + +     N+GSL    YG HWR+LRRLC+ EF V  R++    +R +  
Sbjct  98    DVPFSDRKVPDTLTAFQFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIE  157

Query  726   DHMVRYMRE-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D+MVR++ E         GT A+ + RF FLM+FNL+GNLM S+DLLD +   G +FF  
Sbjct  158   DNMVRWIEEDSLASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPEGREFFDC  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               +++E AG PN+ADF PLL+ LDP G+++    ++++   I+  +++ER+++   G  +
Sbjct  218   MNEILELAGTPNIADFLPLLKKLDPLGMKKRMIDNMSRTMKISSKFVQERLDNRKTGKIN  277

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++DV+L+Y+GD  +GP +F+   +N+++ EMF AG++TT+ ++EW  TELL NP 
Sbjct  278   E-KKDFLDVMLEYQGDGKDGPDKFTEHHVNIVIMEMFFAGSETTSISIEWGFTELLRNPR  336

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             + +KV+ E+  VV G ++ +EE  +E LPYL+AV+KETLRLHP LP L+P   M+  + L
Sbjct  337   AFKKVREEIDRVV-GVKRMVEESDMENLPYLQAVVKETLRLHPALPMLLPRNTMEDTDYL  395

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK TQ+ VN WAIGRD   W+DPL FKPERFL  ++ ++KG HFE IPFGSGRR+C
Sbjct  396   GYLIPKGTQVFVNAWAIGRDADYWEDPLTFKPERFLNSSV-EYKGQHFELIPFGSGRRIC  454

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                PLA R++ L L +++ +FDW LG G++P  +D++ER+G+TLRK  PLK IP
Sbjct  455   VGFPLAHRVVHLTLATLVQAFDWDLGAGVKPEDIDLEERLGLTLRKKNPLKVIP  508



>gb|AHX24369.1| CYP76A26-like protein [Vinca minor]
Length=514

 Score =   457 bits (1177),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 317/466 (68%), Gaps = 8/466 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             V GN+F LG  PH +  +L SK+GPI+ L LGS++T+V+ +  AA E+FK HDV    RK
Sbjct  46    VFGNMFDLGDLPHQTLYKLRSKYGPIVWLQLGSINTMVVQNAVAAGELFKKHDVPFCDRK  105

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
             + + +     N  SL    YG HWR+LRRLC+ EF V  R++    +R +  D+MVR++ 
Sbjct  106   VPDTLTTFNFNSSSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIE  165

Query  750   E-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFA  914
             E         GT A+ + RF FLM+FNL+GNLM S+DLLD +     +FF    +++E A
Sbjct  166   EDSLASKSQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPESREFFDSMNEILELA  225

Query  915   GKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMD  1094
             G PN+ADF P L+ LDP G+++    ++ +   I+  +++ER+++  AG  +E KKD++D
Sbjct  226   GTPNIADFLPFLKKLDPLGLKKRMIDNMTRTMKISSKFVQERLDNRKAGKFNE-KKDFLD  284

Query  1095  VLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAE  1274
             V+L+YRGD  +GP +F+ + +N+++ EMF AG++TT+ ++EW  TELL NP++ +KV+ E
Sbjct  285   VMLEYRGDGKDGPDQFTEQHVNIVIMEMFFAGSETTSISIEWGFTELLRNPNAFKKVREE  344

Query  1275  LRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKET  1454
             +  VV G  + +EE  +E LPYL+AV+KETLRLHP LP L+P   M+    +GY +PK T
Sbjct  345   IDRVV-GINRMVEESDMENLPYLQAVVKETLRLHPALPMLLPRNTMEDTEYMGYLVPKGT  403

Query  1455  QILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASR  1634
             Q+ VN WAIGRD + W+DPL FKPERF + +  ++KG HFE IPFGSGRR+C   PLA R
Sbjct  404   QVFVNAWAIGRDAEYWEDPLSFKPERF-QNSSVEYKGQHFELIPFGSGRRICVGFPLAHR  462

Query  1635  MLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             ++ L L +++ +FDW LG G++P  +D++ER+G+TLRK  PLK IP
Sbjct  463   VVHLTLATLVQAFDWDLGVGVKPQDIDLEERLGLTLRKKNPLKVIP  508



>ref|XP_008241319.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   457 bits (1176),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 231/464 (50%), Positives = 316/464 (68%), Gaps = 7/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             V GN+F LG  PH + +EL  K GP++ L LG+ +T+VI S +AA ++FK+HD+  AGR 
Sbjct  45    VFGNMFDLGTMPHQTLTELTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRT  104

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
               EA +    ++GSL  A YG HWRMLRRL T E  V  R++    +R KC+D++  ++ 
Sbjct  105   TTEASRVLDYHKGSLALAPYGAHWRMLRRLVTVEMLVNKRINETAFIRKKCLDNLQLWIE  164

Query  750   EAGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKP  923
             E  +       + + RF FLMSFNL+GNLM S+DL+DP S  G +FF     +ME+ G  
Sbjct  165   EEASKLEEGHGVHMARFVFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLMEWNGHA  224

Query  924   NVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLL  1103
             N+ADFFP LRWLDPQG++R  +  + KA +IA  ++ ERME    GG   + +D++DVLL
Sbjct  225   NMADFFPWLRWLDPQGLKRKMKRDLGKALEIASKFVGERMEEKQVGG--VRARDFLDVLL  282

Query  1104  QYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRS  1283
             ++ G+ ++ PA+ S R +N+ + E+F AG++TT+ST+EWA+TELL NP +L K +AEL  
Sbjct  283   EFEGNGIDEPAKISHRDVNIFILEIFLAGSETTSSTIEWALTELLCNPETLTKAKAELTQ  342

Query  1284  VVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQIL  1463
             V+ G  +K+EE  IEKLPYL+ +IKETLRLHPP+PFL+P  AM+      Y+IPK TQ+ 
Sbjct  343   VI-GPNRKVEETDIEKLPYLQGIIKETLRLHPPIPFLIPRKAMEDTKFTNYFIPKNTQVF  401

Query  1464  VNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             VN +AIGRDP  W D P  FKPERF+  +  D+KG H+EFIPFG+GRR C  LPLA RML
Sbjct  402   VNTYAIGRDPDVWVDEPNAFKPERFI-GSKTDYKGQHYEFIPFGAGRRACAGLPLAHRML  460

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              L LG +LH FDW L   +    MD KE++GIT+RK+ PL A+P
Sbjct  461   HLTLGLLLHQFDWSLDGNVTRGTMDWKEKLGITMRKSQPLLAVP  504



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score =   455 bits (1170),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 234/472 (50%), Positives = 312/472 (66%), Gaps = 6/472 (1%)
 Frame = +3

Query  369   PGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHD  548
             P P  WPV+GNI  LG  PH +     +KHGP+  L LGS++T+VI S +AA E FK HD
Sbjct  1     PQPPAWPVIGNILDLGTMPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHD  60

Query  549   VVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCID  728
                A RK   A+     ++GSL   +YG +WR+LRRLC+ E  VT R++    +R KC+D
Sbjct  61    SAFADRKCPHALTALGYDQGSLAIGRYGSYWRVLRRLCSAELLVTKRVNETAHLRQKCVD  120

Query  729   HMVRYMRE--AGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             +M  Y+ E  A    T    ID+  F FLM+FN++GN++ S+DLLDP+S+ G +FF    
Sbjct  121   NMAMYLEEEMAAKQVTTEQGIDLSHFLFLMTFNVVGNMVLSRDLLDPKSKDGPEFFDAMN  180

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
               ME+AGKPNVADF P L+WLDPQGI+      + +A   A  ++KER+E     G    
Sbjct  181   WFMEWAGKPNVADFLPWLKWLDPQGIKASMAKDMGRAMKFAEGFVKERLEERKLRGEMRT  240

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D++D +L Y GD  EGP + SS  + +I+ EMF AG++TT+ST+EWAM ELL  P S+
Sbjct  241   TNDFLDAVLDYEGDGKEGPRKISSPNVIIIILEMFFAGSETTSSTIEWAMAELLRQPVSM  300

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
             +K + E+  +V G  +KLEE   EK+P+L+AV+KETLRLHPP+P L+P  A+   N +G+
Sbjct  301   KKAKYEINQIV-GLNRKLEESDTEKMPFLQAVVKETLRLHPPVPLLLPRNAIKETNFMGF  359

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              IPK+TQ+ VN W IGRDP  W+DP  FKPERFL   + D+KG +FE IPFGSGRRMC  
Sbjct  360   DIPKDTQVFVNAWGIGRDPDAWEDPSAFKPERFLGSKI-DYKGQNFELIPFGSGRRMCVG  418

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             L LA R+L L L  +L+ FDW LG G+ P  +DM+ER+GITLRK  PLK IP
Sbjct  419   LSLADRVLHLGLAKLLYHFDWELGDGLTPETLDMRERVGITLRKLHPLKVIP  470



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score =   452 bits (1164),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/454 (49%), Positives = 305/454 (67%), Gaps = 8/454 (2%)
 Frame = +3

Query  423   PHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGN  602
             PH + + L  K+G ++ L LG++ T V+ S +AA E+FKN D+  + R I E M+    +
Sbjct  2     PHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGYH  61

Query  603   EGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMRE----AGNSGT  770
             E SL  A YG HWR LRRL T E  VT R++   GVR KC+D M+ ++ E     G  G 
Sbjct  62    ESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEGR  121

Query  771   AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLL  950
               I V  F FL SFN++GNLM S DLL P S+ G++FF    +VME+ G PN ADFFP L
Sbjct  122   G-IQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVMEWXGHPNXADFFPWL  180

Query  951   RWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEG  1130
             RW+DPQG+R+  +  +  A  IA  +++ER++   A   ++ KKD++DVLL ++G     
Sbjct  181   RWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAA--EDHKKDFLDVLLDFQGSGKNE  238

Query  1131  PARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKL  1310
             P + S + +N+I+ E+F AG++TT+ST+EWA+TELL +P  + KV+AEL  VVG    KL
Sbjct  239   PPQISDKDLNIIILEIFMAGSETTSSTVEWALTELLRHPZCMXKVKAELGRVVGAN-GKL  297

Query  1311  EEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRD  1490
             EE HI+ L YL+AV+KET RLHPP+PFLVP  A+   N +GY+IPK TQ+ VNVWAIGR+
Sbjct  298   EERHIDDLQYLQAVVKETFRLHPPIPFLVPRKAVRDTNFMGYHIPKNTQLFVNVWAIGRE  357

Query  1491  PKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHS  1670
              + W++P  FKPERFL+ N  D+KG HFE IPFG+GRRMC  +PLA RM+ L LGS+++ 
Sbjct  358   AELWEEPSSFKPERFLDLNHIDYKGQHFELIPFGAGRRMCAGVPLAHRMVHLVLGSLVYH  417

Query  1671  FDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             FDW L   +    MDM+E + + +RK  PLKA+P
Sbjct  418   FDWQLDSSITLETMDMRENLAMVMRKLEPLKALP  451



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score =   454 bits (1169),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 230/482 (48%), Positives = 325/482 (67%), Gaps = 7/482 (1%)
 Frame = +3

Query  336   HRRLEEVGA--LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             HRR        LPPG R WPV GN+F+LG  PH +   L  K+GP++ L LGS++T+VI 
Sbjct  24    HRRRSNKNGRLLPPGSRGWPVFGNMFELGNEPHKTLMGLKQKYGPVVWLKLGSINTMVIL  83

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
             S +AA E FKNHDV  A R + E MK    ++GSL  A YG +WR+++R+ T +  +  R
Sbjct  84    SADAATEFFKNHDVAFAERSVTEVMKSHGYHKGSLALAPYGTYWRIMKRIMTVQMLINKR  143

Query  690   LDALRGVRTKCIDHMVRYMREAGN-SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSE  866
             ++    +R KCID ++ ++   G  + +  I V +F FL SFN++G L+ S++L+DP+SE
Sbjct  144   INQTVDIRRKCIDDLIEWINNEGRVNSSGGIHVAKFIFLASFNMLGKLLLSRELVDPKSE  203

Query  867   RGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERME  1046
              G++FF    + ME +G  N+ D FP LRW+DPQG+R+     + K  +I   +L ER E
Sbjct  204   NGSEFFTAMVEFMECSGHQNIVDVFPWLRWIDPQGLRKKMDRGLGKTIEIVSGFLNERFE  263

Query  1047  SMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAM  1226
                  G  EKKKD+++VLL+Y G   +   + S   + +I+ E+F AG++TT+S++EWAM
Sbjct  264   ESERTG--EKKKDFLEVLLEYEGKGKDEQEKLSDHELILIILEIFLAGSETTSSSIEWAM  321

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
             TELL NP ++ KV+AEL  V+G   KKLEE  I+ L YL+ V+KETLRLHPP+PFLVP  
Sbjct  322   TELLSNPEAMNKVKAELAEVLGNN-KKLEEVDIDNLKYLQVVVKETLRLHPPIPFLVPRK  380

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIP  1586
             A+     +GY IPK+TQ+ VNVWAIGRDP+ W+DP  FKPERFL+  + +++G +FEFIP
Sbjct  381   AIQETEFMGYTIPKDTQVFVNVWAIGRDPECWEDPFDFKPERFLDSKI-EYRGQNFEFIP  439

Query  1587  FGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKA  1766
             FG+GRR+C  +PLA RML L LGS+LH FDW + + +    +D ++RMG+T+RK  PLKA
Sbjct  440   FGAGRRICAGIPLAHRMLHLLLGSLLHEFDWEIDNSVLDEVLDSQDRMGVTVRKLKPLKA  499

Query  1767  IP  1772
             IP
Sbjct  500   IP  501



>gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score =   454 bits (1168),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 215/466 (46%), Positives = 309/466 (66%), Gaps = 10/466 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP+ WP+ GNI  LG  PH +   L  K+GP++ L LG  +T+VI S +AA E+FKNH
Sbjct  39    PPGPKPWPIFGNILHLGSMPHRTLYNLRFKYGPVLWLSLGCSNTLVIQSAKAAEELFKNH  98

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  + RK+ E+       +GSL   +YG +W+ LRR  T E   + +++    +R KCI
Sbjct  99    DITFSDRKVPESWTAHNYYQGSLAFGRYGSYWQFLRRTVTVELMTSKKINDSALIRQKCI  158

Query  726   DHMVRYMREAGNSGTAAID-----VGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M+ Y+ E   +  A  D     V R+ F+M+FNLIGNL+ SKDLL+ +S+ G +FF  
Sbjct  159   DKMIEYIEEDVATANAKGDSGEVVVARYVFVMAFNLIGNLVLSKDLLNAQSKEGTEFFDA  218

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               KVME+ GKPN+ADFFP L+ LDPQ +++  +  + +  +I   ++KER+E       +
Sbjct  219   MDKVMEWGGKPNIADFFPFLKGLDPQRVKKNMKVALGRTINIVDKFVKERVEEKKL-MKE  277

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
               K+D +D LL+Y GD  +GP + S+  +++I+ E+F  GT+TT+ T+EWAM+EL  NP 
Sbjct  278   NVKRDLLDALLEYEGD-GKGPDKISTHNMHIIILEIFFGGTETTSGTIEWAMSELFSNPE  336

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S+ KV+ EL  V+G  ++K+EE  I++LPYL+AV+KET+RLHP +P LVP   +   N +
Sbjct  337   SMMKVKEELNQVIG--KRKVEESDIDELPYLQAVVKETMRLHPVIPLLVPRNTLQDTNFM  394

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK+TQ+ VN W+IGRDP  W+DPL FKPE+F+  N+ D+KG +FE +PFGSGRR+C
Sbjct  395   GYEIPKDTQVFVNAWSIGRDPDAWEDPLSFKPEKFIGSNI-DYKGQNFELLPFGSGRRIC  453

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRK  1748
               +PLA R++  AL S+LH FDW L        +DM ERMG T+RK
Sbjct  454   VGIPLAHRIVQFALASLLHCFDWKLDSHSAVDTLDMNERMGFTVRK  499



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score =   452 bits (1164),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 318/474 (67%), Gaps = 6/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNI  LG  PH +   L +KHGP++ L LGS++T+VI S  AA E+FK 
Sbjct  31    LPPQPPAWPVIGNILDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKG  90

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD V A RK  +A      ++GSL   ++G +WR LRRLC+ E  V  R++    +R KC
Sbjct  91    HDFVFADRKCSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKC  150

Query  723   IDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D M+ Y+ E      A     ID+  F FL++FN++GN++ S+DLLDP+S+ G +F+  
Sbjct  151   VDSMIMYIEEEMAVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDA  210

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               + ME+AGKPNVADF P L+WLDPQGI+      + +A  IA  ++KER+E     G  
Sbjct  211   MNRFMEWAGKPNVADFMPWLKWLDPQGIKAGMAKDMGRAMRIAEGFVKERLEERKLRGEM  270

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D +L Y GD  EGP + SS+ I +I+ EMF AG+++T+ST+EWAM ELL  P 
Sbjct  271   RTTNDFLDAVLDYEGDGKEGPHKISSQNIIIIILEMFFAGSESTSSTIEWAMAELLRQPE  330

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  VV G  +KLEE   EK+P+L+AV+KETLRLHPPLP L+P  A+     +
Sbjct  331   SMKKAKDEIDQVV-GLNRKLEENDTEKMPFLQAVVKETLRLHPPLPLLIPRNALKETKFM  389

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VN W+IGRDP  W+DPL FKPERF+   + D+KG +FE IPFGSGRR+C
Sbjct  390   GFDIPKDTQVFVNAWSIGRDPDDWEDPLAFKPERFMGSKI-DYKGQNFELIPFGSGRRIC  448

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L ++++ FDW LG G  P  +DMKER+GITLRK  PLK IP
Sbjct  449   VGLSLADRVLHLGLATLIYHFDWELGDGSTPKTLDMKERVGITLRKLHPLKVIP  502



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   451 bits (1161),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 307/464 (66%), Gaps = 6/464 (1%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P+   + L  K+GPI+ L +G S++++V+ + +AA ++FKNHD+  A R
Sbjct  43    IFGNMFELGSLPYKKVAVLKQKYGPILWLKIGPSINSMVVQTAQAAADLFKNHDISFADR  102

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
                +  +     +GS+   QYG  WR+ RR+CT E FV  +++    VR KC++ MV+++
Sbjct  103   CTVDVNQAHNYYQGSMALGQYGSFWRLQRRICTVEMFVNKKINETVSVRGKCVNEMVKWI  162

Query  747   REAGN--SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +  N     + I+V RF FL SFN++GNL+FSKDL DP SE  + FF     +ME++G 
Sbjct  163   EKEANVVKKGSGIEVTRFVFLASFNMLGNLIFSKDLADPESEEASDFFNAMKGIMEWSGV  222

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
             PNV+D FP LR  D Q +R+     + KA +    +LKER E    GG  ++ KD++DVL
Sbjct  223   PNVSDIFPSLRRFDLQSLRKKMTRDMGKAMEFGSAFLKEREEERIKGGQ-KRNKDFLDVL  281

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I +++ EMF AG++TT+S++EWA+TELL +P ++ KV+AEL 
Sbjct  282   LEFEGTGKDEPAKLSQHEIKILVMEMFLAGSETTSSSVEWALTELLRHPEAMAKVKAELS  341

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              VVG   KK EE  I+ LPY++ V+KE+LRLHPPLPFL+P   +     LGY IPK TQ+
Sbjct  342   KVVG-PNKKFEESDIDNLPYMQGVLKESLRLHPPLPFLIPRSTIQDTKFLGYDIPKGTQV  400

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVNVWAIGRDP+ W DP+ FKPERFL  N+ D KG H+E +PFG+GRRMC  LPL  RM+
Sbjct  401   LVNVWAIGRDPECWDDPMSFKPERFLSSNI-DVKGQHYELMPFGAGRRMCVGLPLGHRMM  459

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH FDW L  G+ P  ++M E  G+T RK   LK IP
Sbjct  460   HFALGSLLHEFDWELPDGVSPKSINMDESFGVTARKRHSLKVIP  503



>gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score =   451 bits (1160),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 221/485 (46%), Positives = 312/485 (64%), Gaps = 9/485 (2%)
 Frame = +3

Query  336   HRRLEEVGAL-PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             HR+ +    L PPGP+ W + GNIF LG TPH +  +   K+GPI+ L LGS++T+VI S
Sbjct  26    HRKSKSGAKLRPPGPKPWLIFGNIFNLGTTPHQNLYKYRFKYGPILWLRLGSINTLVIQS  85

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRL  692
              +AA E+FKNHD     RK+ E       N+ S+   QYG  WR  RRL T E     R+
Sbjct  86    AKAAEELFKNHDFSFCDRKVPECYTAHNYNQSSVSLGQYGSRWRFHRRLVTVELMTNKRI  145

Query  693   DALRGVRTKCIDHMVRYMREAGNSGTA-----AIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             +    +R KC+++M++++ E  +S  A      ++V R+ F+MSFNLIGNL+ S DLL+ 
Sbjct  146   NDTTSIRQKCVNNMLQFIEEDISSAQARGESMEVEVARYVFIMSFNLIGNLVLSWDLLNS  205

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
             +S+ G +FF    KV     KPNVAD FP  +  DPQ I+   +  + +   I   ++++
Sbjct  206   QSKEGPEFFDALNKVARMGAKPNVADLFPFFKGSDPQRIKSNMEKELGQTLKIVEGFVRK  265

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
             R+E        E  KD++DVLL+Y G   E P + S + I +++ EMF  GT+TT+ST+E
Sbjct  266   RIEERKLVKERE-NKDFLDVLLEYEGVGKEEPDKISIQNIFIMILEMFFGGTETTSSTVE  324

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WAM EL  +P S+++V+ EL  VV G ++K+EE  I  LPYL+AVIKET+RLHP  P L+
Sbjct  325   WAMAELFRSPESMRRVKEELNRVV-GPKRKVEESDIHGLPYLQAVIKETMRLHPIFPLLI  383

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             P   +   N +GY IPK+TQ+ VNVWAI RDP  W+DPL FKPERF++ N+ D++G +FE
Sbjct  384   PRNTLYDTNFMGYLIPKDTQVFVNVWAIARDPDVWEDPLSFKPERFIDSNI-DYRGQNFE  442

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
              +PFG+GRR+CP +P+A R+L   + S+LH FDW +G G  P  +DMKE MGIT+RK  P
Sbjct  443   LLPFGAGRRICPGIPMAHRVLHHVVASLLHCFDWEVGSGSTPRTIDMKEGMGITVRKLIP  502

Query  1758  LKAIP  1772
             L+A P
Sbjct  503   LRATP  507



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score =   450 bits (1158),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 311/474 (66%), Gaps = 14/474 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNI  LG TPH +     +KHGP+  L LGS++T+VI S +AA E FK 
Sbjct  30    LPPQPPAWPVIGNILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKG  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   A RK   A+     ++GSL   +YG +WR+LRRLC+ E  VT R++    +R KC
Sbjct  90    HDSAFADRKCPHALTALGYDQGSLAIGRYGGYWRVLRRLCSAELLVTKRVNETAHLRQKC  149

Query  723   IDHMVRYMRE----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D+MV Y+ E       +    ID+  F FLM+FN++GN++ S+DLLDP+S+ G +FF  
Sbjct  150   VDNMVVYLEEEMAVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDA  209

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               + ME+AGKPNVADF P L+WLDPQGI+      + +A   A  ++KER+E     G  
Sbjct  210   MNRFMEWAGKPNVADFLPWLKWLDPQGIKASMAKDMGRAKKFAEGFVKERLEERKLRGEM  269

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D +L Y GD  EGP + SS+ + +I+ EMF AG++TT+ST+EWAM ELL  P 
Sbjct  270   RTTNDFLDAVLDYEGDGKEGPRKISSQNVIIIILEMFFAGSETTSSTIEWAMAELLRQPV  329

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  +VG T         EK+P+L+AV+KETLRLHPP+P L+P  A+   N +
Sbjct  330   SMRKAKDEINQIVGDT---------EKMPFLQAVVKETLRLHPPVPLLLPRNAIKETNFM  380

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VN W IGRDP  W+DP  FKPERFL   + D+KG +FE IPFGSGRRMC
Sbjct  381   GFDIPKDTQVFVNAWGIGRDPDAWEDPSAFKPERFLGSKI-DYKGQNFELIPFGSGRRMC  439

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L  +L+ FDW L   + P  +DM+ER+GITLRK  PLK IP
Sbjct  440   VGLSLADRVLHLGLAKLLYHFDWELSDDLTPETLDMRERVGITLRKLHPLKVIP  493



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score =   451 bits (1159),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 316/476 (66%), Gaps = 8/476 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMF  536
             LPPGP   P+ GN+F L G  P+   + L  K+GPI+ L +G SM+T+VI +  ++ E+F
Sbjct  37    LPPGPNGLPIFGNMFDLAGSEPYKKIASLKDKYGPILWLKIGPSMNTMVIQTAYSSGELF  96

Query  537   KNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             KNHD + + R I +        +GS+  A YG +WR  RR+CT E FV  R++    VR 
Sbjct  97    KNHDAIFSDRNIIDVNLAHNFYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTLVRQ  156

Query  717   KCIDHMVRYMREAGNSGTAA---IDVGRFFFLMSFNLIGNLMFSKDLL-DPRSERGAKFF  884
             + ++ M+ ++ +  +SG A    I+V R+ FL SFN++GNL+ SKDL+ DP SE+G+ FF
Sbjct  157   ESMNKMLGWIEKKASSGGAVLEGIEVTRYVFLASFNMLGNLILSKDLVTDPESEQGSMFF  216

Query  885   YHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGG  1064
                  +ME++G PN++D FP L+  D QG+R+  +  + KA +I   +++ER+E    G 
Sbjct  217   NAMMGIMEWSGVPNISDIFPCLKMFDIQGLRKKMKRDMGKAIEITKKFIEERIEERKKGE  276

Query  1065  NDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHN  1244
              ++  KD +DVLL + G   + PA+ S   I +I+ EMF AGT+TT+S++EWA+TELL +
Sbjct  277   ENKSIKDLLDVLLDFEGSGKDEPAKLSEHEITIIILEMFLAGTETTSSSVEWALTELLRH  336

Query  1245  PSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCN  1424
             P ++ KV+ E+  V+ G  KK EE  I+ LPY++A++KE+LRLHPPLPFL+P  A+    
Sbjct  337   PPAMTKVKLEISQVI-GPNKKFEERDIDSLPYMQAILKESLRLHPPLPFLIPRKAIQDTK  395

Query  1425  MLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRR  1604
              +G+ +PK TQ+LVNVWAIGRDP+ W DP +FKPERFLE  + D KG + E IPFG+GRR
Sbjct  396   FMGHDVPKGTQVLVNVWAIGRDPECWNDPFEFKPERFLESKV-DVKGQNHELIPFGAGRR  454

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             MC  LPL  RM+  A GS+LH FDW L H + P  ++M+E MGIT RK  PLK IP
Sbjct  455   MCVGLPLGHRMMHFAFGSLLHEFDWELPHNVSPKSINMEESMGITTRKKQPLKVIP  510



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score =   450 bits (1158),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 324/470 (69%), Gaps = 4/470 (1%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WPV+GN+F LG  PH S   L SK+GP++ L  GSM+T+VI S +AA ++FKNH
Sbjct  32    PPGPPGWPVIGNLFDLGTMPHQSLYHLRSKYGPVLWLKFGSMNTMVIQSPKAAAQLFKNH  91

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  + RK    +K     +G+L   +YG +WR+LRRLC++E  VT R++ +  +R KCI
Sbjct  92    DLNFSDRKCPGVLKAHDYFQGTLAFGRYGPYWRVLRRLCSSEMLVTKRINEIAPLRQKCI  151

Query  726   DHMVRYM-REAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             D M+ ++ ++A    +  + +  F F M+FN++GNLM S+DLLD  S+ G  F+   G +
Sbjct  152   DAMIGWIEKDAREKESGEVKLPDFLFPMTFNVVGNLMLSRDLLDLNSKEGHDFYNAMGGI  211

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME  G PN++DFFP LRWLD QG+ R     + +A  + G ++KER++     G ++++K
Sbjct  212   MENVGTPNLSDFFPWLRWLDLQGLHRRMVRDMGQAKSLVGGFVKERVQDQQF-GQEKERK  270

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++D LL++ GD  E P + + R  N+I+ EMF AG++TT+ST+EW M E++  P  ++K
Sbjct  271   DFLDALLEFEGDAKEWPRKMTDRNTNIIILEMFFAGSETTSSTIEWGMAEIIRKPEIMKK  330

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ EL  V+    KK+EE  +EKLPYL+AV+KETLRLHP LP L+P  A+   N +G+ I
Sbjct  331   VKEELERVI-IPNKKVEESDVEKLPYLQAVVKETLRLHPALPLLLPRNALQDVNFMGFDI  389

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK+TQ+ VN WAIGRDP +W DPL FKPERFL+  + D+KG +FEF+PFGSGRR+C  + 
Sbjct  390   PKDTQVFVNTWAIGRDPDSWDDPLSFKPERFLDSKV-DYKGQNFEFLPFGSGRRICVGMV  448

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA R++ LAL S+LH+FDW L + +    +D+ E+MGITLRK  PLKAIP
Sbjct  449   LADRVVHLALASLLHTFDWELPNNITQETLDVNEKMGITLRKLVPLKAIP  498



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   450 bits (1158),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/466 (48%), Positives = 312/466 (67%), Gaps = 9/466 (2%)
 Frame = +3

Query  390   VVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGS-MSTVVISSDEAAREMFKNHDVVLAG  563
             +VGN+F L G  P+   + L  K+GPI+ L +GS M+T+V+ + +AA E+FKNHDV  A 
Sbjct  44    IVGNMFDLAGSEPYKKVANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFAD  103

Query  564   RKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRY  743
             R I +        + S+  A YG +WR+ RR+CT E FV  R++    +R K +D M+++
Sbjct  104   RNIVDVNLAHNFYQVSMALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQW  163

Query  744   MREAGN---SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFA  914
             + +  N      + I+V R+ FL SFN++GNLM SKDL DP SE+G++FF     +ME++
Sbjct  164   IEKQSNLENVDRSGIEVTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIMEWS  223

Query  915   GKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMD  1094
             G PN++D F  L+  D QG+R+  +  + KA +I   YLKER+E    GG  EK+KD MD
Sbjct  224   GVPNISDIFSCLKRFDIQGLRKKMERDMGKAKEITFGYLKERIEERQKGG--EKRKDLMD  281

Query  1095  VLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAE  1274
             VLL + G+  + PA+ S   I + + EMF AGT+TT++++EWA+TELL NP ++ KV+AE
Sbjct  282   VLLDFEGNGKDEPAKLSEHEITMTIMEMFLAGTETTSNSVEWALTELLRNPEAMVKVKAE  341

Query  1275  LRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKET  1454
             +  VVG   +K EE  I+ LPY++AV+KE+LRLHPPLPFL+P  A+++   +GY +PK T
Sbjct  342   ILEVVG-PNRKFEECDIDNLPYMQAVLKESLRLHPPLPFLIPRRAIENTKFMGYDVPKGT  400

Query  1455  QILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASR  1634
             Q+LVN W+IGRDP+ W DP +FKPERFL  N+ D KG ++E IPFG+GRRMC  L L  R
Sbjct  401   QLLVNAWSIGRDPECWDDPFEFKPERFLGSNV-DVKGQNYELIPFGAGRRMCVGLSLGHR  459

Query  1635  MLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             M+  A GS+LH F+W L   + P  M+M E MGIT RK  PLK IP
Sbjct  460   MMHFAFGSLLHEFNWELPGNVTPKSMNMDESMGITARKKQPLKVIP  505



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   450 bits (1157),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 237/474 (50%), Positives = 320/474 (68%), Gaps = 6/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNIF LG  PH +   L +KHGP++ L LGS++T+VI S  AA E+FK 
Sbjct  31    LPPQPPAWPVIGNIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKG  90

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD V A RK  +A      ++GSL   ++G +WR LRRLC+ E  V  R++    +R KC
Sbjct  91    HDFVFADRKCSQAFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKC  150

Query  723   IDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D M+ Y+ E      A     ID+  F FL++FN++GN++ S+DLLDP+S+ G +F+  
Sbjct  151   VDSMIMYIEEEMAVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDA  210

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               + ME+AGKPNVADF P L+WLDPQGI+      + +A  IA  ++KER+E     G  
Sbjct  211   MNRFMEWAGKPNVADFMPWLKWLDPQGIKAGMAKDMGRAMRIAEGFVKERLEERKLRGEM  270

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D +L Y GD  EGP + SS+ IN+I+ EMF AG+++T+ST+EWAM ELL  P 
Sbjct  271   RTTNDFLDAVLDYEGDGKEGPHKISSQNINIIILEMFFAGSESTSSTIEWAMAELLRQPE  330

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  VV G  +KLEE   EK+P+L+AV+KETLRLHPPLP L+P  A+     +
Sbjct  331   SMKKAKDEIDQVV-GLNRKLEENDTEKMPFLQAVVKETLRLHPPLPLLIPRNALKETKFM  389

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VN W+IGRDP  W+DPL FKPERF+   + D+KG +FE IPFGSGRR+C
Sbjct  390   GFDIPKDTQVFVNAWSIGRDPDAWEDPLAFKPERFVGSKI-DYKGQNFELIPFGSGRRIC  448

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L ++L+ FDW LG G  P  +DMKER+GITLRK  PLK IP
Sbjct  449   VGLSLADRVLHLGLATLLYHFDWELGDGSTPKTLDMKERVGITLRKLHPLKVIP  502



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   448 bits (1153),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/474 (45%), Positives = 313/474 (66%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GNIF LG  PH +  +   K+GP++ L LG  +T+VI S  AA E+FKNH
Sbjct  48    PPGPPAWPIFGNIFDLGTIPHRNLYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNH  107

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+    RK+ +       ++G++   +YG  WR  RRL T +     R+     +R KCI
Sbjct  108   DISFCDRKVPDCCTAHNYDQGAVSLGRYGSIWRFHRRLITLDLMTNKRIKESAFLRIKCI  167

Query  726   DHMVRYMREAGNSGTAAIDVGR-----FFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             + M++Y+ E   +  A  ++G      + F+M+FNLIGNL+ S+DL + +S  G +F + 
Sbjct  168   NSMIQYIEEDTAAARARGELGEVVIAHYLFVMTFNLIGNLVLSQDLANSQSNEGLEFSHA  227

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K+   +GKPN  D +P L+  DPQ I+R  +  + KA  +   +++ER+E       +
Sbjct  228   MDKITVLSGKPNATDLWPFLKMFDPQRIKRDMEREMGKALRVVEGFVRERIEERKLE-KE  286

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
               KKD++D LL++  D   GP + S +T+ +I+ E+F AGT+TT+ST+EWAMTELL  P 
Sbjct  287   RSKKDFLDALLEFESDEEAGPDKISIQTMFIIILEIFFAGTETTSSTMEWAMTELLRCPE  346

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S+++V+ EL+ VVG  ++K+EE  I++LPYL+AV+KET+RLHP LP L+P  +++  N +
Sbjct  347   SIKRVKEELKRVVG-QKRKVEESDIDQLPYLQAVLKETMRLHPTLPLLIPRNSLEDTNFM  405

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK+TQ+ VNVWAIGRDP++W+DP  FKPERFLE ++ D++G +FE++PFGSGRR+C
Sbjct  406   GYLIPKDTQVFVNVWAIGRDPESWQDPNSFKPERFLESDI-DYRGKNFEYLPFGSGRRIC  464

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               + LA R+L L L S+LH FDW L     P  +DMKE+MG+ +RK  PLKAIP
Sbjct  465   AGILLAQRVLHLGLASLLHCFDWELSSNYTPDSIDMKEKMGMAVRKLVPLKAIP  518



>emb|CDY68641.1| BnaCnng59890D [Brassica napus]
Length=333

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 225/332 (68%), Positives = 272/332 (82%), Gaps = 4/332 (1%)
 Frame = +3

Query  804   MSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRM  983
             M+FNLIGNLMFS+DLLDP S+RG++F YH GKVMEFAGKPNVADFFPLLR++DPQGIRR 
Sbjct  1     MAFNLIGNLMFSRDLLDPDSKRGSEFLYHTGKVMEFAGKPNVADFFPLLRFIDPQGIRRK  60

Query  984   TQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRG--DLVEGPARFSSRTI  1157
             TQFHV +AF+IAG+++KER E      +DEK KDY+DVLL++RG   + E PARFS+R I
Sbjct  61    TQFHVERAFEIAGEFIKERTEVRERERSDEKTKDYLDVLLEFRGGDGVDEEPARFSARDI  120

Query  1158  NVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLP  1337
             NV +FEMFTAGTDTTTSTLEWA+ ELLHNP +L K+Q  LR+      +KL+E  +  LP
Sbjct  121   NVTVFEMFTAGTDTTTSTLEWALAELLHNPRTLTKLQNLLRTYFKSPNQKLQEEDLPNLP  180

Query  1338  YLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG-YYIPKETQILVNVWAIGRDPKTWKDPL  1514
             YL AVI ETLRLHPPLPFLVPH AM +C++   Y IPKETQ+LVNVWAIGRDP TW DP 
Sbjct  181   YLSAVIMETLRLHPPLPFLVPHKAMSTCHIFDKYTIPKETQVLVNVWAIGRDPATWVDPN  240

Query  1515  KFKPERFL-EPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGH  1691
              FKPERF+ +PN  DFKG  +EF+PFGSGRRMCPALPLASR+LPLA+GS++ SFDW L  
Sbjct  241   MFKPERFITDPNPRDFKGQDYEFLPFGSGRRMCPALPLASRVLPLAIGSMVRSFDWALAD  300

Query  1692  GMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             G++  +MDM E++GITL+KA PL+AIP+PY+G
Sbjct  301   GLKGEEMDMGEKIGITLKKAVPLEAIPIPYRG  332



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score =   447 bits (1151),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/495 (44%), Positives = 315/495 (64%), Gaps = 14/495 (3%)
 Frame = +3

Query  318   MINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMST  497
             +++ R  R       LPPGPR WPV GN+F+LG  PH + + L+ +HGP++ L +GS+ T
Sbjct  18    LLHYRRQRAGSSASRLPPGPRGWPVFGNMFELGPMPHKTIAGLSREHGPVVWLRIGSIDT  77

Query  498   VVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFF  677
             +V+ +  AA ++FKNHD     R I E M+    +  ++  +  G +WR ++R+ T E  
Sbjct  78    MVVQTAAAAADLFKNHDASFVERTITEVMRAHGFDRAAVSLSPPGPYWRAMKRMMTAEML  137

Query  678   VTSRLDALRGVRTKCIDHMVRYM-REAGNSGT---------AAIDVGRFFFLMSFNLIGN  827
             V  R+     VR +C+  MV ++ REAG               + V RF FL SFN++ N
Sbjct  138   VQKRIGESEAVRRRCVGDMVEWIGREAGKGNAVRASRTCDGGGVHVARFVFLASFNMLAN  197

Query  828   LMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKA  1007
             LM S+DL+ P +E G++FF    ++M  +G+PN+ D FP LRWLDPQG+RR     + K 
Sbjct  198   LMLSQDLVSPDAEEGSEFFAAMIELMSCSGQPNIVDLFPCLRWLDPQGLRRKIDRGMGKT  257

Query  1008  FDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTA  1187
               I   ++++R+    +  N   KKD+++VLL+YRG+  +   + S   +++I+ E+F A
Sbjct  258   LKIVAGFVEKRIREKKS--NPNSKKDFLEVLLEYRGNGEDESDQISDHQLHIIIMEVFLA  315

Query  1188  GTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETL  1367
             G++TT+ST+EWAM ELL +P ++   ++EL  VVG   K+ EE HI+ LPYL+AV+KETL
Sbjct  316   GSETTSSTIEWAMVELLSHPEAMAAARSELARVVG-EGKRFEEAHIDDLPYLQAVMKETL  374

Query  1368  RLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPN  1547
             RLHPP+PFLVP  A+   N +GY IPK TQ+ VN WAIGRDP+ W++   FKPERFL   
Sbjct  375   RLHPPIPFLVPRRAVREVNFMGYQIPKNTQLFVNAWAIGRDPQRWEEAAAFKPERFLGSG  434

Query  1548  MADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKER  1727
               D+KG +FE IPFG+GRR+C  +PLA RML L LG++LH F+W +      + MD +ER
Sbjct  435   R-DYKGQNFELIPFGAGRRICAGIPLAHRMLHLVLGNLLHEFEWGVDEVGRKAMMDERER  493

Query  1728  MGITLRKATPLKAIP  1772
             MG+T+RK  PL A P
Sbjct  494   MGVTVRKLVPLMATP  508



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   446 bits (1148),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 213/466 (46%), Positives = 308/466 (66%), Gaps = 9/466 (2%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+  LG  PH + ++L    GP++ L +G+ +T+ I S +AA E FKNHD+  A R + E
Sbjct  45    NMLDLGQMPHKTQTKLRHTFGPVIWLRIGARNTMAILSAKAATEFFKNHDISFAERSVTE  104

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
               K    ++GSL  A YG HWR+LRRL T +     R++    +R+KC+D+M +++ E  
Sbjct  105   GSKVLDYHKGSLALAPYGSHWRLLRRLLTVDILTNKRINDTAAIRSKCVDNMQKWIEEEA  164

Query  759   N----SGTAA--IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
             +    +GT++  + + RF FLMSFNL+GNL+ S+DL+DP SE G +FF     VME  G 
Sbjct  165   SKLQENGTSSRGVHLARFVFLMSFNLLGNLLLSRDLVDPNSEEGLEFFELMKGVMETNGL  224

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              N+AD+FP LRW DPQG+++  +  + K  ++A  ++K R+      G ++  KD++DVL
Sbjct  225   ANMADYFPWLRWFDPQGVKKRMKKDLAKLLELASGFVKVRLHERLLVGGEKTNKDFLDVL  284

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L+++G+ ++ P + S   IN+ + E+F AG +TT+ST+EWAMTELL NP +L K + ELR
Sbjct  285   LEFQGNGIDEPTKISDHDINIFILEIFLAGAETTSSTIEWAMTELLCNPETLIKAKTELR  344

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              V+ G  +K+ E  I+ LPYL+ ++KETLRLHPP+PFL+P  A+     +GY+IPK TQ+
Sbjct  345   QVI-GQNRKMNESDIDNLPYLQVIVKETLRLHPPVPFLIPRKAILDTKFMGYFIPKNTQV  403

Query  1461  LVNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRM  1637
              VN +AIGRDP  W D P  FKPERF+   + D+KG H+E IPFG+GRRMC  +PL  +M
Sbjct  404   FVNAYAIGRDPDVWIDEPDSFKPERFIGSKV-DYKGQHYELIPFGAGRRMCAGVPLGHKM  462

Query  1638  LPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             L L LGS+LH FDW LG  +    MD  +R+GIT+RK  PL A+P 
Sbjct  463   LHLTLGSLLHQFDWALGRNVTKDTMDWNDRLGITMRKYQPLLAVPT  508



>gb|AHX24368.1| CYP76A26-like protein [Tabernaemontana elegans]
Length=514

 Score =   446 bits (1146),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 318/466 (68%), Gaps = 8/466 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             + GN+F LG  PH S  +L SK+GPI+ L LGS++T+V+ +  +A E+FK HDV    RK
Sbjct  46    IFGNMFDLGDLPHQSMYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRK  105

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
             + + +     N GSL    YG HWR+LRRLC+ EF V  R++    +R +  D+MVR++ 
Sbjct  106   VPDTLTAFDFNRGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIE  165

Query  750   E-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFA  914
             E         GT A+ + RF FLM+FNL+GNLM S+DLLD +     +FF    +++E A
Sbjct  166   EDSLASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDSKDPESREFFDCMNEILELA  225

Query  915   GKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMD  1094
             G PN+ADF PLL+ LDP G+++    ++ +   I+  +++ER+++  AG  +E KKD++D
Sbjct  226   GTPNIADFLPLLKKLDPLGMKKRMVDNMTRTMKISSKFVQERLDNRKAGKVNE-KKDFLD  284

Query  1095  VLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAE  1274
             V+L+Y+GD  +GP +F+ + +N+++ EMF AG++TT+ ++EW  TELL NP + +KV+ E
Sbjct  285   VMLEYQGDGKDGPDKFTEQHVNIVIMEMFFAGSETTSISIEWGFTELLRNPYAFKKVREE  344

Query  1275  LRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKET  1454
             +  VV G  + +EE  +E LPYL+AV+KETLRLHP LP L+P   M+    +GY IPK T
Sbjct  345   IDRVV-GVNRMVEETDMENLPYLQAVVKETLRLHPALPMLLPRNTMEDTEYMGYLIPKGT  403

Query  1455  QILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASR  1634
             Q+ VN WAIGRD   W+DPL FKPERFL  ++ ++KG HFE IPFGSGRR+C   PLA R
Sbjct  404   QVFVNAWAIGRDADYWQDPLTFKPERFLNSSV-EYKGQHFELIPFGSGRRICVGFPLAHR  462

Query  1635  MLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             ++ L L +++ +FDW LG G++P  +D++ER+G+TLRK  PLK IP
Sbjct  463   VVHLTLATLVQAFDWDLGAGVKPQDIDLEERLGLTLRKKNPLKVIP  508



>gb|KDP24880.1| hypothetical protein JCGZ_25133 [Jatropha curcas]
Length=510

 Score =   445 bits (1145),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 307/470 (65%), Gaps = 12/470 (3%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+VGNIF LG   H    EL  K+GP++ L LGS+ TVVI S +AA E+FKNH
Sbjct  36    PPGPTGWPLVGNIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNH  95

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D     R +   +      +GSL   ++G +WR LRR+C  E     R++    +R KCI
Sbjct  96    DASFCDRTVPCVLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCI  155

Query  726   DHMVRYMREAGNSGTAAIDVG-----RFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M+R + +   +G A+ + G      + F+M+FNLIGNLM SKDL D + + G +FF  
Sbjct  156   DVMIRSIEDDMAAGKASGESGIVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEA  215

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               KVM +AG PN+ADF P L+WLDPQG+ R     + +A DI   ++KER+E     G  
Sbjct  216   MDKVMVWAGTPNLADFLPFLQWLDPQGLIRNMSRDMGRAKDIVAGFVKERIEDYKM-GKK  274

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             +  KD++DVLL++ GD  E   +     I +I+ EMF AG +TT+ST+EW M EL  +P 
Sbjct  275   KANKDFLDVLLEFEGDGKEWEGKIPYDKIIIIILEMFFAGPETTSSTMEWVMAELFSDPK  334

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L+KV+ EL +VV G  +K+EE  I+KLPYL+AVIKET RLHP +P L+P   ++  N +
Sbjct  335   ALRKVKDELDTVV-GENRKVEESDIDKLPYLQAVIKETCRLHPVVPLLLPRNTIEDTNFM  393

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+I K TQ+LVN WAIGRDP++W+DP+ FKPERFL   + DFKG +FE IPFGSGRR+C
Sbjct  394   GYHISKGTQVLVNAWAIGRDPESWEDPMNFKPERFLGSKI-DFKGQNFELIPFGSGRRIC  452

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
               + LA R++PL L S+LH+F+W L    +   +DM+ERM IT+RK  PL
Sbjct  453   VGMGLAQRVVPLGLASLLHNFEWDL----DSQTLDMRERMAITVRKLVPL  498



>gb|AHX24365.1| CYP76A26-like protein [Cinchona calisaya]
Length=516

 Score =   444 bits (1143),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 320/474 (68%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN+F LG  PH +   L SK+GP++ L LGS++T+V+ +  AA E+FK H
Sbjct  40    PPGPPGWPIFGNMFDLGDLPHQTLYRLRSKYGPVIWLQLGSINTMVVQNAVAAAELFKKH  99

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             DV  A RK+ +A+     N+GSL    +G HWR+LRRLC+ EF V  +++    +R +  
Sbjct  100   DVPFADRKVPDALTAFEFNQGSLGMNTFGGHWRVLRRLCSMEFLVNKKMNETTDLRRRIE  159

Query  726   DHMVRYMRE-----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D+M+R++ +         G  A+ + R  FLM+FNL+GNLM S+DLLD R     +FF  
Sbjct  160   DNMIRWIEDECVSSKAQGGNGAVQLSRLLFLMAFNLVGNLMLSRDLLDNRDPESKEFFDS  219

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               +++E AG PN+ADF P L+ LDP G+++    ++ K   I+  +++ER+++  AG   
Sbjct  220   MNEILELAGTPNIADFLPFLKRLDPLGMKKRMIANMTKTMRISSKFVQERLDNRKAGKFS  279

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             + KKD++DV+L+Y GD  +GP RF+ + +N+++ EMF AG++TT+ ++EW  TELL NP 
Sbjct  280   D-KKDFLDVMLEYEGDGKDGPDRFTEKHVNIVIMEMFFAGSETTSISIEWGFTELLRNPH  338

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             + +KV+ E+  VV G  + +EE  +E LPYL+A +KETLRLHP LP L+P    +  + +
Sbjct  339   AFKKVREEIDRVV-GVNRMVEESDMENLPYLQAAVKETLRLHPALPLLLPRNTAEDTDYM  397

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY +PK TQ+ VN WAIGRDP+ W DPL FKPERFL  ++ ++KG HFE IPFGSGRR+C
Sbjct  398   GYEVPKGTQVFVNAWAIGRDPEYWDDPLTFKPERFLNSSV-EYKGQHFELIPFGSGRRIC  456

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
                PLA R++ L L +++ +FDW LG G++P  +DM ER+G+TLRK  P+K IP
Sbjct  457   VGFPLAHRVVHLTLATLVQAFDWDLGAGVKPQDIDMDERLGLTLRKKNPIKVIP  510



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   444 bits (1142),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 235/474 (50%), Positives = 315/474 (66%), Gaps = 6/474 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPP P  WPV+GNI  LG   H +   L +KHGP++ L LGS++TV I S +AA E+FK 
Sbjct  31    LPPQPPAWPVIGNILDLGTMAHQNLHNLRAKHGPVLWLKLGSVNTVAIQSAQAAMELFKG  90

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD V A RK   A+     ++GSL   +YG +WR LRRLC+ E FV  R++    +R KC
Sbjct  91    HDFVFADRKCPHALTALGYDQGSLAVGRYGDYWRALRRLCSAELFVNKRVNDAAHLRQKC  150

Query  723   IDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             +D M+ Y+ E      A     ID+  F FL++FN++GN++ S+DLLDP+S+ G +F+  
Sbjct  151   VDSMIMYIEEEMAVKQATKEQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDA  210

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
                VME+AGKPNVADF P L+WLDPQGI+      + +A  IA  ++KER+E     G  
Sbjct  211   MNLVMEWAGKPNVADFMPWLKWLDPQGIKASMAKDMGRAMKIAEGFVKERLEERKLRGEM  270

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D LL Y GD  EGP + SS+ IN+I+ EMF AG++TT+ST+EWAM ELL  P 
Sbjct  271   RTTNDFLDTLLDYEGDGKEGPHKISSQNINIIILEMFFAGSETTSSTIEWAMAELLRQPE  330

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S++K + E+  VV G  +KLEE   E +P+L+AV+KETLRLHPP+P L+P  A+     +
Sbjct  331   SMKKAKDEIDQVV-GLNRKLEENDTENMPFLQAVVKETLRLHPPVPLLLPRNALKETKFM  389

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ IPK+TQ+ VN W+IGRDP  W+DPL FKP+RF+   + D KG +FE IPFGSGRR+C
Sbjct  390   GFDIPKDTQVFVNAWSIGRDPDAWEDPLAFKPKRFMGSKI-DCKGQNFELIPFGSGRRIC  448

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               L LA R+L L L ++L+ FDW LG G  P  +DMKER+GI  RK  PLK IP
Sbjct  449   IGLSLADRVLHLGLATLLYHFDWELGDGSTPKTLDMKERVGIIQRKLHPLKVIP  502



>gb|KDO61005.1| hypothetical protein CISIN_1g0379902mg, partial [Citrus sinensis]
Length=283

 Score =   435 bits (1119),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/290 (73%), Positives = 242/290 (83%), Gaps = 12/290 (4%)
 Frame = +3

Query  318   MINERSHRRLEEV--GALPPGPRRWPVVGNIFQLGWTP---HVSFSELASKHGPIMTLWL  482
             M+ +R HR  EE+    LPPGPR WPVVGNIFQLGW P   H SF+ LA KHGP+MTLWL
Sbjct  1     MVTKRRHRHKEELERQRLPPGPRWWPVVGNIFQLGWMPMPPHASFAILAHKHGPLMTLWL  60

Query  483   GSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLC  662
             GSM TVV+SS+E AR+MFKNHDVVLAGRKIYEAMKGD+G EGS+IT+QYG HWRMLRRLC
Sbjct  61    GSMCTVVVSSNEVARDMFKNHDVVLAGRKIYEAMKGDYGTEGSIITSQYGAHWRMLRRLC  120

Query  663   TTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSK  842
             TTEFFVTSRLDA RGVR+KCID MV+++ EA     A IDVGRF FLM+FNLIGNLMFSK
Sbjct  121   TTEFFVTSRLDATRGVRSKCIDRMVQFVEEA--EACAPIDVGRFIFLMAFNLIGNLMFSK  178

Query  843   DLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAG  1022
             DLL P SERGAKF YHAGKVME AGKPNVADF P+LRWLDPQGIR+ TQFHV +AF+IAG
Sbjct  179   DLLGPESERGAKFSYHAGKVMELAGKPNVADFLPILRWLDPQGIRKKTQFHVERAFEIAG  238

Query  1023  DYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILF  1172
              ++KERME      N+EKKKD++DVLL + GD V+ PA+FSSRTINVI+F
Sbjct  239   GFIKERMED-----NEEKKKDFLDVLLAFHGDGVDEPAKFSSRTINVIVF  283



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   443 bits (1139),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/475 (47%), Positives = 312/475 (66%), Gaps = 18/475 (4%)
 Frame = +3

Query  390   VVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGS-MSTVVISSDEAAREMFKNHDVVLAG  563
             +VGN+F L G  P+   + L  K+GPI+ L +GS M+T+V+ + +AA E+FKNHDV  A 
Sbjct  44    IVGNMFDLAGSEPYKKVANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFAD  103

Query  564   RKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRY  743
             R I +        + S+  A YG +WR+ RR+CT E FV  R++    +R K +D M+++
Sbjct  104   RNIVDVNLAHNFYQVSMALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQW  163

Query  744   MREAGN---SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFA  914
             + +  N      + I+V R+ FL SFN++GNLM SKDL DP SE+G++FF     +ME++
Sbjct  164   IEKQSNLENVDRSGIEVTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIMEWS  223

Query  915   GKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMD  1094
             G PN++D F  L+  D QG+R+  +  + KA +I   YLKER+E    GG  EK+KD MD
Sbjct  224   GVPNISDIFSCLKRFDIQGLRKKMERDMGKAKEITFGYLKERIEERQKGG--EKRKDLMD  281

Query  1095  VLLQYRGDLVEGPARFSSRTINVILF---------EMFTAGTDTTTSTLEWAMTELLHNP  1247
             VLL + G+  + PA+ S   I + +          EMF AGT+TT++++EWA+TELL NP
Sbjct  282   VLLDFEGNGKDEPAKLSEHEITMTIMVKDLSRKHSEMFLAGTETTSNSVEWALTELLRNP  341

Query  1248  SSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNM  1427
              ++ KV+AE+  VVG   +K EE  I+ LPY++AV+KE+LRLHPPLPFL+P  A+++   
Sbjct  342   EAMVKVKAEILEVVG-PNRKFEECDIDNLPYMQAVLKESLRLHPPLPFLIPRRAIENTKF  400

Query  1428  LGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRM  1607
             +GY +PK TQ+LVN W+IGRDP+ W DP +FKPERFL  N+ D KG ++E IPFG+GRRM
Sbjct  401   MGYDVPKGTQLLVNAWSIGRDPECWDDPFEFKPERFLGSNV-DVKGQNYELIPFGAGRRM  459

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             C  L L  RM+  A GS+LH F+W L   + P  M+M E MGIT RK  PLK IP
Sbjct  460   CVGLSLGHRMMHFAFGSLLHEFNWELPGNVTPKSMNMDESMGITARKKQPLKVIP  514



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score =   442 bits (1138),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 232/476 (49%), Positives = 329/476 (69%), Gaps = 8/476 (2%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             + PPGP+ WP+ GNIF LG  PH +   L  +HGP++ L LG+++T+V+ S +AA E+FK
Sbjct  35    STPPGPQGWPIFGNIFDLGTLPHQTLHRLRPQHGPVLWLQLGAINTMVVQSAKAAAELFK  94

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             NHD+  + R +   +     ++GS+   +YG +WRM+R++C +E  V  R++ +  +R K
Sbjct  95    NHDLPFSDRNVPFTLTAHNYDQGSMALGKYGPYWRMIRKVCASELLVNKRINEMGSLRRK  154

Query  720   CIDHMVRYMRE----AGNSGTAA-IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFF  884
             C+D M+R++ E    +G  G A  +++  F F M+FNLIGN+  S+D++D +S+ G +FF
Sbjct  155   CVDDMIRWIEEDAAKSGAEGRAGEVELPHFLFCMAFNLIGNITLSRDVVDIKSKDGHEFF  214

Query  885   YHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGG  1064
                  VME+AG+PN+ADFFPLL+ LDP G+ R     + +A ++   ++ ER E   +G 
Sbjct  215   QAMNGVMEWAGRPNIADFFPLLKRLDPLGMMRNMVRDMGQALNLIARFVNERDEERQSGM  274

Query  1065  NDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHN  1244
               E K+D++DVLL+ R D  EGP   S   + +I+ EMF AG++TT+STLEWAMTELL  
Sbjct  275   VRE-KRDFLDVLLECRDDEKEGPHEMSDNKVKIIVLEMFFAGSETTSSTLEWAMTELLRR  333

Query  1245  PSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCN  1424
             P S++K Q EL  VV G   K+EE  I++L YL+AV+KETLRLHPP+P L+P  A+   N
Sbjct  334   PESMRKAQEELDRVV-GPHGKVEESDIDQLLYLQAVVKETLRLHPPIPLLLPRNALQDTN  392

Query  1425  MLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRR  1604
              +GY++PK TQ+ VN WAIGRDP  WK+PL FKP+RFL  N+ D+KG +FEFIPFGSGRR
Sbjct  393   FMGYFVPKNTQVFVNAWAIGRDPDAWKEPLSFKPDRFLGSNL-DYKGQNFEFIPFGSGRR  451

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +C  + LA+++LPLAL S+LH FDW LG G+ P  MDM ER+GIT+RK  PLK IP
Sbjct  452   ICIGISLANKLLPLALASLLHCFDWELGGGVTPETMDMNERVGITVRKLIPLKPIP  507



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score =   442 bits (1138),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 307/466 (66%), Gaps = 9/466 (2%)
 Frame = +3

Query  390   VVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGS-MSTVVISSDEAAREMFKNHDVVLAG  563
             + GN+F L G  PH   +    K+GPI+ L +GS M+T+V+ + +AA E+FKNHDV  A 
Sbjct  44    IFGNMFDLAGSEPHKKVANWKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFAD  103

Query  564   RKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRY  743
             R I +        +GS+  A YG +WRM RR+CT+E FV  R++    +R K +D M+++
Sbjct  104   RNIVDVNLAHNIYQGSISLAPYGNYWRMQRRICTSEMFVNKRINETVQIRRKSMDKMLQW  163

Query  744   MREAGN---SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFA  914
             + +  N      + I+V  + FL SFN++GNL+ SKDL DP S++G++FF     +M++A
Sbjct  164   IEKQANLVNINRSGIEVTHYVFLASFNMLGNLILSKDLADPESDKGSEFFNAMTGIMQWA  223

Query  915   GKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMD  1094
             G PN++D F  L+  D QG+R+  +  + KA +I   YLKER E    G   EK+KD +D
Sbjct  224   GVPNISDIFSCLKRFDIQGLRKKMERDMGKAKEITFGYLKERTEERQKG--REKRKDLLD  281

Query  1095  VLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAE  1274
             VLL + G   +  A+ S   I + + EMF AGT+TT+S++EWA+TELLHNP ++ KV+AE
Sbjct  282   VLLDFEGSGKDEQAKLSEHEITMTIMEMFLAGTETTSSSVEWALTELLHNPEAMAKVKAE  341

Query  1275  LRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKET  1454
             +  VVG  ++K EE  I+ LPY++AV+KE+LRLHPPLPFL+P  A      +GY +PK T
Sbjct  342   ISEVVG-PDRKFEECDIDNLPYMQAVLKESLRLHPPLPFLIPRRATQDTKFMGYDVPKGT  400

Query  1455  QILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASR  1634
             Q+LVNVW+IGRD + W DP +FKPERFL   + D KG H+E IPFG+GRRMC  L L  R
Sbjct  401   QVLVNVWSIGRDLECWDDPFEFKPERFLGSKV-DVKGQHYELIPFGAGRRMCVGLSLGHR  459

Query  1635  MLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             M+  A GS+LH F+W L + + P  ++M ERMG+T RK  PLK IP
Sbjct  460   MMHFAFGSLLHEFNWELPNNVSPKYINMDERMGLTARKKQPLKVIP  505



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   442 bits (1137),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 220/464 (47%), Positives = 303/464 (65%), Gaps = 8/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P+   S L  K+GP++ L LG S + +V+ +  AA E+FKNHD   A R
Sbjct  44    IFGNMFELGKEPYKKMSVLQQKYGPVLGLKLGPSTNIMVVQTAHAAAELFKNHDTSFADR  103

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
              + +        +GSL   +YG  WR  RR+CT E FV  ++     +R KC+D+M++++
Sbjct  104   PMVDVNLAHNYYQGSLAIGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWI  163

Query  747   REAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +AG+S    + I+V RF FL SFN++GNL+ SKDL DP SE  + FF     +ME++G 
Sbjct  164   EKAGSSAEKGSGIEVTRFVFLASFNMLGNLVLSKDLADPESEEASDFFNAMKGIMEWSGI  223

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              NV+D FPLLR  D Q +R+     + KA +I    LKER E    G   EK+KD++DVL
Sbjct  224   ANVSDIFPLLRKFDLQKLRKKMTRDMGKAMEIMSMLLKEREEERKKGM--EKRKDFLDVL  281

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I V++ EMF AG++TT+S++EWA+TELL +P ++ KV+ E+ 
Sbjct  282   LEFEGTGKDEPAKLSEHEIKVLIVEMFLAGSETTSSSVEWALTELLRHPEAMAKVKTEIS  341

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              VVG +  K EE  IE LPY++AVIKE+LRLHPPLPFL+P   +     +GY IPK TQ+
Sbjct  342   KVVGLS--KFEESDIENLPYMQAVIKESLRLHPPLPFLIPRKTIQDTKFMGYDIPKGTQV  399

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN WAIGRDP+ W DP+ FKPERFL   + D KG ++E IPFG+GRRMC  LPL  RM+
Sbjct  400   LVNAWAIGRDPECWDDPMSFKPERFLGSKI-DVKGQNYELIPFGAGRRMCVGLPLGHRMM  458

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH F+W L  G+ P  ++M E MG+T RK   LK IP
Sbjct  459   HFALGSLLHEFEWELPDGVSPKSINMDESMGVTARKRDSLKVIP  502



>ref|XP_011094434.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   442 bits (1138),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/482 (46%), Positives = 322/482 (67%), Gaps = 8/482 (2%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             R +  G  PPGP+  P+ GN+ QLG  PH +  +    +GP++ L LGS+ T+V+    +
Sbjct  27    RPKNSGKKPPGPKGVPIFGNLLQLGDLPHETMHKWKQTYGPVIWLKLGSVYTMVVQDAAS  86

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             A E+FK HD+  A RK+ + +     N+G+L   Q+G HWR+LRRLC+ EF V  R++  
Sbjct  87    ASELFKKHDLPFADRKVPDVLTAYDFNQGTLGMNQFGGHWRVLRRLCSMEFLVNKRMNET  146

Query  702   RGVRTKCIDHMVRYMREA-----GNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSE  866
               +R +  ++M R++ E         GT AI + RF FL++FNL+GNLM S+DLLD +  
Sbjct  147   TELRHRIRENMERWILEESAAARAQGGTGAIQLSRFLFLLAFNLVGNLMLSRDLLDAKDP  206

Query  867   RGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERME  1046
                +FF    KV+E AG PN+AD+ P L+W+DP G++R    ++ +   I+  +++ER+ 
Sbjct  207   ESREFFDCMNKVLELAGTPNIADYLPYLKWMDPAGMKRNMTKNLGRTMKISSKFIQERLN  266

Query  1047  SMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAM  1226
             +  AG   EKK D++DVLL+Y GD  +GP R + + IN+I+ EMF AG++TT+ ++EW  
Sbjct  267   NRKAGKFQEKK-DFLDVLLEYEGDGKDGPDRITEKNINIIITEMFFAGSETTSISIEWGF  325

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
              ELL +P + +K++ EL  VVG   +++EE  +E +PYL+AV+KETLRLHP LP L+P  
Sbjct  326   AELLRSPHTFKKLREELDRVVG-VNRRVEEKDVENMPYLQAVVKETLRLHPALPLLLPRN  384

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIP  1586
              M++ N LGY IPK TQ+ VN W IGRDPK W+DPL FKPERFL+ N+ ++KG HFE IP
Sbjct  385   TMENTNYLGYDIPKGTQVFVNAWGIGRDPKCWEDPLAFKPERFLQSNV-EYKGQHFELIP  443

Query  1587  FGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKA  1766
             FGSGRR+C   PLA R++ L L +++ SFDW LG G++P  +D +ER+G+TLRK  PL  
Sbjct  444   FGSGRRICVGFPLAHRVVHLTLATLVQSFDWDLGPGVKPEDIDREERLGLTLRKKNPLFI  503

Query  1767  IP  1772
             IP
Sbjct  504   IP  505



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   442 bits (1137),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 309/474 (65%), Gaps = 8/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP++GNIF LG  PH +  +L  K+GP++ L LG ++T+VI S +AA E+FK+H
Sbjct  38    PPGPPAWPIIGNIFDLGANPHQNLYKLGFKYGPVLWLRLGYINTMVIQSAKAAEELFKHH  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+    RK+ ++       + +L   +Y  HWR  RR  T E     R++    +R KCI
Sbjct  98    DISFCDRKVPQSFTARNYCKAALALGRYDSHWRFHRRFVTLELMTNKRINETAVLRQKCI  157

Query  726   DHMVRYMREAGNSGTA-----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D M+RY+ E  ++  A      + +  + F+MSFNLIGNL  S+DLL+  SE G +FF  
Sbjct  158   DKMIRYIDEDASAARARGESGELVISHYVFVMSFNLIGNLALSRDLLNSHSEEGTEFFDA  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K ME+ GKPN+ADF P L+ LDPQ +++  + ++ +  DI   ++KER+E       +
Sbjct  218   MDKAMEWGGKPNLADFLPFLQGLDPQRVKKNMEQYLGRTIDIVERFVKERIEEKKL-MKE  276

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                 D++D LL+++GD +E P   S+ ++ +IL E+F  GT+TT+ TLEW M EL  +P 
Sbjct  277   RDTSDFLDALLEFKGDAIEEPDAISTHSMLIILLEIFFGGTETTSGTLEWVMAELFRSPE  336

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S+++V+ EL  V+ G  +K+ E  I++LPYL+AVIKE +RLHP LP LVP   M+    +
Sbjct  337   SMRRVKEELNQVI-GPHRKVVESDIDQLPYLQAVIKEGMRLHPVLPLLVPRNTMEDTTFM  395

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
              Y+I K+TQ+ VN WAIGRDP  W+DPL FKPERFL  N+ D+KG +FE +PFGSGRR+C
Sbjct  396   EYFIAKDTQVFVNAWAIGRDPDAWEDPLSFKPERFLGSNI-DYKGQNFELLPFGSGRRIC  454

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               +PLA R+L LAL S+LH FDW LG    P  +DM ER+GIT+RK  P+KAIP
Sbjct  455   VGIPLAHRVLHLALASLLHCFDWELGSNSTPESIDMNERLGITVRKLVPMKAIP  508



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   442 bits (1136),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 222/464 (48%), Positives = 311/464 (67%), Gaps = 7/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRK  569
             + GN+F LG  PH + +EL  K GP++ L LG+ +T+ + S +AA E FKNHD+  A R 
Sbjct  45    IFGNMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQSAKAASEFFKNHDLSFANRT  104

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
             I EA +    ++GSL  A YG HWR+LRRL T +  V  R++    VR KC D++  ++ 
Sbjct  105   INEACRVYDYHKGSLALAPYGSHWRVLRRLMTVDMVVNKRINETAFVRRKCFDNLQLWIE  164

Query  750   EAGNSGTA--AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKP  923
             E  +       + V RF FLM+FNL+GNLM S+DL+DP+S  G +FF     +ME+ G  
Sbjct  165   EEASKLKEGHGVHVARFVFLMTFNLLGNLMLSRDLVDPKSNEGLEFFKAMNGLMEWNGAA  224

Query  924   NVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLL  1103
              +AD+FP LRWLDPQG++R  +  + KA  IA  ++KERME+   G   EK +D++D+LL
Sbjct  225   YMADYFPWLRWLDPQGLKRKMKKDLGKAIQIASKFVKERMEARGVG--REKTRDFLDLLL  282

Query  1104  QYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRS  1283
             ++ G+ ++ P + S   +N+ + E+F A ++TT+ST EWAMTELL NP +L K +AEL  
Sbjct  283   EFEGNGIDEPDKISEHDLNIFILEIFMASSETTSSTTEWAMTELLCNPETLMKAKAELTQ  342

Query  1284  VVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQIL  1463
             V+ G  +K+EE  I+ LPYL+ +IKETLRLHPP+PFL+P  AMD    +GY+IPK+TQ+ 
Sbjct  343   VI-GPNRKIEESDIDNLPYLQGIIKETLRLHPPVPFLLPRKAMDDTKFMGYFIPKDTQVF  401

Query  1464  VNVWAIGRDPKTWKD-PLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             VN +AIGRDP  W D P  FKPERF+   + D+KG H+E IPFG+GRRMC  +PLA RML
Sbjct  402   VNAYAIGRDPDVWVDEPNSFKPERFIGSKI-DYKGQHYELIPFGAGRRMCAGVPLAHRML  460

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
              L LG +LH FDW L   +    MD K+++G ++RK+ PL A+P
Sbjct  461   HLTLGMLLHQFDWSLDGNVTRDTMDWKDKLGASMRKSVPLLAVP  504



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score =   442 bits (1136),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 307/466 (66%), Gaps = 9/466 (2%)
 Frame = +3

Query  390   VVGNIFQL-GWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMFKNHDVVLAG  563
             + GN+F L G  P+   + L  K+GPI+ L +G SM+T+++ + +AA E+FKNHDV  A 
Sbjct  44    IFGNMFDLAGSEPYKKAANLKQKYGPIVWLKIGPSMNTIIVQTAQAAAELFKNHDVTFAD  103

Query  564   RKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRY  743
             R I +       ++ S+  A YG +WRMLRR+CT E FV  R++    +R K +D M+++
Sbjct  104   RYIVDVNLAHNNHQASMALAPYGNYWRMLRRICTVEMFVNKRINETVQIRRKSMDKMLQW  163

Query  744   MREAGN---SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFA  914
             + +  N   +  + I+V R+ FL SFN++GNL+ SKDL DP SE+G++FF     +M++A
Sbjct  164   IEKQANLVNTNRSGIEVTRYVFLASFNMLGNLILSKDLADPESEKGSEFFKAMTGIMQWA  223

Query  915   GKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMD  1094
             G PN++D F  L+  D Q +R+  +  + KA +I   YLKER+E    GG  EK+KD +D
Sbjct  224   GVPNISDIFSCLKRFDIQDLRKKMEHDMGKAKEITFGYLKERIEEGQKGG--EKRKDLLD  281

Query  1095  VLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAE  1274
             VLL + G   +  A+ S   I + + E F AGT+TT+S++E A+TELL NP ++ KV+AE
Sbjct  282   VLLDFEGSGKDEQAKLSEHEITMTIMEFFLAGTETTSSSVELALTELLRNPEAMAKVKAE  341

Query  1275  LRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKET  1454
             +  VVG   +K EE  I+ LPY++AV+KE+LRLHPPLPFL+P  A      +GY +PK T
Sbjct  342   ISEVVG-PNRKFEESDIDNLPYMQAVLKESLRLHPPLPFLIPRRATQDTKFMGYDVPKGT  400

Query  1455  QILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASR  1634
             Q+LVNVW+IGRDP+ W DP +FKPERFL  N+ D KG ++E IPFG+GRRMC  L L  R
Sbjct  401   QVLVNVWSIGRDPECWNDPFEFKPERFLGSNV-DVKGQNYELIPFGAGRRMCVGLSLGHR  459

Query  1635  MLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             M+  A GS+LH F+W L   + P  M+M E MG+T RK  PLK IP
Sbjct  460   MMHFAFGSLLHEFNWELPDNVTPKSMNMDESMGVTARKKQPLKVIP  505



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   441 bits (1134),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 214/472 (45%), Positives = 304/472 (64%), Gaps = 6/472 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
              PPGP   P+ GN+F+LG  P+   + L  K+GP++ L LGS  T+V+ + +A+ E+FKN
Sbjct  35    FPPGPPGLPIFGNMFELGTEPYKKMAVLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKN  94

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  A R I +  +     +GSL  A YG  WR  RR+CT E FV  ++     VR KC
Sbjct  95    HDISFANRVIPDVNQAHSYYQGSLAIAPYGPFWRFQRRICTIEMFVHKKISETEPVRRKC  154

Query  723   IDHMVRYMREAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             +D+M++++ +  NS    + I+V RF FL SFN++GNL+ SKDL D  SE  ++FF    
Sbjct  155   VDNMLKWIEKEANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEFFIAMK  214

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
             ++ E++G  NV+D FP L+  D Q +R+     + KA +I   +LKER E    G   EK
Sbjct  215   RINEWSGIANVSDIFPFLKKFDLQSLRKKMARDMGKAVEIMSMFLKEREEERKKG--TEK  272

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
              KD++DVLL+++G   + PA+ S   I + + EMF AGT+TT+S++EWA+TELL +P ++
Sbjct  273   GKDFLDVLLEFQGTGKDEPAKLSEHEIKIFVLEMFLAGTETTSSSVEWALTELLRHPEAM  332

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              KV+ E+   +    +K E+  IE LPY++AV+KE+LRLHPPLPFL+P   +     +GY
Sbjct  333   AKVKTEISQAI-EPNRKFEDSDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGY  391

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK+TQ+LVN WAIGRDP+ W DP+ FKPERFL   + D KG H+  IPFG+GRRMC  
Sbjct  392   DVPKDTQVLVNAWAIGRDPECWDDPMSFKPERFLGSKI-DVKGQHYGLIPFGAGRRMCVG  450

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LPL  RM+  ALGS+L  F+W L  G+ P  ++M   MG+T RK   LK IP
Sbjct  451   LPLGHRMMHFALGSLLREFEWELPDGVSPKSINMDGSMGVTARKRDSLKVIP  502



>gb|KDO61009.1| hypothetical protein CISIN_1g010359mg [Citrus sinensis]
Length=512

 Score =   441 bits (1135),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 240/474 (51%), Positives = 318/474 (67%), Gaps = 9/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN F LG  PH S  +L +K+GP++ L LGS++TVVI S +AA EMFKN 
Sbjct  38    PPGPPAWPIFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQ  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D +   RK+ +A+      +GSL   +YG +WR+LRRLC +E  V  R++    +R KCI
Sbjct  98    DHIFCDRKVPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCI  157

Query  726   DHMVRYMR----EAGNSG-TAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D  ++ +     EA   G +  +D+  + FLM+F+LIGNL  S++LL+ +S++  +FF  
Sbjct  158   DKTIQCIENDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAA  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K ME+ GKPN++D+FP LR LDPQGIRR     +     I   Y+KER++      ND
Sbjct  218   MVKCMEWVGKPNMSDYFPFLRSLDPQGIRRNMMKDMGCVLQIISGYVKERLDEQKL-LND  276

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++D L+QY GD  EGP R S + IN+I+ EMF AG++TT+ST+EWA+ ELL NP 
Sbjct  277   E-KKDFLDGLIQYEGDGKEGPDRLSDQNINIIVTEMFLAGSETTSSTMEWAVAELLRNPE  335

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +++K + EL  VV G  +K+EE  I +LPY KAV+KETLRLHPP P L+P  AM     +
Sbjct  336   AMRKTKDELDRVV-GRNRKVEEKDIVELPYFKAVLKETLRLHPPAPLLLPRNAMTDTEFM  394

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK+TQ+ VNVWAIGRDP  W++PL FKPERFL  N+ DFKG HFE IPFGSGRR+C
Sbjct  395   GYQIPKDTQVFVNVWAIGRDPDCWENPLSFKPERFLGSNV-DFKGQHFELIPFGSGRRIC  453

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               + LA R+L L L S+LH FDW LG    P  +DM ER GI +RK  PL+ IP
Sbjct  454   VGISLADRLLHLGLASLLHHFDWELGQDATPESLDMNERFGIAVRKLVPLRVIP  507



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score =   441 bits (1134),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 216/476 (45%), Positives = 312/476 (66%), Gaps = 8/476 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMF  536
             LPPGP   P+ GN F L G  P+   + L  K+GPI+ L +G SM+ +VI +  ++ E+F
Sbjct  36    LPPGPNGLPIFGNXFDLAGSEPYKKIASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELF  95

Query  537   KNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             K HDV  + R I +        +GS+  A YG +WR  RR+CT E FV  R++    +R 
Sbjct  96    KYHDVTFSDRNIVDVNLAHNFYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTLIRQ  155

Query  717   KCIDHMVRYMREAGNSG---TAAIDVGRFFFLMSFNLIGNLMFSKDLL-DPRSERGAKFF  884
             K ++ M+ ++ +  +SG      I+V R+ FL SFN++GN++ SKDL+ DP SE+G+ FF
Sbjct  156   KSMNRMLGWIEKKASSGGGVIEGIEVTRYVFLASFNMLGNMILSKDLVTDPESEKGSMFF  215

Query  885   YHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGG  1064
                  +ME++G PN++D FP L+  D QG+R+  +  + KA +I  ++++ER+E    G 
Sbjct  216   NAMMGIMEWSGVPNISDIFPCLKMFDLQGLRKKMKRDMGKAIEIIKNFIEERIEERKKGE  275

Query  1065  NDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHN  1244
              ++  KD +DVLL + G     PA+ S   I +I+ EMF AGT+TT+S++EWA+TELL +
Sbjct  276   ENKSIKDLLDVLLDFEGSGKGEPAKLSEHEITIIILEMFLAGTETTSSSVEWALTELLRH  335

Query  1245  PSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCN  1424
             P ++ KV+ E+  V+ G  KK +E HI+ LPY++A++KE+L LHPPLPFL+P  A+    
Sbjct  336   PRAMTKVKLEISQVI-GPNKKFKERHIDSLPYMQAILKESLCLHPPLPFLIPRKAIQDTK  394

Query  1425  MLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRR  1604
              +G+ +PK TQ+LVNVWAIGRDP+ W DP +FKPERFLE  + D KG + E IPFG+GRR
Sbjct  395   FMGHDVPKGTQVLVNVWAIGRDPECWNDPFEFKPERFLESKV-DVKGQNHELIPFGAGRR  453

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             MC  LPL  RM+  A GS+LH FDW L + + P  ++M+E MGIT RK  PLK IP
Sbjct  454   MCAGLPLGHRMMHFAFGSLLHEFDWELPNNVSPKSINMEESMGITARKKQPLKVIP  509



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   441 bits (1134),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 216/464 (47%), Positives = 300/464 (65%), Gaps = 7/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV-VISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P+   S L  K+GP++ L +G+ + + V+ + +AA E+FKNHD   A R
Sbjct  44    IFGNMFELGTEPYKKMSALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADR  103

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
              + +        +GS   A+YG  WR  RR+CT E FV  ++     VR KC+D+M++++
Sbjct  104   PLVDVNSAHNYYQGSPALARYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWI  163

Query  747   REAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +A NS    + I+V RF FL SFN++GNL+ SKDL DP SE  ++FF     +ME++G 
Sbjct  164   EKAANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMEWSGI  223

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
             PNV+D FP LR  D Q +R+     + KA +I    LKER E    G   EK+KD++DVL
Sbjct  224   PNVSDIFPFLRKFDLQSLRKKMTRDMGKAMEIMSMLLKEREEERKKGM--EKRKDFLDVL  281

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I V + E+F AGT+TT S++EWA+TELL +P ++ +V+ E+ 
Sbjct  282   LEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTNSSVEWALTELLRHPQAMAEVKTEIS  341

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              VVG    K EE  IE LPY++AV+KE+LRLHPPLPFL+P   +     +GY + K T++
Sbjct  342   KVVG-LNNKFEESDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGYDVLKGTRV  400

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN WAIGRDP+ W DP+ FKPERFL   + D KG H+E IPFG+GRRMC  LPL  RM+
Sbjct  401   LVNAWAIGRDPECWDDPMSFKPERFLGSKL-DVKGQHYELIPFGAGRRMCVGLPLGHRMM  459

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH FDW L  G+ P  ++M E MG+T RK   LK IP
Sbjct  460   QFALGSLLHEFDWELPDGVSPKSINMDESMGVTARKRDSLKVIP  503



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score =   440 bits (1132),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 230/476 (48%), Positives = 329/476 (69%), Gaps = 8/476 (2%)
 Frame = +3

Query  360   ALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             + PPGP+ WP+ GNIF LG  PH +   L  +HGP++ L LG+++T+V+ S +AA E+FK
Sbjct  35    STPPGPQGWPIFGNIFDLGTLPHQTLYRLRPQHGPVLWLQLGAINTMVVQSAKAAAELFK  94

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             NHD+  + R +   +     ++GS+   +YG +WRM+R++C +E  V  R++ +  +R K
Sbjct  95    NHDLSFSDRNVPFTLTAHNYDQGSMALGKYGPYWRMIRKVCASELLVNKRINEMGSLRRK  154

Query  720   CIDHMVRYMRE----AGNSGTAA-IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFF  884
             C+D M+R++ E    +G  G A  +++  F F M+FNLIGN+  S+D++D +S+ G +FF
Sbjct  155   CVDDMIRWIEEDAAKSGAEGRAGEVELPHFLFCMAFNLIGNITLSRDVVDIKSKDGHEFF  214

Query  885   YHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGG  1064
                  V+E+AG+PN+ADFFPLL+ LDP G+ R     + +A ++   ++KER E   +G 
Sbjct  215   QAMNGVVEWAGRPNIADFFPLLKRLDPLGMMRNMVRDMGQALNLIARFVKERDEERQSGM  274

Query  1065  NDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHN  1244
               E K+D++DVLL+ R D  EGP   S   + +I+ EMF AG+DTT+STLEWAMTELL  
Sbjct  275   VRE-KRDFLDVLLECRDDEKEGPHEMSDNKVKIIVLEMFFAGSDTTSSTLEWAMTELLRR  333

Query  1245  PSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCN  1424
             P S++K Q EL  VV G   K+EE  I++L YL+AV+KETLRLHPP+P L+P  A+   N
Sbjct  334   PESMRKAQEELDRVV-GPHGKVEESDIDQLLYLQAVVKETLRLHPPIPLLLPRNALQDTN  392

Query  1425  MLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRR  1604
              +GY++PK TQ+ VN WAIGRDP  WK+PL FKP+RFL  N+ D+KG +FEFIPFGSGRR
Sbjct  393   FMGYFVPKNTQVFVNAWAIGRDPDAWKEPLSFKPDRFLGSNL-DYKGQNFEFIPFGSGRR  451

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +C  + LA+++LPLAL S+LH FDW LG G+ P  +DM ER+G+ +RK  PLK IP
Sbjct  452   ICIGISLANKLLPLALASLLHCFDWELGGGVTPETIDMNERVGMAVRKLIPLKPIP  507



>ref|XP_011094433.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/468 (45%), Positives = 310/468 (66%), Gaps = 9/468 (2%)
 Frame = +3

Query  393   VGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKI  572
             VGNIF LG  PH +F +L +K+GP++ L LG+++T+V+ S E A E+FK  D+  A RK 
Sbjct  45    VGNIFDLGEIPHQTFYQLQAKYGPVIWLKLGAVNTMVVQSAETATELFKKCDLPFADRKA  104

Query  573   YEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMRE  752
              +++     ++GS+    Y ++WR LRR+C TEF V  R+DA   +R  C++  +++++E
Sbjct  105   PDSLTALDYHQGSVAIGAYREYWRTLRRICMTEFLVHKRVDASIPIRRNCLEKTIKWIKE  164

Query  753   -----AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAG  917
                    N G+  I + RF FL SFN+IGNLM S+++++ + ++  +FF      +E+ G
Sbjct  165   DVEKSKKNGGSGEIQLDRFLFLNSFNIIGNLMLSREVMESKLDKAGEFFDAFVLFLEWCG  224

Query  918   KPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDV  1097
             KPN+AD F  L+W DPQ IR+ T+ ++ +    A + +KER++   +G   E + D++D 
Sbjct  225   KPNMADSFQFLKWADPQRIRKNTEKYLERLLGFASEIVKERIQEKQSGKVKE-RNDFLDA  283

Query  1098  LLQYRGDL-VEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAE  1274
             LL    D+  EG  + S + + ++L EMF  GT+TT+ T+EW M ELL +PSS++K+Q E
Sbjct  284   LLDEEDDIKAEGADKLSVKNVTIVLLEMFFGGTETTSGTIEWGMAELLRHPSSMKKIQEE  343

Query  1275  LRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKET  1454
             +  VVG + + +EE  + KLPYL+A +KE LRL+PPL  L+P  AM+    +GY +PK T
Sbjct  344   IDRVVGRS-RMVEESDLNKLPYLQATVKEILRLYPPLQMLLPRKAMEDTEFMGYVVPKNT  402

Query  1455  QILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASR  1634
             QILVN WAI RDP  W DPL FKPERFLE ++ D+KG HF+ IPFGSGRR C  + L  R
Sbjct  403   QILVNAWAIHRDPAAWSDPLSFKPERFLESDI-DYKGQHFQMIPFGSGRRSCLGMTLGHR  461

Query  1635  MLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             M+ L+L +++H+F+W LG G+ P  +DMKE +G+TLRK  PLK IP P
Sbjct  462   MVCLSLATLVHAFEWKLGDGLTPETLDMKEMVGLTLRKKVPLKVIPTP  509



>ref|XP_006481913.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=512

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 239/474 (50%), Positives = 317/474 (67%), Gaps = 9/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN F LG  PH S  +L +K+GP++ L LGS++TVVI S +AA EMFKN 
Sbjct  38    PPGPPAWPIFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQ  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D +   RK+ +A+      +GSL   +YG +WR+LRRLC +E  V  R++    +R KCI
Sbjct  98    DHIFCDRKVPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCI  157

Query  726   DHMVRYMR----EAGNSG-TAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D  ++ +     EA   G +  +D+  + FLM+F+LIGNL  S++LL+ +S++  +FF  
Sbjct  158   DKTIQCIENDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAA  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K ME+ GKPN++D+FP LR LDPQGIRR     +     I   Y+KER++      ND
Sbjct  218   MVKCMEWVGKPNMSDYFPFLRSLDPQGIRRNMMKDMGCVLQIISGYVKERLDEQKL-LND  276

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++D L+QY GD  EGP R S + IN+I+ EMF AG++TT+ST+EWA+ ELL NP 
Sbjct  277   E-KKDFLDGLIQYEGDGKEGPDRLSDQNINIIVTEMFLAGSETTSSTMEWAVAELLRNPE  335

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +++K + EL  VV G  +K+EE  I +LPY KAV+KETLRLHPP P L+P  AM     +
Sbjct  336   AMRKTKDELDRVV-GRNRKVEEKDIVELPYFKAVLKETLRLHPPGPLLLPRNAMKDTEFM  394

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK+TQ+ VNVW IGRDP  W++PL FKPERFL  N+ DFKG HFE IPFGSGRR+C
Sbjct  395   GYQIPKDTQVFVNVWTIGRDPDCWENPLSFKPERFLGSNV-DFKGQHFELIPFGSGRRIC  453

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               + LA R+L L L S+LH FDW LG    P  +DM ER GI +RK  PL+ IP
Sbjct  454   VGISLADRLLHLGLASLLHHFDWELGQDATPESLDMNERFGIAVRKLVPLRVIP  507



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/483 (44%), Positives = 314/483 (65%), Gaps = 8/483 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             R + +    PP P  WP++GNIF LG  PH +  +L  K+GP++ L LG ++T+VI S +
Sbjct  29    RPIHDAKQTPPAPPGWPIIGNIFDLGANPHQNLYKLGIKYGPVLWLRLGYINTMVIQSAK  88

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
             AA E+F++HD+    RK+ ++      ++ +L   +Y  HWR  RR  T E     R++ 
Sbjct  89    AAEELFRHHDISFCDRKVPQSFTACNYSKAALALGRYDSHWRFHRRFVTLELMTNKRINE  148

Query  699   LRGVRTKCIDHMVRYMREAGNSGTA-----AIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
                +R KCID M++Y+ E  ++  A      + +  + F+MSFNLIGNL FS+DLL+  S
Sbjct  149   TAVLRQKCIDKMIQYIEEDASAARARGESGELVISHYVFVMSFNLIGNLAFSRDLLNSHS  208

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             E G +FF    KVME+ GKPN+ADF P L+ LDPQ +++  + ++ +  D+   ++KER+
Sbjct  209   EEGTEFFDAMDKVMEWGGKPNLADFLPFLQELDPQRVKKNMEQYLGRTVDVVERFVKERI  268

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             E        E  +D++D LL+++GD  E P   S  ++ +I+ E+F  GT+TT+ TLEWA
Sbjct  269   EEKKLMKERE-TRDFLDALLEFKGDAKEEPDSISIHSMLIIILEIFFGGTETTSGTLEWA  327

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             M EL  +P ++++V+ EL  V+ G  + + E  I++LPYL+AVIKE +RLHP LP L+P 
Sbjct  328   MAELFRSPETMRRVKEELNKVI-GPNRTVMESDIDRLPYLQAVIKEAMRLHPVLPLLIPR  386

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
                +    +GY+IPK+TQ+ VN WAIGRDP  W+DPL FKPERFL  N+ D+KG +F+ +
Sbjct  387   NTTEDTTFMGYFIPKDTQVFVNAWAIGRDPDAWEDPLSFKPERFLGSNI-DYKGQNFQLL  445

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFGSGRR+C  +PLA R+L LAL S+LH FDW LG    P  +DM ER+GI++RK  P+K
Sbjct  446   PFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTPETIDMNERLGISVRKLVPMK  505

Query  1764  AIP  1772
             AIP
Sbjct  506   AIP  508



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 234/477 (49%), Positives = 322/477 (68%), Gaps = 7/477 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WPV G++F LG TPH + +EL  K+GP++ L LGS++T+ +   + A E FKN
Sbjct  32    LPPGPLGWPVFGHMFNLGGTPHRAIAELEQKYGPVVWLKLGSINTMALLKAKPASEFFKN  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  A R I E M     N GSL  A YG  WR+LRR+CT E FV+ R+    G+R KC
Sbjct  92    HDLSFADRTIVETMTAHGYNYGSLALAPYGSRWRVLRRICTVEMFVSKRISETEGIRRKC  151

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +D M+ ++ + GN    AI VGR+ FL SFN++GNLM S+DL+DP SE+G +F+    KV
Sbjct  152   VDDMLSWIEKDGNGN--AIPVGRYAFLASFNMLGNLMMSRDLVDPESEKGLEFYDAMKKV  209

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME++ +PNV+D FP +RW+D QG++R     +  A  I   ++KER++    G  + K+K
Sbjct  210   MEWSARPNVSDLFPWIRWIDLQGLKRRANRDMGTAMGIVSGFVKERIQQRKNG--EWKEK  267

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL+     VE   + +   I + + E+F AGT+TT++++EWAM+ELL NP ++ K
Sbjct  268   DFLDVLLESESCKVES-EKLTETEIIIFILEIFLAGTETTSTSIEWAMSELLRNPETMAK  326

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             ++ E+ SVVG  E+ LE  HI+ LPYL+AVIKETLRLHPPLPFL+P  A+   N +GY +
Sbjct  327   LKDEISSVVGLGERFLES-HIDNLPYLQAVIKETLRLHPPLPFLLPRRAIQDTNFMGYCV  385

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK TQ+ VNVWAIGRD + W+D + FKPERFL  N+ D+KG  FE IPFG+GRRMC  L 
Sbjct  386   PKNTQVFVNVWAIGRDQEYWEDAVCFKPERFLGTNV-DYKGQSFELIPFGAGRRMCAGLA  444

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG*C  1793
             L  RM+   LGS++H F+W L   + P  +DM ERMGIT+ K  PLKA+P  +   C
Sbjct  445   LGHRMIHFVLGSLVHEFEWELESSVTPDAVDMSERMGITVGKLKPLKAVPRKHAREC  501



>ref|XP_006430323.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
 gb|ESR43563.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
Length=512

 Score =   439 bits (1129),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 239/474 (50%), Positives = 318/474 (67%), Gaps = 9/474 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP+ GN F LG  PH S  +L +K+GP++ L LGS++TVVI S +AA EMFKN 
Sbjct  38    PPGPPAWPIFGNFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQ  97

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D +   RK+ +A+      +GSL   +YG +WR+LRRLC +E  V  R++    +R KCI
Sbjct  98    DHIFCDRKVPDALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCI  157

Query  726   DHMVRYMR----EAGNSG-TAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D  ++ +     EA   G +  +D+  + FLM+F+LIGNL  S++LL+ +S++  +FF  
Sbjct  158   DKTIQCIENDVAEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAA  217

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
               K ME+ GKPN++D+FP LR LDPQGIRR     +     I   Y+KER++      ND
Sbjct  218   MVKCMEWVGKPNMSDYFPFLRSLDPQGIRRNMMKDMGCVLQIISGYVKERLDEQKL-LND  276

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E KKD++D L++Y GD  EGP R S + IN+I+ EMF AG++TT+ST+EWA+ ELL NP 
Sbjct  277   E-KKDFLDGLIKYEGDGKEGPDRLSDQNINIIVTEMFLAGSETTSSTMEWAVAELLRNPE  335

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +++K + EL  VV G  +K+EE  I +LPY KAV+KETLRLHPP P L+P  AM     +
Sbjct  336   AMRKTKDELDRVV-GRNRKVEEKDIVELPYFKAVLKETLRLHPPAPLLLPRNAMTDTEFM  394

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY IPK+TQ+ VNVWAIGRDP  W++PL FKPERFL  N+ DFKG HFE IPFGSGRR+C
Sbjct  395   GYQIPKDTQVFVNVWAIGRDPDCWENPLSFKPERFLGSNV-DFKGQHFELIPFGSGRRIC  453

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               + LA R+L L L S+LH FDW LG    P  +DM ER GI +RK  PL+ IP
Sbjct  454   VGISLADRLLHLGLASLLHHFDWELGQDATPESLDMNERFGIAVRKLVPLRVIP  507



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   439 bits (1128),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 211/464 (45%), Positives = 307/464 (66%), Gaps = 6/464 (1%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P+   + L  K+GP++ L +G S++++V+ + +AA ++FKNHD+  A R
Sbjct  44    IFGNMFELGTLPYKKVAVLKQKYGPVLWLKIGPSINSMVVQTAQAAADLFKNHDISFADR  103

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
                +  +     +GS+   QYG  WR  RR+CT E FV  +++    VR KC++ MV+++
Sbjct  104   CPVDVNQAHNYYQGSMALGQYGSFWRFQRRICTVEMFVNKKINETVSVRRKCVNDMVKWI  163

Query  747   REAGN--SGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +  N     + I++ RF FL SFN++GNL+FSKDL DP SE  + FF     +ME++G 
Sbjct  164   EKEANVVKKGSGIELTRFVFLASFNMLGNLIFSKDLADPDSEEASDFFNAMKGIMEWSGI  223

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
             PNV+D FP L+  D Q +R+     + KA +    +LKER E    GG +++ KD++DVL
Sbjct  224   PNVSDIFPSLKRFDLQSLRKKMTRDMGKAMEFGSAFLKEREEERIKGG-EKRDKDFLDVL  282

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I +++ EMF AG++TT+S++EWA+TELL +P ++ KV+ EL 
Sbjct  283   LEFEGTGKDEPAKLSEHEIKILVMEMFLAGSETTSSSVEWALTELLRHPEAMAKVKEELS  342

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              VVG   KK EE  I+ LPY++A++KE+LRLHPPLPFL+P   +     +GY IPK TQ+
Sbjct  343   KVVG-PNKKFEESDIDNLPYMQAILKESLRLHPPLPFLIPRSTIQDTKFMGYDIPKGTQV  401

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVNVWAIGRDP+ W DP+ FKPERFL   + D KG ++E +PFG+GRRMC  LPL  RM+
Sbjct  402   LVNVWAIGRDPECWDDPMSFKPERFLGSKI-DVKGQNYELMPFGAGRRMCVGLPLGHRMM  460

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH FDW L  G+ P  ++M E +G+T RK   LK IP
Sbjct  461   HFALGSLLHEFDWELPDGVSPKSINMDESLGVTARKRHSLKVIP  504



>gb|ABR17519.1| unknown [Picea sitchensis]
Length=512

 Score =   439 bits (1128),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 218/477 (46%), Positives = 299/477 (63%), Gaps = 12/477 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+ WP+VGN+FQLG  PH S   LA+K+GP+M+L LG  +TVV+SS   A+E+ K 
Sbjct  36    LPPGPQGWPIVGNLFQLGKKPHESLFRLATKYGPLMSLSLGMKTTVVVSSPSMAKEVLKT  95

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             H  V AGR + +A +    ++ S +  QYG  WR LRR+  TE F   RLDAL+ +R   
Sbjct  96    HGHVFAGRIVTQAARSLSHDKSSFLLCQYGSRWRTLRRISNTELFSVKRLDALQDLRRVQ  155

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  M+  + E    G+  +++G   F  +FNLIGN+ F KD+ DP             K+
Sbjct  156   VRGMIHQIFENSVKGSGCVNIGHIAFHSAFNLIGNMAFGKDMFDPHFRASEDLKDAISKL  215

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM--ESMNAGGNDEK  1076
             M     PN+AD+FP L++LD QG+ R T  +  KA+D+   ++++R+     N+   D+ 
Sbjct  216   MVLHTAPNLADYFPCLQFLDLQGVYRNTGIYRKKAYDVMDKFIEDRLAKRGKNSDRTDDG  275

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
             KKD +DVLL  R D       F+   I   L +MF AG+DTT  T+EWA+ EL+ NP  L
Sbjct  276   KKDLLDVLLDMRSD------EFTLTDIRGYLNDMFVAGSDTTAVTIEWAIAELVRNPEKL  329

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
             ++ QAEL  V+ G  ++LEE   E+LPYL+AV+KE  RLHP  P LVPH A     + G+
Sbjct  330   KRAQAELEEVI-GLNRRLEESDTERLPYLRAVVKEVFRLHPAGPLLVPHRADGRFEIAGF  388

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMA---DFKGHHFEFIPFGSGRRM  1607
              IPK +++LVNVW +GRDP+ W +PLKF PERF++  M    D+KG  FE IPFG+G RM
Sbjct  389   VIPKHSRVLVNVWGMGRDPQIWNEPLKFVPERFIDDEMCGQMDYKGKDFELIPFGAGTRM  448

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             C  LPLASRM+ L LGS++HSF+W    GM   QMDM E+ G+ L+KA PL+AI  P
Sbjct  449   CVGLPLASRMVHLVLGSLIHSFEWAPPKGMSAEQMDMTEKFGLALQKAVPLEAIATP  505



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   437 bits (1124),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 216/464 (47%), Positives = 300/464 (65%), Gaps = 11/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLG-SMSTVVISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P+   S L  K+GP++ L LG S + +V+ + EAA E+FKNHD   A R
Sbjct  44    IFGNMFELGKEPYKKMSALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADR  103

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
              I +  +     +GSL   +YG  WR  RR+CT E FV  ++     +R KC+D+M++++
Sbjct  104   PIVDVNQAHNYFQGSLAVGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWI  163

Query  747   REAGNSGTAA--IDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +  NS      I+V RF FL SFN++GNL+ SKDL DP SE  ++FF     +ME++G 
Sbjct  164   EKTVNSAEKGNGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMEWSGI  223

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              NV+D FP LR  D Q +R+     + KA +I    LKER + M      EK KD++DVL
Sbjct  224   ANVSDIFPFLRMFDLQKLRKKMTRDMGKAMEIMSMLLKERKKGM------EKMKDFLDVL  277

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I V++ EMF AG++TT+S++EWA+TELL +P ++ +V+ E+ 
Sbjct  278   LEFEGTGKDEPAKLSEHEIKVLIVEMFLAGSETTSSSVEWALTELLRHPQAMAEVKTEIS  337

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
               VG +  + EE  IE LPY++AVIKE+LRLHPPLPFL+P   +   N +GY + K TQ+
Sbjct  338   KAVG-SNNRFEESDIENLPYMQAVIKESLRLHPPLPFLIPRETIHDTNFMGYDVLKGTQV  396

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN WAIGRDP+ W DP+ FKPERFL   + D KG H+E IPFG+GRRMC  LPL  RM+
Sbjct  397   LVNAWAIGRDPECWDDPMSFKPERFLGSKI-DVKGQHYELIPFGAGRRMCVGLPLGHRMM  455

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH F+W L  G+ P  ++M E MG+T RK   LK IP
Sbjct  456   HFALGSLLHEFEWELPDGVSPKSINMDESMGVTARKRDSLKVIP  499



>gb|KDP27489.1| hypothetical protein JCGZ_20024 [Jatropha curcas]
Length=510

 Score =   434 bits (1115),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 211/459 (46%), Positives = 301/459 (66%), Gaps = 12/459 (3%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             NIF LG   H    EL  K+GP++ L +G + TVVI S +A  E+FKNHD     R +  
Sbjct  47    NIFDLGTMAHRILYELKFKYGPVLRLRIGLVDTVVIQSAKAVMELFKNHDASFCDRTVPC  106

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
              +      EGS+   ++G +WR +RR+C  E     R++    +R KCID M+R + +  
Sbjct  107   VLTSHNYKEGSIAVGRFGPYWRTIRRICAIELLANRRINETVQIRRKCIDVMIRSIEDDM  166

Query  759   NSGTAAIDVGR-----FFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKP  923
              +G A+ + G+     + F+M+FNLIGNLM SKDL D + + G +FF    KVM +AG P
Sbjct  167   AAGKASGESGKVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVMVWAGTP  226

Query  924   NVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLL  1103
             N+ADF P L+WLDPQG++R     + +A DI   ++KER+E    G   +  KD++DVLL
Sbjct  227   NLADFLPFLQWLDPQGLKRNMSRDMGRAKDIVAGFVKERIEDYKMG-KKKANKDFLDVLL  285

Query  1104  QYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRS  1283
             ++ GD  E   +     + +I+ EMF AG++TT+ST+EW M EL  NP +L+KV+ EL +
Sbjct  286   EFEGDGKEWEGKIPYDKMIIIILEMFFAGSETTSSTMEWVMAELFSNPEALRKVKDELDA  345

Query  1284  VVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQIL  1463
             VVG   +K+EE  I+KLPYL+AVIKET+RLHP +P L+P   ++  N +GY+I K TQ+L
Sbjct  346   VVG-ENRKVEESDIDKLPYLQAVIKETVRLHPVVPLLLPRNTIEDTNFMGYHISKGTQVL  404

Query  1464  VNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLP  1643
             +N WAIGRDP++W+DP+ FKPERFL  N+ D+KG +FE IPFGSGRR+C  + LA R++P
Sbjct  405   INAWAIGRDPESWEDPMNFKPERFLGSNI-DYKGQNFELIPFGSGRRICVGMGLAQRVVP  463

Query  1644  LALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             L + S+LH+F+W L        +DM+ERMGIT++K  PL
Sbjct  464   LGVASLLHNFEWDL----HSQTLDMRERMGITVKKLVPL  498



>gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia serpentina]
Length=493

 Score =   433 bits (1113),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 300/473 (63%), Gaps = 9/473 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++GN+  LG  PH S ++L+ KHGPIM+L LG ++TVV+SS   A+E+ + 
Sbjct  30    LPPGPAPLPIIGNLHMLGDQPHKSLAKLSKKHGPIMSLKLGQITTVVVSSSGMAKEVLQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  + R I  A+      + S++       WR LR+   +  F  +RLDA + +R++ 
Sbjct  90    HDLAFSSRSIPNALHAHNQYQFSVVWLPVASRWRSLRKTLNSNIFSGNRLDANQHLRSRK  149

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             ++ ++ Y R+   +G  A+DVGR  F  S NL+ NL+FSKDL DP S+   +F      +
Sbjct  150   VEELIAYCRKNCQTG-EAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNI  208

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  AGKPN+ D+FP+L  +DPQGIRR    H  K   +    + ER+E   + G    K 
Sbjct  209   MVEAGKPNLVDYFPVLEKVDPQGIRRRMTVHFGKVLKLFDGLVNERLEQRRSRGG---KN  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DVLL    +  E P       I  +  ++F AGTDTT+STLEWAM E+L NP  ++K
Sbjct  266   DVLDVLLT---NSEENPEEIDRTHIERMCLDLFVAGTDTTSSTLEWAMAEMLKNPDKMKK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              QAEL  V+G   K +EE  + +LPYL+ V+KETLR+HPP+PFL+P        + GY +
Sbjct  323   TQAELAEVIG-RGKAIEESDLPRLPYLRCVVKETLRIHPPVPFLIPRRVEQDVEVCGYKV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN W IGRD   W+D L FKPERFLE  + D +G  FE IPFG+GRR+CP LP
Sbjct  382   PKGSQVLVNAWTIGRDEAVWEDALAFKPERFLESEL-DIRGRDFELIPFGAGRRICPGLP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPY  1781
             LA R +PL +GS+L+SF+W L  G+ P  +DM+E+ GITL+KA PL+A+P+P+
Sbjct  441   LALRTVPLMVGSLLNSFNWKLEGGITPKDLDMEEKFGITLQKAHPLRAVPIPF  493



>gb|KCW48764.1| hypothetical protein EUGRSUZ_K02408, partial [Eucalyptus grandis]
Length=443

 Score =   430 bits (1106),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 306/445 (69%), Gaps = 7/445 (2%)
 Frame = +3

Query  423   PHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGN  602
             PH + + L  K+GP++ L LGS+ T+VI S   A E FKNHD+    R I + M+     
Sbjct  2     PHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEYC  61

Query  603   EGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTA---  773
             +GS+  A YG +WR+ RRL T +  V  RL+    ++ KC+D M+ ++ EA ++      
Sbjct  62    KGSIALAPYGTYWRVSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRLG  121

Query  774   -AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLL  950
               + + RF FLM+FNL+GNLM S+DLLDP S+ G++FF     +ME++G   +AD FP L
Sbjct  122   EGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVGSEFFEAMSGLMEWSGHVTIADLFPWL  181

Query  951   RWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEG  1130
             RWL PQG+RR     + KA  IA D+++ER+E    GGND+++ D++DVLL++ G+  + 
Sbjct  182   RWLGPQGLRRKMDRDMGKAMRIASDFVRERIEEKKIGGNDDRR-DFLDVLLEFEGNGKDE  240

Query  1131  PARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKL  1310
             PA+ S + I   + EMF AG +T++ST+EWA+TELL +P+S+ KVQAEL  VVG + +K+
Sbjct  241   PAKLSEKQIKTFILEMFLAGAETSSSTVEWALTELLRDPNSMAKVQAELSRVVG-SNRKV  299

Query  1311  EEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRD  1490
             +E  I++L YL+AV+KETLRLHPPLPFLVP  AM +   +GY IPK TQ+ VN WAIGR+
Sbjct  300   QETDIDQLSYLQAVVKETLRLHPPLPFLVPRKAMANTIFMGYDIPKNTQVFVNSWAIGRE  359

Query  1491  PKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHS  1670
             P  W+DP+ FKPERF+   + D+KG H+EFIPFG+GRRMC  +PLA R+L LAL S+LH 
Sbjct  360   PDVWEDPMAFKPERFIGSKL-DYKGQHYEFIPFGAGRRMCAGMPLAHRVLHLALSSLLHE  418

Query  1671  FDWVLGHGMEPSQMDMKERMGITLR  1745
             F+W     ++   +DM++R+G+T+R
Sbjct  419   FNWEFDSRIDAKTIDMRDRVGMTMR  443



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   432 bits (1112),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 299/465 (64%), Gaps = 7/465 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV-VISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P+   S L  K+GP++ L LG+ + + V+ + +AA E+FKNHD+  A R
Sbjct  44    IFGNMFELGTEPYKRMSVLKQKYGPVLWLKLGTSTKIMVVQTAQAAEELFKNHDISFADR  103

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
              I +A +     +GSL  A YG  WR  RR+CT E FV  R+     VR +C+D+M++++
Sbjct  104   FIPDANQAHSYYQGSLALAPYGSFWRFKRRICTVEMFVHKRISETVPVRRRCVDNMLKWI  163

Query  747   REAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +  NS    + I+V R  FL SFN++GNL+ SKDL DP SE  ++FF     +M+++G 
Sbjct  164   EKEANSAEKGSGIEVTRLVFLASFNMVGNLVLSKDLADPESEEASEFFNAMKGIMDWSGI  223

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              NV+D F  LR  D Q +R+  +  + KA +I   +LKER E    G   EK  D++DVL
Sbjct  224   ANVSDIFRFLRKFDLQNLRKKMERDMGKALEIMSMFLKEREEERKKGV--EKGNDFLDVL  281

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + P + S + I + + EMF AG++TT S++EWA+TELL +P ++ +V+ E+ 
Sbjct  282   LEFEGTGKDEPTKLSEQEIKIFVLEMFLAGSETTNSSVEWALTELLRHPQAMAEVKTEIS  341

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              VVG      EE  IE LPY++AVIKE+LRLHPPLPFL+P   +     +GY +PK TQ+
Sbjct  342   KVVG-PNNTFEESDIENLPYMQAVIKESLRLHPPLPFLIPRETIQDTKFMGYDVPKGTQV  400

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN WA+GRDP+ W DP+ FKPERF+   + D KG H+  IPFG+GRRMC  LPL  RM+
Sbjct  401   LVNAWALGRDPQCWDDPMSFKPERFVGSKI-DVKGQHYGLIPFGAGRRMCVGLPLGHRMM  459

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
               ALGS+LH FDW L  G+ P  ++M E MG+T RK   LK IP+
Sbjct  460   QFALGSLLHQFDWELPDGVTPKSINMDESMGVTARKRDSLKVIPI  504



>ref|XP_006853497.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
 gb|ERN14964.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
Length=512

 Score =   432 bits (1110),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 214/485 (44%), Positives = 306/485 (63%), Gaps = 24/485 (5%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+  P+VG++ +LG  PH + + LA  HG +MTL LG M+TVV+SS E A+E+ + 
Sbjct  35    LPPGPKGLPMVGSLHRLGSRPHEALAALAETHGSLMTLQLGFMTTVVVSSSEMAKEVLQK  94

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D+V  GR + E +K     EGSL+ AQ G  WR LRR+CTT+ F   RLD+L+ +R + 
Sbjct  95    NDLVFGGRTVIEVLKMRSYPEGSLVWAQTGPRWRALRRICTTQLFTPQRLDSLQALRCQK  154

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  MV  +R+A      A+D+GR  F+ S N+I N++FS D+++P S    +F      +
Sbjct  155   VHEMVELIRQA----EPAVDIGRAAFVTSMNIISNMIFSADMVNPNSGSAQEFRDVVWAI  210

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AG PN+AD+FP+L+ LDPQG++        +        + ER++S   GG D  + 
Sbjct  211   MEVAGAPNLADYFPMLKALDPQGLKGRCNKLFGRLHQFLNVKIDERLQSRERGGVD--RG  268

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILF--------------EMFTAGTDTTTSTLEW  1220
             D++D +L  +    E    FS   I  +L               ++F AG+DT+++T+EW
Sbjct  269   DFIDAILDSKQ---ENGVDFSRSEILALLTVRHYPRLCYAENEKDLFVAGSDTSSTTVEW  325

Query  1221  AMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVP  1400
             AM ELL NP  +     EL  ++GG E  +EE  I +LPYL++V+KET R HPP+P L+P
Sbjct  326   AMAELLRNPDKMAMANMELSRILGGPEHIMEELDISRLPYLQSVVKETWRFHPPVPLLIP  385

Query  1401  HMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEF  1580
             H A  + N+ GY +PK TQ+L+N WAIGRDPK W +P  F PERFL  N+ D+KG  F+F
Sbjct  386   HRADATVNVAGYIVPKHTQVLINYWAIGRDPKVWDNPTAFLPERFLGCNV-DYKGKDFQF  444

Query  1581  IPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             IPFG+GRR+CP LPL  RM+ L L S+LH FDW L  GM+  +MDM+++ G+TL+K  PL
Sbjct  445   IPFGAGRRICPGLPLGVRMVHLILASLLHYFDWGLPDGMKAEEMDMRDKFGVTLQKLVPL  504

Query  1761  KAIPV  1775
             + IPV
Sbjct  505   RVIPV  509



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score =   431 bits (1107),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 297/464 (64%), Gaps = 11/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV-VISSDEAAREMFKNHDVVLAGR  566
             V GN+F+LG   +   + L  K+GP++ L +G+ + + V+ + +AA E+FKNHD   A R
Sbjct  41    VFGNMFELGTESYKKMAALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADR  100

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
                +        +GS   A+YG  WR  RRLCT E FV  ++     VR KC+D M++++
Sbjct  101   PQVDVNSAHNYYQGSPALARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWI  160

Query  747   REAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +AG S    + I+V RF FL SFN++GNL+ SKDL DP SE  ++FF+    +ME++G 
Sbjct  161   EKAGCSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFHAMKGIMEWSGV  220

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              NV+D FP LR  D Q +R+     + KA +I    LKER + M      EK KD++DVL
Sbjct  221   ANVSDVFPFLRKFDLQSLRKKMTRDMGKAMEIMSMLLKERKKGM------EKMKDFLDVL  274

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I V + E+F AGT+TT+S++EWA+TELL +P ++ +V+ E+ 
Sbjct  275   LEFEGTGKDEPAKLSEHEIKVFILELFLAGTETTSSSVEWALTELLRHPQAMAEVKTEIS  334

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
               VG +  K EE  IE LPY++AVIKE+LRLHPPLPFL+P   +     +GY + K T++
Sbjct  335   KAVG-SNNKFEESDIENLPYMQAVIKESLRLHPPLPFLIPRETIQDTKFMGYDVLKGTRV  393

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN WAIGRDP+ W DP+ FKPERFL   + D KG H+E IPFG+GRRMC  LPL  RM+
Sbjct  394   LVNAWAIGRDPECWDDPMSFKPERFLGSKL-DVKGQHYELIPFGAGRRMCVGLPLGHRMM  452

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH FDW L  G+ P  ++M E MG+T RK   LK IP
Sbjct  453   HFALGSLLHEFDWELPDGVSPKSINMDESMGVTARKRDSLKVIP  496



>sp|Q8VWZ7.1|C76B6_CATRO RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome 
P450 76B6; AltName: Full=Geraniol 10-hydroxylase; Short=CrG10H 
[Catharanthus roseus]
 emb|CAC80883.1| geraniol 10-hydroxylase [Catharanthus roseus]
 gb|AHA82034.1| geraniol 10-hydroxylase [Catharanthus roseus]
Length=493

 Score =   430 bits (1105),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 296/470 (63%), Gaps = 9/470 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P +G++  LG  PH S ++L+ KHGPIM+L LG ++T+VISS   A+E+ + 
Sbjct  30    LPPGPSPLPFIGSLHLLGDQPHKSLAKLSKKHGPIMSLKLGQITTIVISSSTMAKEVLQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R +  A+      + S++       WR LR++  +  F  +RLDA + +RT+ 
Sbjct  90    QDLAFSSRSVPNALHAHNQFKFSVVWLPVASRWRSLRKVLNSNIFSGNRLDANQHLRTRK  149

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y R+   SG  A+DVGR  F  S NL+ NL+FSKDL DP S+   +F      +
Sbjct  150   VQELIAYCRKNSQSG-EAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNI  208

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  AGKPN+ DFFPLL  +DPQGIR     H  +   + G  + ER+E   + G   +K 
Sbjct  209   MVEAGKPNLVDFFPLLEKVDPQGIRHRMTIHFGEVLKLFGGLVNERLEQRRSKG---EKN  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DVLL       E P       I  +  ++F AGTDTT+STLEWAM+E+L NP  ++K
Sbjct  266   DVLDVLLTTSQ---ESPEEIDRTHIERMCLDLFVAGTDTTSSTLEWAMSEMLKNPDKMKK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              Q EL  V+G   K +EE  I +LPYL+ V+KETLR+HPP+PFL+P     S  + GY +
Sbjct  323   TQDELAQVIG-RGKTIEESDINRLPYLRCVMKETLRIHPPVPFLIPRKVEQSVEVCGYNV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN WAIGRD   W D L FKPERF+E  + D +G  FE IPFG+GRR+CP LP
Sbjct  382   PKGSQVLVNAWAIGRDETVWDDALAFKPERFMESEL-DIRGRDFELIPFGAGRRICPGLP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA R +PL LGS+L+SF+W L  GM P  +DM+E+ GITL+KA PL+A+P
Sbjct  441   LALRTVPLMLGSLLNSFNWKLEGGMAPKDLDMEEKFGITLQKAHPLRAVP  490



>gb|AGX93050.1| geraniol 10-hydroxylase-like protein [Lonicera japonica]
Length=498

 Score =   429 bits (1102),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 209/472 (44%), Positives = 301/472 (64%), Gaps = 7/472 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++G++ +LG  PH S ++LA  +GPIM+L LG ++TVVISS +AA+E+ + 
Sbjct  32    LPPGPAPLPIIGSLHKLGDQPHQSLAKLAKIYGPIMSLKLGRITTVVISSSDAAKEVLQK  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R + +A+      + S++       WR LR++  +  F  +RLDA + +R + 
Sbjct  92    KDLAFSSRHVPDALHAHNQFKFSVVWLPVAPQWRSLRKILNSNIFSGNRLDANQHLRCRK  151

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             ++ ++ Y R++ +SG A +D+GR  F  S NL+ N +FSKDL DP  +   +F    G +
Sbjct  152   VEELITYCRKSSHSGDA-VDIGRAAFRTSLNLLSNTIFSKDLTDPYQDSAKEFKELVGNI  210

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  AGKPN+ DFFP L+ +DPQGIR     H  K  ++ G  + ER+E  ++  +DEK  
Sbjct  211   MVEAGKPNLVDFFPSLKKIDPQGIRHRMTIHFGKVLELFGGLINERLELKSSQKSDEKN-  269

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DV L       E P       I  +  ++F AGTDTT+STLEWAM E+L NP +L K
Sbjct  270   DVLDVCLSISK---ENPDEIDRTHIERMCLDLFVAGTDTTSSTLEWAMAEVLRNPETLVK  326

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              +AEL  V+G   K L E  +  LPYL+ ++KETLR+HPP+PFL+P          GY +
Sbjct  327   AKAELEEVIGKG-KILAEADVSNLPYLRCIVKETLRIHPPVPFLIPRKVEMDVEACGYTV  385

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+ VNVWAIGRDP  W+DPL FKPERF+   + D +G  FE +PFG+GRR+CP LP
Sbjct  386   PKNSQVFVNVWAIGRDPTLWEDPLSFKPERFMASEL-DVRGRDFELLPFGAGRRICPGLP  444

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LA RM+P+ LGS+++SF+W L  G+ P ++DM E+ GITL KA  L+A+P P
Sbjct  445   LAIRMVPVMLGSLVNSFNWKLDGGIAPKELDMGEKFGITLAKAQSLRAVPSP  496



>gb|AGX93054.1| geraniol 10-hydroxylase-like protein [Tabernaemontana elegans]
Length=493

 Score =   426 bits (1096),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/474 (45%), Positives = 297/474 (63%), Gaps = 13/474 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P +GN+  LG  PH S ++L+ KHGP+M+L LG ++TVVISS   A+E+ + 
Sbjct  30    LPPGPAPLPFIGNLHLLGDQPHKSLAKLSKKHGPLMSLKLGHITTVVISSSGMAKEVLQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R + +A+      + S++       WR LR++  +  F  +RLDA + +R + 
Sbjct  90    QDLAFSSRSVPDALHAHNQFQFSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRCRK  149

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y R+   +G A +DVGR  F  S NL+ N +FSKDL DP S+   +F      +
Sbjct  150   VQELIAYCRKNCQTGEA-VDVGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNI  208

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES--MNAGGNDEK  1076
             M  AGKPN+ DFFP+L  +DPQGIR+    H  K   +    + ER+E   + +G ND  
Sbjct  209   MVEAGKPNLVDFFPVLEKVDPQGIRKRMTVHFGKVLKLFNGLINERLEQKRLQSGNND--  266

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
                 +DVLL       E P       I  +  ++F AGTDTT+STLEWAM E+L NP  +
Sbjct  267   ---VLDVLLTTSE---ESPEEIDRTHIERMCLDLFVAGTDTTSSTLEWAMAEMLKNPDKM  320

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
             QK QAE+  V+G   K +EE  + +LPYL+ V+KETLR+HPP+PFL+P        + GY
Sbjct  321   QKTQAEIAEVIGKG-KAIEEADVARLPYLRCVVKETLRIHPPVPFLIPRKVDQDVEVCGY  379

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK +Q+LVN WAIGRD   W+DPL FKPERF E  + D +G  FE IPFG+GRR+CP 
Sbjct  380   KVPKGSQVLVNAWAIGRDGTVWEDPLAFKPERFFESEI-DIRGRDFEVIPFGAGRRICPG  438

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LPLA+RM+P+ LGS+L+SF+W L  G+ P  +DM E+ GITL+KA PL+A+P P
Sbjct  439   LPLAARMVPVMLGSLLNSFNWKLEGGIAPKDLDMDEKFGITLQKAHPLRAVPSP  492



>dbj|BAP90522.1| geraniol 10-hydroxylase [Ophiorrhiza pumila]
Length=512

 Score =   426 bits (1096),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 299/472 (63%), Gaps = 11/472 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++GN+  LG  PH S ++LA  HGP+M+L LG ++T+ ISS   A+E+ + 
Sbjct  49    LPPGPTPLPIIGNLHLLGDQPHKSLAKLAKTHGPLMSLKLGQITTLAISSSGMAKEVLQK  108

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R I +A+      + S++       WR LR++  +  F  +RLDA + +R + 
Sbjct  109   QDLAFSSRSIPDAIHAHNQFQYSVVWLPVATRWRSLRKILNSNIFSGNRLDANQHLRCRK  168

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y R+   +G  A+D+GR  F  S NL+ N +FSKDL DP S+   +F      +
Sbjct  169   VQELIAYCRKNCQTG-EAVDIGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNI  227

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKK  1079
             M  AGKPN+ DFFP+L   DPQGIRR    H  K  ++ G  + ER+++  + GGN+   
Sbjct  228   MVEAGKPNLVDFFPVLEKFDPQGIRRRMTIHFGKVLEMFGGLINERLDNGKSRGGNN---  284

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
              D +DVLL       E P       I  +  ++F AGTDTT++TLEWAM E+L  P  ++
Sbjct  285   -DVLDVLLNASE---ETPDEIDRTHIERLCLDLFVAGTDTTSNTLEWAMAEMLKTPEKMK  340

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             K +AEL  V+G   K +EE  + +LPYL+ ++KETLRLHPP+PFL+P        + GY 
Sbjct  341   KAKAELAEVIGKG-KAIEEADVSRLPYLRCIVKETLRLHPPVPFLIPRKVEQDVEVCGYN  399

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             +PK TQ+LVN WAIGRD  TW++ L+FKPERFLE  + D +G  FE IPFG+GRR+CP L
Sbjct  400   VPKGTQVLVNAWAIGRDETTWENALEFKPERFLESEL-DIRGRDFELIPFGAGRRICPGL  458

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             PLA RM+P+ LGS+L+SFDW LG  + P  +DM+E+ GITL+KA PL A+P+
Sbjct  459   PLAVRMVPVMLGSLLNSFDWKLGGSIAPKDLDMEEKFGITLQKANPLLAVPI  510



>ref|XP_006365964.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=502

 Score =   425 bits (1093),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 210/483 (43%), Positives = 313/483 (65%), Gaps = 12/483 (2%)
 Frame = +3

Query  324   NERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVV  503
             N +S R+L      PPGP   P++G++ QLG  P+ S +ELA  HGP+MTL LGS++TV+
Sbjct  25    NTKSTRKL------PPGPTGLPIIGSLLQLGSKPNHSLAELAKIHGPLMTLKLGSITTVI  78

Query  504   ISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVT  683
              SS E A+E+ + HD   + R I +A+      E +L        WR  RR+C T+ F  
Sbjct  79    ASSSETAKEILQKHDKTFSARIIPDAVSSQPNREATLSWIPPDNMWRNKRRICNTQMFNN  138

Query  684   SRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
              RLD L+ +R +  + +V ++R    SG+A +D+GR  F  + NLI N++FS D++DP  
Sbjct  139   QRLDLLQELRHQKAEQLVSHIRSQCESGSA-VDIGRVAFTTTLNLISNMIFSIDMVDPEF  197

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             ++  +F      +ME  G PN++D+F +L+WLD QG+RR  +    +  +I    +++R+
Sbjct  198   KKAHEFKELVWTIMEDGGVPNLSDYFLVLKWLDLQGVRRRIRPAYLRLHEIFEQLIEQRV  257

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             E+  +G   ++  D++DVLL Y  D   G   F  +TI  I+ ++F AG+DT+  T+EWA
Sbjct  258   EARGSGQMIKRDGDFLDVLLDYCKDEGSG---FDRKTIKPIILDLFIAGSDTSALTIEWA  314

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             M ELL  P  L KV+ E+   +G T++ ++E  ++KLPYL+AV+KET+RLHP  P L+PH
Sbjct  315   MAELLRKPEELNKVRQEIIQQIG-TKRAVKESDMDKLPYLQAVVKETMRLHPAAPLLLPH  373

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
              A     +LG+ +PK++Q+LVN WAIGRDPKTW+ PL+F P RF+E ++ D+KG  FEFI
Sbjct  374   KAQHDVQVLGFTVPKDSQVLVNAWAIGRDPKTWERPLEFLPLRFMESSL-DYKGGDFEFI  432

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
              FG+GRR+CP +PLA RM+ L L S++  F+W L  GM P ++DM+E+ G+TLRKA PL 
Sbjct  433   LFGAGRRICPGMPLAIRMVNLILASIIQPFNWKLADGMTPEKLDMEEQFGVTLRKAIPLV  492

Query  1764  AIP  1772
             AIP
Sbjct  493   AIP  495



>gb|AGX93051.1| geraniol 10-hydroxylase-like protein [Cinchona calisaya]
Length=493

 Score =   425 bits (1092),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 210/471 (45%), Positives = 296/471 (63%), Gaps = 9/471 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++GN+  LG  PH S ++LA KHGP+M+L LG ++TVV++S + A+E+ + 
Sbjct  30    LPPGPTPLPIIGNLHLLGDQPHKSLAKLAKKHGPLMSLKLGQITTVVVTSSDMAKEVLQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R I +A+        S++       WR LR++  +  F  +RLDA + +R K 
Sbjct  90    QDLAFSFRSIPDALHAHDQYRYSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRLKK  149

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  +V Y R+    G A +DVGR  F  S NL+ N +FSKDL DP S+   +F      +
Sbjct  150   VQELVAYCRKNSQVGEA-VDVGRAAFRTSLNLLSNTLFSKDLTDPYSDSAKEFKDLVWNI  208

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  AGKPN+ DFFP+L  +DPQGIRR    H  K   + G  + ER+E   + G +    
Sbjct  209   MLEAGKPNLVDFFPVLEKIDPQGIRRRMTIHFGKVLKLFGGLVDERLEQGKSKGGNS---  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DVLL       E P       I  +  ++F AGTDTT++TLEWAM E+L NP  ++K
Sbjct  266   DVLDVLLTTSE---EAPGEIDRTHIERMCLDLFVAGTDTTSNTLEWAMAEVLRNPEKMKK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              +AEL  V+G   K +EE  + +LPYL+ ++KETLR+HPP+PFL+P        + GY +
Sbjct  323   AKAELAEVIG-KGKLVEEADVSRLPYLRCIVKETLRIHPPVPFLIPRRVDQDVEVCGYNV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN WAIGRD   W++ L FKPERF E  + D +G  FE IPFG+GRR+CP LP
Sbjct  382   PKGSQVLVNAWAIGRDETVWENALAFKPERFWESEL-DIRGRDFELIPFGAGRRICPGLP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+P+ LGS+L+SFDW L  G+ P  +DM+E+ GITL+KA PL+A+P+
Sbjct  441   LAVRMVPVMLGSLLNSFDWKLEAGIAPKGLDMEEKFGITLQKAYPLRAVPI  491



>ref|XP_007040049.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY24550.1| Cytochrome P450, putative [Theobroma cacao]
Length=500

 Score =   425 bits (1092),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 214/476 (45%), Positives = 303/476 (64%), Gaps = 9/476 (2%)
 Frame = +3

Query  354   VGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREM  533
             +  LPPGPRR P+ GN+F LG  PH S SELA  HGP+M+L +GS+ TVVISS+  A+++
Sbjct  32    LSKLPPGPRRIPIFGNLFDLGDKPHKSLSELAKIHGPLMSLKIGSLITVVISSENMAKQV  91

Query  534   FKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVR  713
              + HD+  + R I +A++    +E  L        WR LR++C T  F + +LDA + +R
Sbjct  92    LQKHDLTFSNRTIVDAVRASQHDEVGLPWIPVSPLWRTLRKVCNTHLFASQKLDANQYLR  151

Query  714   TKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHA  893
              K I  ++  ++++ ++G   I++G+  F  + NL+ N +FS DL+DP S    +F    
Sbjct  152   RKKIQELIAIVQKSCHAG-EVINIGQAAFNTTINLLSNTIFSMDLVDPNSPTAQEFKKTV  210

Query  894   GKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDE  1073
               +ME AGKPN+AD+FP+LR +DPQG+RR    H  K  D+ G    ER++S  A G+  
Sbjct  211   WGIMEEAGKPNLADYFPILRKIDPQGVRRRMTIHFEKLLDLFGKMFDERLQSRKAQGS-T  269

Query  1074  KKKDYMDVLLQYRGDLVEGPARFSSRT-INVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
                D +D +L    D++EG     ++T +  +L  +F AG DTT+STLEWAM ELL NP 
Sbjct  270   ASNDVLDTVL----DIIEGNIEELNKTHVTHLLLVLFVAGADTTSSTLEWAMAELLRNPQ  325

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
              L K + EL  V+ G    +EE  I +LPYL+A+IKET R+H  +P L+P  A     + 
Sbjct  326   VLVKAKKELEQVI-GKGNPVEESDINRLPYLQAIIKETFRMHATVPLLLPRKAGADAEIC  384

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ +PK  Q+LVNVWAIGRDP  W+ P  F PERF+  ++ D KG  F  IPFG+GRR+C
Sbjct  385   GFTVPKGAQVLVNVWAIGRDPSIWEKPSAFMPERFMGSDI-DVKGRDFGLIPFGAGRRIC  443

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             P LPLA+RML L LGS++HSFDW L  G+ P  M+M+E+ G+TL+ A PL+AIP P
Sbjct  444   PGLPLANRMLHLMLGSLIHSFDWKLEGGISPEDMNMEEKFGLTLQLAEPLRAIPTP  499



>gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii]
Length=493

 Score =   424 bits (1091),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/473 (45%), Positives = 298/473 (63%), Gaps = 11/473 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++GN+  LG  PH S ++L+ K+GPIM L LG ++TVVISS   A+E+ + 
Sbjct  30    LPPGPSPLPIIGNLHLLGEQPHKSLAKLSKKYGPIMGLQLGRVTTVVISSSGVAKEVLQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R + +A+      + S++       WR LR++  +  F  +RLDA + +R++ 
Sbjct  90    QDLAFSSRSVPDALHAHNQFQFSVVWLPVASQWRSLRKILNSNIFSGNRLDANQHLRSRK  149

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             ++ ++ Y R+   +G A +DVGR  F  S NL+ N +FSKDL DP S+   +F      +
Sbjct  150   VEELIAYCRKNSQTGEA-VDVGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNI  208

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA-GGNDEKK  1079
             M  AGKPN+ DFFP+L  +DPQGIRR    H  K   +    + ER+E   + GGN+   
Sbjct  209   MLEAGKPNLVDFFPVLEKVDPQGIRRRMTVHFGKVLKLFDGLINERLEQRRSRGGNN---  265

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
              D ++VLL       E P       I  +  ++F AGTDTT+STLEWAM E+L NP  ++
Sbjct  266   -DVLEVLLTTSE---ESPEEIDRTHIERMCLDLFVAGTDTTSSTLEWAMAEMLKNPDKMK  321

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             K QAEL  V+G   K + E  + +LPYL+  +KETLR+HPP+PFL+P     +  + GY 
Sbjct  322   KTQAELAEVIGKG-KTVAEADVARLPYLRCAVKETLRIHPPVPFLIPRRTEQAVEVCGYK  380

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             +PK +Q+LVN WAIGRD   W D L FKPERFLE  + D +G  FE IPFG+GRR+CP L
Sbjct  381   VPKGSQVLVNAWAIGRDETLWDDALAFKPERFLESEV-DMRGRDFELIPFGAGRRICPGL  439

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             PLA RM+P+ LGS+L+SFDW L  G+ P  +DM+E+ GITL+KA PL+A+P P
Sbjct  440   PLAIRMVPVMLGSLLNSFDWKLEGGIAPKDLDMEEKFGITLQKAHPLRAVPRP  492



>gb|KCW48743.1| hypothetical protein EUGRSUZ_K02382 [Eucalyptus grandis]
Length=488

 Score =   423 bits (1087),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 220/485 (45%), Positives = 309/485 (64%), Gaps = 37/485 (8%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             RSHR       LPPGP RWP+ GN+F LG  P  + + L  K+GP++ L LGS+ T+V  
Sbjct  32    RSHR-------LPPGPSRWPIFGNLFNLGKMPRRTLAGLREKYGPVIWLRLGSIDTMVTL  84

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
             S   A E FKNHD+    R I + M+     +GS+  A YG +WR+ RRL T    V  R
Sbjct  85    SSRVAAEFFKNHDLNFVERTITDLMQSQEYYKGSIALAPYGTYWRVSRRLLTAGILVARR  144

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTA----AIDVGRFFFLMSFNLIGNLMFSKDLLDP  857
             L+    ++ KC+D M+ ++ EA ++        + + RF FLM+FNL+GNLM S+DLLDP
Sbjct  145   LNETAPIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDP  204

Query  858   RSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKE  1037
              S+ G++FF     +ME++G   +AD FP LRWL PQG+RR     + KA  IA D+++E
Sbjct  205   DSKVGSEFFEAMSGLMEWSGHVTIADLFPWLRWLGPQGLRRKMDRDMGKAMRIASDFVRE  264

Query  1038  RMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
             R+E    GGND+ ++D++DVL ++ G+  + PA+ S    N+         T+T++ST+E
Sbjct  265   RIEEKKIGGNDD-RRDFLDVLPEFEGNGKDEPAKLSETNQNI--------HTETSSSTVE  315

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WA+TELL +P+S+ KVQAEL                 +L YL+AV+K+TLRLHPPLPFLV
Sbjct  316   WALTELLRDPNSMAKVQAEL----------------SRLSYLQAVVKDTLRLHPPLPFLV  359

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             P   M +   +GY IPK TQ+ VN WAIGRDP  W+DP+ FKPERF+   + D+KG H+E
Sbjct  360   PRKVMANTIFMGYDIPKNTQVFVNSWAIGRDPDVWEDPMAFKPERFIGSKL-DYKGQHYE  418

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
             FIPFG+GRRMC  +PLA R+L LAL S+LH F+W     ++   +DM++R+G+T+RK  P
Sbjct  419   FIPFGAGRRMCAGMPLAHRVLHLALSSLLHEFNWEFDSRIDAKTIDMRDRVGMTMRKYVP  478

Query  1758  LKAIP  1772
             L  +P
Sbjct  479   LLVVP  483



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score =   423 bits (1088),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 221/472 (47%), Positives = 309/472 (65%), Gaps = 6/472 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P+VGN+F LG  PH+    + +++GP+M L +G+++T+VI S +AA   FKN
Sbjct  34    LPPGPSGLPIVGNMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTLVIQSAQAATAFFKN  93

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD     R + E  +     +GSL  A YG +WRMLRR+C+ E FV SR++    +R K 
Sbjct  94    HDANFLERVVVEVNRVCNYLQGSLALAPYGNYWRMLRRICSMELFVHSRINNSESIRRKS  153

Query  723   IDHMVRYMREAGNSGTA-AIDVGRFFFLMSFNLIGNLMFSKDL-LDPRSERGAKFFYHAG  896
             +D M++++   G       I++ RF FL SFN++GNL+ SK+L  DP S   ++FF    
Sbjct  154   VDKMIQWIETHGKKEQGQGIEITRFVFLASFNMLGNLIMSKELAADPDSTTASEFFDAMM  213

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
               +E++G PN++D FPLLRWLD QG+RR  +  + K  +I   ++KER++    G    K
Sbjct  214   GQVEWSGTPNISDVFPLLRWLDIQGLRRKMKRDMGKGKEILSTFIKERIKEQENG--RAK  271

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D++DVLL + G   + PA+ S   IN+ + EMF AGT+T++ST EWA+TELL NP ++
Sbjct  272   GTDFLDVLLAFEGKGKDEPAKLSEHEINIFILEMFLAGTETSSSTTEWALTELLRNPETM  331

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              +V+AE+  VV G  KK EE  I+K+PY++AV+KET RLHPPLPFL+P  A      +GY
Sbjct  332   ARVKAEIAEVV-GPNKKFEESDIDKVPYMQAVVKETFRLHPPLPFLLPRKATQDTKFMGY  390

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK TQI +N WAIGRDP+ W DPL F PERF+   + DFKG ++E IPFG+GRRMC  
Sbjct  391   DVPKGTQIFINAWAIGRDPECWHDPLDFIPERFIGSKI-DFKGLNYELIPFGAGRRMCVG  449

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +PL  RM+   LG++LH F+W L H M    +DM ER+G T+RK  PLK IP
Sbjct  450   VPLGHRMVHFVLGTLLHEFNWELPHNMSSKSIDMTERLGTTVRKLEPLKVIP  501



>ref|XP_010676619.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=546

 Score =   423 bits (1088),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 292/471 (62%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P+ GN+F LG  PH+S +ELA ++GP+MTL LG + TV+ISS   A+E  + 
Sbjct  81    LPPGPPTLPIFGNLFSLGTKPHISLTELAKRYGPLMTLQLGRVPTVIISSAAMAKEALQR  140

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D+  + R + +A+     +E S++       WR LR++C ++ F TSRLDA + +RTK 
Sbjct  141   NDLAFSNRMVIDAVCAVNHHENSIVWLPLSPKWRNLRKICNSKVFATSRLDASQSLRTKK  200

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y ++   S   A+DVG+  F  + NL+ + +FS DL DP S+   +F      V
Sbjct  201   VKDLLSYAQKCSESNI-AMDVGQAAFTTTLNLLSSTIFSVDLGDPSSKFSREFKEIVRGV  259

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AGKPN AD+FP L+  DPQGIRR T     K  D+    + +R++  N   +     
Sbjct  260   MEEAGKPNFADYFPFLKRFDPQGIRRRTSVQFQKMIDLFNSMIDQRLQG-NKPSDSILGN  318

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL    D  E         I  +L ++F AGTDTT+ST+EWAM ELL NP  L+K
Sbjct  319   DVLDALLGINQDKTE---EIDPINIPSLLVDLFAAGTDTTSSTMEWAMAELLRNPEKLKK  375

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              Q ELR  +G     ++E  I +LPYL+A++KET RLHP +PFLVP        + G+ +
Sbjct  376   AQQELRETIGKG-NPVQESDIARLPYLQAIVKETFRLHPAVPFLVPRKVDSDVKLFGFTV  434

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK  Q+LVNVWAIGRDP  W+ P  F+PERF+   M D KG HFE IPFG GRR+CP LP
Sbjct  435   PKNAQVLVNVWAIGRDPNNWERPNSFEPERFMGLEM-DVKGFHFELIPFGGGRRICPGLP  493

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+ + LGS++H FDW L  G+ P +MDM+E+ G TL KA  L+AIPV
Sbjct  494   LAIRMIYMMLGSLIHGFDWKLEGGISPEKMDMEEKFGFTLEKAQRLRAIPV  544



>ref|XP_010661587.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Vitis vinifera]
Length=496

 Score =   421 bits (1083),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/474 (44%), Positives = 296/474 (62%), Gaps = 10/474 (2%)
 Frame = +3

Query  354   VGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREM  533
               +LPPGPR  P++GNI +LG  PH S + L+  +GP+M+L LGS++T+VISS E A+E+
Sbjct  31    TASLPPGPRPLPIIGNILKLGDKPHRSLANLSKTYGPVMSLKLGSIATIVISSSETAKEV  90

Query  534   FKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVR  713
                +D   + R + +A++    +E S++      HWR +R++CT E F   +LDA +G+R
Sbjct  91    LHRNDQAFSSRTVPDAVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLR  150

Query  714   TKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHA  893
              K +  ++ ++ E  + G  A+D+    F  S NL+ N +FS +L    S    +F   A
Sbjct  151   RKIVQELLDHVEECCSRG-CAVDINGAVFTASLNLLSNTIFSINLAHHGSNFSQEFKNIA  209

Query  894   GKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDE  1073
               VME  G+PN  D+FP  R +DPQGIR   + + NK F I    + +R++S  +  +  
Sbjct  210   RGVMEGVGRPNFVDYFPAFRLIDPQGIRWNMKIYFNKLFHIFDGIINQRLQSKTSSAS--  267

Query  1074  KKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
               KD +D LL       E    +S   I  +L ++F AGTDTT+ST+EWAM ELL NP  
Sbjct  268   --KDVLDALLNLTK---ENDNEWSCSDIKHLLLDLFVAGTDTTSSTVEWAMAELLCNPEK  322

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             + K Q E+R V+G  E  ++E  I K PYL++++KET RLHPP P LVPH A     + G
Sbjct  323   IAKAQKEIRGVLGN-EGIVQESDISKFPYLQSIVKETFRLHPPAPLLVPHKAETDVEICG  381

Query  1434  YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             + IPK +Q+LVN WAIGRDP TW +P  F PERFLE ++ D KG  FE IPFG+GRR+CP
Sbjct  382   FTIPKNSQVLVNAWAIGRDPSTWPNPNAFMPERFLECDI-DVKGRDFELIPFGAGRRICP  440

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
              +PLA RM+ L L S+L+S  W L  GM+P  MDM E+ G+TL+KA PL+AIP+
Sbjct  441   GMPLAHRMVHLMLASLLYSHAWKLEDGMKPENMDMSEKFGLTLQKAQPLRAIPI  494



>ref|XP_011099226.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum]
Length=494

 Score =   421 bits (1083),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 295/465 (63%), Gaps = 14/465 (3%)
 Frame = +3

Query  393   VGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKI  572
             +G++  LG  PH S ++LA  HGP+M L LG ++TVV+SS   A+E+ +  D+V + R I
Sbjct  40    IGSLHLLGDQPHQSLAKLAKTHGPLMCLRLGFINTVVVSSAAMAKEVLQKQDLVFSSRTI  99

Query  573   YEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMRE  752
              +A+      + S++       WR LR++  +  F  SRLDA + +R + +  ++ Y R+
Sbjct  100   PDAIHAHDQFKYSVVWLPVASRWRSLRKVLNSNIFSGSRLDANQHLRCRKVQELIAYCRK  159

Query  753   AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVA  932
                +G   +DVGR  F  S NL+ N +FSKDL DP S+   +F      +M  AGKPN+ 
Sbjct  160   NSQTG-EPVDVGRAAFRTSLNLLSNTIFSKDLTDPFSDSAKEFKDLVWNIMVEAGKPNLV  218

Query  933   DFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERME---SMNAGGNDEKKKDYMDVLL  1103
             DFFP+L  LDPQGIRR    H  K  D+    + ER+E   + NAG +D      +D+LL
Sbjct  219   DFFPMLEKLDPQGIRRRMTIHFGKVIDLFSGLINERLEKGKTQNAGNSD-----VIDILL  273

Query  1104  QYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRS  1283
                    E P       I  +  ++F AGTDTT+STLEWAM E L NP +++K +AEL  
Sbjct  274   ATSK---ENPEEIDRVHIERMCLDLFVAGTDTTSSTLEWAMAEALKNPETVKKAKAELEE  330

Query  1284  VVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQIL  1463
             V+G   K L+E  I +LPYL+ ++KETLR+HPP+PFL+P        + GY +PK +Q+ 
Sbjct  331   VIGKG-KVLDEADISRLPYLRCMVKETLRIHPPVPFLIPRRVDQDVEVCGYTVPKNSQVF  389

Query  1464  VNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLP  1643
             VN WAIGRDP  WKDPL+FKPERFLE  + D +G  FE IPFG+GRR+CP LPLA RM+P
Sbjct  390   VNAWAIGRDPDVWKDPLEFKPERFLESEL-DMRGRDFELIPFGAGRRICPGLPLAVRMVP  448

Query  1644  LALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             + LGS+L+SFDW L +G+ P ++DM E+ GITL+KA PL+A+P+P
Sbjct  449   VMLGSLLNSFDWKLENGIGPKELDMDEKFGITLQKARPLRAVPLP  493



>ref|XP_011017516.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=500

 Score =   421 bits (1083),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 213/481 (44%), Positives = 292/481 (61%), Gaps = 11/481 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             RR       PPGPR+ P++GNI  L   PH +F++L+  +GPIMTL LGS +T+VISS  
Sbjct  27    RRKSGCTVFPPGPRQLPIIGNILALSDKPHRTFAKLSQTYGPIMTLKLGSRTTIVISSPN  86

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGN--EGSLITAQYGQHWRMLRRLCTTEFFVTSRL  692
              A+E  + HD  L+ R I +A++    N  + S++      HW+ L++L  T+ F + RL
Sbjct  87    IAKEALQKHDQALSSRTIPDAIRVQHYNYHKNSMVWLPVSTHWKFLKKLAATQMFTSQRL  146

Query  693   DALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERG  872
             DA R +R K +  ++ Y+ E  N+G  A+DVGR  F    NLI N  FS D+ +  S   
Sbjct  147   DASRALREKKVQELLEYVHENCNNG-HAVDVGRSVFTTVLNLISNTFFSLDVTNYNSGLS  205

Query  873   AKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESM  1052
              +F       +E  GK N+AD+FP+LR +DPQGIRR T  ++ +   I    + ER    
Sbjct  206   QEFSDLVVGFLEQIGKSNIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLR  265

Query  1053  NAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTE  1232
             ++    +   D +D LL       E  +  SS  I V+L + F AGTDTT+ST+EWAMTE
Sbjct  266   SSSVASKASHDVLDTLLILAQ---ENNSELSSTEIQVLLIDFFVAGTDTTSSTVEWAMTE  322

Query  1233  LLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAM  1412
             LL NP  + K + EL+ V G     ++E  I K PYL+A++KET RLHPP+PFL+P  A+
Sbjct  323   LLRNPDKMFKAKNELQQVEG----PVQESDISKCPYLQAIVKETFRLHPPVPFLLPRKAV  378

Query  1413  DSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFG  1592
                 M G+ +PK  QIL+N+WAIGRDP  W DP  FKPERFLE   AD KG  FE IPFG
Sbjct  379   SEVEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPERFLE-CQADMKGRGFELIPFG  437

Query  1593  SGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +GRR CP LPL  +M+ L L S++HSFDW +   + P  +DM E  G+TL K+ PL+AIP
Sbjct  438   AGRRSCPGLPLGHKMVHLTLASLIHSFDWKIADDLTPEDIDMSEAFGLTLHKSDPLRAIP  497

Query  1773  V  1775
             +
Sbjct  498   L  498



>ref|XP_002276053.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   421 bits (1082),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/478 (44%), Positives = 298/478 (62%), Gaps = 10/478 (2%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             R     +LPPGPR +P++GNI +LG  PH S + L+  +GP+M+L LGS+ST+V+SS E 
Sbjct  27    RKPSTASLPPGPRPFPIIGNILKLGDKPHQSLTNLSKTYGPVMSLKLGSISTIVVSSPET  86

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             A+E+   +D   +GR++  A+K    +E S+I +    +WR +R++CT E F   RL+A 
Sbjct  87    AKEVLHRNDQAFSGREVLGAVKAHNHHESSVIWSPTSAYWRKIRKICTREMFSVQRLNAS  146

Query  702   RGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             +G+R K +  ++ ++ E    G  A+D+G   F  S NL+ N +FS +L    S    +F
Sbjct  147   QGLRKKIVQELLDHVEECCGRG-CAVDIGAATFTASLNLLSNTIFSTNLAHHDSTFSQEF  205

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
                   VME AGKPN AD+FP  R +DPQ I+R  + H  K  DI    + +R++S  + 
Sbjct  206   KDIVWGVMEEAGKPNFADYFPAFRLIDPQCIQRNMKVHFGKLIDIFDGLITQRVQSKASS  265

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
              ++    D +D  L       E    +S   I  +L ++F AGTDTT+ T+EWAM ELLH
Sbjct  266   ASN----DVLDAFLNLTK---ENNQEWSCNDIIHLLMDLFVAGTDTTSDTIEWAMAELLH  318

Query  1242  NPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSC  1421
             NP ++ K Q EL+ V+ G +  ++E  I KLPYL+ ++KET RLHPP P LVPH A    
Sbjct  319   NPETMVKAQRELQEVL-GKDGIVQESDISKLPYLQGIVKETFRLHPPAPLLVPHKAETDV  377

Query  1422  NMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGR  1601
              + G+ +PK +Q+L+N WAIGRDP  W +P  F PERFL  ++ D KG  FE IPFG+GR
Sbjct  378   EICGFTVPKNSQVLINAWAIGRDPSIWSNPNAFVPERFLGCDI-DVKGRDFELIPFGAGR  436

Query  1602  RMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             R+C  LPLA RM+ L L S+LHS+ W L  GM+P  MDM E++G TL+KA PL+AIP+
Sbjct  437   RICLGLPLAHRMVHLILASLLHSYAWKLDDGMKPEDMDMNEKLGFTLQKAQPLRAIPI  494



>ref|XP_009780649.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=499

 Score =   421 bits (1082),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 205/470 (44%), Positives = 307/470 (65%), Gaps = 9/470 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  +P++G++ +LG  PH S + LA  HGP+MTL LGS++T+V SS E A+E+ + 
Sbjct  30    LPPGPTGFPIIGSLLELGSKPHHSLANLAKIHGPLMTLKLGSVTTIVASSPETAKEILQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L+ R + +A+      E +L     G  WR  RR+C+T+ F   RLD+L+ +R K 
Sbjct  90    HDKTLSARTVTDAITAQPNPEATLAWVT-GDKWRNRRRICSTQMFTNRRLDSLQEIRHKK  148

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  +V +MR+   SG AA+D+GR  F  + NL+ + +FS DL+DP  +   +F    G +
Sbjct  149   VAQLVNHMRKQCQSG-AAVDIGRVTFATTLNLMSSTIFSIDLVDPEFQTVQEFMDLVGII  207

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME + KPN++D+FP +RWLD QG++R  +    +  +I    +++R+E   +G   +K  
Sbjct  208   MEDSVKPNLSDYFPFIRWLDLQGVKRHIKPAYLRLHEIFDQVIEKRVEDRASGM--KKTG  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL    +   G   F  +TI  ++ ++F AG+DT+  T EWA+ ELL NP  LQK
Sbjct  266   DFLDVLLDQCEEEGSG---FDRQTIKPLILDLFLAGSDTSAITTEWAVAELLRNPQKLQK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             ++ E+   +G  E+ ++E  I+KLPYL+AV+KE +RLHP  P L+PH A +   + G+ +
Sbjct  323   LREEILQQIG-IERPVKESDIDKLPYLQAVVKEVIRLHPAAPLLLPHKAQEDTEIFGFIV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN WAI RDPK W++PL+F PERF+  ++ D+KG  FE+IPFG+GRR+CP +P
Sbjct  382   PKNSQVLVNAWAIERDPKYWENPLEFMPERFINSSV-DYKGRDFEYIPFGAGRRICPGMP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA RM+ L L S++  F W L  GM P  +DM+E+ G+TLRKA PL AIP
Sbjct  441   LAIRMVNLMLASIVQPFSWKLPKGMAPENLDMEEQFGLTLRKAIPLLAIP  490



>ref|XP_006360237.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   420 bits (1080),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 212/483 (44%), Positives = 302/483 (63%), Gaps = 15/483 (3%)
 Frame = +3

Query  333   SHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             S RR + V    PGP   P++GN+  LG  PH+S ++LA K+GPIM L LG ++TVVISS
Sbjct  23    SLRRAKRVA---PGPFPLPIIGNLHLLGDKPHISLTQLAKKYGPIMNLKLGQINTVVISS  79

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI-TAQYGQHWRMLRRLCTTEFFVTSR  689
                A+E+ +  D+  + R   +A++    N+ S+I        WR LR++  +  F  ++
Sbjct  80    SVLAKEVMQKQDLAFSNRFGIDAIRACNHNDFSVIWLPVNNSQWRTLRKIMNSHIFSGNK  139

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
             LDA   +RTK I  ++ Y  ++   G  A+D+GR  F  S NL+ N +FSKDL DP S+ 
Sbjct  140   LDANEHLRTKKIQELIDYCHKSSKVG-EAVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDS  198

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
               +F     K+M   GKPN+ D+FP L+ +DPQGIRR +  +  K   +  D + ER++ 
Sbjct  199   AKEFKELVWKIMVEVGKPNLVDYFPFLKKIDPQGIRRRSTDYFTKILHLMSDLIDERLKE  258

Query  1050  MNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
                G  + +  D +D LL         P       I  +  ++F AGTDTT++TLEWAM 
Sbjct  259   RELG--NRENVDVLDALLDI------SPGEIDRNQIEQLCLDLFAAGTDTTSNTLEWAMA  310

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELL NP + +K Q EL  V+G   K ++E  + KLPYL+ ++KET R+HP +PFL+P   
Sbjct  311   ELLKNPHTFEKAQEELAQVIG-RGKLIDEADVAKLPYLRCIVKETFRIHPQVPFLIPRKV  369

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
              +  ++ GY IPK++Q+LVNVWAIGRD   W+DPL FKPERF E N+ D +G  FE IPF
Sbjct  370   EEDVDLYGYTIPKDSQVLVNVWAIGRDSSLWEDPLDFKPERFWESNI-DVRGQDFELIPF  428

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             G+GRR+CP LPLA RM+P+ALGS++++F+W L  G+ P  +DM+E+ GITL KA PL AI
Sbjct  429   GAGRRICPGLPLAIRMIPIALGSLINTFNWKLDGGIAPKDLDMEEKFGITLAKAQPLLAI  488

Query  1770  PVP  1778
             P+P
Sbjct  489   PIP  491



>ref|XP_009624917.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=495

 Score =   419 bits (1078),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 207/470 (44%), Positives = 305/470 (65%), Gaps = 9/470 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  +P++G++ +LG  P+ S + LA  HGP+MTL LGS+ T+V SS E A+E+ + 
Sbjct  30    LPPGPTGFPIIGSLLELGSKPNHSLANLAKIHGPLMTLKLGSVITIVASSPETAKEILQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L+ R + + +      E +L     G  WR  RR+C+T+ F   RLD+L+ +R + 
Sbjct  90    HDKTLSARTVPDVITAQPNPEATLAWVT-GDKWRNRRRICSTQMFTNQRLDSLQEIRHEK  148

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  +V +MR+   SG AA+DVG   F  + NL+ N +FS DL+DP  E   +F    G +
Sbjct  149   VAQLVNHMRKQCQSG-AAVDVGHVAFATTLNLMSNTIFSIDLVDPEFETAQEFKDLVGTI  207

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME + KPN++D+FP++RWLD QG++R  +    +  +I    +++R+E   +G   +K  
Sbjct  208   MEDSVKPNLSDYFPIIRWLDLQGVKRHIKPAYLRLHEIFDQLIEKRVEDRASGM--KKTG  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL    +   G   F  +TI  ++ ++F AG+DT+  T EWAM ELL NP  LQK
Sbjct  266   DFLDVLLDQCEEEGSG---FDRQTIKPLILDLFLAGSDTSAITTEWAMAELLRNPQKLQK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ E+   +G TE+ ++E  I+KLPYL+AV+KE LRLHP  P L+PH A +   + G+ +
Sbjct  323   VREEILQQIG-TERPVKESDIDKLPYLQAVVKEVLRLHPAAPLLLPHKAQEDTEIFGFIV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN WAI RDPK W+ PL+F PERF++ ++ D+KG  FE+IPFG+GRR+CP +P
Sbjct  382   PKNSQVLVNAWAIVRDPKYWEKPLEFLPERFIKSSV-DYKGRDFEYIPFGAGRRICPGMP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA R + L L S++  F W L  GM P  +DM+E+ G+TLRKA PL AIP
Sbjct  441   LAIRTVNLVLASIVQPFSWKLPKGMAPENLDMEEQFGLTLRKAIPLLAIP  490



>ref|XP_006365963.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=501

 Score =   419 bits (1078),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 305/471 (65%), Gaps = 6/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++G++ QLG  P+ S +ELA  HGP+MTL LGS++TV+ SS E A+E+ + 
Sbjct  29    LPPGPTGLPIIGSLLQLGSKPNQSLAELAKIHGPLMTLKLGSITTVIASSPETAKEILQK  88

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L+ R + +A+      E +L   Q    WR  RR+  T+ F   +LD+L+ +R K 
Sbjct  89    HDKTLSARMVPDAVTSQPNPEATLAWVQSDNMWRNKRRILNTQMFTNQKLDSLQQLRHKK  148

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
              + +V ++R+   +G++ +D+GR  F    NL+   +FS DL+DP S+   +F      +
Sbjct  149   AEQLVCHIRKLCENGSS-VDIGRVAFATMLNLVSRTIFSIDLVDPESDMAQEFKDLVWTI  207

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
              E+AGKPN++D+FP+L+WLD QG+RR  +    +   I    +++R++   +    +   
Sbjct  208   NEYAGKPNLSDYFPVLKWLDLQGVRRHVRPAYIRLHQIFDQLIEKRLDDRASTRKMKVAG  267

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL    D   G   F  +TI  I+ ++F AG+DT+  T EWAMTELL  P  L K
Sbjct  268   DFLDVLLDQCEDKGSG---FDRKTIKPIIVDLFVAGSDTSAITTEWAMTELLRKPEELNK  324

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ E+   +G TE+ ++E  ++KLPYL+AV+KET+RLHP  P L+PH A     +LG+ +
Sbjct  325   VRQEIIQQIG-TERAVKESDMDKLPYLQAVVKETMRLHPAAPLLLPHKAQHDVQVLGFTV  383

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK++QI VN WAIGRDPK W+ PL+F PERF+E ++ D+KG  FEFIPFG+GRR+CP +P
Sbjct  384   PKDSQIFVNAWAIGRDPKYWEKPLEFLPERFMESSV-DYKGRDFEFIPFGAGRRICPGMP  442

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+ L L S++  F+W L  GM   ++DM+E+ G+TL+KA PL AIP 
Sbjct  443   LAIRMVNLMLASMIQPFNWKLPDGMAREELDMEEQFGVTLKKAIPLVAIPC  493



>ref|XP_009613392.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=453

 Score =   417 bits (1073),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/394 (51%), Positives = 282/394 (72%), Gaps = 7/394 (2%)
 Frame = +3

Query  600   NEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNS--GTA  773
             N  SL  A YG +WRMLRR+CTTE F   R++    +R KCID+M++++ +  NS     
Sbjct  54    NSSSLALAPYGTYWRMLRRICTTEMFTNKRINETVHLRRKCIDYMLQWIDKEANSLENGK  113

Query  774   AIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLR  953
              ++V RF +L SFN+IGNLM S DL+DP S+  + FF    KV+E++G+PN++D +P L+
Sbjct  114   GVEVSRFVYLASFNMIGNLMLSHDLVDPESKTASDFFTTLKKVIEWSGRPNISDIYPCLK  173

Query  954   WLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGP  1133
             WLD QG+R+ ++  + KA ++A  ++KERM+    G   EKK D+++VLL++ G+  + P
Sbjct  174   WLDLQGLRQKSEHDMGKAVEVASAFVKERMKEQKEG--REKKNDFVEVLLEFEGNGKDEP  231

Query  1134  ARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLE  1313
             A+ S   IN+ + EMF   ++TT+S+ EWA+TELLHNP  + KV+AEL  VVG   +KLE
Sbjct  232   AKLSEHQINIFILEMFIGESETTSSSSEWALTELLHNPEVMTKVKAELSEVVGN--RKLE  289

Query  1314  EYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDP  1493
             E  I+KL Y++AVIK TLRLHPP+PFL+P  A+     +GY IP++TQ+ VNVWAIGRDP
Sbjct  290   ESDIDKLHYMQAVIKGTLRLHPPIPFLLPRRAVQDTRFMGYDIPEDTQVFVNVWAIGRDP  349

Query  1494  KTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSF  1673
             + W+DPL F+PERFL   + DFKG  +EFIPFG+GR+MC  LPLA+R+L LALGS+L  F
Sbjct  350   EFWEDPLAFRPERFLCSKI-DFKGQCYEFIPFGAGRKMCVGLPLANRILHLALGSLLQEF  408

Query  1674  DWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             DW L   + P+ MDM E++GIT+RK  PLKA+P+
Sbjct  409   DWELPENITPNSMDMTEKIGITVRKVQPLKAVPI  442



>ref|XP_011013817.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=496

 Score =   419 bits (1077),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 210/479 (44%), Positives = 290/479 (61%), Gaps = 11/479 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             RR      LPPGPR+ P++GNI  LG  PH + + L+  +GP+MTL LG ++T+VISS  
Sbjct  27    RRKSRCTVLPPGPRQLPIIGNILALGDKPHRTLANLSQTYGPLMTLKLGRITTIVISSPN  86

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
              A+E  + HD  L+ R + +A++    N  S+I      HW+ L++L  T+ F + RLDA
Sbjct  87    IAKEALQKHDQALSSRTVPDALRVHHKN--SMIWLPASTHWKFLKKLTATQMFTSQRLDA  144

Query  699   LRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAK  878
              R +R K +  ++ Y+ E  ++G  A+DVGR  F    NLI N  FS D+    S+   +
Sbjct  145   SRALRGKKVQELLEYVHEKCSNG-HAVDVGRSVFTTVLNLISNTFFSLDVTTYNSDLSQE  203

Query  879   FFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA  1058
             F      VME  GKPN+AD+FP+LR +DPQGIRR T  ++ +   I    + ER    ++
Sbjct  204   FSDLVVGVMEQIGKPNIADYFPILRLVDPQGIRRKTSNYLKRLTKIFDSIINERTRLRSS  263

Query  1059  GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELL  1238
                 +   D +D LL       E     SS  I ++L + F AGTDTT+ST EWAMTELL
Sbjct  264   SVASKASHDVLDALLILAK---ENNTELSSTDIQILLLDFFNAGTDTTSSTEEWAMTELL  320

Query  1239  HNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
               P  + + + EL+ + G     ++E  I K PYL+A++KET RLHPP PFL+P  A+  
Sbjct  321   LKPDKMVRAKNELQEIEG----PVQESDISKCPYLQAIVKETFRLHPPAPFLLPRKAVSE  376

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               M G+ +PK  QIL+N+WAIGRDP  W DP  FKPERFLE   AD KG  FE IPFG+G
Sbjct  377   VEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPERFLE-CQADVKGRDFELIPFGAG  435

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RR+CP LPLA +M+ L L S++HSFDW +   + P  +DM +  G+TL K  PL+AIP+
Sbjct  436   RRICPGLPLAHKMVHLTLASLIHSFDWKIADDLTPEDIDMSQTFGLTLHKREPLRAIPM  494



>gb|KDP43097.1| hypothetical protein JCGZ_27046 [Jatropha curcas]
Length=493

 Score =   419 bits (1076),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 212/468 (45%), Positives = 297/468 (63%), Gaps = 21/468 (4%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP+ WP+ GNI  LG  PH +  +L  K+GP++ L LG  +T+VI S +AA E+FKNH
Sbjct  39    PPGPKAWPIFGNILDLGSMPHRTLYKLRFKYGPVLWLRLGCANTLVIQSAKAAEELFKNH  98

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  + RK+ E+       +GSL   +YG +WR LRR+ T E   + +++    +R KCI
Sbjct  99    DITFSDRKVAESWTAHNYYQGSLSLGRYGSYWRFLRRIVTVELMTSKKINESTLIRQKCI  158

Query  726   DHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVM  905
             D M  Y+ E   +  A  D G                 +DLL+ RS+ G +F     +VM
Sbjct  159   DKMTEYIEEDVAAANAKGDSG-----------------EDLLNARSKEGTEFSGAMDEVM  201

Query  906   EFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKD  1085
             E+ GKPN+ADFFP L+ LDPQ +++  +  +    +I   ++KER+E       +  K+D
Sbjct  202   EWGGKPNIADFFPFLKGLDPQRVKKNMKVALGITINIVDKFVKERVEEKKL-MKENVKRD  260

Query  1086  YMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKV  1265
             ++D LL+Y GD  +GP + S+  + +I+ EMF AGT+TT+ T EWAMTEL  NP S+ KV
Sbjct  261   FLDALLEYEGD-GKGPDKISTHNMLIIILEMFLAGTETTSGTTEWAMTELFRNPESMMKV  319

Query  1266  QAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIP  1445
             + EL  V+ G ++K++E  I+KLPYL+AVIKET+RLHP +P L+P   +   N +GY IP
Sbjct  320   KEELNQVI-GQKRKVKESDIDKLPYLQAVIKETMRLHPAIPLLIPRNTLQDTNFMGYEIP  378

Query  1446  KETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPL  1625
             K+TQ+ VN W+IGRDP  W+DPL FKPERF+  N+ D+ G +FE +PFGSGRR+C  +PL
Sbjct  379   KDTQVFVNAWSIGRDPDAWEDPLSFKPERFIGSNI-DYNGQNFELLPFGSGRRICVGIPL  437

Query  1626  ASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             A R++  AL S+LH FDW L        +DMKERMG T RK  PLKAI
Sbjct  438   AHRIVHFALASLLHCFDWKLDIYSASDTLDMKERMGFTARKLKPLKAI  485



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score =   419 bits (1076),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 218/485 (45%), Positives = 301/485 (62%), Gaps = 10/485 (2%)
 Frame = +3

Query  321   INERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV  500
             I  RS R+    G LPPGP R P+VGN+  LG  PH S ++LA  HG +M+L LG ++T+
Sbjct  24    ILRRSKRK---SGKLPPGPSRLPIVGNLLDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTI  80

Query  501   VISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFV  680
             V+SS   A+E+ + HD+    R + +A++    +E  +        WR LR++C +  F 
Sbjct  81    VVSSATMAKEVLQKHDLTFCNRTVVDAVRALDHHEAGIAWLPVATRWRNLRKICNSHIFT  140

Query  681   TSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPR  860
             + +LDA + +R K +  ++  ++E    G  A+D+ +  F  + N + N + S DL D  
Sbjct  141   SQKLDANQDLRRKKVQDLLAEVQERCLVG-EAVDLRQAAFTATLNALSNTVLSLDLTDLS  199

Query  861   SERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKER  1040
             S+   +F  H   +M+ AGKPN+ D+FPLLR +DPQGIRR T  H  K FD+    + ER
Sbjct  200   SDIAREFKEHISCIMDEAGKPNLVDYFPLLRRIDPQGIRRRTAIHFGKVFDLFDRLIIER  259

Query  1041  MESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEW  1220
             ++     G      D +D LL      V      ++R I     ++F AGTDTT+STLEW
Sbjct  260   LQLRKVKGY-IPLDDMLDTLLTISE--VNNEEMDATR-IKHFFLDLFGAGTDTTSSTLEW  315

Query  1221  AMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVP  1400
             AM ELLH+P +L K +AEL   +G     LEE  I +LPYL+AVIKETLRLHP +PFL+P
Sbjct  316   AMAELLHSPKTLLKARAELERTIG-EGNLLEESDITRLPYLQAVIKETLRLHPAVPFLLP  374

Query  1401  HMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEF  1580
             H A     + G+ +PK  Q+LVNVWAIGRDP  W+DP  F PERFLE  + D +G +FEF
Sbjct  375   HKAGADAEIGGFTVPKNAQVLVNVWAIGRDPSMWEDPNSFVPERFLESGI-DHRGQNFEF  433

Query  1581  IPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             IPFGSGRR+CP LPLA RMLPL LGS++ SFDW L  G+ P  ++M ++ G+TL KA PL
Sbjct  434   IPFGSGRRICPGLPLAMRMLPLMLGSLILSFDWKLADGVTPENLNMDDKFGLTLLKAQPL  493

Query  1761  KAIPV  1775
             +AIP+
Sbjct  494   RAIPI  498



>sp|D1MI46.1|C76BA_SWEMU RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome 
P450 76B10; AltName: Full=Geraniol 10-hydroxylase; Short=SmG10H 
[Swertia mussotii]
 gb|ACZ48680.1| geraniol 10-hydroxylase [Swertia mussotii]
Length=495

 Score =   417 bits (1073),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 209/462 (45%), Positives = 290/462 (63%), Gaps = 9/462 (2%)
 Frame = +3

Query  393   VGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKI  572
             +GN+  LG  PH S ++LA KHGPIM L LG ++T+V++S   A+E+ +  D+  + R I
Sbjct  42    IGNLHLLGDQPHKSLAKLAKKHGPIMGLQLGQVTTIVVTSSGMAKEVLQKQDLAFSSRSI  101

Query  573   YEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMRE  752
               A+      + S+I       WR LR+   +  F  +RLDA + +R++ +  ++ Y R+
Sbjct  102   PNAIHAHDQYKYSVIWLPVASRWRGLRKALNSNMFSGNRLDANQHLRSRKVQELIAYCRK  161

Query  753   AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVA  932
             +  +G A IDVGR  F  S NL+ N MFSKDL DP S+   +F      VM  AGKPN+ 
Sbjct  162   SSQTGDA-IDVGRAAFRTSLNLLSNTMFSKDLTDPYSDSAKEFKDLVWNVMVEAGKPNLV  220

Query  933   DFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYR  1112
             D+FPLL  +DPQGIR+    H  K  ++ G  + ER++   A G ++   D +DVLL   
Sbjct  221   DYFPLLDKVDPQGIRKRMTIHFGKILELFGGLIDERLQQKKAKGVND---DVLDVLLTTS  277

Query  1113  GDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVG  1292
                 E P       I  +  ++F AGTDTT+STLEWAM+E+L NP  ++  QAEL  V+G
Sbjct  278   E---ESPEEIDRTHIQRMCLDLFVAGTDTTSSTLEWAMSEMLKNPEKMKAAQAELAQVIG  334

Query  1293  GTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNV  1472
                K +EE  + +LPYL+  IKETLR+HPP+P L+P        + GY +PK +Q+LVNV
Sbjct  335   KG-KAVEEADLARLPYLRCAIKETLRIHPPVPLLIPRRTEQEVEVCGYTVPKNSQVLVNV  393

Query  1473  WAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLAL  1652
             WAI RD   WKDPL FKPERFLE  + + +G  FE IPFG+GRR+CP LPLA RM+P+ L
Sbjct  394   WAISRDDAIWKDPLSFKPERFLESEL-EMRGKDFELIPFGAGRRICPGLPLAVRMVPVML  452

Query  1653  GSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             GS+L+SFDW L  G+ P  +DM+E+ GITL+KA PL+A+  P
Sbjct  453   GSLLNSFDWKLEGGIAPKDLDMEEKFGITLQKAHPLRAVATP  494



>ref|XP_011100232.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=547

 Score =   419 bits (1078),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 214/463 (46%), Positives = 304/463 (66%), Gaps = 9/463 (2%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+F LG  PH + + L   +GP++ L +GS++TV + + +AA E+FKNHD   A R I E
Sbjct  79    NMFDLGSMPHKTVAGLKKDYGPVVWLRIGSINTVALLTAKAAAELFKNHDANFAERTITE  138

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM----  746
              MK    ++ +L  + YG +WR+++R+ T E  V  R+     +R +CI  MV ++    
Sbjct  139   VMKVHDFHKTALSLSPYGSYWRVMKRIMTVEMLVQKRIKETEPIRRRCIGDMVEWINKEA  198

Query  747   REAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPN  926
             + A    +  I V RF FL SFN++GNLM S+DL+ P S  G++FF    ++ME++G PN
Sbjct  199   KAAAGGESGRIHVARFVFLASFNMLGNLMLSRDLVSPESVEGSEFFAAMIELMEWSGHPN  258

Query  927   VADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQ  1106
             + D FP L+WLDPQG+RR  +  + +   I G ++ ER++    GG     KD+++VLL+
Sbjct  259   IVDLFPWLKWLDPQGLRRNAERGMARTLKIVGRFVAERLKERQLGGG--AGKDFLEVLLE  316

Query  1107  YRGDLVEGPA-RFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRS  1283
               G+  +      S   +NVI+ E+F AG++TT+S++EWAM ELL +P  ++K + EL  
Sbjct  317   CEGNRNDDQRHNISEHELNVIITEVFLAGSETTSSSIEWAMVELLSHPEIMRKAKNELAR  376

Query  1284  VVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQIL  1463
             VVG +  K EE HIE LPYL+AV+KETLRLHPP+PFLVP  A+   N +GY IPK TQ+ 
Sbjct  377   VVGKS-NKFEESHIESLPYLQAVLKETLRLHPPIPFLVPRRAIQETNFMGYQIPKNTQLF  435

Query  1464  VNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLP  1643
             VN W+IGRDP+ W DPL FKPERFL   + D+KG +FE IPFG+GRR+C  +PLA RML 
Sbjct  436   VNAWSIGRDPECWDDPLSFKPERFLGSKI-DYKGQNFELIPFGAGRRICAGIPLAHRMLH  494

Query  1644  LALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             L LGS+LH FDW +    + +  D +ERMG+T+RK  PL+AIP
Sbjct  495   LLLGSLLHEFDWRVDEIGKNAMTDTRERMGVTVRKVVPLEAIP  537



>ref|XP_010691516.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=500

 Score =   417 bits (1073),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 214/476 (45%), Positives = 290/476 (61%), Gaps = 10/476 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+R P+ GNIF LG  PH SF+ LA  HGP+++L LGS++TVV+SS + A+EMF  
Sbjct  33    LPPGPKRMPIFGNIFDLGEKPHRSFANLAKIHGPLVSLQLGSVTTVVVSSADVAKEMFLK  92

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D  LA R I ++++    ++ S+        WR LR++   +   T RLDA +  R   
Sbjct  93    NDQALANRTIPDSVRAGDHDKLSMSWLPVSAKWRNLRKISAVQLLSTQRLDASQAHRQSK  152

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y+ +    G   +D+GR  F  S NL+ N  FS +L    S    +F      +
Sbjct  153   VQQLLEYVHDCSKKGQP-VDIGRAAFTTSLNLLSNTFFSVELASHESSASQEFKQLMWNI  211

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKER--MESMNAGGNDEK  1076
             ME  G+PN ADFFP+L +LDP GIRR    + ++   +  D + ER  + S N  G  ++
Sbjct  212   MEEIGRPNYADFFPILGYLDPFGIRRRLAGYFDQLIAVFQDIIGERQKIRSANLSGG-KQ  270

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D +D LL    +        S   IN +L ++F AGTDTT STLEWAM EL+ NP  +
Sbjct  271   TNDILDTLLNLYDE-----KELSMGEINHLLVDIFDAGTDTTASTLEWAMAELVKNPDMM  325

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              KVQ E+   +G     ++E  I KLPYL+A+IKETLRLHPP  FL+P  A     + GY
Sbjct  326   VKVQDEIEQAIGKGCSMVQESDISKLPYLQAIIKETLRLHPPTVFLLPRKADADVELYGY  385

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK  Q+LVN+WAIGRDPK WK+P  F PERFLE N+ D+KG  FE +PFG+GRR+CP 
Sbjct  386   VVPKNAQVLVNLWAIGRDPKVWKNPEVFSPERFLESNI-DYKGRDFELLPFGAGRRICPG  444

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             L LA RML L + + LHS+DW L  GM P  +DM E+ GITL+K  PL+ IPVP K
Sbjct  445   LTLAYRMLNLMMANFLHSYDWKLEDGMHPKDLDMDEKFGITLQKVKPLQVIPVPRK  500



>ref|XP_004248012.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=494

 Score =   417 bits (1072),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 219/506 (43%), Positives = 303/506 (60%), Gaps = 13/506 (3%)
 Frame = +3

Query  261   MDYEICGFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFS  440
             MDY    FV +L+     A I  +  ++L      PPGP  WP++GN+  LG  PH+S +
Sbjct  1     MDYYTLVFVSILVLANIIAKICSKGSKKL------PPGPSPWPIIGNLQLLGAKPHISLA  54

Query  441   ELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLIT  620
              LA  +GPIM+L LG ++T+VISS   A+++ K  D   + R    A++     + S+  
Sbjct  55    NLAKNYGPIMSLKLGQITTIVISSSTIAKQVLKTQDQAFSSRFAPNALQAHNHYKFSVAW  114

Query  621   AQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFF  800
                   WR LRR+  T    +++LDA + +R++ +  ++ Y  +    G  A+D+G+  F
Sbjct  115   LPVCPQWRTLRRILNTNLLSSNKLDANQHLRSQKVKQLIDYCDKCSQQG-EALDIGQVVF  173

Query  801   LMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRR  980
               S NL+ N +FSKDL DP S+   +       +M   GKPN+ DFFP+L  +D QGIRR
Sbjct  174   KTSLNLLSNTLFSKDLADPFSDSKVELKEVIWGIMAEVGKPNLVDFFPILEKIDLQGIRR  233

Query  981   MTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTIN  1160
                 H  K F +  D + ER+E     G  EK     DVL  +     + P       I 
Sbjct  234   RAIIHFGKLFKLFDDLINERLEEKKRPGFMEKS----DVLEIFLNITEKNPQEIDHNHIK  289

Query  1161  VILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPY  1340
              +  ++F AGTDTTTSTLEWAM ELL  P  ++K Q EL  ++G   K +EE  + +LPY
Sbjct  290   SMFMDLFGAGTDTTTSTLEWAMAELLKQPEIIKKAQVELAEIIGKG-KLIEEADVFRLPY  348

Query  1341  LKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKF  1520
             L+ +IKETLRLHPP+P LVP        +  Y IPK +Q+LVNVWAIGRD   WKDPL+F
Sbjct  349   LQCIIKETLRLHPPVPLLVPRKVDQDVELCDYIIPKGSQVLVNVWAIGRDFTFWKDPLEF  408

Query  1521  KPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGME  1700
             KPERFL  ++ D +G  FE IPFG+GRR+CP LPLA RM+P+ LGS+L+SF+W L  G+E
Sbjct  409   KPERFLNLDL-DMRGQDFELIPFGAGRRICPGLPLALRMIPVMLGSLLNSFNWKLDAGIE  467

Query  1701  PSQMDMKERMGITLRKATPLKAIPVP  1778
             P ++DM+E+ GITL KA PL+AIP P
Sbjct  468   PQELDMEEKFGITLAKAHPLRAIPSP  493



>emb|CDP17802.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   417 bits (1071),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/479 (43%), Positives = 307/479 (64%), Gaps = 8/479 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             R  +    LPPGP  +P++GN+ QLG  PH SF++L+  +GP+M L LGS +T+++SS +
Sbjct  28    RSRKSAARLPPGPYSFPIIGNLHQLGEKPHQSFAKLSKTYGPLMFLKLGSKATILVSSAD  87

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
              ARE+ + +D + + R    A +    ++ S++       WR +R++C    F T RLDA
Sbjct  88    VAREVLQRYDQLFSSRAAPTAAQALDHHKISMVWLPVLSQWRNIRKMCKENIFATPRLDA  147

Query  699   LRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAK  878
              +G+R + +  +  Y+ ++  S   A++VG   F  S NL+   +FSKD  +  S    +
Sbjct  148   SQGLRQEKLRELCEYLHKSSVS-RKAVNVGDAAFTTSLNLMSRTLFSKDFANYDSNSSQE  206

Query  879   FFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA  1058
                 A  VM+  G  N++D+FP+L+ +DPQGI R T+F+  + FDI  D + ER++    
Sbjct  207   LREVAWGVMKNVGASNLSDYFPVLQRIDPQGIMRDTKFYFQRLFDIFDDIIDERLQVR--  264

Query  1059  GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELL  1238
             G ++ K+KD ++ LL +    ++  + F+   +  +L ++F AG DTT++T+EWAMTELL
Sbjct  265   GTSEAKQKDLLEALLDHS---IKNESEFNRNDLKHLLLDLFVAGIDTTSATVEWAMTELL  321

Query  1239  HNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
              +P  + K +AEL+ V+G  E  ++E  I +LPYL+AVIKET RLHPP P LVPH A + 
Sbjct  322   RSPDKIAKARAELKEVIGEKEG-VQESDISRLPYLQAVIKETFRLHPPAPLLVPHKADED  380

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               + G+ +PK+ Q+LVNVWA GRDP  W DP  F+PERFL  ++ D +G HFE IPFG+G
Sbjct  381   VEINGFIVPKDIQVLVNVWASGRDPTMWSDPENFEPERFLGSDI-DVRGQHFELIPFGAG  439

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RR+CP LPLA RM+ L L S +H+ DW L  GM+P  MDM+E+ G+T++KA PLKAIPV
Sbjct  440   RRICPGLPLAYRMVHLMLASFIHNIDWKLEDGMKPEDMDMEEKFGLTIQKALPLKAIPV  498



>ref|XP_010676979.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=500

 Score =   417 bits (1071),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 211/473 (45%), Positives = 291/473 (62%), Gaps = 7/473 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P+ GN+ + G  PHV  ++LA KHGP+MTL LG + TVVISS   A+E  K 
Sbjct  35    LPPGPWPIPIFGNLVRHGDKPHVGLTQLAEKHGPLMTLQLGQVQTVVISSASMAKEALKT  94

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+    R+  +    +  NE S +    G  WR +R+ CT     T+RL +   +R   
Sbjct  95    HDISFCNRRTVDVFHAERYNENSAVWLPVGPQWRNIRKFCTVHILSTARLVSSERLRRNK  154

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             ++ ++ Y+++   SG  ++D+G+  F  S NL+    FS+DL DP SE   +F      +
Sbjct  155   VNDLIAYVQKCNESGL-SVDIGQAVFTTSLNLLSCTFFSEDLGDPNSELAREFKTTIRAL  213

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AGK N A++FP+LR +D QG RR    H+ K  +I  + + +R++      N  +  
Sbjct  214   MEEAGKLNFANYFPILRKIDLQGGRRRASVHMKKIINIFNNLIDQRLKGKRV-SNSLQDI  272

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DVLL +  D   G  +  +  I  +L ++F  GTDT++ST+EWAM ELL  P  L+K
Sbjct  273   DILDVLLGFDND---GAHKIETSKIPFLLLDVFIGGTDTSSSTVEWAMAELLQKPEKLKK  329

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              QAELR  + G    L+E HI +LPYL+AV+KETLRLHPP+P L P        + G+ +
Sbjct  330   AQAELRENI-GKGNALDESHIFRLPYLRAVVKETLRLHPPVPILAPRKVDADVMIFGFTV  388

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK+ ++L+NVWAIGRDP TWK P  F+PERFL   + DFKGH FE IPFG+GRRMC  LP
Sbjct  389   PKKAELLINVWAIGRDPDTWKHPNSFEPERFLGSEI-DFKGHDFELIPFGAGRRMCLGLP  447

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPY  1781
             LA RML L LGS++H FDW L  G+  + MDM+ER GITL KA  L+A+P  +
Sbjct  448   LAIRMLHLVLGSLIHRFDWKLEAGVSAANMDMEERYGITLAKAKTLRAVPCIF  500



>ref|XP_010053037.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=501

 Score =   416 bits (1070),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/471 (44%), Positives = 294/471 (62%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR  P+VGNI +L   PH + ++L+  +GP+MT+ LG+++T+VISS EAA+E  + 
Sbjct  36    LPPGPRPLPIVGNILELSDKPHQALAKLSKLYGPVMTIKLGAITTIVISSPEAAKEALQK  95

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D +L+GR+I + +K       S++       W+ LR++CT + F   +LDA + +R K 
Sbjct  96    NDQLLSGRQIPDTVKASGHYAESVVWLPASDKWKQLRKVCTVQMFSAQKLDAGQLLRRKK  155

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +D +V ++ ++   G + +D+G+  F    NLI + +FS DL         +F      V
Sbjct  156   VDELVSFIHQSCWQGRS-VDIGKAAFTTVLNLISSTLFSVDLAHHDEGSSQEFRDLVWGV  214

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME  GKPNV+DFFP LRW DPQG RR    + ++   I    ++ER ++  +        
Sbjct  215   MEETGKPNVSDFFPALRWFDPQGARRRISGYFSRLLAIFDRMIEERTQATASSVASSLSN  274

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D L+  +          S   I  +L ++F AG DT+TS+LEWAM ELLHNP  + +
Sbjct  275   DMLDSLINLKES-----GELSRHEIKSLLLDLFIAGVDTSTSSLEWAMAELLHNPEKIAR  329

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              + EL  VV G    L+E  I +LPYL+A++KETLRLHPP+PFL+PH A     + G+ +
Sbjct  330   AREELDRVVSGDGGTLQEPDITRLPYLQAIVKETLRLHPPVPFLIPHKAESDVEIGGFRL  389

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             P+  Q+LVNVWA+GRDP  W +P  F PERFL   + DFKG  FE IPFGSGRR+CP +P
Sbjct  390   PRHAQVLVNVWAMGRDPGVWSNPDSFMPERFLGGEI-DFKGRDFELIPFGSGRRICPGMP  448

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+ L L S+L SFDW L  G+ P +MDM E+ GITL+KATPL AIP+
Sbjct  449   LAYRMVHLILASLLRSFDWKLEEGVTPVEMDMTEKFGITLQKATPLCAIPM  499



>ref|XP_010691514.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=500

 Score =   416 bits (1070),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 214/476 (45%), Positives = 290/476 (61%), Gaps = 10/476 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+R P+ GNIF LG  PH SF+ LA  HGP+++L LGS++TVV+SS + A+EMF  
Sbjct  33    LPPGPKRMPIFGNIFDLGEKPHRSFANLAKIHGPLVSLQLGSVTTVVVSSADVAKEMFLK  92

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D  LA R I ++++    ++ S+        WR LR++   +   T RLDA +  R   
Sbjct  93    NDQALANRTIPDSVRAGDHDKLSMSWLPVSAKWRNLRKISAVQLLSTQRLDASQAHRQSK  152

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y+ +    G   +D+GR  F  S NL+ N  FS +L    S    +F      +
Sbjct  153   VQQLLEYVHDCSKKGQP-VDIGRAAFTTSLNLLSNTFFSVELASHESSASQEFKQLMWNI  211

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKER--MESMNAGGNDEK  1076
             ME  G+PN ADFFP+L +LDP GIRR    + ++   +  D + ER  + S N  G  ++
Sbjct  212   MEEIGRPNYADFFPILGYLDPFGIRRRLAGYFDQLIAVFQDIIGERQKIRSANLSGG-KQ  270

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D +D LL    +        S   IN +L ++F AGTDTT STLEWAM EL+ NP  +
Sbjct  271   TNDILDTLLNLYDE-----KELSMGEINHLLVDIFDAGTDTTASTLEWAMAELVKNPYMM  325

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              KVQ E+   +G     ++E  I KLPYL+A+IKETLRLHPP  FL+P  A     + GY
Sbjct  326   VKVQDEIEKAIGKGCSMVQESDISKLPYLQAIIKETLRLHPPTVFLLPRKADADVELYGY  385

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK  Q+LVN+WAIGRDPK WK+P  F PERFLE N+ D+KG  FE +PFG+GRR+CP 
Sbjct  386   IVPKNAQVLVNLWAIGRDPKVWKNPEVFSPERFLESNI-DYKGRDFELLPFGAGRRICPG  444

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYK  1784
             L LA RML L + + LHS+DW L  GM P  +DM E+ GITL+K  PL+ IPVP K
Sbjct  445   LTLAYRMLNLMMANFLHSYDWKLEDGMHPKDLDMDEKFGITLQKVKPLQVIPVPRK  500



>ref|XP_009626597.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=495

 Score =   415 bits (1066),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 205/470 (44%), Positives = 306/470 (65%), Gaps = 9/470 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  +P++G++ +LG  P+ S + LA  HGP+MTL LGS+ T+V SS E A+E+ + 
Sbjct  30    LPPGPTGFPIIGSLLELGSKPNHSLANLAKIHGPLMTLKLGSVITIVASSPETAKEILQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L+ R + + +      E +L     G  WR  RR+C+T+ F   RLD+L+ +R + 
Sbjct  90    HDKTLSARTVPDVITAQPNPEATLAWVT-GDKWRNRRRICSTQMFTNQRLDSLQEIRHEK  148

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  +V +MR+   S  AA+DVGR  F  + NL+ + +FS DL+DP  E   +F      +
Sbjct  149   VAQLVNHMRKQCQS-RAAVDVGRVAFATTLNLMSSTIFSIDLVDPEFETAQEFKDLVWTI  207

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME + KPN++D+FP++RWLD QG++R  +    +  +I    +++R+E   +G   +K  
Sbjct  208   MEDSVKPNLSDYFPIIRWLDLQGVKRHIKPAYLRLHEIFDQLIEKRVEDRASGM--KKTG  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL    +   G   F  +TI  ++ ++F AG+DT+  T EWAM ELL NP  LQK
Sbjct  266   DFLDVLLDQCEEEGSG---FDRQTIKPLILDLFLAGSDTSAITTEWAMAELLRNPQELQK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ E+   +G TE+ ++E  I+KLPYL+AV+KE +RLHP +P L+PH A +   + G+ +
Sbjct  323   VREEILQQIG-TERPVKESDIDKLPYLQAVVKEVMRLHPAVPLLLPHKAQEDTEIFGFIV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN WAI RDPK W+ PL+F PERF++ ++ D+KG  FE+IPFG+GRR+CP +P
Sbjct  382   PKNSQVLVNAWAIERDPKYWEKPLEFLPERFIKSSV-DYKGRDFEYIPFGAGRRICPGMP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA RM+ L L S++  F W L  GM P  +DM+E+ G+TLRKA PL AIP
Sbjct  441   LAIRMVNLMLASIVQPFSWKLPKGMTPGNLDMEEQFGLTLRKAIPLLAIP  490



>ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33753.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score =   415 bits (1066),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 207/451 (46%), Positives = 292/451 (65%), Gaps = 8/451 (2%)
 Frame = +3

Query  366   PPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNH  545
             PPGP  WP++GNIF LG  PH +  +L  K+GP++ L LG ++T+VI S +AA E+FK H
Sbjct  41    PPGPPAWPIIGNIFDLGGNPHQNLYKLRFKYGPVLWLRLGCINTLVIQSTKAAEELFKRH  100

Query  546   DVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCI  725
             D+  + RK+ ++      N+ SL   QY  HWR  RR  T E     R+     +R KCI
Sbjct  101   DISFSDRKVPQSFTAHNFNKASLALGQYDSHWRFHRRFVTLELMTKKRVHETAAIRQKCI  160

Query  726   DHMVRYMREAGNSGTAAIDVGRF-----FFLMSFNLIGNLMFSKDLLDPRSERGAKFFYH  890
             D+M+RY+ +  ++  A  + G        F++SFNLIGNL+ S+DLL+  SE G KFF  
Sbjct  161   DNMIRYIEDDASAARARGESGELVISHHVFVLSFNLIGNLVLSRDLLNSHSEEGTKFFDA  220

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
              GK ME+ GKPN+ADF PLL   DPQ +++  + ++ +  DI   ++K+ +E        
Sbjct  221   MGKAMEWGGKPNLADFLPLLHPFDPQRVKKNMKQYLGQTIDIVERFVKQSIEEKKLMKER  280

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
             E  +D++D LL+++G   E P   S+  + +I+ E+F  GT+TT+ TLEWAMTEL  +P 
Sbjct  281   E-TRDFLDALLEFKGGAKEEPDAISTHDMLIIILEIFFGGTETTSGTLEWAMTELFRSPE  339

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             S+++V+ EL  V+ G EKK+ E  I++LPYL+AVIKE +RLHP +P L+P    +    +
Sbjct  340   SMRRVKEELNQVI-GPEKKVVESDIDQLPYLQAVIKEAMRLHPVVPLLIPRNTKEDTTFM  398

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             GY+I K+TQ+ VN WAIGRDP  W+DPL FKPERFL  N+ D+KG +FE +PFGSGRR+C
Sbjct  399   GYFIRKDTQVFVNAWAIGRDPDAWEDPLSFKPERFLGSNI-DYKGQNFELLPFGSGRRIC  457

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEP  1703
               +PLA R+L LAL S+LH FDW LG    P
Sbjct  458   VGIPLAHRVLHLALASLLHCFDWELGSNSTP  488



>ref|XP_010661589.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   414 bits (1065),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 304/478 (64%), Gaps = 10/478 (2%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             R   V  LPPGPR +P++GN+ +LG  PH S + L+  +GP+M+L LGS +T+V+SS EA
Sbjct  27    RKSGVARLPPGPRPFPIIGNLLKLGEKPHQSLTILSKTYGPLMSLKLGSTTTIVVSSSEA  86

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             A+E+   +D   + R +  A++    +  S++      HWR LR++C+ + F + R++A 
Sbjct  87    AQEVLNKNDQAFSSRTVLNAIQVADHHHFSIVFLPASAHWRNLRKICSKQMFSSHRVEAG  146

Query  702   RGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             + +R   +  ++ + +E+ +SG A +D+GR  F  + NL+ N +FS +L    S    +F
Sbjct  147   QAMRENIVQQLLGHAQESCSSGRA-VDIGRATFTTTLNLLSNTIFSVNLAHYNSNFSQEF  205

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
                   +ME AGKPN+ADFFP+LR +DPQGI R      NK  ++   ++++R+    + 
Sbjct  206   KDLIWSIMEEAGKPNLADFFPVLRLVDPQGILRRMTVCFNKLVEVFDGFIEQRLPLKASS  265

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
              N++     +++  Q+  +L       SS  +  +L ++F+AGTDTT+ST+EWAM ELL+
Sbjct  266   ANNDVLDGLLNLDKQHDHEL-------SSNDVRHLLVDLFSAGTDTTSSTVEWAMAELLN  318

Query  1242  NPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSC  1421
             NP+ + K ++EL  VVG  EK +EE  I KLPYL+AV+KET RLHPP+PFLVP       
Sbjct  319   NPNLMAKARSELGKVVG-KEKMVEESDISKLPYLQAVVKETFRLHPPVPFLVPRKTEMKS  377

Query  1422  NMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGR  1601
              +LGY +PK   +LVNVWAIGRD   W +P  F PERFLE  + D KG  F+ IPFG+GR
Sbjct  378   EILGYAVPKNAHVLVNVWAIGRDSTIWSNPNSFVPERFLECEI-DVKGRDFQLIPFGAGR  436

Query  1602  RMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             R+CP L L  RM+ L L S+LHSFDW L  G++P  MDM E+ G TLRKA PL+A+P+
Sbjct  437   RICPGLLLGHRMVHLMLASLLHSFDWKLEDGLKPEDMDMTEKFGFTLRKAQPLQAVPI  494



>ref|XP_009777857.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=495

 Score =   414 bits (1063),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 290/472 (61%), Gaps = 8/472 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP++GN+  LG  PH+S + LA  +GPIM+L LG ++T+VISS   A+++ KN
Sbjct  31    LPPGPTPWPIIGNLHLLGQKPHISLANLAKIYGPIMSLKLGQITTIVISSSTMAKQVLKN  90

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D   + R I  A++     + S++       WR LRR+  T    ++RLDA + +R++ 
Sbjct  91    QDQAFSARFIPNALQAHNHYKFSVVWLHVCPQWRTLRRILNTNLLSSNRLDANQHLRSQK  150

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y  +    G   +DVG+  F  + NL+ N +FSKDL DP S+   +       +
Sbjct  151   VKELLAYCAKCCQEGEV-VDVGQVAFKTNLNLLSNTLFSKDLADPFSDSKVELKDVIWGI  209

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M   GKPN+ DFFPLL  +DPQGIRR   FH  K   +    + ER+E  +   + +   
Sbjct  210   MAEVGKPNLVDFFPLLEKIDPQGIRRRATFHFGKLIKLFDGLINERLEEKSRFSSAKS--  267

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
                DVL  +     E P   +   I  ++ ++F AGTDTTTSTLEWAM E++  P  ++K
Sbjct  268   ---DVLEDFLYISEENPEEINHNHIKSMILDLFGAGTDTTTSTLEWAMAEIIRQPEIMEK  324

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              QAEL  V+G   K +EE  + +LPYL+ +IKETLR+HPP PFL+P        M  Y I
Sbjct  325   AQAELAKVIGKG-KIVEEADVSRLPYLQCIIKETLRMHPPAPFLIPRKVEQDVEMFDYII  383

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVNVWAIGRD  +W+DPL FKPERF   ++ D +G  FE IPFG+GRR+CP LP
Sbjct  384   PKGSQVLVNVWAIGRDSTSWEDPLVFKPERFWSSDV-DMRGQDFELIPFGAGRRICPGLP  442

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LA RM+P+ LGS+L+SF W L  G+ P  +DM+E+ GITL  A PL+AIP P
Sbjct  443   LALRMVPVMLGSLLNSFTWKLEPGIAPKDLDMEEKFGITLAIAHPLRAIPSP  494



>ref|XP_009780149.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=493

 Score =   413 bits (1062),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/473 (44%), Positives = 295/473 (62%), Gaps = 13/473 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             L PGP   P++GN+  LG  PH+S ++L+  +GPIM L LG ++TVVISS   ARE+ + 
Sbjct  32    LAPGPFPLPIIGNLHLLGDKPHISLAKLSKIYGPIMNLKLGQVNTVVISSSVLAREVMQK  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+V A R + +A++    ++ S++       WR LR++  +  F  S+LDA + +R K 
Sbjct  92    RDLVFANRSVADALRAQNHSDSSVVFLPVNTRWRTLRKIMNSNIFSGSKLDANQHLRNKK  151

Query  723   IDHMV-RYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
             I  +V  + + A N GT  +D+GR  F  S NL+ N +FSKDL DP S+   +F      
Sbjct  152   IQELVDHFHKSAKNGGT--VDIGRAAFRTSLNLLSNTIFSKDLSDPFSDSAKEFKDLVWG  209

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             +M  AGKPN+ D+FP L  +DPQGIRR    H  K  D+    + ER++       +   
Sbjct  210   IMVEAGKPNLVDYFPFLVKIDPQGIRRRMTDHFTKVLDLMSGLIDERLKERKL--RNHAN  267

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
              D +D LL         P  F    I  +  ++F AGTDTT++TLEWA+ ELL NP +L+
Sbjct  268   VDVLDALLNI------SPEEFDRNHIEHLCLDLFVAGTDTTSNTLEWAVAELLKNPHTLE  321

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             K Q EL  V+G   K ++E  I +LPYL+ ++KETLR+HP LPFL+P    +     GY 
Sbjct  322   KAQEELAHVIG-RGKLVDETDIAQLPYLRCIVKETLRIHPALPFLIPRKVEEDVEFCGYI  380

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             +PK++Q+LVNVWAIGRD   W++PL FKPERF E  + D +G  FE IPFG+GRR+CP L
Sbjct  381   VPKDSQVLVNVWAIGRDSDLWENPLDFKPERFWESEI-DVRGRDFELIPFGAGRRICPGL  439

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             PLA RM+P+ALGS+L++F+W L  G+ P  +DM+E+ GITL KA PL A P+P
Sbjct  440   PLAIRMVPVALGSLLNTFNWKLQGGIAPKDLDMEEKFGITLGKAQPLLATPIP  492



>ref|XP_011029123.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=501

 Score =   413 bits (1062),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 214/478 (45%), Positives = 296/478 (62%), Gaps = 6/478 (1%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             + E  G LPPGP   P++GN+  LG  PH S + LA  HGP+M+L LG ++TVVISS   
Sbjct  29    KTESSGKLPPGPAALPIIGNLLDLGDKPHKSLARLAKTHGPLMSLKLGQITTVVISSPTL  88

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             A+E+ + HDV L+ R I +A++    +E  L        WR LR++C +  F   +LDA 
Sbjct  89    AKEVLQKHDVSLSNRTIPDAIRSHKHHELGLPWVPIAMRWRNLRKVCNSYIFTNQKLDAN  148

Query  702   RGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             + +R K I  +V  ++E   +G A + +G+  F  + N + N +FS +L D  SE  ++ 
Sbjct  149   QELRLKKIQELVALVQEHCLAGEAMV-IGQAAFTTALNALSNSIFSLNLSDSNSETASQL  207

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
                 G +ME AGKPN+AD+FP+L  +D QGI+R    H  K  +I    + ER++     
Sbjct  208   KEVVGCIMEEAGKPNLADYFPVLGRIDLQGIKRRMTIHFGKILNIFDGIVNERLQLRKMQ  267

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
             G      D +D LL    D  E   + S   I  +  ++F AGTDTT+STLEWAM ELLH
Sbjct  268   GY-VPVNDMLDTLLTISEDSNEDIMKTSQ--IKHLFLDLFAAGTDTTSSTLEWAMAELLH  324

Query  1242  NPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSC  1421
             NP +L K + EL   +G     +EE  I +LPYL+AVIKET RLHP +P L+P  A ++ 
Sbjct  325   NPRTLSKARTELEQTIGKG-CLIEESDIVRLPYLQAVIKETFRLHPAVPLLLPRKAGENV  383

Query  1422  NMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGR  1601
              + GY IPK  Q+ VNVWAIGRDP  W+DP  F PERFL  ++ D +G +FE IPFG+GR
Sbjct  384   EISGYTIPKGAQLFVNVWAIGRDPSLWEDPESFVPERFLGSDI-DARGRNFELIPFGAGR  442

Query  1602  RMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             R+CP LPLA RMLP+ LGS++HSFDW L +G+ P  MDM+++ GITL KA  L+A+P+
Sbjct  443   RICPGLPLAMRMLPMMLGSLIHSFDWKLENGVTPESMDMEDKFGITLEKAQSLRAVPI  500



>ref|XP_010692297.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   412 bits (1059),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 202/472 (43%), Positives = 300/472 (64%), Gaps = 16/472 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP++GNIF+LG  PH S +ELA  +GPIM+L LGS++T+VISS E AREMF  
Sbjct  28    LPPGPTPWPIIGNIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLK  87

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  +GR   +A++    ++ S++    G  WR LR++ T + F   RLDA + +R K 
Sbjct  88    HDLDFSGRANTDALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKK  147

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +D ++ Y R     G   +++G+  F  + NL+ +  FSKDL    S    +F   A  +
Sbjct  148   VDELIEYARHCSERGL-PLNIGKAAFTTTLNLLSSTFFSKDLASHDSSSSQEFKDIASNI  206

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME   KPN++DFFP+++ LD QGI + +  +V +  ++    + ER        + ++K 
Sbjct  207   MEEGAKPNLSDFFPIVKSLDLQGILKRSTGYVTQLMELFERIIDER--------STDEKD  258

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +  LL+   D      + S   +  +L ++F AGTDTT+++LEWAM  L+ +P  + K
Sbjct  259   DVLGTLLKLAKD-----DKLSLEEVKHMLVDLFVAGTDTTSNSLEWAMALLIRHPEKIAK  313

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              Q+E+  V+ G + K++E  I KLPY+++++KE +RL+PP PFL+PH A     + GY +
Sbjct  314   AQSEMDEVL-GKDGKMQESDIAKLPYVQSILKEVMRLYPPAPFLIPHKAEQDVPLGGYLV  372

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK + I VNV++IG DP+ W+DP  F PERFLE N+ DFKG  FE +PFGSGRR+CP +P
Sbjct  373   PKNSTIWVNVYSIGHDPRVWQDPEIFSPERFLETNV-DFKGQDFELLPFGSGRRICPGIP  431

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LA RM+ + LG +LHSF+W   HG  P  +DM+E+ GI L+KA PL+AIP+P
Sbjct  432   LAHRMVQMMLGVLLHSFNWKYAHGTNPKDIDMEEKFGIALQKAEPLQAIPLP  483



>ref|XP_009782145.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=499

 Score =   412 bits (1059),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 306/470 (65%), Gaps = 9/470 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  +P++G++ +LG  P+ S + LA  HG +MTL LGS+ T+V SS E A+E+ + 
Sbjct  30    LPPGPTGFPIIGSLLELGSKPNHSLANLAKIHGSLMTLNLGSVITIVASSPETAKEILQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L+ R + + +      E +L     G  WR  RR+C+T+ F   RLD+L+ +R + 
Sbjct  90    HDKTLSARTVPDVITAQPNPEATLAWVT-GDKWRNRRRICSTQMFTNQRLDSLQEIRHEK  148

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  +V +MR+   +G AA+D+GR  F  + NL+ + +FS DL+DP  E   +F     ++
Sbjct  149   VAQLVNHMRKQCQNG-AAVDIGRVAFATTLNLMSSTIFSVDLVDPEFETAQEFKDLVWRI  207

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME + KPN++D+FP +RWLD QG++R  +    +  +I    +++R+E   +G   +K  
Sbjct  208   MEDSVKPNLSDYFPFIRWLDLQGVKRHIKPAYLRLHEIFDQVIEKRVEDRASGM--KKTG  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL    +   G   F  +TI  ++ ++F AG+DT+  T EWAM ELL NP +L+K
Sbjct  266   DFLDVLLDQCEEEGSG---FDRQTIKPLILDLFLAGSDTSAITTEWAMAELLRNPQTLRK  322

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ E+   +G TE+ ++E  I+KLPYL+AV+KE +RLHP +P L+PH A +   + G+ +
Sbjct  323   VREEILQQIG-TERPVKESDIDKLPYLQAVVKEVMRLHPAVPLLLPHKAQEDAEIFGFIV  381

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVN WAI RDPK W+ PL+F PERF+  ++ D+KG  FE+IPFG+GRR+CP +P
Sbjct  382   PKNSQVLVNAWAIERDPKYWEKPLEFLPERFINSSV-DYKGRDFEYIPFGAGRRICPGMP  440

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA RM+ L L S++  F W L  GM P  +DM+E+ G+TLRKA PL AIP
Sbjct  441   LAIRMVNLMLASIVQPFSWKLPKGMAPENLDMEEQFGLTLRKAIPLLAIP  490



>ref|XP_004233425.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=492

 Score =   411 bits (1057),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/483 (43%), Positives = 300/483 (62%), Gaps = 15/483 (3%)
 Frame = +3

Query  333   SHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             S RR + V    PGP   P++GN+  LG  PH+S ++LA K+GPIM L LG ++ VVISS
Sbjct  23    SVRRSKRVA---PGPFPLPIIGNLHLLGHKPHISLTQLAKKYGPIMNLKLGQINAVVISS  79

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI-TAQYGQHWRMLRRLCTTEFFVTSR  689
                A+E  +  D+  + R + +A++    ++ S+I        WR LR++  +  F  ++
Sbjct  80    SVLAKEAMQKQDLAFSNRFVIDAIRACNHDDFSVIWLPVNNSQWRTLRKIMNSHIFSGNK  139

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
             LDA   +RTK +  ++ Y  ++   G A +D+GR  F  S NL+ N +FSKDL DP S+ 
Sbjct  140   LDANEHLRTKKMQELIDYCHKSSKVGEA-VDIGRAAFRTSLNLLSNTIFSKDLTDPFSDS  198

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
               +F     K+M  AGKPN+ D+FP L+ +DPQGIRR +  +  +      D + ER++ 
Sbjct  199   AKEFKELVWKIMVEAGKPNLVDYFPFLKKIDPQGIRRRSTNYFTEILHRMSDLIDERLKE  258

Query  1050  MNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
                G  + +  D +D LL         P       I  +  ++F AGTDTT++TLEWAM 
Sbjct  259   RELG--NRENIDVLDALLDI------SPDEIDRNQIEHLCLDLFAAGTDTTSNTLEWAMA  310

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELL NP +L+K Q EL  V+G   K ++E  + KLPYL+ ++KET R+HP  PFL+P   
Sbjct  311   ELLKNPRALEKAQKELEQVIGRG-KPIDEADVAKLPYLRCIVKETFRIHPQAPFLIPRKV  369

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
              +   + GY I K++Q+LVNVWAIGRD   W+DPL FKPERF E ++ DF+G  FE IPF
Sbjct  370   EEDVELYGYTIRKDSQVLVNVWAIGRDSSLWEDPLNFKPERFWESDI-DFRGRDFELIPF  428

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             G+GRR+CP LPLA RM+P+ALGS++++F+W L  G+ P  +DM+E+ GITL KA PL AI
Sbjct  429   GAGRRICPGLPLAIRMIPIALGSLINTFNWKLHGGIAPKDLDMEEKFGITLAKAQPLLAI  488

Query  1770  PVP  1778
             PVP
Sbjct  489   PVP  491



>emb|CDP20559.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   410 bits (1055),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 202/479 (42%), Positives = 299/479 (62%), Gaps = 8/479 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             R  +    LPPGP  +P++GN+ Q+G  PH S+++L+  +GP+M+L LGS +TV++SS  
Sbjct  26    RSRKSAARLPPGPYSFPIIGNLHQVGQNPHQSYAKLSKTYGPLMSLKLGSKATVLVSSAN  85

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
              ARE+ + +D + +GR    A      ++ S++       WR LR++C    F T RLD 
Sbjct  86    VAREVLQKYDQMFSGRSATGAAHTLDHHKVSMVWLPVSSQWRNLRKMCKENIFATQRLDT  145

Query  699   LRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAK  878
              +G+R + +  +  Y+  +  S   A++VG   F  S NLI   +FSKD  D  S+   +
Sbjct  146   SQGLRQEKLQELRDYLHRSSVS-RKAVNVGDAAFTTSLNLISRTLFSKDFADYDSDSSQE  204

Query  879   FFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA  1058
                    VM+  G  N++D+FP+LR +DPQGI R  +F+  K FDI  D + ER++    
Sbjct  205   LQEIVWGVMKNVGAFNLSDYFPVLRVIDPQGIMRDAKFYFQKLFDIFDDIINERLQVR--  262

Query  1059  GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELL  1238
             G ++ KK D ++ LL +    ++    F S  +  +L ++F AG DTT++T+EWAM ELL
Sbjct  263   GASETKKNDLLEALLDHS---IKNEFEFGSNDLKHLLLDLFVAGADTTSTTVEWAMAELL  319

Query  1239  HNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
              +P    K +AEL+ ++G  E+ ++E  I +LPYL+AVIKET RLHP  P LVPH A + 
Sbjct  320   RSPDKFAKARAELKEIIG-QEEVVQESDISRLPYLQAVIKETFRLHPAAPLLVPHKANED  378

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               + GY +PK TQ+L+N WA GRDP TW DP  F+PERFL+ ++ D +G HFE IPFG+G
Sbjct  379   VEINGYIVPKNTQVLINAWASGRDPTTWSDPEIFEPERFLDRDI-DARGQHFELIPFGAG  437

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RR+CP LPLA RM+ L L + +H+ DW L  GM+P  +DM E+ G+++ KA PL+AIPV
Sbjct  438   RRICPGLPLAYRMVHLMLAAFIHNIDWKLEEGMKPEDLDMDEKFGLSVPKALPLEAIPV  496



>ref|XP_009787971.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=492

 Score =   410 bits (1054),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 296/472 (63%), Gaps = 12/472 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             L PGP   P++GN+  LG  PH S ++L+  +GPIM L LG ++TVVISS   ARE+ + 
Sbjct  32    LAPGPFPLPIIGNLHLLGDKPHKSLAKLSKIYGPIMNLKLGQVNTVVISSSVLAREVMQK  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+V A R + +A++    ++ S++       WR LR++  +  F  S+LDA + +RTK 
Sbjct  92    RDLVFANRSVADALRARNHSDSSVVFLPVNTRWRTLRKIMNSNIFSGSKLDANQHLRTKK  151

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             I+ +V +  ++  +G A +D+GR  F  S NL+ N +FSKDL DP S+   +F      +
Sbjct  152   IEELVDHFHKSAKNG-ATVDIGRAAFRTSLNLLSNTIFSKDLSDPFSDSAKEFKDLVWGI  210

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  AGKPN+ D+FP L  +DPQGIRR    H  K  D+    + ER++       +    
Sbjct  211   MVEAGKPNLVDYFPFLVKIDPQGIRRRMTDHFTKVLDLMSGLIDERLKERKL--RNHANV  268

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL    +L           I  +  ++F AGTDTT++TLEWA+ ELL NP +L+K
Sbjct  269   DVLDALLNISPEL-------DRNHIEHLCLDLFVAGTDTTSNTLEWAVAELLKNPHTLEK  321

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              Q EL  V+G   K ++E  I +LPYL+ ++KETLR+HP LPFL+P    +     GY +
Sbjct  322   AQEELAHVIG-RGKLVDETDIAQLPYLRCIVKETLRIHPALPFLIPRKVEEDVEFCGYIV  380

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK++Q+LVNVWAIGRD   W++PL FKPERF E  + D +G  FE IPFG+GRR+CP LP
Sbjct  381   PKDSQVLVNVWAIGRDSDLWENPLDFKPERFWESEI-DVRGRDFELIPFGAGRRICPGLP  439

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LA RM+P+ALGS+L++F+W L  G+ P  +DM+E+ GITL KA PL A P+P
Sbjct  440   LAIRMVPVALGSLLNTFNWKLQGGIAPKDLDMEEKFGITLGKAQPLLATPIP  491



>ref|XP_009596429.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=497

 Score =   409 bits (1052),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 292/471 (62%), Gaps = 8/471 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             L PGP   P++GN+  LG  PH+S ++L+  HGPIM L LG ++TVVISS   ARE+ + 
Sbjct  32    LAPGPFPLPIIGNLHLLGDKPHISLAKLSKIHGPIMNLKLGQINTVVISSSVLAREVMQK  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  A R + +A++    ++ S++       WR LR++  +  F  ++LDA + +RTK 
Sbjct  92    RDLAFANRSVADALRARNHSDFSVVFLPVNSRWRTLRKIMNSNIFSGNKLDANQHLRTKK  151

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             I  +V +  ++  +G   +D+GR  F  S NL+ N +FSKDL DP S+   +F      +
Sbjct  152   IQELVDHCHKSAKNGET-VDIGRAAFRTSLNLLSNTIFSKDLSDPFSDSAKEFKDLVWSI  210

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  AGKPN+ D+FP L  +DPQGIRR    H  K  D+    + ER++       +    
Sbjct  211   MVEAGKPNLVDYFPFLVKIDPQGIRRRMTDHFTKILDLMSGLIDERLKERKL--RNHANV  268

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL    D    P       I  +  ++F AGTDTT++TLEWAM ELL NP  L+K
Sbjct  269   DVLDALLNISHD---SPEELDRNLIEQMCLDLFAAGTDTTSNTLEWAMAELLQNPHILEK  325

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              Q EL  ++G   K ++E  I +LPYL+ ++KETLR+HP LPFL+P    +   + GY +
Sbjct  326   AQEELAQMIG-RGKLVDEADIAQLPYLRCIVKETLRIHPALPFLIPRKVEEDVELCGYIV  384

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK++Q+LVNVWAIGRD   W++PL FKPERF E  + D +G  FE IPFG+GRR+CP LP
Sbjct  385   PKDSQVLVNVWAIGRDSGLWENPLVFKPERFWESEI-DVRGQDFELIPFGAGRRICPGLP  443

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+P+ALGS+L++ +W L  G+ P  +DM+E+ GITL KA PL A P+
Sbjct  444   LAIRMIPVALGSLLNTLNWKLQGGIAPKDLDMEEKFGITLGKAQPLLATPL  494



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score =   409 bits (1051),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/471 (44%), Positives = 294/471 (62%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++GN+  LG  PH S +ELA  +GPIMTL LG ++T+VISS   A+E+ + 
Sbjct  34    LPPGPVPLPIIGNLLNLGNRPHESLAELAKTYGPIMTLKLGYVTTIVISSAPMAKEVLQK  93

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+    R + +A++    N+ S+        WR+LR++C +  F T +LD+   +R   
Sbjct  94    QDLSFCNRFVPDAIRATNHNQLSMAWMPVSTTWRVLRKICNSHLFTTQKLDSNTHLRHHK  153

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++  + E+  +G A + +GR  F  S NL+ N +FS DL+DP SE   +F      +
Sbjct  154   VQELLAKVEESRQAGDA-VYIGREAFRTSLNLLSNTIFSVDLVDPISETVLEFQELVRCI  212

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             +E   +PN+ D+FP+LR +DPQGIRR    +  K   I    +K+R++     G+     
Sbjct  213   IEEIERPNLVDYFPVLRKIDPQGIRRRLTIYFGKMIGIFDRMIKQRLQLRKMQGSI-ATS  271

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL    D            +  +L ++F AGTDTT+STLEWAM ELLHNP  L K
Sbjct  272   DVLDTLLNISED---NSNEIERNHMEHLLLDLFVAGTDTTSSTLEWAMAELLHNPEKLLK  328

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              + EL   +G  +K+++E  I +LP+L+AV+KET RLHP +PFL+PH   +  ++ G  +
Sbjct  329   ARVELLQTIGK-DKQVKESDITRLPFLQAVVKETFRLHPVVPFLIPHRVEEDTDIDGLTV  387

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK  Q+LVN WAIGRDP  W++P  F PERFLE +M D KG +FE IPFG+GRR+CP LP
Sbjct  388   PKNAQVLVNAWAIGRDPNIWENPNSFVPERFLELDM-DVKGQNFELIPFGAGRRICPGLP  446

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA+RM+ L L S++HS DW L  GM P  M+M++R GITL+KA PLKAIP+
Sbjct  447   LATRMVHLMLASLIHSCDWKLEDGMTPENMNMEDRFGITLQKAQPLKAIPI  497



>ref|XP_010508150.1| PREDICTED: cytochrome P450 76C1 isoform X1 [Camelina sativa]
Length=512

 Score =   409 bits (1052),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 205/486 (42%), Positives = 304/486 (63%), Gaps = 11/486 (2%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             RS +   +  ALPPGP R P++GNI  +G  PH SF+EL+  +GP+M+L LGS++TVVIS
Sbjct  28    RSRQTSRKATALPPGPPRLPIIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIS  87

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI-TAQYGQHWRMLRRLCTTEFFVTS  686
             S +AARE+ + HD +L+GR    +++     + SL+        WR+ RRL  T+ F   
Sbjct  88    SPQAAREVLRTHDQILSGRSPTNSIRSINHQDASLVWLPASSARWRLYRRLSVTQLFSPQ  147

Query  687   RLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSE  866
             RL+A + +R   +  +V ++ E+ +    ++D+ R  F+ + N+I N++FS DL    ++
Sbjct  148   RLEATKAMRANKVKELVSFISESSDR-EESVDISRASFITTLNIISNILFSADLGSYNTK  206

Query  867   RGAKFFYHAG-KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
                         VME  GKP+ A++FPLLR+LD QG R+  +  + + F +   ++  ++
Sbjct  207   DSINGVQDTVISVMEVVGKPDAANYFPLLRFLDLQGNRKTMKVCIERLFRVFRGFIDAKI  266

Query  1044  ESMNAGGN--DEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
                ++  N  D  K D++D LL Y+GD     A  +   I  ++ +MFTAG+DT++STLE
Sbjct  267   AEKSSQSNPKDVSKNDFVDNLLNYKGD----EAEINISDIEHLVLDMFTAGSDTSSSTLE  322

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WAM ELL NP ++ K QAE+  V+G     +E+  I +LPYL+AV+KET RLHP  PFLV
Sbjct  323   WAMAELLRNPKTMVKAQAEIDRVIG-QNGIVEDSDISELPYLQAVVKETFRLHPGAPFLV  381

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             P  A     +LG+ + K+TQ+LVNVW IGRDP  W++P +F+PERFL   + D +G  +E
Sbjct  382   PRKAESDVEILGFMVLKDTQVLVNVWGIGRDPSVWENPTRFEPERFLGKEI-DLRGRDYE  440

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
             F PFG+GRR+CP LPLA + + L L S+L+SFDW L +G+    +DM E  GITL K  P
Sbjct  441   FTPFGAGRRICPGLPLAVKTVSLMLASLLYSFDWKLPNGLVSEDLDMDETFGITLHKTNP  500

Query  1758  LKAIPV  1775
             L A+PV
Sbjct  501   LHAVPV  506



>ref|NP_001268152.1| ripening-related P-450 enzyme-like [Vitis vinifera]
 emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera]
Length=499

 Score =   408 bits (1049),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 295/471 (63%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++G++  LG  PH S + LA  +GPIMTL LG ++T+VISS   A+E+ + 
Sbjct  34    LPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIMTLKLGYVTTIVISSAPMAKEVLQK  93

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+    R I +A++    N+ S+        WR LRR C +  F + +LD+   +R + 
Sbjct  94    QDLSFCNRSIPDAIRAAKHNQLSMAWIPVSTTWRALRRTCNSHLFTSQKLDSNTHLRHQK  153

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++  + ++  +G   +D+G+  F  S NL+ N +FS DL+DP SE   +F      V
Sbjct  154   VQELLANVEQSCQAG-GPVDIGQEAFRTSLNLLSNTIFSVDLVDPISETAQEFKELVRGV  212

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AGKPN+  +FP+LR +DPQGIRR    +  +  +I    +K+R++     G+     
Sbjct  213   MEEAGKPNLVYYFPVLRQIDPQGIRRRLTIYFGRMIEIFDRMIKQRLQLRKIQGSI-ASS  271

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DVLL    D            +  +L ++F AGTDTT+STLEWAM ELLHNP +L K
Sbjct  272   DVLDVLLNISED---NSNEIERSHMEHLLLDLFAAGTDTTSSTLEWAMAELLHNPETLLK  328

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              + EL   +G  +K+++E  I +LPYL+AV+KET RLHP +PFL+P       ++ G+ +
Sbjct  329   ARMELLQTIG-QDKQVKESDISRLPYLQAVVKETFRLHPAVPFLLPRRVEGDADIDGFAV  387

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK  Q+LVN WAIGRDP TW++P  F PERFL  +M D KG +FE IPFG+GRR+CP LP
Sbjct  388   PKNAQVLVNAWAIGRDPNTWENPNSFVPERFLGLDM-DVKGQNFELIPFGAGRRICPGLP  446

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+ L L S++HS+DW L  G+ P  M+M+ER GI+L+KA PL+A+PV
Sbjct  447   LAIRMVHLMLASLIHSYDWKLEDGVTPENMNMEERYGISLQKAQPLQALPV  497



>ref|XP_006360240.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   408 bits (1048),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/483 (43%), Positives = 299/483 (62%), Gaps = 15/483 (3%)
 Frame = +3

Query  333   SHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             S RR + V    PGP   P++GN+  LG  PH+S ++LA K+GPIM L LG ++TVVISS
Sbjct  23    SLRRSKRVA---PGPFPLPIIGNLHFLGNKPHISLAQLAKKYGPIMHLKLGQINTVVISS  79

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKG-DFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
                A+E+ +  D+  +GR + + +   +  N   ++       WR LR++  +  F  ++
Sbjct  80    SILAKEVMQKQDLSFSGRFVPDGVHACNHSNYSVVMLPVNNSQWRTLRKVMNSHIFSGNK  139

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
             LDA + +RTK I  ++ Y  ++G +   A+D+GR  F  S NL+ N +FSKDL DP S+ 
Sbjct  140   LDANKHLRTKKIQELIDYCHKSGQN-CEAVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDS  198

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
               +F      +M  AGKPN+ DFFP L+ +DPQGIRR    H +K   +    + ER++ 
Sbjct  199   DKEFKGWVWNIMAEAGKPNLVDFFPFLKKIDPQGIRRRLTNHFSKVLQLMSGLIDERLKE  258

Query  1050  MNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
                   + +  D +D LL         P       I  +  ++F AGTDTT++TLEWAM 
Sbjct  259   REMA--NRENVDVLDALLSI------SPEEIDRNHIKHLCLDLFAAGTDTTSNTLEWAMA  310

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELL NP +L+K Q EL  V+G   K ++E  + +LPYL+ ++KE LRLHPP+ FL+P   
Sbjct  311   ELLKNPHTLEKAQKELAQVIG-RGKLVDEVDVAQLPYLQCIVKEALRLHPPVSFLIPRKV  369

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
              +   + GY IPK +Q+LVNVWAIGRD   W++PL FKPERF E  + D +G  FE IPF
Sbjct  370   EEDVELCGYTIPKGSQVLVNVWAIGRDSGIWENPLDFKPERFWESEI-DLRGRDFELIPF  428

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             G+GRR+CP LPLA RM+P+ALGS++++F+W L  G+ P+ +DM+E+ GITL KA PL AI
Sbjct  429   GAGRRICPGLPLAIRMIPVALGSLINTFNWKLHGGIAPNDLDMEEKFGITLAKAQPLLAI  488

Query  1770  PVP  1778
             P P
Sbjct  489   PTP  491



>ref|XP_006360238.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=493

 Score =   408 bits (1048),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/483 (43%), Positives = 297/483 (61%), Gaps = 14/483 (3%)
 Frame = +3

Query  333   SHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             S RR + V    PGP   P++GN+  LG  PH+S ++LA K+GPIM L LG ++ VVISS
Sbjct  23    SLRRTKRVA---PGPFPLPIIGNLHLLGHKPHISLTQLAKKYGPIMNLKLGQINAVVISS  79

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQH-WRMLRRLCTTEFFVTSR  689
                A+E+ +  D+  + R + +A +    N+ S I      + WR LR++  +  F  ++
Sbjct  80    SVLAKEVMQKQDLAFSNRFVIDASRACNHNDFSAIWLPVDNYKWRTLRKIMNSHIFSGNK  139

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
             LDA   +RTK I  ++ Y  ++   G A +D+GR  F    NL+ N +FSKDL DP S+ 
Sbjct  140   LDANEHLRTKKIQELIDYCHKSSKVGEA-VDIGRATFRTFLNLLSNTIFSKDLTDPFSDS  198

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
               +F     K+M   GKPN+ D+FP L+ +DPQGIRR +  +  K   I  D + ER++ 
Sbjct  199   AKEFKELVWKIMVEIGKPNLVDYFPFLKKIDPQGIRRRSSDYYTKILHIMSDLIDERLKE  258

Query  1050  MNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
                G  + +  D +D LL      +          I  +  ++F AGTDTT++TLEWAM 
Sbjct  259   RELG--NRENVDVLDALLD-----ISAADEIDRNQIEQLCLDLFAAGTDTTSNTLEWAMA  311

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELL NP + +K Q EL  V+G   K ++E  + +LPYL+ ++KE LRLHPP+ FL+P   
Sbjct  312   ELLKNPHTFEKAQEELAQVIG-RGKLVDEVDVAQLPYLQCIVKEALRLHPPVSFLIPRKV  370

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
              +   + GY IPK +Q+LVNVWAIGRD   W++PL FKPERF E  + D +G  FE IPF
Sbjct  371   EEDVELCGYTIPKGSQVLVNVWAIGRDSGIWENPLDFKPERFWESEI-DLRGRDFELIPF  429

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             G+GRR+CP LPLA RM+P+ALGS++++F+W L  G+ P  +DM+E+ GITL KA PL AI
Sbjct  430   GAGRRICPGLPLAIRMIPIALGSLINTFNWKLDGGIAPKDLDMEEKFGITLAKAQPLLAI  489

Query  1770  PVP  1778
             P+P
Sbjct  490   PIP  492



>ref|XP_010658029.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
 ref|XP_010658036.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
Length=499

 Score =   408 bits (1049),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 205/471 (44%), Positives = 295/471 (63%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++G++  LG  PH S + LA  +GPIMTL LG ++T+VISS   A+E+ + 
Sbjct  34    LPPGPVPLPIIGSLLNLGNRPHESLANLAKTYGPIMTLKLGYVTTIVISSAPMAKEVLQK  93

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+    R I +A++    N+ S+        WR LRR C +  F   +LD+   +R + 
Sbjct  94    QDLSFCNRSIPDAIRAAKHNQLSMAWLPVSTTWRALRRTCNSHLFTPQKLDSNTHLRHQK  153

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++  + ++  +G   +D+G+  F  S NL+ N +FS DL+DP SE   +F      V
Sbjct  154   VQELLANVEQSCQAG-GPVDIGQEAFRTSLNLLSNTIFSVDLVDPISETAQEFKELVRGV  212

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AGKPN+ D+FP+LR +DPQ IRR    +  +  +I    +K+R++     G+     
Sbjct  213   MEEAGKPNLVDYFPVLRRIDPQSIRRRLTIYFGRMIEIFDRMIKQRLQLRKNQGSI-ASS  271

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +DVLL    D     +      +  +L ++F AGTDTT+STLEWAM ELLHNP +L K
Sbjct  272   DVLDVLLNISED---NSSEIERSHMEHLLLDLFAAGTDTTSSTLEWAMAELLHNPETLLK  328

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              + EL   +G  +K+++E  I +LPYL+AV+KET RLHP +PFL+P       ++ G+ +
Sbjct  329   ARMELLQTIG-QDKQVKESDISRLPYLQAVVKETFRLHPAVPFLLPRRVEGDADIDGFAV  387

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK  Q+LVN WAIGRDP TW++P  F PERFL  +M D KG +FE IPFG+GRR+CP LP
Sbjct  388   PKNAQVLVNAWAIGRDPNTWENPNSFVPERFLGLDM-DVKGQNFELIPFGAGRRICPGLP  446

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RM+ L L S++HS+DW L  G+ P  M+M+ER GI+L+KA PL+A+PV
Sbjct  447   LAIRMVHLMLASLIHSYDWKLEDGVTPENMNMEERYGISLQKAQPLQALPV  497



>ref|XP_010053039.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77278.1| hypothetical protein EUGRSUZ_D01636 [Eucalyptus grandis]
Length=506

 Score =   408 bits (1049),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 205/476 (43%), Positives = 293/476 (62%), Gaps = 12/476 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR  P+VGNI +L   PH + ++L+  +GP+MT+ LG+++T+VISS EAA+E  + 
Sbjct  36    LPPGPRPLPIVGNILELSDKPHQALAKLSKLYGPVMTIKLGAITTIVISSPEAAKEALQK  95

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D +L+GR+I + +K       S++       W+ LR++CT + F   +LDA + +  K 
Sbjct  96    NDQLLSGRQIPDTVKASGHYAESVVWLPASDKWKQLRKVCTVQMFSAHKLDAGQLLHRKK  155

Query  723   IDHMVRYMREAGNSGTAAIDVGR-----FFFLMSFNLIGNLMFSKDLLDPRSERGAKFFY  887
             +D +V ++ ++   G + +D+G+       F    NLI + +FS DL         +F  
Sbjct  156   VDELVSFIHQSCRQGRS-VDIGKAACRDTAFTTVLNLISSTLFSVDLAHHDEGSSQEFRD  214

Query  888   HAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGN  1067
                 VME  GKPNV+DFFP LRW DPQG R+    + ++   I    ++ER ++  +   
Sbjct  215   LVWGVMEETGKPNVSDFFPALRWFDPQGARQRISGYFSRLLAIFDRMIEERTQATASSVA  274

Query  1068  DEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNP  1247
                  D +D L+  +          S   I  +L ++F AG DT+TS+LEWAM ELLHNP
Sbjct  275   SSLSNDVLDSLINLKES-----GELSRHEIKSLLLDLFIAGVDTSTSSLEWAMAELLHNP  329

Query  1248  SSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNM  1427
               + + + EL  VV G    L+E  I +LPYL+A++KETLRLHPP+PFL+PH A     +
Sbjct  330   EKIARAREELDRVVSGDGGTLQEPDITRLPYLQAIVKETLRLHPPVPFLIPHKAESDVEI  389

Query  1428  LGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRM  1607
              G+ +P+  Q+LVNVWA+GRDP  W +P  F PERFL   + DFKG  FE IPFGSGRR+
Sbjct  390   GGFRLPRHAQVLVNVWAMGRDPGVWSNPDSFMPERFLGGEI-DFKGRDFELIPFGSGRRI  448

Query  1608  CPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             CP +PLA RM+ L L S+L SFDW L  G+ P +MDM E+ GITL+KATPL AIP+
Sbjct  449   CPGMPLAYRMVHLILASLLRSFDWKLEEGVTPEEMDMTEKFGITLQKATPLCAIPM  504



>ref|XP_006360236.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=493

 Score =   407 bits (1046),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 215/509 (42%), Positives = 303/509 (60%), Gaps = 20/509 (4%)
 Frame = +3

Query  261   MDY-EIC-GFvllllawvawaMINERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVS  434
             MDY  IC GF  +        + + R  +R+       PGP   P++GN+  LG  PH+S
Sbjct  1     MDYMNICLGFFFICFLVRGVLIFSLRRSKRVA------PGPFPLPIIGNLHLLGHKPHIS  54

Query  435   FSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSL  614
              ++LA KHGPIM L LG ++TVVISS   A+++ +  D+  + R + +A++    +  S+
Sbjct  55    LAQLAKKHGPIMNLKLGQINTVVISSSALAKQVLQKQDLAFSNRFVPDALRACNHSGLSV  114

Query  615   I-TAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGR  791
             +  +     WR LR++  +  F  ++LDA   VRTK I  ++ Y       G  A+D+GR
Sbjct  115   VWLSVNNSQWRTLRKVMNSHIFSGNKLDANEHVRTKKIQDLINYCHNCSKVG-EAVDMGR  173

Query  792   FFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQG  971
               F  S NLI N +FSKDL DP S+   +F      +M   GKPN+ D+FPLL+ +DPQG
Sbjct  174   ASFRTSLNLISNTIFSKDLTDPFSDSAKEFKELVWNIMVEVGKPNLVDYFPLLKRIDPQG  233

Query  972   IRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSR  1151
             IRR    + +K   +    + ER++    G  +    D +D LL         P      
Sbjct  234   IRRRLTEYFSKVLHLISGLIDERIKERKMG--NRANVDVLDALLNI------SPDEIDRN  285

Query  1152  TINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEK  1331
              I  +  EMF AGTDT ++TLEWAM ELL N  +L+K Q EL  ++G   K ++E  + K
Sbjct  286   HIEHLCLEMFAAGTDTISNTLEWAMAELLKNQHTLEKAQKELEQIIG-RGKLIDEADVAK  344

Query  1332  LPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDP  1511
             LPYL+ ++KET R+HP +PFL+     +  +  GY IPK++Q+LVNVWAIGRD   W+DP
Sbjct  345   LPYLRCIVKETFRIHPQVPFLIQRKTEEDVDFCGYTIPKDSQVLVNVWAIGRDSSLWEDP  404

Query  1512  LKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGH  1691
             L FKPERF E  + DF+G  FE IPFG+GRR+CP LPLA RM+P+ALGS+L++F+W L  
Sbjct  405   LDFKPERFWESEI-DFRGRDFELIPFGAGRRICPGLPLAIRMVPVALGSLLNTFNWKLHG  463

Query  1692  GMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             G+ P  +DM+E  GITL K  PL AIP+P
Sbjct  464   GIAPKDLDMEESFGITLAKTQPLLAIPIP  492



>ref|XP_004310057.1| PREDICTED: geraniol 8-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   407 bits (1047),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 210/476 (44%), Positives = 296/476 (62%), Gaps = 7/476 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+ +P++GN+F+LG  PHVS ++L+ ++GPI++L LG ++TVV+SS + A+E+ + 
Sbjct  36    LPPGPKPFPLIGNLFELGDKPHVSLAKLSQRYGPIISLQLGQLTTVVVSSPDLAKEILRT  95

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD V   R + +A+     +  S+        WR LR +C  + F    LDA +  R   
Sbjct  96    HDQVFCNRTLPDAIHACNHSGYSMAWLPVSARWRNLRTICNLQLFSPKVLDANQANRHVK  155

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++  + E+  +G  AID+GR  F  + NL+   +FS D  DP SE   +F      +
Sbjct  156   VQKLIDDVNESMRAG-EAIDIGRAAFTTTLNLLSQTIFSVDFADPSSETAREFKKTVWGM  214

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME  GKPN+AD+FPLLR LDPQGIRR   ++  K  DI    + +R+ES   G N     
Sbjct  215   MEEIGKPNLADYFPLLRKLDPQGIRRRLTYYFQKTVDIFYQMIHQRLES-RRGDNYITTN  273

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D+LL    +  E            +  ++F AGTDT+++TLEWAM ELL NP  L K
Sbjct  274   DMLDILLNISEEKKED---MDMPETQHLFLDLFAAGTDTSSATLEWAMAELLRNPEVLSK  330

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              QAEL  V+G   K +EE ++ +LPYL+A++KETLRLHP +P L+P  A  +  + GY I
Sbjct  331   AQAELHQVIGKG-KLVEESYVARLPYLQAILKETLRLHPTVPLLLPRKAKANIEIGGYVI  389

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFL-EPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             P+  Q+L+NVWAIGRDP TW++P  FKPERFL   N  D  G +F+ IPFG GRR+CP L
Sbjct  390   PEGAQVLINVWAIGRDPITWENPYSFKPERFLGSDNQIDVIGKNFDLIPFGGGRRICPGL  449

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             PLA RML L LGS+L+ FDW L  G  P  M+M+++ G+TL+ A PL+A+P   KG
Sbjct  450   PLAMRMLHLMLGSLLNCFDWELEDGAVPETMNMEDKFGLTLQMAKPLRAVPKKSKG  505



>ref|XP_006388387.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
 gb|ERP47301.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
Length=496

 Score =   407 bits (1046),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 215/479 (45%), Positives = 293/479 (61%), Gaps = 11/479 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             RR      LPPGPR+ P++GNI  LG  PH + ++L+  +GP+MTL LG ++T+VISS  
Sbjct  27    RRKSGCTILPPGPRQLPIIGNILALGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPN  86

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
              A+E  + HD  L+ R + +A++G   N  S++      HW+ L++L  T+ F + RLDA
Sbjct  87    IAKEALQKHDQALSSRTVPDAVRGHHKN--SILWLPASSHWKFLKKLTATQMFTSQRLDA  144

Query  699   LRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAK  878
              R +R K +  ++ Y+ E  N G  A+DVGR  F    NLI N  FS D+ +  S+   +
Sbjct  145   SRALRGKKVQELLEYVHEKCNKG-HAVDVGRSVFTTVLNLISNTFFSLDIANYNSDLSQE  203

Query  879   FFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA  1058
             F Y    VME  GK N+AD+FP+LR +DPQGIRR T  ++ +   I    + ER    ++
Sbjct  204   FSYLVVGVMEQIGKANIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRSS  263

Query  1059  GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELL  1238
                 +   D +D LL       E     SS  I V+L + F AGTDTT+ST+EWAMTELL
Sbjct  264   SVASKASHDVLDALLILAK---ENNTELSSTDIQVLLLDFFIAGTDTTSSTVEWAMTELL  320

Query  1239  HNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
              NP  + K + EL+ V G     ++E  I K PYL+A++KET RLHPP P L+P  A+  
Sbjct  321   LNPDKMVKAKNELQQVEG----PVQESDISKCPYLQAIVKETFRLHPPAPLLLPRKAVSE  376

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               M G+ +PK  QIL+N+WAIGRDP  W DP  FKPERFLE   AD KG  FE IPFG+G
Sbjct  377   VEMQGFTVPKNAQILINIWAIGRDPTIWPDPNSFKPERFLECQ-ADVKGRDFELIPFGAG  435

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RR+CP LPL  +M+ LAL S++HSFDW +   + P  +D  E  GITL K+ PL+AIP+
Sbjct  436   RRICPGLPLGHKMVHLALASLIHSFDWKIADDLTPEDIDTSETFGITLHKSEPLRAIPM  494



>ref|XP_010056209.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=495

 Score =   407 bits (1045),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 200/471 (42%), Positives = 300/471 (64%), Gaps = 7/471 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P +G++ QLG  PH S   +A +HG +MTL LG +++VV+SS EAARE  + 
Sbjct  28    LPPGPAGLPFLGSLLQLGARPHESLFNMARRHGQVMTLRLGLVTSVVVSSPEAARETLQK  87

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   + R + + +      E +L      Q WR  RR+C+T+ F   RLDAL+ +R + 
Sbjct  88    HDENFSDRAVPDVITAQPNPEFTLAWVPGDQRWRARRRVCSTQMFTAQRLDALQHLRHQK  147

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  +V +++++   G   +D+G+  F  + NL+ + MFS D++DP  +   +F     ++
Sbjct  148   VHQLVTHIKKSCEPGRE-VDIGQLAFATTLNLMSSTMFSIDIVDPEFQTAQEFKDLVWRI  206

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AGKPN +D+FP +R  D  G++R  Q    +  +I  + + +R++    G ++  K 
Sbjct  207   MEDAGKPNPSDYFPAVRRFDLLGVKRHIQPAYMRLHEIFDEIIDKRLKERATGSSESSKS  266

Query  1083  -DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
              D++DVLL       E  + F+ ++I  ++ ++F AG+DT+  T EWAM ELLHNPS LQ
Sbjct  267   GDFLDVLLD---QCEEEGSDFTRQSIKPVILDLFIAGSDTSALTTEWAMAELLHNPSLLQ  323

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             + + EL + +G TE+ ++E     LPYL+A++KETLRLHP +P L+P+ + +   +  Y 
Sbjct  324   RSRDELTAAIG-TERPVQESDTRHLPYLQAIVKETLRLHPAVPLLLPYKSKNDAEVCAYV  382

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             IPK  Q+LVN WAIGRDP  W+DPL F PERFL  N+ D+KG  FE+IPFG+GRR+CP L
Sbjct  383   IPKGMQVLVNAWAIGRDPSYWEDPLSFTPERFLGSNV-DYKGRDFEYIPFGAGRRICPGL  441

Query  1620  PLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             PLA RM+ L + S++ SF+W L  GM P  +DM+E+ G+TLRKA PL+AIP
Sbjct  442   PLAIRMVHLMVASLVQSFNWKLPEGMAPESLDMQEQFGVTLRKAIPLRAIP  492



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   408 bits (1049),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 217/461 (47%), Positives = 299/461 (65%), Gaps = 7/461 (2%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV-VISSDEAAREMFKNHDVVLAGRKIY  575
             N+F+LG  P+   + L  K+GP++ L LG+ + + V+ +  AA E+FKNHD   A R I 
Sbjct  47    NMFELGTEPYKRMAALKQKYGPVLWLKLGTSTNIMVVQTAPAAAELFKNHDTSFADRFIP  106

Query  576   EAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREA  755
             +  +     +GSL   +YG  WR  RR+CT E FV  R+     VR +C+D+M++++ + 
Sbjct  107   DVNQAHSYYQGSLAIGRYGSFWRFQRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKE  166

Query  756   GNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNV  929
              NS    + I+V RF FL SFN++GNL+ SKDL DP SE  + FF    ++ME++G  NV
Sbjct  167   ANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASDFFNAMKRIMEWSGIANV  226

Query  930   ADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQY  1109
             +D FP LR  D Q +R+     + KA +I   +LKER E    G   EK KD++DVLL++
Sbjct  227   SDIFPFLRKFDFQKLRKKMARDMGKAIEIMSMFLKEREEERKKGA--EKGKDFLDVLLEF  284

Query  1110  RGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVV  1289
              G   + PA+ S   I V++ EMF AG++TT+S++EWA+TELL +P ++ KV+ E+  V+
Sbjct  285   EGTGKDEPAKLSEHEIKVLIVEMFLAGSETTSSSVEWALTELLRHPEAMDKVKTEISKVI  344

Query  1290  GGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVN  1469
             G    K EE  IE LPY++AVIKE+LRLHPPLPFL+P   +     +GY IPK T++LVN
Sbjct  345   G-PNSKFEESDIENLPYMQAVIKESLRLHPPLPFLLPRETIQDTKFMGYDIPKGTRVLVN  403

Query  1470  VWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLA  1649
              WAIGRDP+ W DP+ FKPERFL   + D KG H+E IPFG+GRRMC  LPL  RM+  A
Sbjct  404   TWAIGRDPECWDDPMSFKPERFLGSKI-DVKGQHYELIPFGAGRRMCVGLPLGHRMMHFA  462

Query  1650  LGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LGS+LH FDW L +G+ P  ++M E MG T RK   LK IP
Sbjct  463   LGSLLHEFDWELPNGVSPKSINMDESMGATARKRDSLKVIP  503



>gb|AGI97015.1| geraniol 10-hydroxylase [Gentiana macrophylla]
Length=496

 Score =   406 bits (1044),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 286/472 (61%), Gaps = 12/472 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP R P++GN+  LG  PH S  +LA KHGPIM+L LG ++TVVISS E A+E+ + 
Sbjct  31    LPPGPTRLPIIGNLHLLGDQPHKSLEKLAKKHGPIMSLKLGQITTVVISSSEMAKEVLQK  90

Query  543   HDVVLA-GRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
              D+  +  R +  A+      + S +       WR LR++  T  F   RLD  + +R K
Sbjct  91    QDLEFSSNRSVPNALYAHDHYKYSAVWLPAASQWRSLRKVMNTNIFSVKRLDDNQHLRNK  150

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
              +  ++ Y ++    G  A+DVGR  F  + NL+ N +FSKDL DP S+ G +F      
Sbjct  151   KVQELIDYCKKNSEKG-EAVDVGRAAFRTTLNLLSNTIFSKDLTDPLSDSGKEFKELVEN  209

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES-MNAGGNDEK  1076
             +M   G+PN+ D+FP+L  +DPQGIRR +  H  K   +  D ++ER+ S ++ GG    
Sbjct  210   IMMVVGEPNLVDYFPILAKIDPQGIRRRSTIHFGKLLQLIKDLIRERITSGISQGG----  265

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D +DVLL       E P +   + I  +  ++F AG DTT+STLEWAMTELL NP  +
Sbjct  266   VSDVVDVLLTTSQ---ETPEQIQMKHIEHMCLDLFAAGADTTSSTLEWAMTELLKNPDKM  322

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
             +K Q E+  V+G  +  + E  + +LPYL+ V+KETLR+H P+PFLVP        + GY
Sbjct  323   KKTQNEIAQVIG-KKNVIHESDVAQLPYLRCVVKETLRMHTPIPFLVPRRVEQEVEVCGY  381

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK +Q+LVN WAIGRD  TWKD   F PERF E  + D +G  FE IPFG GRR+CP 
Sbjct  382   TVPKGSQVLVNAWAIGRDETTWKDAFTFLPERFWESEL-DIRGQDFELIPFGGGRRICPG  440

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LPLA RM+ + LGS+L+ FDW    G  P  +DM+++ GITL KA PL AIP
Sbjct  441   LPLAVRMIHVMLGSLLNCFDWDSESGNSPDGLDMEDKFGITLHKARPLLAIP  492



>ref|XP_006853508.1| hypothetical protein AMTR_s00032p00219670 [Amborella trichopoda]
 gb|ERN14975.1| hypothetical protein AMTR_s00032p00219670 [Amborella trichopoda]
Length=488

 Score =   406 bits (1043),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/477 (45%), Positives = 310/477 (65%), Gaps = 6/477 (1%)
 Frame = +3

Query  357   GALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMF  536
             G LPPGP   P+VG++ +LG  P+ + + LA  HGPIMTL LG ++TVV+SS + ARE+ 
Sbjct  14    GRLPPGPTGLPIVGSLHKLGAKPNEALTALARTHGPIMTLRLGFLTTVVVSSSDMAREVL  73

Query  537   KNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             + +D   AGR I +A+  D  +  S+   Q G +WR LRRLC T+ F T RLDAL+ +R 
Sbjct  74    QKNDQAFAGRVILDAVTVDSHHNFSIAWGQVGPYWRTLRRLCNTQLFTTQRLDALQALRH  133

Query  717   KCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             + +  ++  + +  ++   A+ +GR  F+ S NL+ N++FS D++DP+SE   +      
Sbjct  134   RKVHELLELVDQYSDA-RKAVHMGRMAFVTSLNLLSNMIFSSDMVDPQSESVGELKELIW  192

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME  G PN+AD+FP LR LDPQGI+R     V +   +  + + ER+ +   G     
Sbjct  193   SIMEGVGTPNIADYFPFLRPLDPQGIKRKNIVQVRRLHQLLNEKIDERVGARERG--QPI  250

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D++DVLL Y     E  ++FS   I   L +M+ AG+DTT +TLEWAM ELLHNP  +
Sbjct  251   YGDFIDVLLDYSDQ--ESGSKFSRAGILAPLVDMYLAGSDTTATTLEWAMAELLHNPEKM  308

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
                + EL+  + G+   ++E  + +LPYL+AV+KETLRLHPP+P L+PH A  +  + GY
Sbjct  309   AAAKQELKENIAGSMHTVQESDLGRLPYLQAVVKETLRLHPPVPLLLPHRADVTVKVSGY  368

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              IP+ TQ+LVN WAIGRD + W++P  F PERF+  N+ DFKG  F++IPFG+GRR+CP 
Sbjct  369   VIPEHTQVLVNAWAIGRDVQVWENPTAFIPERFVGSNI-DFKGRDFQYIPFGAGRRICPG  427

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPYKG  1787
             LPL  RM+ + L S+LHSF W L  G++P +MD+K++ G+TL+KA PL A+PV Y G
Sbjct  428   LPLGVRMVHIMLASLLHSFYWELPDGLKPEEMDIKDKFGVTLQKAVPLVAVPVKYLG  484



>ref|XP_010691493.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=499

 Score =   406 bits (1044),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 204/474 (43%), Positives = 291/474 (61%), Gaps = 10/474 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP+  P+ GNIF LG  PH SF+ L+  HGP+++L LGS++T+V+SS   A EMF  
Sbjct  32    LPPGPKPVPIFGNIFDLGEKPHRSFANLSKIHGPLISLKLGSVTTIVVSSASVAEEMFLK  91

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             +D  LA R I ++++    ++ S+      Q WR +R++   +     +LDA + +R   
Sbjct  92    NDQALANRTIPDSVRAGDHDKLSMSWLPVSQKWRNMRKISAVQLLSNQKLDASQPLRQTK  151

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y+++        +D+GR  F  S NL+ N  FS +L    S    +F      +
Sbjct  152   VKQLLSYVQDCSKK-MQPVDIGRAAFTTSLNLLSNTFFSIELASHESSASQEFKQLMWNI  210

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKER--MESMNAGGNDEK  1076
             ME  G+PN ADFFP+L ++DP GIRR    + +K  D+  D ++ER  + S N+ G  ++
Sbjct  211   MEEIGRPNYADFFPILGYIDPFGIRRRLAGYFDKLIDVFQDIIRERQKLRSSNSSGA-KQ  269

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSL  1256
               D +D LL+   D        S   IN +L ++F AGTDTT STLEWAM EL+ NP  +
Sbjct  270   TNDILDTLLKLHED-----NELSMPEINHLLVDIFDAGTDTTASTLEWAMAELVKNPEMM  324

Query  1257  QKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGY  1436
              KVQ E+   +G     ++E  I KLPYL+ +IKETLRLHPP  FL+P  A +   + GY
Sbjct  325   TKVQIEIEQALGKDCLDIQESDISKLPYLQGIIKETLRLHPPTVFLLPRKADNDVELYGY  384

Query  1437  YIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPA  1616
              +PK  Q+LVN+WAIGRDPK WK+P  F PERFL+ N+ D+KG  FE +PFG+GRR+CP 
Sbjct  385   VVPKNAQVLVNLWAIGRDPKVWKNPEVFSPERFLDCNI-DYKGRDFELLPFGAGRRICPG  443

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             L LA RML L L ++L +++W L  G+ P  +DM E+ GITL+K  PL+ IPVP
Sbjct  444   LTLAYRMLNLMLATLLQNYNWKLEDGINPKDLDMDEKFGITLQKVKPLQVIPVP  497



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   406 bits (1043),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 303/464 (65%), Gaps = 7/464 (2%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV-VISSDEAAREMFKNHDVVLAGR  566
             + GN+F+LG  P    S L  K+GP++ L LG+ + + V+ + +AA E+FKNHD+  A R
Sbjct  44    IFGNMFELGTEPFKKMSVLKQKYGPVLWLKLGTSTNIMVVQTAQAAAELFKNHDISFADR  103

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
              I +  +     +GSL  A YG  WR  RR+CT E FV  ++     VR KC+D+M++++
Sbjct  104   FIPDVNQAHSYYQGSLALAPYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWI  163

Query  747   REAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +A NS    + I+V RF FL SFN++GNL+ SK+L DP SE  ++FF     +ME++G 
Sbjct  164   EKAANSAEKGSGIEVTRFVFLASFNMLGNLILSKNLADPESEEASEFFNAMKGIMEWSGI  223

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              NV+D FP LR  D Q +R+     + KA +I   +LKER E    G   EK+KD++DVL
Sbjct  224   TNVSDIFPFLRKFDLQSLRKKMTRDMGKAIEIMSMFLKEREEERKKGM--EKRKDFLDVL  281

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I + + E+F AG++TT++++EWA+TELL +P ++ KV+ E+ 
Sbjct  282   LEFEGTGKDEPAKLSEHEIKIFILEIFLAGSETTSNSVEWALTELLRHPEAMAKVKTEIS  341

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              V+G   +K EE  IE LPY+++VIKE+LRLHPPLPFL+P   +     +GY +PK T++
Sbjct  342   KVIG-PNRKFEESDIENLPYMQSVIKESLRLHPPLPFLLPRETIQDTKFMGYDVPKGTRV  400

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN WAIGRDP+ W DP+ FKPERFL   + D KG H+E IPFG+GRRMC  LPL  RM+
Sbjct  401   LVNAWAIGRDPECWDDPMSFKPERFLGSKL-DVKGQHYELIPFGAGRRMCVGLPLGHRMM  459

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH F+W L  G+ P  ++M E MG T RK   LK IP
Sbjct  460   HFALGSLLHEFEWELPDGVSPKSINMDESMGATARKRDSLKVIP  503



>gb|AGX93055.1| geraniol 10-hydroxylase-like protein [Vinca minor]
Length=493

 Score =   405 bits (1042),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 204/460 (44%), Positives = 288/460 (63%), Gaps = 9/460 (2%)
 Frame = +3

Query  399   NIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIYE  578
             N+  LG  PH S ++L+ K+GPIM+L LG ++T+VISS   A+E+ +  D+  + R +  
Sbjct  42    NLHLLGDHPHKSLAKLSKKYGPIMSLKLGRITTLVISSSTTAKEVLQKQDLAFSSRSVPN  101

Query  579   AMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAG  758
             A+      + S++       WR LR++  +  F  +RLDA + +R + ++ ++ Y R+  
Sbjct  102   ALHAHNQFQYSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRCRKVEELIAYCRKNC  161

Query  759   NSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADF  938
              SG  A+D+GR  F  S NL+ N +FSKDL DP S+   +F      +M  AGKPN+ DF
Sbjct  162   QSG-EAVDLGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLVDF  220

Query  939   FPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGD  1118
             FP+L  +DPQGIRR    H  K   +    + ER++   + G      D +DVLL     
Sbjct  221   FPVLEKVDPQGIRRRMTVHFGKVIQLFNGLINERLDKRKSRGG---YNDVLDVLLTTTE-  276

Query  1119  LVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGGT  1298
               E P       I  +  ++F AGTDTT+STLEWAM E+L NP  ++K Q EL  VVG  
Sbjct  277   --ENPEEIDRTHIERMCLDLFVAGTDTTSSTLEWAMAEMLRNPEKMKKTQEELAEVVG-R  333

Query  1299  EKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVWA  1478
              K +EE  + +LPYL+ V+KETLR+HPP+PFL+P   +    + GY +PK +Q+LVN WA
Sbjct  334   GKLIEEGDVSRLPYLRCVVKETLRVHPPVPFLIPRKVVQDVEVCGYKVPKGSQVLVNAWA  393

Query  1479  IGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALGS  1658
             IGRD   WKD L FKPERFLE  + D +G  FE IPFG+GRR+CP LPLA+RM+P+ LGS
Sbjct  394   IGRDETFWKDALGFKPERFLESEL-DTRGRDFELIPFGAGRRICPGLPLANRMVPVMLGS  452

Query  1659  VLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             +L+SF+W L  G+ P  +DM+E+ GITL+KA PL+A+P P
Sbjct  453   LLNSFNWKLEGGIAPKDLDMEEKFGITLQKAHPLRAVPSP  492



>ref|XP_002513347.1| (S)-N-methylcoclaurine 3'-hydroxylase isozyme, putative [Ricinus 
communis]
 gb|EEF48750.1| (S)-N-methylcoclaurine 3'-hydroxylase isozyme, putative [Ricinus 
communis]
Length=496

 Score =   405 bits (1042),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 204/474 (43%), Positives = 294/474 (62%), Gaps = 22/474 (5%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR+WP++GNI Q+G  PH+S +  A  HGP+++L LG+   VV SS  AA E+ K 
Sbjct  37    LPPGPRQWPILGNILQVGKNPHISMANYAKVHGPLISLRLGTRVVVVASSPTAAAEILKT  96

Query  543   HDVVLAGRKI--YEAMKGDFGNEGSLI-TAQYGQHWRMLRRLCTTEFFVTSRLDALRGVR  713
             HD +L+GR I      + +  +  +L+        W+ LR +C +E F    +++   +R
Sbjct  97    HDRLLSGRYIPATTPYEDNVLDRIALVWNPSCSDQWKFLRAMCRSELFSAKAIESQATLR  156

Query  714   TKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGA-KFFYH  890
              K +  M+ ++          +++G   F  +FN I NL+FSKDLL    +  A +    
Sbjct  157   EKKLTEMLDFLTSKQGQ---IVNIGEVVFTTAFNTISNLLFSKDLLSFEDQGNAGELKTL  213

Query  891   AGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND  1070
                +ME A  PN+ADF+P+L  LDPQGI+R  +  + + F +   Y+KER E       D
Sbjct  214   ISTLMELATCPNIADFYPVLTKLDPQGIKRKMKNCLERMFGVWDIYIKERRER---HVKD  270

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
              +K D++DV L            F    IN +L E+F+AG DTTT+T+EWAM ELL   +
Sbjct  271   ARKTDFLDVFLS---------NGFDDHQINWLLLELFSAGADTTTTTVEWAMAELLKEIT  321

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
              L+KV+ EL + +G  +  + E HI +L YL A +KETLRLHPP+PFL+P  A ++C ++
Sbjct  322   VLEKVREELETEIG--KDMIRESHIPQLKYLNACVKETLRLHPPVPFLIPRRAPEACEVM  379

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
              Y IPK +QI+VNVWAIGRDP  W+DPL ++PERFL+ N+ DFKGH+FEF+PFGSGRR+C
Sbjct  380   NYTIPKHSQIIVNVWAIGRDPSAWEDPLSYRPERFLDSNL-DFKGHNFEFLPFGSGRRIC  438

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             P LP+ +R LPL L S++H FDW L +G +P+ +DM ++  ITL K   L  +P
Sbjct  439   PGLPMGTRQLPLILASLVHCFDWSLQNGDDPAMLDMNDKFSITLEKEQHLLVVP  492



>ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
 gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
Length=502

 Score =   405 bits (1041),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 210/478 (44%), Positives = 293/478 (61%), Gaps = 6/478 (1%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             + E  G LPPGP   P++G++  LG  PH S + LA  HGP+M+L LG ++T+VISS   
Sbjct  29    KTESSGKLPPGPAALPIIGSLLDLGDKPHKSLARLAKTHGPLMSLKLGQITTIVISSPTL  88

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             A+E+ + HDV  + R I +A++    +E  L        WR LR++C +  F   +LDA 
Sbjct  89    AKEVLQKHDVSFSNRTIPDALRAHKHHELGLPWVPIAMRWRNLRKVCNSYIFTNQKLDAN  148

Query  702   RGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             + +R K I  +V  ++E   +G  A+D+G+  F  + N + N +FS +L D  SE  ++ 
Sbjct  149   QDLRRKKIQELVALVQEHCLAG-EAMDIGQAAFTTALNALSNSIFSLNLSDSNSETASQL  207

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
                 G +ME AGKPN+AD+FP+LR +D QGI+R    H  K  +I    + ER++     
Sbjct  208   KEVVGGIMEEAGKPNLADYFPVLRRIDLQGIKRRMTIHFGKILNIFDGIVNERLQLRKMQ  267

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
             G      D +D LL    D  E     S   I  +  ++F AGTDTT+STLEWAM ELLH
Sbjct  268   GY-VPVNDMLDTLLTISEDNNEDIMETSQ--IKHLFLDLFAAGTDTTSSTLEWAMAELLH  324

Query  1242  NPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSC  1421
             NP +L   + EL   + G    +EE  I +LPYL+AVIKET RLHP +P L+P  A ++ 
Sbjct  325   NPRTLSIARTELEQTI-GKGSLIEESDIVRLPYLQAVIKETFRLHPAVPLLLPRKAGENV  383

Query  1422  NMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGR  1601
              + GY IPK  Q+ VN WAIGRDP  W+DP  F PERFL  ++ D +G +FE IPFG+GR
Sbjct  384   EISGYTIPKGAQLFVNAWAIGRDPSLWEDPESFVPERFLGSDI-DARGRNFELIPFGAGR  442

Query  1602  RMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             R+CP LPLA RML + LGS++HSFDW L +G+ P  MDM+++ GITL KA  L+A+P+
Sbjct  443   RICPGLPLAMRMLHMMLGSLIHSFDWKLENGVTPESMDMEDKFGITLGKARSLRAVPI  500



>ref|XP_009794426.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Nicotiana 
sylvestris]
Length=492

 Score =   404 bits (1039),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 203/474 (43%), Positives = 297/474 (63%), Gaps = 11/474 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQL-GWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFK  539
             LPPGP + P++GN+F L G  PH+S + LA  +GPIM+L LG ++T+VISS   A+++ +
Sbjct  27    LPPGPLQLPIIGNLFHLLGAKPHISLANLAKIYGPIMSLKLGQITTIVISSSTMAKQVLQ  86

Query  540   NHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTK  719
             N D   + R I  A++    ++ S+        WR LRR+  +     ++LD+ + +R++
Sbjct  87    NQDQAFSNRFIPNALQAHNYSKFSVTWLPVNPTWRTLRRILNSNILSLTKLDSNQHLRSQ  146

Query  720   CIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGK  899
              +  +V Y+ +    G A I +G+  F  S N + N++FSKDL+DP  +   +       
Sbjct  147   KVQQLVDYVAKCSQEGEAVI-IGKAAFKTSLNFLSNILFSKDLVDPFFDSKVELKDVIWN  205

Query  900   VMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKK  1079
             ++  AGKPN+ DFFP+L  +DPQ IRR T  H NK F +  D + ER+E   +      K
Sbjct  206   ILAEAGKPNLVDFFPILENIDPQRIRRNTDIHFNKLFVLFDDLINERLEEKRSRS---IK  262

Query  1080  KDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQ  1259
              D ++V L+ R    E         IN +L ++F  GT+TTTST+EWAM E+L  P  ++
Sbjct  263   NDVLEVFLKIRE---ENSEEIDQNHINSLLLDIFIGGTNTTTSTVEWAMAEILRQPEIMK  319

Query  1260  KVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYY  1439
             KVQAEL  VVG   K ++E  + +LPYL+ ++KETLR+HPP+PFL+P        +  Y 
Sbjct  320   KVQAELAEVVGKG-KPIKEDDVSRLPYLQCIVKETLRMHPPVPFLLPRKVEQDVELCDYI  378

Query  1440  IPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPAL  1619
             IPK +Q+LVNVWAI RD   W++PL FKPERF    + D +G  FE IPFG+GRR+CP L
Sbjct  379   IPKGSQVLVNVWAISRDSALWEEPLVFKPERFWSSEL-DVRGKDFELIPFGAGRRICPGL  437

Query  1620  PL-ASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             PL ASRM+P+ +GS+L+SF+W L  G++P ++DM+E+ GITL KA PL+AI  P
Sbjct  438   PLAASRMVPVMVGSLLNSFNWKLEEGIKPEELDMEEKFGITLAKACPLRAIAYP  491



>ref|XP_006358804.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   404 bits (1039),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 204/472 (43%), Positives = 283/472 (60%), Gaps = 8/472 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP++GNI  LG  PHVS + LA K+GPIM+L LG ++TVVISS   A+++ K 
Sbjct  28    LPPGPSPWPIIGNIHLLGAKPHVSLANLAKKYGPIMSLKLGQITTVVISSSPIAKQVLKT  87

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D   + R +  A++     + S+        WRMLRR+  T    ++R+DA + +R++ 
Sbjct  88    QDQAFSSRSVPNALQAHNHYKFSVAWLPVCPQWRMLRRILNTNLLSSNRVDANQHLRSQK  147

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y  +    G  A+DVG+  F  + NL+ N +FSKDL+D  S+   +       +
Sbjct  148   VKELIAYCEKCSQQGE-AVDVGQIVFKTNLNLVSNTLFSKDLVDLCSDLKLELTDAILSI  206

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ++ AGK N+ DFFP+L  +DPQ +R  T  +  K   + GD   ER+E      N  +K 
Sbjct  207   VDVAGKINLVDFFPILEKIDPQRMRYRTNIYFGKLNKLFGDMTNERLEEKKT--NQSEKS  264

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D + VLL Y    +E P       +N  L ++F  G DT TSTLEWAM E+L  P  ++K
Sbjct  265   DILQVLLNYS---IENPQEMDQNYVNSTLLDLFVGGIDTITSTLEWAMAEILRQPEIMKK  321

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             VQAEL  VVG   K +EE  + +L YL+ +IKETLRLHPP PFL+P        +  Y I
Sbjct  322   VQAELAQVVGKG-KPIEEADVSRLAYLQFIIKETLRLHPPAPFLIPRRVDQDVELCDYII  380

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK + +LVN WAIGRD   W+D L FKPERF    + D +G  FE IPFG+GRR CP  P
Sbjct  381   PKGSLVLVNAWAIGRDSSFWEDALVFKPERFRSLEL-DMRGKDFELIPFGAGRRTCPGFP  439

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LA R++P  LGS+L+SF+W L   +EP  +DM+E+ G+ L KA PL+AIP P
Sbjct  440   LALRLMPAILGSMLNSFNWKLEACIEPKDLDMEEKFGVVLVKAHPLRAIPSP  491



>ref|XP_006494410.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=488

 Score =   404 bits (1038),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 214/482 (44%), Positives = 299/482 (62%), Gaps = 17/482 (4%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             RL     LPPGPR +PV+GN+ +LG  PH S ++LA  HGPIM+L LG ++TVV+SS   
Sbjct  18    RLGRTAGLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSM  77

Query  522   AREMFKNHDVVLAGRKIYEAMKGD--FGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLD  695
             A+ + K HD +   RK+ E++       +E SL+       WR LR++C    F   +LD
Sbjct  78    AKTILKEHDSLFCDRKVPESILSQPYQHHEFSLVWLPVSPLWRSLRKICNMHIFTNQKLD  137

Query  696   ALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGA  875
             A + +R K I  ++ Y+ E  ++G  A+D G+  F  S NL+ N +FS DL+DP +ER  
Sbjct  138   ANQDLRRKKIKDLLAYVEENCSAG-KALDFGQAAFNTSLNLLSNTIFSMDLVDP-NER--  193

Query  876   KFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMN  1055
             +F      +ME AGKPN++D FPLL+ LD QGIRR    +  K F++    + +R++   
Sbjct  194   EFKETVWGIMEEAGKPNLSDHFPLLKMLDLQGIRRRNTLYSGKMFEVLDRLIDQRLKQRQ  253

Query  1056  AGGND--EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMT  1229
               G     + KD +D LL     + E    F ++ I  +L ++F AG DTT+ T+EWAM 
Sbjct  254   EHGCSISTESKDTLDTLLNI---IQEKSVEFDTKHIKHLLADLFIAGNDTTSITMEWAMA  310

Query  1230  ELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMA  1409
             ELLHNP  L K + EL+  VG     ++E  I +LPYL+AV+KET RLHP +P L+P  A
Sbjct  311   ELLHNPKVLSKAKLELKQTVGKGNP-IDESDIARLPYLQAVVKETFRLHPAVPLLIPRKA  369

Query  1410  MDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPF  1589
              +   +    +PK  Q+ VNVWAIGRD   W +P  FKPERFL  ++ DFKG +FE IPF
Sbjct  370   SEGVEIASVTVPKGAQVFVNVWAIGRDENIWDNPHSFKPERFLGSDV-DFKGQNFELIPF  428

Query  1590  GSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAI  1769
             G+GRR+CP LPLA RML L LGS+++SFDW L    E   MDMKE+ G+T++KA PL+A+
Sbjct  429   GAGRRICPGLPLAIRMLYLMLGSLINSFDWKL----EDESMDMKEKFGLTIQKAKPLRAV  484

Query  1770  PV  1775
             P+
Sbjct  485   PI  486



>dbj|BAC53893.1| cytochrome P450 [Petunia x hybrida]
Length=532

 Score =   405 bits (1041),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/473 (42%), Positives = 291/473 (62%), Gaps = 8/473 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP++GN+  LG  PH+S ++LA  +GPIM+L LG ++TVVISS   A+++ K 
Sbjct  31    LPPGPTPWPIIGNLHLLGAKPHISLAQLAQIYGPIMSLKLGQVTTVVISSSAMAKQVLKY  90

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D+  + R + +A++    N+ S++       WR LRR+  T    ++RLD+ + +R++ 
Sbjct  91    QDLAFSTRFVPDALQTHNHNKFSVVWLPVSPQWRTLRRILNTNILSSNRLDSNQHLRSQK  150

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             +  ++ Y           +DVG+  F  + NL+ N +FSKDL DP S+   +       V
Sbjct  151   LKELLAYCATCSQEAKV-VDVGQAVFKTNLNLLSNTLFSKDLADPFSDSKVELKDVIWGV  209

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             +   GKPN+ D+FP+L  +DPQGIRR T  H  K   +    + ER+E      ++  K 
Sbjct  210   IAEIGKPNLVDYFPILEKIDPQGIRRRTTIHFGKLMRLFDSLINERVEEKRRSHSE--KS  267

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D ++VLL       E P   +   I  +  ++F A TDTTTSTLEWAM E+L  P  ++K
Sbjct  268   DVLEVLLNINK---ENPEEINQNHIKAMFLDLFGAATDTTTSTLEWAMAEILRQPEIMKK  324

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              QAEL  V+G   K +EE  + +LPYL+ +IKET R+HP  PFL+P        + GY +
Sbjct  325   AQAELAEVIGKG-KPIEEADVSRLPYLQCIIKETFRMHPATPFLLPRKVEQDVEVCGYIV  383

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+LVNVWAIGRD   W+DPL FKPERF   ++ D +G  FE IPFG+GRR+CP LP
Sbjct  384   PKGSQVLVNVWAIGRDSTYWEDPLMFKPERFWNLDL-DVQGQDFELIPFGAGRRICPGLP  442

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVPY  1781
             LA RM+P+ LGS+L+SF+W L  G+EP ++DM+E+ G+ L KA+ + + P+ Y
Sbjct  443   LALRMVPVVLGSLLNSFNWKLETGIEPEELDMEEKFGLALAKASSVASYPISY  495



>ref|XP_002276094.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=496

 Score =   404 bits (1037),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 302/478 (63%), Gaps = 10/478 (2%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             R     +LPPGPR +P++GNI +LG  PH S + L+  +GP+M+L LGS+ST+VISS E 
Sbjct  27    RKPSTASLPPGPRPFPIIGNILKLGDKPHQSLTNLSKTYGPVMSLKLGSVSTIVISSSET  86

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             A+E+   ++   +GR + +A+K    +E S++ +    +WR +R++CT E F   RL+A 
Sbjct  87    AKEVLHRNNQAFSGRVVLDAVKAHNHHESSVVWSPASAYWRKIRKICTREMFSVQRLEAS  146

Query  702   RGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             +G+R K +  ++ +  E    G  A+D+G   F  S NL+ N +FS +L+   S    +F
Sbjct  147   QGLRRKIVQELLDHAEECCGRG-CAVDIGAATFTASLNLLSNTIFSINLVHHASTFSQEF  205

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
                  +VME AG+PN AD+FP  + +DPQGI++  + H++K   I    + +R++S  + 
Sbjct  206   KDIVWRVMEDAGRPNFADYFPAFKLIDPQGIQQNMKIHLDKLIHIFEGIINQRLQSKASS  265

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
              ++    D +D  L       E    +S R I  +L ++F AGTDTT+ T+EWAM ELLH
Sbjct  266   ASN----DVLDAFLNLTE---ENNQEWSCRDIIHLLMDLFLAGTDTTSGTIEWAMAELLH  318

Query  1242  NPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSC  1421
             NP  + K Q EL+ V+ G +  ++E  I KLPY +A++KET RLHPP P L PH A    
Sbjct  319   NPEKMAKAQRELQEVL-GKDGIVQESDISKLPYFQAIVKETFRLHPPGPLLAPHKAESDV  377

Query  1422  NMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGR  1601
              + G+ +PK +Q+LVNVWAIGRDP TW +P  F PERFL  ++ D KG  FE IPFG+GR
Sbjct  378   EIRGFTVPKNSQVLVNVWAIGRDPSTWSNPNAFVPERFLGCDI-DVKGRDFELIPFGAGR  436

Query  1602  RMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             R+C  LPLA RM+ L L S+LHS+ W L  GM+P+ MDM E++G+TL K  PL+AIP+
Sbjct  437   RICLGLPLAHRMVHLILASLLHSYAWKLDDGMKPADMDMNEKLGLTLHKVQPLRAIPI  494



>ref|XP_004241763.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=494

 Score =   404 bits (1037),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 301/470 (64%), Gaps = 9/470 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP   P++G++ +LG  P+ S +ELA KHGP+MTL LGS++T+V+SS + A+E+   
Sbjct  29    LPPGPTGLPIIGSLLKLGTKPNQSLAELAKKHGPLMTLQLGSLTTIVVSSAKVAKEILHK  88

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   + R +  A+      E +L        W+  RR  +T+ F   RLD L+ +R + 
Sbjct  89    HDETFSARIVPVAVAAQPNPEATLAWVNGDHMWKKKRRFLSTQMFNNQRLDLLQELRHQK  148

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
              + +V ++R    SG+A +D+GR  F  + NLI N +FS D++D   +   +F      V
Sbjct  149   AEQLVSHIRSQCESGSA-VDIGRVAFATTLNLISNTIFSIDMVDTEFKTAHEFKELVWTV  207

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME AG PN++DFFP+L+WLD QG+R+  +    +  +I  + +++R+E+   G   +KK 
Sbjct  208   MEDAGVPNLSDFFPVLKWLDLQGVRKRIKPAYLRLHEIFEENIEKRIEARAIGM--KKKG  265

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++D+LL    D  E         I  ++ ++F AG+DT+  T EWAM ELL  P  L K
Sbjct  266   DFLDILL----DQCEDDGSGFGTNIKPLMVDLFIAGSDTSAITTEWAMAELLRKPEELNK  321

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ E+   +G  E+ ++E  ++KLPYL+AV+KET+RLHP +P L+PH A +   +LG+ +
Sbjct  322   VRQEIMEQIG-LERAVKESDMDKLPYLQAVVKETMRLHPAVPLLLPHKAQNDIQVLGFNV  380

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK +Q+ VN WAIGRDPK+W+  L+F P+RF+E N+ D+KG  FEFIPFG+GRR+CP +P
Sbjct  381   PKYSQVFVNAWAIGRDPKSWERALEFLPQRFIESNV-DYKGRDFEFIPFGAGRRICPGIP  439

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA RM+ L L SV+  F W L  GM P +++M+E+ G++LRKA PL A+P
Sbjct  440   LAIRMVNLMLASVIQPFKWKLPDGMAPEELNMEEQFGVSLRKAVPLVAVP  489



>ref|XP_010544670.1| PREDICTED: cytochrome P450 76C4-like isoform X1 [Tarenaya hassleriana]
Length=508

 Score =   404 bits (1038),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/487 (43%), Positives = 304/487 (62%), Gaps = 13/487 (3%)
 Frame = +3

Query  324   NERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVV  503
             + +S RR     ALPPGP R+PV+GNI  +G  PH S ++L+  +GP+M+L LG+++TVV
Sbjct  24    SAKSRRR---SAALPPGPPRFPVIGNILDVGKNPHHSLADLSKTYGPVMSLKLGNLTTVV  80

Query  504   ISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVT  683
             +SS EAA+E+ + HD VL+GR   + ++    ++ S++      HWR LR++  T+ F  
Sbjct  81    VSSPEAAKEVLQVHDQVLSGRTPSDPVRAIGHHDVSVVWLPASAHWRQLRKILATQLFSP  140

Query  684   SRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
              RL+A + +R   +  ++ ++ E+ + G  A+D+ R  F+ S N+I N++FS D     S
Sbjct  141   QRLEATKPLRMNKLRELLGFLGESCSRGE-AVDIARSTFVTSLNIISNILFSVDFAGYDS  199

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             +   ++   A ++ME AGKPN+ADFFP L +LD QG R+  +    + F +   ++  R+
Sbjct  200   KISYEYQDAAVRIMEVAGKPNIADFFPFLGFLDLQGSRKEIKACTERLFRVFQGFIDARI  259

Query  1044  ES--MNAGGND-EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTL  1214
                  +AG  D         +L   +GD  E       + +   L +MF AGTDT++ST+
Sbjct  260   AKRLTHAGRKDGSSVDLLDSLLDLAQGDKSE----LGLKDVKHFLLDMFLAGTDTSSSTV  315

Query  1215  EWAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFL  1394
             EWAM ELL NP  + K Q E+R ++G  E  ++E  I KLPYL+AV+KET RLHPP P L
Sbjct  316   EWAMVELLRNPKVMAKAQEEIRRMIGEHE-IVQESDIAKLPYLQAVVKETFRLHPPAPLL  374

Query  1395  VPHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHF  1574
             +P  A     +LG+ +PK  Q+L+NVWAIGRDP  W++P+KF+PERFLE    D KG  F
Sbjct  375   IPRKAESDVQILGFLVPKNAQVLINVWAIGRDPNVWENPMKFEPERFLE-RETDMKGKDF  433

Query  1575  EFIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKAT  1754
             E  PFG+GRR+CP +PLA + +PL L S+LHSFDW L +G+    +DM E  G+TL KA 
Sbjct  434   ELTPFGAGRRICPGMPLALKTVPLVLASLLHSFDWKLQNGVVSDHLDMDEAFGVTLHKAN  493

Query  1755  PLKAIPV  1775
             PL A+PV
Sbjct  494   PLYAVPV  500



>gb|EYU29984.1| hypothetical protein MIMGU_mgv1a026778mg, partial [Erythranthe 
guttata]
Length=478

 Score =   403 bits (1035),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 297/462 (64%), Gaps = 7/462 (2%)
 Frame = +3

Query  393   VGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKI  572
             +G++  LG  PH S + L+  +GPIM L LG + TV++SS   A+E+ +NHD+V +GR +
Sbjct  23    IGSLHLLGDQPHKSLTRLSKIYGPIMHLRLGFVHTVLVSSAAMAKEVMQNHDLVFSGRTV  82

Query  573   YEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMRE  752
              +A++    +  S+I       WR LR+   +  F  + L+  R +R K ++ ++ Y R 
Sbjct  83    PDAIRAHDHSSYSVIWLPVAARWRSLRKTINSNIFSGNSLEGNRQLRHKKVEELIEYCRT  142

Query  753   AGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVA  932
                SGTA +DVG   F  S N++ N +FS+DL DP S+   +F      +M  AGKPN+ 
Sbjct  143   NSQSGTA-VDVGGAAFRTSLNILSNTIFSRDLTDPFSDSSKEFKELIWNMMVEAGKPNLV  201

Query  933   DFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYR  1112
             DFFPLLR  D QGIRR    H  K  D+  D + ER+E M +G  D    D +DVLL   
Sbjct  202   DFFPLLRKFDLQGIRRRMTVHFGKVIDLFSDLIDERLEKMKSGEYD-PTGDVIDVLLAA-  259

Query  1113  GDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVG  1292
             G+  + P       I  +  ++F AGT+TT+ST+EWAM E L NP ++++ +AEL  V+G
Sbjct  260   GE--KNPEEIDRIHIERMCLDLFAAGTETTSSTVEWAMAEALKNPETMKRAKAELAEVIG  317

Query  1293  GTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNV  1472
                K ++E  I +LPYL+ ++KETLR+HPP PFL+P  A     + GY +P+ +Q+ VN 
Sbjct  318   AG-KIVDEADIPRLPYLRCMLKETLRIHPPAPFLIPRRAERDVVVCGYTVPENSQVFVNA  376

Query  1473  WAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLAL  1652
             WAIGRDP+ W++PL FKPERFLE  + DF+G  FE +PFGSGRR+CP LPLA+R+LP+ +
Sbjct  377   WAIGRDPEIWEEPLVFKPERFLESEV-DFRGRDFELVPFGSGRRICPGLPLAARVLPVVV  435

Query  1653  GSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             GS+L+SFDW +  G+  ++++M E+ GITL++A PL+A+PVP
Sbjct  436   GSLLNSFDWKIEGGVTAAELNMDEKFGITLQRAHPLRAVPVP  477



>ref|XP_004233427.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=491

 Score =   403 bits (1036),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 283/477 (59%), Gaps = 11/477 (2%)
 Frame = +3

Query  345   LEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAA  524
             L     L PGP   P++GN+  LG  PHVS ++LA KHGPIM L  G ++TV+ISS   A
Sbjct  24    LRRTKRLAPGPFALPIIGNLHLLGHKPHVSLTQLAVKHGPIMNLKFGQINTVIISSSVLA  83

Query  525   REMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALR  704
             RE+ +  D+  + R I +A++    N+ S I       WR LR++     F  +RLDA  
Sbjct  84    REVTQKKDLTFSNRCIPDALRACNHNDFSAIWLPVDSQWRKLRKIMNYHIFSGNRLDANE  143

Query  705   GVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFF  884
              +R+K I  ++ Y    G  G   +++ R  F  + NL+ N  FS DL DP ++   +F 
Sbjct  144   HLRSKKIQELIDYCGNCGKVG-ETVNISRATFRTAMNLLSNTFFSIDLTDPFTDSAKEFK  202

Query  885   YHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGG  1064
                  +   AGKPNV DFFP LR +DPQG+RR    +  K   I  D + ER++  + G 
Sbjct  203   ELVSNISIEAGKPNVVDFFPFLRKIDPQGVRRRMTKYFTKILHIMSDLIDERLKERSMGK  262

Query  1065  NDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHN  1244
             +     D +D LL         P       I  +  ++F AGTDTT++TLEWAM ELL N
Sbjct  263   H--ANVDVLDALLNI------CPKEIDRNQIEQLCLDLFEAGTDTTSNTLEWAMAELLKN  314

Query  1245  PSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCN  1424
             P +++K Q EL  V+ G  K +    +  LPYL+ ++KE  R+HP +PFL+P    +  +
Sbjct  315   PHTMKKAQEELAQVI-GRGKLINAADVANLPYLRCIVKENFRIHPQVPFLIPRKTEEDVD  373

Query  1425  MLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRR  1604
               GY IPK++QILVNVWAIGRD   W++PL FKPERF E  + D +G  FE +PFG+GRR
Sbjct  374   FCGYIIPKDSQILVNVWAIGRDSSLWENPLDFKPERFWESEI-DIRGQDFELLPFGAGRR  432

Query  1605  MCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             +CP LPLA RM+P+ LGS+L++F+W L  G+ P  +DM+ER GITL KA PL AIP+
Sbjct  433   ICPGLPLAIRMIPIVLGSLLNTFNWKLQDGITPEDLDMEERFGITLAKAQPLLAIPI  489



>ref|XP_010093536.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXB54226.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score =   403 bits (1036),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/479 (41%), Positives = 303/479 (63%), Gaps = 11/479 (2%)
 Frame = +3

Query  342   RLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEA  521
             R  +   LPPGPR  P++GN+ QLG  PH S  E+A  +GP+MTL LGS++TVV SS + 
Sbjct  25    RKSDTKRLPPGPRGIPILGNLLQLGPRPHESLHEMAKLYGPLMTLRLGSVTTVVASSPDM  84

Query  522   AREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDAL  701
             ARE+  NHD V A R I +++     ++G+L        WR  RR+C+++ F   RLD L
Sbjct  85    ARELLHNHDQVFANRPIPDSVTAQPNHQGTLAWVPGDHRWRNRRRICSSQLFTAQRLDIL  144

Query  702   RGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKF  881
             +  R + ++ ++ ++R+  ++ T  +D+G   F  + NL+ N +FS D++D       +F
Sbjct  145   QHFRHRKVEQVLGHIRKHCDAAT-PVDIGSLSFAATLNLMSNTIFSVDIIDAEFGTAQEF  203

Query  882   FYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAG  1061
                   +ME+AGKPN++D+FP L+  D Q ++   +    +  +I  + + +R+E+    
Sbjct  204   KDVVWSIMEYAGKPNLSDYFPALKRFDLQRVKLSVRVSYLRLHEIFDEIIAQRLEA-REK  262

Query  1062  GNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLH  1241
                 + +D++DVLL    +        S   I  ++ ++F AG+DT+ ST EWAM E+L 
Sbjct  263   DKKSRHEDFLDVLLDQSDE-------NSPEAIKPVIMDLFIAGSDTSGSTTEWAMAEVLR  315

Query  1242  NPSSLQKVQAELRSVVG-GTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
              P  LQK Q EL  V+G  T+++++E  I++LPY++A++KETLRLHP  P L+P++A + 
Sbjct  316   KPKVLQKAQKELEEVIGSSTQQRIKESDIDRLPYIQAIVKETLRLHPAAPLLLPYIAAND  375

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               + GY I K  Q+LVN W+IGR+PK W+DPL F PERFL  ++ D++G  FE+IPFG+G
Sbjct  376   VVVNGYTIQKGNQLLVNAWSIGRNPKYWQDPLTFSPERFLGSSV-DYRGRDFEYIPFGAG  434

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RR+CP LPLA+RM+ L L S+LHSFDW L  G+    +DM E+ GITL+KA PL A+P+
Sbjct  435   RRICPGLPLANRMVTLLLASLLHSFDWKLPEGITSENLDMTEQFGITLKKAIPLCAVPL  493



>ref|XP_009613834.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=495

 Score =   403 bits (1035),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 294/484 (61%), Gaps = 13/484 (3%)
 Frame = +3

Query  333   SHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISS  512
             S RR +    L PGP   P++GN+  LG  PH S ++LA  HGPIM L  G ++TVVISS
Sbjct  22    SLRRNKSSKRLAPGPFPLPIIGNLHLLGDQPHKSLAQLAKVHGPIMNLKFGQINTVVISS  81

Query  513   DEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI--TAQYGQHWRMLRRLCTTEFFVTS  686
                A+E+ +  D+  + R + +A++     + S++     +   WR LR++  +  F  +
Sbjct  82    SVLAKEVMQKQDLTFSNRCVPDALRACNHYDFSVLWLPVNHDSRWRTLRKIMISNIFSGN  141

Query  687   RLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSE  866
             +LD    +RTK I  ++ +  ++ N+G A +D+GR  F  S NL+ N +FSKDL DP S+
Sbjct  142   KLDVSEHLRTKKIQELIDFCHKSANNGEA-VDIGRAAFRTSLNLLSNTIFSKDLSDPFSD  200

Query  867   RGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERME  1046
                +F      +M   GKPN+ D+FP L  +DPQGIRR    H  K  D+    + ER++
Sbjct  201   SAKEFKDLVWNIMVETGKPNLVDYFPFLEKIDPQGIRRRMTDHFTKILDLMSGLIDERLK  260

Query  1047  SMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAM  1226
                    +    D +D LL         P       I  +  ++F AGTDTT++TLEWAM
Sbjct  261   ERKM--RNYANVDVLDALLNI------SPEELDRNHIEHMCLDLFAAGTDTTSNTLEWAM  312

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
              ELL NP  L+K Q EL  ++G   K ++E  I +LPYL+ ++KETLR+HP  PFL+P  
Sbjct  313   AELLQNPHILEKAQEELAQMIGRG-KLVDETDIAQLPYLRCIVKETLRIHPQAPFLIPRK  371

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIP  1586
               D   + GY +PK++++LVNVWAIGRD   W++PL FKPERF E  + D +G  FE IP
Sbjct  372   VEDDVELCGYIVPKDSKVLVNVWAIGRDSGLWENPLVFKPERFWESEI-DVRGQDFELIP  430

Query  1587  FGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKA  1766
             FG+GRR+CP LPLA RM+P+ALGS+L++F+W L  G+ P  +DM+E+ GIT+ KA PL A
Sbjct  431   FGAGRRICPGLPLAIRMIPVALGSLLNTFNWKLQGGIAPKDLDMEEKFGITVAKAQPLLA  490

Query  1767  IPVP  1778
             IP+P
Sbjct  491   IPIP  494



>gb|KDO36667.1| hypothetical protein CISIN_1g011040mg [Citrus sinensis]
Length=495

 Score =   403 bits (1035),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 212/476 (45%), Positives = 293/476 (62%), Gaps = 17/476 (4%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR +PV+GN+ +LG  PH S ++LA  +GPIM+L LG ++T+V+SS   A+ + +N
Sbjct  32    LPPGPRPYPVIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQN  91

Query  543   HDVVLAGRKIYEAM--KGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             HD+    RK+ EA+  K    NE SL+       W+ LR++C T  F   +LDA + +R 
Sbjct  92    HDLSFCDRKVPEAVMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRR  151

Query  717   KCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
               I  ++ Y+ E   +G  AIDVG+  F  S NL+ N +FS DL++P+     +F     
Sbjct  152   NKIKDLLAYVEENCRAG-KAIDVGQAAFNTSLNLLSNTIFSIDLVNPKER---EFKNIVC  207

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND--  1070
             ++ME AGKPN++D FPLL+ LD QGIRR T  +  K   +    + +R+E     G    
Sbjct  208   RIMEQAGKPNLSDHFPLLKVLDLQGIRRRTTLYAGKMLKVLDRLVDQRLEQRQEHGCRII  267

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
              + KD +D LL    D         ++ I  +  ++F AG DT + T+EWAM ELLHNP 
Sbjct  268   TECKDILDTLLNIIQD---KSVEIDTKNIKHLFADLFIAGNDTISITVEWAMAELLHNPE  324

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L K + EL   VG     +EE  I +LPYL+AVIKET RLHP  P L+P  A    N++
Sbjct  325   ALLKAKLELEQTVGKGNL-IEESDITRLPYLQAVIKETFRLHPAAPLLIPRKASKDVNIV  383

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ +PK  Q+ VN+WAIGRD  TW +P  F PERFL   + DFKG +FE IPFG+GRR+C
Sbjct  384   GFTVPKGAQVFVNIWAIGRDESTWDNPHSFMPERFLGSKV-DFKGQNFELIPFGAGRRIC  442

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             P LPLA RML L LGS+++SFDW L    E   MDM+E+ G+T++KA PL  +PVP
Sbjct  443   PGLPLAIRMLHLMLGSLINSFDWKL----EGENMDMEEKFGLTIQKAQPLHVVPVP  494



>ref|XP_002276561.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=498

 Score =   403 bits (1035),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/474 (42%), Positives = 295/474 (62%), Gaps = 9/474 (2%)
 Frame = +3

Query  357   GALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMF  536
             G LPPGP  +P++GN+  LG  PH S + LA  +GP+M+L LG ++TVVI+S   A+E+ 
Sbjct  31    GKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGPVMSLKLGCVTTVVITSATMAKEVL  90

Query  537   KNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             +  D     R I +A++    N+ S++       WR LR++C +  F   +LD+   +R 
Sbjct  91    QKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWRTLRKICNSHIFTNQKLDSSNYLRH  150

Query  717   KCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
             + +  ++  + ++  +G   +D+G+  F  + NL+ N  FS DL++P S+   +F     
Sbjct  151   QKVQDLLANVEQSCQAGDV-VDIGQEAFRTTLNLLSNTTFSVDLVEPSSDTVQEFKELVR  209

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME A KPN+AD+FP++R +DPQGIRR    H  K   +    +K+R+ S    G    
Sbjct  210   HMMEEAAKPNLADYFPVVRKIDPQGIRRRMAIHFGKMIKVLDKKVKQRLRSRQVQGW-MA  268

Query  1077  KKDYMDVLLQYRGDLVEGPARFSSRT-INVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
               D +D LL    ++ E    F   T I+ +L ++F AGTDTT +TLEWAM ELLHNP +
Sbjct  269   SSDVLDTLL----NISEDSNNFLDITHIDHLLLDLFVAGTDTTANTLEWAMAELLHNPET  324

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L +VQAELR  +G  +K ++E  I +LPYL+AV+KET RLHP +PFL+P        M G
Sbjct  325   LLRVQAELRQTIG-KDKLVKESDIARLPYLQAVVKETFRLHPAVPFLLPRKVEVDTEMCG  383

Query  1434  YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             + +PK+ Q+LVNVWAIGRDP  W++P  F PERFL  +M D +G +FE IPFG+GRR+CP
Sbjct  384   FIVPKDAQVLVNVWAIGRDPNLWENPNLFMPERFLGSDM-DVRGQNFELIPFGAGRRICP  442

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
              L L  RM+ L L S++HS DW L  G+ P  M+M+E+ G TL+KA PL+ +P+
Sbjct  443   GLLLGIRMVQLMLASLIHSNDWKLEDGLTPENMNMEEKFGFTLQKAQPLRVLPI  496



>gb|AAS92624.1| cytochrome P450 [Hypericum androsaemum]
Length=498

 Score =   403 bits (1035),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 204/471 (43%), Positives = 292/471 (62%), Gaps = 11/471 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR  P++GN+  L   PH S ++LA  HGP++TL LG ++TVV+SS   ARE+ + 
Sbjct  37    LPPGPRPLPIIGNLLALRDKPHKSLAKLARVHGPLVTLKLGQVTTVVVSSPATAREILQK  96

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L+ R I +A++    +E  L     G  WR  R++C +  F   +L++ + VR + 
Sbjct  97    HDATLSNRYIIDAIRAQGHHEAGLAWVPVGPTWRKFRKVCYSHIFTNQKLNSSQHVRQRT  156

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             I  ++   RE+   G A +DVG+  F  + + +   + S DL D  S+   +F   A  +
Sbjct  157   IQQLLAEARESCRVGEA-MDVGKAAFRAALSSLSISVMSLDLADAASDTAREFKELARCI  215

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M   G+PN+AD+FP+L+  DPQG+R   +    +  D+ G  + +RME     G DE   
Sbjct  216   MNDVGEPNLADYFPVLKRFDPQGVRGRVEISFGRILDLFGSIIADRMEKR---GADE---  269

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL       E P       I  +L ++F AGT+TT+STLEWAM ELLH P+++ K
Sbjct  270   DILDTLLTTHD---ENPELVEINDIKHLLLDLFVAGTETTSSTLEWAMAELLHKPTTMAK  326

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              +AEL  ++G      +E  + +LPYL+AVI+ETLRLHP +P L+P  A +  ++ G+ I
Sbjct  327   AKAELEQIIGKGNSIDQESEVSRLPYLQAVIQETLRLHPAVPLLLPRRAGEEVHVSGFTI  386

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK+ Q+LVNVWA+GRDP+ W+DP  F PERFL  ++ D  G  FE IPFG+GRR+CP LP
Sbjct  387   PKDAQVLVNVWAMGRDPEVWEDPCSFTPERFLGSSI-DVIGTCFELIPFGAGRRICPGLP  445

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RML + LG++L SFDW L  G+ P  MDM++R GITL+KA PL AIP+
Sbjct  446   LAMRMLQMMLGNLLLSFDWKLPDGVTPECMDMEDRFGITLQKAQPLLAIPL  496



>ref|XP_002271652.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   403 bits (1035),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/460 (44%), Positives = 289/460 (63%), Gaps = 10/460 (2%)
 Frame = +3

Query  396   GNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIY  575
             GN+ +LG  PH SF+ L+ K+GP+M+L LGS++T+VISS E A+++    D   +GR + 
Sbjct  48    GNLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVP  107

Query  576   EAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREA  755
              A++    +  S+       HWR LR++C+ + F   R+DA  G+R K +  ++ +  E+
Sbjct  108   NAIQVASHHHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRQKVVQQLLDHAHES  167

Query  756   GNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVAD  935
              +SG A +D+GR  F ++ NL+ N +FS DL    S    +F      ++   GKPN+AD
Sbjct  168   CSSGRA-VDIGRAAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSILVEVGKPNLAD  226

Query  936   FFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRG  1115
             FFP LR +DPQGI +    + NK FD+   ++ +R++ + A   D    D +D LL    
Sbjct  227   FFPGLRLVDPQGIHKRMSVYFNKLFDVFDSFINQRLQ-LRASSTD---NDVLDALLNLNK  282

Query  1116  DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGG  1295
                +     S   I  +L ++F+AGTDTT+ST+EWAM ELL+NP ++ K + EL  VVG 
Sbjct  283   ---QHDHELSCNDIRHLLVDLFSAGTDTTSSTIEWAMAELLNNPKAMAKARDELSQVVG-  338

Query  1296  TEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVW  1475
              ++ +EE  I KLPYL AV+KET RLHPP PFL+P  A     +LGY +PK  Q+++NVW
Sbjct  339   KDRIVEESDISKLPYLHAVVKETFRLHPPAPFLLPRKAEMDSEILGYAVPKNAQVIINVW  398

Query  1476  AIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALG  1655
             AIGRD KTW DP  F PERFLE ++ D KG  F+ IPFG+GRR+CP L L  RM+ L L 
Sbjct  399   AIGRDSKTWSDPHSFGPERFLECDI-DVKGRDFQLIPFGAGRRICPGLLLGRRMVHLVLA  457

Query  1656  SVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             S+LHSFDW L  GM+P  MDM E  G ++RKA PL+ +P+
Sbjct  458   SLLHSFDWKLEGGMKPEDMDMSETFGFSVRKAQPLRVVPI  497



>ref|XP_006360234.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=491

 Score =   402 bits (1034),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 201/472 (43%), Positives = 282/472 (60%), Gaps = 11/472 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             L PGP   P++GN+  LG  PH+S ++LA  HGPIM L  G ++TV++SS   ARE+ + 
Sbjct  30    LAPGPFPLPIIGNLHLLGDKPHISLTQLAKNHGPIMNLKFGQINTVIVSSAVLAREVTQK  89

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
              D++ + R I +A++    N+ S I       WR LR++     F  +RLDA   +R+K 
Sbjct  90    KDLMFSNRCIPDALRACNHNDFSAIWLPVDSQWRTLRKIMNYHIFSGNRLDANEHLRSKK  149

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             I  ++ Y       G   +++ R  F  + NL+ N  FS DL DP ++   +F      +
Sbjct  150   IQELIDYCGNCSKVG-ETVNISRATFRTAMNLLSNTFFSIDLTDPFTDSAKEFKELVSNI  208

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
                AGKPNV DFFP L+ +DPQGIRR    +  K   +  D + ER++  + G +     
Sbjct  209   SIEAGKPNVVDFFPFLQKIDPQGIRRRMTKYFTKILHLMSDLIDERLKERSMGKH--ANV  266

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL         P       I  +  ++F AGTDTT++TLEWAM ELL NP +L+K
Sbjct  267   DVLDALLNI------CPKEIDRNQIEQLCLDLFEAGTDTTSNTLEWAMAELLKNPHTLEK  320

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              Q EL  V+G   K +    +  LPYL+ ++KE  R+HP +PFL+P    +  +  GY I
Sbjct  321   AQEELAQVIG-RGKLINAADVANLPYLRCIVKENFRIHPQVPFLIPRKTEEDVDFCGYII  379

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK++Q+LVNVWAIGRD   W+DPL FKPERFLE  + D +G  FE +PFG GRR+CP LP
Sbjct  380   PKDSQVLVNVWAIGRDSSLWEDPLDFKPERFLESEI-DIRGQDFELLPFGVGRRICPGLP  438

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             LA RM+P+ LGS+L++F+W L  G+ P  +DM+ER GITL KA PL AIP+P
Sbjct  439   LAIRMIPIVLGSLLNTFNWKLQDGITPEDLDMEERFGITLSKAQPLLAIPIP  490



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   403 bits (1035),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 211/464 (45%), Positives = 300/464 (65%), Gaps = 6/464 (1%)
 Frame = +3

Query  390   VVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV-VISSDEAAREMFKNHDVVLAGR  566
             + GN+FQLG  P  + + L  K+GP++ L LG+ + + V+ +  AA E+FKNHD+  A R
Sbjct  45    IFGNVFQLGTEPFKAMACLEQKYGPVLWLKLGTSTNIMVVQTARAAAELFKNHDISFADR  104

Query  567   KIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYM  746
              I    +     +GS+   QYG +WR  RR+CT E F+  ++     VR KC+D+M++++
Sbjct  105   FIPIVNQAHNYCQGSMALCQYGSYWRFQRRICTVEMFIHKKISETVPVRRKCVDNMLKWI  164

Query  747   REAGNSGT--AAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGK  920
              +A NS    + I+V RF FL SFN++GNL+ SKDL DP SE  ++FF     +M ++G 
Sbjct  165   GKAANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMVWSGV  224

Query  921   PNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVL  1100
              NV+D FP LR  D Q +R+  +  + KA +IA  +LKER E    G  ++  KD++D L
Sbjct  225   TNVSDIFPFLRKFDVQNLRKKMERDMGKAMEIASIFLKEREEERKKGA-EKIGKDFLDAL  283

Query  1101  LQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
             L++ G   + PA+ S   I V+L EMF AGT+TT+S++EWA+ ELL +P ++ KV+ E+ 
Sbjct  284   LEFEGTGKDEPAKLSEHEIKVLLVEMFLAGTETTSSSVEWALAELLRHPQAMDKVKTEIS  343

Query  1281  SVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQI  1460
              ++G   +K EE  I+ LPY++AVIKE+LRLHPPLP L+P   +     +GY +PK T++
Sbjct  344   KLIG-PNRKFEENDIDNLPYMQAVIKESLRLHPPLPLLIPRETVHDTKFMGYDVPKGTRV  402

Query  1461  LVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRML  1640
             LVN W IGRDP+ W DP+ FKPERFL   + D KG H+E IPFG+GRRMC  LPL  RM+
Sbjct  403   LVNAWEIGRDPECWDDPMSFKPERFLGSKV-DMKGQHYELIPFGAGRRMCVGLPLGHRMM  461

Query  1641  PLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
               ALGS+LH F+W L  G+ P  ++M   MGIT RK   LK IP
Sbjct  462   HFALGSLLHEFEWELPDGVSPKSINMDVSMGITARKQESLKVIP  505



>emb|CAN75686.1| hypothetical protein VITISV_010578 [Vitis vinifera]
Length=499

 Score =   402 bits (1033),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 203/460 (44%), Positives = 288/460 (63%), Gaps = 10/460 (2%)
 Frame = +3

Query  396   GNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKNHDVVLAGRKIY  575
             GN+ +LG  PH SF+ L+ K+GP+M+L LGS++T+VISS E A+++    D   +GR + 
Sbjct  48    GNLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVP  107

Query  576   EAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREA  755
              A++       S+       HWR LR++C+ + F   R+DA  G+R K +  ++ +  E+
Sbjct  108   NAIQVANHQHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRRKVVQQLLDHAHES  167

Query  756   GNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVAD  935
              +SG A +D+GR  F ++ NL+ N +FS DL    S    +F      ++   GKPN+AD
Sbjct  168   CSSGRA-VDIGRTAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSILVEVGKPNLAD  226

Query  936   FFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRG  1115
             FFP LR +DPQGI +    + NK FD+   ++ +R++ + A   D    D +D LL    
Sbjct  227   FFPGLRLVDPQGIHKRMSVYFNKLFDVFDSFINQRLQ-LRASSTD---NDVLDALLNLNK  282

Query  1116  DLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELRSVVGG  1295
                +     S   I  +L ++F+AGTDTT+ST+EWAM ELL+NP ++ K + EL  VVG 
Sbjct  283   ---QHDHELSCNDIRHLLVDLFSAGTDTTSSTIEWAMAELLNNPKAMAKARDELSQVVG-  338

Query  1296  TEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQILVNVW  1475
              ++ +EE  I KLPYL AV+KET RLHPP PFL+P  A     +LGY +PK  Q+++NVW
Sbjct  339   KDRIVEESDISKLPYLHAVVKETFRLHPPAPFLLPRKAEMDSEILGYAVPKNAQVIINVW  398

Query  1476  AIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRMLPLALG  1655
             AIGRD KTW DP  F PERFLE ++ D KG  F+ IPFG+GRR+CP L L  RM+ L L 
Sbjct  399   AIGRDSKTWSDPHSFGPERFLECDI-DVKGRDFQLIPFGAGRRICPGLLLGRRMVHLVLA  457

Query  1656  SVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             S+LHSFDW L  GM+P  MDM E  G ++RKA PL+ +P+
Sbjct  458   SLLHSFDWKLEGGMKPEDMDMSEXFGFSVRKAQPLRVVPI  497



>ref|XP_006358805.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   402 bits (1033),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 205/474 (43%), Positives = 287/474 (61%), Gaps = 12/474 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP++GNI  LG  PH S + LA  +GPIM+L LG ++TVVISS   A+++ KN
Sbjct  28    LPPGPSPWPIIGNIHLLGANPHTSLANLAKIYGPIMSLKLGQITTVVISSSSMAKQVLKN  87

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD+  + R I +A++    ++ S +       WR LR++  T+   T+RLDA + +R++ 
Sbjct  88    HDLAFSTRFIPDALQAHNYSKFSAVWLPVCPQWRTLRKIMNTKLLSTNRLDANQHLRSQK  147

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
                ++ Y  +    G  A+DVG+  F  + NL+ N +FSKDL+D  S+   +       +
Sbjct  148   EKELIDYCEKCSQQG-EAVDVGQLVFKTNLNLVSNTLFSKDLVDLYSDAKVELKDAILSI  206

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ++ AG  N+ DFFP+L  +DPQ IR  T  H  K + + GD + ER+E      N  +K 
Sbjct  207   IDVAGMINLVDFFPILENVDPQRIRYRTNIHFGKLYKLFGDMINERLEEKKT--NQSEKS  264

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D + VLL +     E P       +N  L ++F    DT T+T+EWAM E+L  P  ++K
Sbjct  265   DILQVLLNHSA---ENPQEMDRNFMNSTLLDLFIGSIDTITNTVEWAMAEILRQPEIMKK  321

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             VQAEL  VVG   K +EE  + +LPYL+ +IKETLRLHPP PFL+P        +  Y I
Sbjct  322   VQAELAQVVGKG-KPIEEADVSRLPYLQFIIKETLRLHPPAPFLIPRRVDQDVELCDYII  380

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERF--LEPNMADFKGHHFEFIPFGSGRRMCPA  1616
             PK + +LVN WAIGRD   W+D L FKPERF  LE NM   +G  FE IPFG+GRR CP 
Sbjct  381   PKGSIVLVNAWAIGRDSSFWEDTLVFKPERFQSLELNM---RGKDFELIPFGAGRRTCPG  437

Query  1617  LPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
              PLA R++P+ LGS+L+SF+W L   +EP  +DM+E+ G  + KA PL+AIP P
Sbjct  438   FPLALRLMPVILGSMLNSFNWKLEACIEPKDLDMEEKFGAIIAKAHPLRAIPSP  491



>ref|XP_010523703.1| PREDICTED: cytochrome P450 76C4-like [Tarenaya hassleriana]
Length=506

 Score =   402 bits (1034),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 305/483 (63%), Gaps = 14/483 (3%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             +S RR      LPPGP R P++GNI  +G  PH S +EL+  +GPIM+L LG+++TVV+S
Sbjct  26    KSRRR---SAVLPPGPPRLPIIGNILNVGKNPHHSLAELSKAYGPIMSLKLGTLTTVVVS  82

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSR  689
             S +AA+E+ + HD  L+GR   + ++    +E S++       WR+LR++   + F  SR
Sbjct  83    SPDAAKEVLQVHDQALSGRTFSDPVRAIGHHEVSVVWLPALARWRLLRKISAAQVFSPSR  142

Query  690   LDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSER  869
             L+A R +RT  +  ++ ++ ++ N G  A+D+GR  F+ + N+I N +FS +        
Sbjct  143   LEATRPIRTNKLQELLNFLNDSCNRGE-AVDIGRASFVTAVNIISNTLFSINFASYDYTA  201

Query  870   GAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMES  1049
               +F      +M  AGKPN+ADFFP+LR+LD QGIR+  +   ++ F++   ++  R   
Sbjct  202   SNEFHDLVVGIMTAAGKPNLADFFPILRFLDLQGIRKELKACSDRLFEVFQGFIDSRTAK  261

Query  1050  MNAGGNDEKKKDYMDVLLQYRGDLV-EGPARFSSRTINVILFEMFTAGTDTTTSTLEWAM  1226
              ++     + KD +D L+    D+V E  +  S + I  +L ++F AGTDT +ST+EWAM
Sbjct  262   RSS---RTEPKDVLDSLI----DIVHENESELSMKDIRHLLLDLFLAGTDTNSSTVEWAM  314

Query  1227  TELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHM  1406
              ELLH P ++ K QAE+  ++ G    ++E  I KLPY++AV+KETLRLHPP PFL+P  
Sbjct  315   AELLHRPETMAKAQAEIARLI-GENGVIQESDIPKLPYIQAVMKETLRLHPPAPFLLPRK  373

Query  1407  AMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIP  1586
             A     +  + +PK  Q+LVNVWAIGRDP  W +P +F+PERFL   + D KG  FE  P
Sbjct  374   AESDVQISDFLVPKNAQVLVNVWAIGRDPNVWDNPTQFEPERFLGSEI-DMKGKDFELTP  432

Query  1587  FGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKA  1766
             FG+GRR+CP + LA + +P+ L S+LHSFDW L +G+ P ++DM+E  G+TL KA PL A
Sbjct  433   FGAGRRICPGMQLAFKTVPMMLVSLLHSFDWKLQNGVVPEKLDMEEAFGVTLHKAQPLYA  492

Query  1767  IPV  1775
             +P+
Sbjct  493   VPI  495



>ref|XP_010518177.1| PREDICTED: cytochrome P450 76C1-like [Camelina sativa]
Length=511

 Score =   402 bits (1034),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/486 (42%), Positives = 302/486 (62%), Gaps = 11/486 (2%)
 Frame = +3

Query  330   RSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVIS  509
             RS +   +  +LPPGP R P++GNI  +G  PH SF+EL+  +GP+M+L LGS++TVVI+
Sbjct  27    RSRQTSRKASSLPPGPPRLPIIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIA  86

Query  510   SDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLI-TAQYGQHWRMLRRLCTTEFFVTS  686
             S +AARE+ + HD +L+GR    +++     + SL+        WR+ RRL  T+ F   
Sbjct  87    SPQAAREVLRTHDQILSGRSPTNSIRSINHQDASLVWLPASSARWRLYRRLSVTQLFSPQ  146

Query  687   RLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSE  866
             RL+A + +R   +  +V ++ E+ +    +ID+ R  F+ + N+I N++FS DL    ++
Sbjct  147   RLEATKAMRANKVKELVSFISESSDR-EESIDISRASFITTLNIISNILFSADLGSYNAK  205

Query  867   RGAKFFYHAG-KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
                         VME  GKP+ A++FPLLR+LD QG R+  +    + F +   ++  ++
Sbjct  206   DSTNGVQDTVISVMEAVGKPDAANYFPLLRFLDLQGNRKTMKACTERLFRVFRGFIDAKI  265

Query  1044  --ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLE  1217
               +S  +   D  K D++D LL Y+GD     A  +   I  ++ +MFTAG+DT++S LE
Sbjct  266   AEKSSQSKPKDVSKNDFVDNLLNYKGD----EAEINISDIEHLVLDMFTAGSDTSSSALE  321

Query  1218  WAMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLV  1397
             WAM ELL NP ++ K QAE+  V+G     +E+  I +LPYL+AV+KET RLHP  PFLV
Sbjct  322   WAMAELLRNPKTMVKAQAEIDRVIG-QNGTVEDSDISELPYLQAVVKETFRLHPGAPFLV  380

Query  1398  PHMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFE  1577
             P  A     +LG+ + K++Q+LVNVW IGRDP  W++P +F+PERFL   + D +G  +E
Sbjct  381   PRKAESDVEILGFMVLKDSQVLVNVWGIGRDPSVWENPTRFEPERFLGKEI-DLRGRDYE  439

Query  1578  FIPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATP  1757
             F PFG+GRR+CP LPLA + + L L S+L+SFDW L +G+    +DM E  GITL K  P
Sbjct  440   FTPFGAGRRICPGLPLAVKTVSLMLASLLYSFDWKLPNGVVSEDLDMDETFGITLHKTNP  499

Query  1758  LKAIPV  1775
             L A+PV
Sbjct  500   LHAVPV  505



>ref|XP_002301305.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80578.2| cytochrome P450 family protein [Populus trichocarpa]
Length=500

 Score =   402 bits (1033),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 212/481 (44%), Positives = 293/481 (61%), Gaps = 11/481 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             RR      LPPGPR+ P++GNI  LG  PH + ++L+  +GP+MTL LG ++T+VISS  
Sbjct  27    RRKSGCTVLPPGPRQLPIIGNILALGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPN  86

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGN--EGSLITAQYGQHWRMLRRLCTTEFFVTSRL  692
              A+E  + HD  L+ R + +A+   + N  + S++      HW+ LR+L  T+ F + RL
Sbjct  87    IAKEALQKHDQALSSRTVPDALHVQYYNYHKNSMVWLPASTHWKFLRKLTATQMFTSQRL  146

Query  693   DALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERG  872
             DA R +R K +  ++ Y+ E  N+G  A+DVGR  F    NLI N  FS D+ +  S+  
Sbjct  147   DASRALRGKKVQELLEYVHEKCNNG-HAVDVGRSVFTTVLNLISNTFFSLDVTNYNSDLS  205

Query  873   AKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESM  1052
              +F      V+E  GKPN+AD+FP+LR +DPQGIRR T  ++ +   I    + ER    
Sbjct  206   QEFSNLVVGVLEQIGKPNIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLR  265

Query  1053  NAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTE  1232
             ++    +   D +D LL       E     SS  I V+L + F AGTDTT+ST+EWAMTE
Sbjct  266   SSSVASKASHDVLDALLILAK---ENNTELSSTDIQVLLIDFFIAGTDTTSSTVEWAMTE  322

Query  1233  LLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAM  1412
             LL NP  + K + EL+ V G     ++E  I K PYL+A++KET RLHPP P L+P  A+
Sbjct  323   LLLNPDKMVKAKNELQQVEG----PVQESDISKCPYLQAIVKETFRLHPPAPLLLPRKAV  378

Query  1413  DSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFG  1592
                 M G+ +PK  QIL+N+WAIGRDP  W DP  FKPERFLE   AD KG  FE IPFG
Sbjct  379   SEVEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPERFLECQ-ADVKGRDFELIPFG  437

Query  1593  SGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +GRR+CP LPL  +M+ L L S++HSFDW +   + P  +D  E  G+TL K+ PL+AIP
Sbjct  438   AGRRICPGLPLGHKMVHLTLASLIHSFDWKIAGDLTPEDIDTSETFGLTLHKSEPLRAIP  497

Query  1773  V  1775
             +
Sbjct  498   M  498



>ref|XP_011033851.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Populus euphratica]
Length=500

 Score =   402 bits (1033),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 213/485 (44%), Positives = 293/485 (60%), Gaps = 10/485 (2%)
 Frame = +3

Query  321   INERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV  500
             I  RS R+    G LPPGP R P+VGN++ LG  PH S ++LA  HG +M+L LG ++T+
Sbjct  24    ILRRSKRK---SGKLPPGPSRLPIVGNLWDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTI  80

Query  501   VISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFV  680
             V+SS   A+E+ + HD+    R I +A++    +E  +        WR LRR+C +  F 
Sbjct  81    VVSSAAMAKEVLQKHDLTFCNRTIVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFT  140

Query  681   TSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPR  860
               +LDA + +R K +  ++  ++E    G  A+D+    F  + N + N + S +L D  
Sbjct  141   AQKLDANQDLRRKKVQDILAEVQERCLVG-EAVDLRHAAFTATLNALSNTVLSLNLTDLS  199

Query  861   SERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKER  1040
             S+   +F      +M+ AGKP + D+FPLLR +DPQGIRR    H  K  D+    + ER
Sbjct  200   SDIAREFKERISCIMDEAGKPTLVDYFPLLRRIDPQGIRRRMAIHFGKVLDLFDRLIIER  259

Query  1041  MESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEW  1220
             ++     G      D +D LL       E      +  I     ++F AGTDTT+STLEW
Sbjct  260   LQLRKEKGY-IPLDDMLDTLLTISEVNNE---EIDATRIKHFFLDLFGAGTDTTSSTLEW  315

Query  1221  AMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVP  1400
             AM ELLH+P +L K +AEL   +G     LEE  I +LPYL+AVIKETLRLHP +PFL+P
Sbjct  316   AMAELLHSPKTLLKARAELERTIG-EGNLLEESDITRLPYLQAVIKETLRLHPAVPFLLP  374

Query  1401  HMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEF  1580
             H A     + G+ +PK  Q+LVNVWAIGRDP  W+DP  F PERFL+  + D +G +FEF
Sbjct  375   HRAGADAEIGGFTVPKNAQVLVNVWAIGRDPSMWEDPNSFVPERFLDSGI-DHRGQNFEF  433

Query  1581  IPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             IPFGSGRRMCP LPLA RML L LGS++ SFDW L  G+ P  ++M ++ G+TL KA PL
Sbjct  434   IPFGSGRRMCPGLPLAMRMLHLMLGSLILSFDWKLADGVTPENLNMDDKFGLTLLKAQPL  493

Query  1761  KAIPV  1775
             +AIP+
Sbjct  494   RAIPI  498



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score =   400 bits (1029),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 213/465 (46%), Positives = 302/465 (65%), Gaps = 8/465 (2%)
 Frame = +3

Query  396   GNIFQL-GWTPHVSFSELASKHGPIMTLWLGS-MSTVVISSDEAAREMFKNHDVVLAGRK  569
             GN+F L G  P+   + L  K+GPI+ L +GS M+T+VI +  +A E+F+NHDV  + R 
Sbjct  2     GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRP  61

Query  570   IYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMR  749
             I +        +GS+  A YG +WR  RR+CT E FV  R++    +R + +D M+R   
Sbjct  62    IVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDE  121

Query  750   EAGNSGTAA---IDVGRFFFLMSFNLIGNLMFSKDLL-DPRSERGAKFFYHAGKVMEFAG  917
             E  +S       I+V R+ FL SFN++GN++FSKDL+ DP S++G++FF     +ME+AG
Sbjct  122   EKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIMEWAG  181

Query  918   KPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDV  1097
              PN++D FP L+  D QG+R+  +  + K  +I   +++ER+E    G  +   KD +DV
Sbjct  182   VPNISDIFPCLKMFDVQGLRKKMERDMGKGKEITKKFIEERIEERKKGEKNRSIKDLLDV  241

Query  1098  LLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAEL  1277
             L+ + G   + P + S   I VI+ EMF AGT+TT+S++EWA+TELL +P ++ KV+ E+
Sbjct  242   LIDFEGSGKDEPDKLSEDEITVIILEMFLAGTETTSSSVEWALTELLRHPQAMAKVKLEI  301

Query  1278  RSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYIPKETQ  1457
               V+ G  KK EE  I+ LPY++AV+KE LRLHPPLP L+P  A+     +GY IPK TQ
Sbjct  302   LQVI-GPNKKFEECDIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKFMGYDIPKGTQ  360

Query  1458  ILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALPLASRM  1637
             +LVN WAIGRDP+ W +P +FKPERFLE  + D KG ++E IPFG+GRRMC  LPL  RM
Sbjct  361   VLVNAWAIGRDPEYWDNPFEFKPERFLESKV-DVKGQNYELIPFGAGRRMCVGLPLGHRM  419

Query  1638  LPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             +    GS+LH FDW L H + P  ++M+E MGIT RK  PLK IP
Sbjct  420   MHFTFGSLLHEFDWELPHNVSPKSINMEESMGITARKKQPLKVIP  464



>ref|XP_006423653.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
 gb|ESR36893.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
Length=495

 Score =   401 bits (1031),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 293/476 (62%), Gaps = 17/476 (4%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGPR +PV+GN+ +LG  PH S ++LA  +GPIM+L LG ++T+V+SS   A+ + +N
Sbjct  32    LPPGPRPYPVIGNLLELGGKPHESLAKLAQIYGPIMSLRLGQVTTIVVSSPSMAKAILQN  91

Query  543   HDVVLAGRKIYEAM--KGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
             HD+    RK+ EA+  K    NE SL+       W+ LR++C T  F   +LDA + +R 
Sbjct  92    HDLSFCDRKVPEAIMSKTYRRNEFSLVWMPVSALWKNLRKICNTHIFTNQKLDANQDLRR  151

Query  717   KCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
               I  ++ Y+ E   +G A IDVG+  F  S NL+ N +FS DL++P+     +F     
Sbjct  152   NKIKDLLAYVEENCRAGKA-IDVGQAAFNTSLNLLSNTIFSIDLVNPKER---EFKNIVC  207

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGND--  1070
             ++ME AGKPN++D FPLL+ LD QGIRR +  +  K   +    + +R+E     G    
Sbjct  208   RIMEQAGKPNLSDHFPLLKVLDMQGIRRRSTLYAGKMLKVLDRLVDQRLEQRQEHGCRII  267

Query  1071  EKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPS  1250
              + KD +D LL    D         ++ I  +  ++F AG DT + T+EWAM ELLHNP 
Sbjct  268   TECKDILDTLLNIIQD---KSVEIDTKNIKHLFADLFIAGNDTISITVEWAMAELLHNPE  324

Query  1251  SLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNML  1430
             +L K + EL   VG     +EE  I +LPYL+AVIKET RLHP  P L+P  A    N++
Sbjct  325   ALLKAKLELEQTVGKGNL-IEESDITRLPYLQAVIKETFRLHPAAPLLIPRKASKDVNIV  383

Query  1431  GYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMC  1610
             G+ +PK  Q+ VN+WAIGRD  TW +P  F PERFL   + DFKG +FE IPFG+GRR+C
Sbjct  384   GFTVPKGAQVFVNIWAIGRDESTWDNPHSFMPERFLGSKV-DFKGQNFELIPFGAGRRIC  442

Query  1611  PALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPVP  1778
             P LPLA RML L LGS+++SFDW L    E   MDM+E+ G+T++KA PL  +PVP
Sbjct  443   PGLPLAIRMLHLMLGSLINSFDWKL----EGENMDMEEKFGLTIQKAQPLHVVPVP  494



>ref|XP_002301307.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80580.2| cytochrome P450 family protein [Populus trichocarpa]
Length=496

 Score =   401 bits (1031),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 293/479 (61%), Gaps = 11/479 (2%)
 Frame = +3

Query  339   RRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDE  518
             RR      LPPGPR+ P++GNI  LG  PH + + L+  +GP+MTL LG ++T+VISS  
Sbjct  27    RRKSGCTVLPPGPRQLPIIGNILALGDKPHRTLANLSQTYGPLMTLKLGRITTIVISSPN  86

Query  519   AAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDA  698
              A+E  + HD  L+ R + +A++    N  S+I      HW+ LR+L  T+ F + RLDA
Sbjct  87    IAKEALQKHDQALSSRTVPDALRVHHKN--SMIWLPASTHWKFLRKLTATQMFTSQRLDA  144

Query  699   LRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAK  878
              R +R K +  ++ Y+ E  N+G  A+DVGR  F    NLI N  FS D+ +  S+   +
Sbjct  145   SRALRGKKVQELLEYVHENCNNG-HAVDVGRSVFTTVLNLISNTFFSLDVTNYNSDLSQE  203

Query  879   FFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNA  1058
             F      VME  GKPN+AD+FP+LR +DPQGIRR T  ++ +   I    + ER    ++
Sbjct  204   FSDLVVGVMEQIGKPNIADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRSS  263

Query  1059  GGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELL  1238
                 +   D +D LL       E     SS  + ++L + F AGTDTT+ST+EWAMTELL
Sbjct  264   SVASKASHDVLDALLILAK---ENNTELSSTDVQILLLDFFNAGTDTTSSTVEWAMTELL  320

Query  1239  HNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDS  1418
              NP  + K + EL+ + G     ++E  I K PYL+A++KET RLHPP P L+P  A+  
Sbjct  321   LNPDKMVKAKNELQEIEG----PVQESDISKCPYLQAIVKETFRLHPPAPLLLPRRAVSE  376

Query  1419  CNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSG  1598
               M G+ +PK  QIL+N+WAIGRDP  W DP  FKPERFLE   AD KG  FE IPFG+G
Sbjct  377   VEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPERFLECQ-ADVKGRDFELIPFGAG  435

Query  1599  RRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             RR+CP LPLA +M+ L L S++HSFDW +   + P  +DM E  G+TL K+ PL+AIP+
Sbjct  436   RRICPGLPLAHKMVHLTLASLIHSFDWKIADDLTPEDIDMSETFGLTLHKSEPLRAIPM  494



>ref|XP_010691517.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=491

 Score =   401 bits (1030),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 205/474 (43%), Positives = 293/474 (62%), Gaps = 10/474 (2%)
 Frame = +3

Query  357   GALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMF  536
               LPPGP+  P+ GNIF+LG  PH SF+ L+  +GP+++L LG+++T+VISS E A+EMF
Sbjct  25    AKLPPGPKPMPIFGNIFELGEKPHRSFTRLSEIYGPLISLKLGAITTIVISSSEVAKEMF  84

Query  537   KNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRT  716
               +D  L  R I +++K    ++ S+        WR LR++ T +   T RLDA + +R 
Sbjct  85    LKNDQNLCNRTIPDSVKASNHDKLSISWLPVSTKWRNLRKISTVQLLSTQRLDASQSLRQ  144

Query  717   KCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAG  896
               +  ++ Y++E   +G  +ID+GR  F  S +L+ N  FSK+L    S    +F     
Sbjct  145   AKVQQLLDYVQECCRNG-QSIDIGRAAFTTSLSLLSNTFFSKELAHHSSSASLEFKQLMW  203

Query  897   KVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEK  1076
              +ME  G+PN AD+FP+L ++DP GIRR    + +K   +  + + ER+  + +      
Sbjct  204   CIMEEIGRPNYADYFPILGYIDPFGIRRRLTTYFDKLIGVFQEIICERLRKVKSC-TTAA  262

Query  1077  KKDYMDVLLQ-YRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSS  1253
               D +D LL+ Y+ +        S   IN +L ++F AGTDTT STLEWAM EL+ NP  
Sbjct  263   TTDVLDTLLKLYKQN------ELSMEEINHLLVDIFNAGTDTTASTLEWAMAELVKNPKR  316

Query  1254  LQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLG  1433
             L K Q E+   +G +   +EE  I KLPYL+A+IKETLRLHPP  FL+P  A  +  + G
Sbjct  317   LAKAQGEIERALGKSGSIIEESDISKLPYLQAIIKETLRLHPPTVFLLPRKADGNFTLYG  376

Query  1434  YYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCP  1613
             Y +PK  Q+LVN+WAIGRDPK W++P  F PERFL  ++ D KGH+FE +PFG+GRR+CP
Sbjct  377   YVVPKNAQVLVNLWAIGRDPKVWENPDVFLPERFLGCDI-DLKGHNFELLPFGAGRRICP  435

Query  1614  ALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
              L LA RML L L ++L S +W L  GM P  +DM E+ GITL+K  PL+ IP+
Sbjct  436   GLSLAYRMLNLMLATLLQSHNWKLEDGMSPRDLDMTEKFGITLQKINPLQLIPL  489



>gb|KDO57775.1| hypothetical protein CISIN_1g011069mg [Citrus sinensis]
Length=494

 Score =   401 bits (1030),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 293/471 (62%), Gaps = 9/471 (2%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  WP++GN+ QLG  PH S ++LA  HGPIM+L +G ++TVVISS   A+++ ++
Sbjct  31    LPPGPTPWPIIGNLPQLGHKPHKSLADLAKVHGPIMSLKIGQVTTVVISSASMAKQVLQD  90

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD  L  R + +++      E  +        W+ LR++C    F + +LDA + +R K 
Sbjct  91    HDAALCNRNVPDSVSSHQKGEYGIPWLPASTQWKKLRKICNLHIFTSQKLDANQDLRRKK  150

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             I  +V +++E+ ++G  AID+G+  F  + NL+ N +FS DL DP S    +F      +
Sbjct  151   IQQLVAFVQESCHAGE-AIDIGQAAFDTAVNLLSNTIFSVDLADPNSASAREFKNLMWGL  209

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M  +GKPNV+DFFP+LR LD QG+RR    H  K  ++   ++ +R++     G     K
Sbjct  210   MVESGKPNVSDFFPMLRKLDIQGVRRRLSRHHIKILEVLDRFIYQRLKQRQEHGF-VGSK  268

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D +D LL      +    +        +  ++F AG +TT+STLEWA+TEL+H+P +L K
Sbjct  269   DMLDTLLN-----ISESEKIDRNDFKHLFLDLFAAGAETTSSTLEWALTELVHSPEALSK  323

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
              ++EL   +G     +EE  I +LPYL+AV+KETLRLHP +P L+P  A     + G+ +
Sbjct  324   ARSELEKQIGKGN-PMEESDIARLPYLQAVVKETLRLHPAVPLLIPRKASVDVQISGFIV  382

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK  Q+LVN WAIGRD  TW++P  FKPERFL  ++ D KG +FE IPFG+GRR+CP LP
Sbjct  383   PKGAQVLVNAWAIGRDASTWENPYSFKPERFLGLDV-DVKGRNFELIPFGAGRRICPGLP  441

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIPV  1775
             LA RML L LGS++ SFDW L   +    MDM+E+ GITL+KA PL+ +PV
Sbjct  442   LAIRMLHLMLGSLIKSFDWKLESKVTTENMDMEEKFGITLQKAQPLRVVPV  492



>ref|XP_004241762.2| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=968

 Score =   416 bits (1068),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 305/470 (65%), Gaps = 6/470 (1%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  +P++G++ QLG  P+ S ++LA+ HGP+MTL LGS++TV+ SS E A+E+ + 
Sbjct  500   LPPGPTGFPIIGSLLQLGSRPNQSLAKLANIHGPLMTLKLGSITTVIASSPETAKEILQK  559

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD + + R +  A+      E +L        WR  RR+C  + F   +LD+L+ +R + 
Sbjct  560   HDKIFSARTVPNAVASQPNWEATLAWVPPDNMWRNKRRICNKQMFTNQKLDSLQELRRQK  619

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
              + +V ++R    SG+A +D+GR  F  + NLI N +FS D++D   +   +F      +
Sbjct  620   AEQLVSHIRSQCESGSA-VDIGRVAFATTLNLISNTIFSIDMVDTEFKTAHEFKELVWTI  678

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             ME +G PN +D+FPLL+WLD QGIRR  +    +  +I  + +++R++    G   +K  
Sbjct  679   MEESGVPNTSDYFPLLKWLDLQGIRRRIRPAYLRLHEIFEENIEKRLDDRATGQTMKKDG  738

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL      VE    F  +TI  ++ ++F AG+DT+ ST EWAM ELL NP  L K
Sbjct  739   DFLDVLLDQCE--VENSG-FDRKTIKPLILDLFIAGSDTSASTTEWAMAELLRNPEELNK  795

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V+ E+   +G  E+ ++E  ++KLPYL+AV+KET+RLHP +P L+PH A     +LG+ +
Sbjct  796   VRQEIIQQIG-IERAVKESDMDKLPYLQAVVKETMRLHPAVPLLLPHKAQHDIQVLGFNV  854

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK+ Q+ VNVW++GRDPK W+ PL+F PERF+E ++ D+KG  FEFIPFG+GRR+CP +P
Sbjct  855   PKDGQVFVNVWSMGRDPKYWEKPLEFMPERFMESSV-DYKGRDFEFIPFGAGRRICPGMP  913

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLKAIP  1772
             LA RM+ L L S++  F+W L  GM    +DM+E+ G+TLRKA PL A+P
Sbjct  914   LAIRMVNLMLASIIQPFNWKLPKGMTTENLDMEEQFGVTLRKAIPLVAVP  963


 Score =   404 bits (1039),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/457 (43%), Positives = 293/457 (64%), Gaps = 13/457 (3%)
 Frame = +3

Query  363   LPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVVISSDEAAREMFKN  542
             LPPGP  +P++G++ QLG  P+ S +ELA  HGP+MTL LGS++TV+ SS E A+E+ + 
Sbjct  27    LPPGPTGFPIIGSLLQLGSKPNQSLAELAKIHGPLMTLKLGSITTVIASSPETAKEILQK  86

Query  543   HDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVTSRLDALRGVRTKC  722
             HD   +GR I +A+      E +L        WR  RR+C T+ F   +LD+L+ +R + 
Sbjct  87    HDKTFSGRTIPDAVSSQPNREATLAWVPPDNIWRNKRRICNTQMFTNQKLDSLQELRHQK  146

Query  723   IDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRSERGAKFFYHAGKV  902
             ++ +V ++R    SG+ A+D+GR  F  + NLI N +FS D +DP  +   +F    G +
Sbjct  147   VERLVNHIRSRCESGS-AVDIGRVVFATTLNLISNTIFSIDTVDPEFKTAHEFKELVGTI  205

Query  903   MEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERMESMNAGGNDEKKK  1082
             M+ AG PN++DFFP+L+W D QG+RR     +  A+    +  +E +E    G   ++  
Sbjct  206   MKDAGVPNLSDFFPVLKWFDLQGVRR----RIRPAYLRLHEIFEENIEKRVKGMTMKRDG  261

Query  1083  DYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWAMTELLHNPSSLQK  1262
             D++DVLL +  D          +TI  I+ ++F AG+DT+  T+EWAM ELL  P  L K
Sbjct  262   DFLDVLLDHCKD------ENDRKTIKPIILDLFIAGSDTSAITIEWAMAELLRKPEELNK  315

Query  1263  VQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPHMAMDSCNMLGYYI  1442
             V  E+   + G E+ ++E  ++KLPYL+AV+KET+RLHP  P L+PH A     +LG+ +
Sbjct  316   VGQEIMEQI-GLERAVKESDMDKLPYLQAVVKETMRLHPATPLLLPHKAQHDVQVLGFTV  374

Query  1443  PKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFIPFGSGRRMCPALP  1622
             PK++Q+LVN WAIGRDPK+W+ PL+F P RF+E ++ D+KG  FEFIPFG+GRR+CP +P
Sbjct  375   PKDSQVLVNAWAIGRDPKSWERPLEFLPGRFMESSV-DYKGRDFEFIPFGAGRRICPGMP  433

Query  1623  LASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMG  1733
             LA RM+ L L S++  F+W L  GM P ++DM+E+ G
Sbjct  434   LAIRMVNLILASIIQPFNWKLPDGMTPEKLDMEEQFG  470



>ref|XP_011033850.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Populus euphratica]
Length=519

 Score =   402 bits (1032),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 213/485 (44%), Positives = 293/485 (60%), Gaps = 10/485 (2%)
 Frame = +3

Query  321   INERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTV  500
             I  RS R+    G LPPGP R P+VGN++ LG  PH S ++LA  HG +M+L LG ++T+
Sbjct  43    ILRRSKRK---SGKLPPGPSRLPIVGNLWDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTI  99

Query  501   VISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFV  680
             V+SS   A+E+ + HD+    R I +A++    +E  +        WR LRR+C +  F 
Sbjct  100   VVSSAAMAKEVLQKHDLTFCNRTIVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFT  159

Query  681   TSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPR  860
               +LDA + +R K +  ++  ++E    G  A+D+    F  + N + N + S +L D  
Sbjct  160   AQKLDANQDLRRKKVQDILAEVQERCLVG-EAVDLRHAAFTATLNALSNTVLSLNLTDLS  218

Query  861   SERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKER  1040
             S+   +F      +M+ AGKP + D+FPLLR +DPQGIRR    H  K  D+    + ER
Sbjct  219   SDIAREFKERISCIMDEAGKPTLVDYFPLLRRIDPQGIRRRMAIHFGKVLDLFDRLIIER  278

Query  1041  MESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEW  1220
             ++     G      D +D LL       E      +  I     ++F AGTDTT+STLEW
Sbjct  279   LQLRKEKGY-IPLDDMLDTLLTISEVNNE---EIDATRIKHFFLDLFGAGTDTTSSTLEW  334

Query  1221  AMTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVP  1400
             AM ELLH+P +L K +AEL   +G     LEE  I +LPYL+AVIKETLRLHP +PFL+P
Sbjct  335   AMAELLHSPKTLLKARAELERTIG-EGNLLEESDITRLPYLQAVIKETLRLHPAVPFLLP  393

Query  1401  HMAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEF  1580
             H A     + G+ +PK  Q+LVNVWAIGRDP  W+DP  F PERFL+  + D +G +FEF
Sbjct  394   HRAGADAEIGGFTVPKNAQVLVNVWAIGRDPSMWEDPNSFVPERFLDSGI-DHRGQNFEF  452

Query  1581  IPFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPL  1760
             IPFGSGRRMCP LPLA RML L LGS++ SFDW L  G+ P  ++M ++ G+TL KA PL
Sbjct  453   IPFGSGRRMCPGLPLAMRMLHLMLGSLILSFDWKLADGVTPENLNMDDKFGLTLLKAQPL  512

Query  1761  KAIPV  1775
             +AIP+
Sbjct  513   RAIPI  517



>emb|CDP04799.1| unnamed protein product [Coffea canephora]
Length=814

 Score =   411 bits (1056),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/485 (42%), Positives = 304/485 (63%), Gaps = 11/485 (2%)
 Frame = +3

Query  324   NERSHRRLEEVGALPPGPRRWPVVGNIFQLGWTPHVSFSELASKHGPIMTLWLGSMSTVV  503
             N RS +       LPPGP  +P++GN+ QLG  PH SF++L+  +GP+M+L LGS +T++
Sbjct  24    NSRSRK---SAARLPPGPYSFPIIGNLHQLGKKPHQSFAKLSRTYGPLMSLKLGSKTTIL  80

Query  504   ISSDEAAREMFKNHDVVLAGRKIYEAMKGDFGNEGSLITAQYGQHWRMLRRLCTTEFFVT  683
             +SS   ARE+ + +D + + R I  A +    ++ SL+       WR +R++C    F T
Sbjct  81    VSSATVAREVLQEYDRMFSSRAIPTAAQALDHHKFSLVWLPPSSQWRNMRKMCKENIFAT  140

Query  684   SRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMSFNLIGNLMFSKDLLDPRS  863
              RLD  +G+R + +  +  Y+  +  S   A++VG   F  S NLI   +FSKD  D  S
Sbjct  141   QRLDTSQGLRQEKLQELRDYLHRSSVS-RKAVNVGDAAFTTSLNLISRTLFSKDFADYDS  199

Query  864   ERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQFHVNKAFDIAGDYLKERM  1043
             +   +       VM+  G  N++D+FP+L+ +DPQGI R ++F+  K FDI+ D + ER+
Sbjct  200   DSSQELKEIVWGVMKNVGAFNLSDYFPVLQMIDPQGIMRDSKFYFQKLFDISDDIINERL  259

Query  1044  ESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVILFEMFTAGTDTTTSTLEWA  1223
             +    G ++ KK D ++ LL +    ++    F    +  +L E+  AGT+T+++T+EWA
Sbjct  260   QVR--GTSEAKKNDLLEALLDHS---IKNEFEFGRNDLKHLLLELIVAGTETSSTTVEWA  314

Query  1224  MTELLHNPSSLQKVQAELRSVVGGTEKKLEEYHIEKLPYLKAVIKETLRLHPPLPFLVPH  1403
             M ELL +P  + K +AEL+ V+G  E+ ++E  I +LPYL+A IKET RLHP  P LVPH
Sbjct  315   MAELLRSPDKIAKAKAELKEVIG-QEEVVQESDISRLPYLQAAIKETFRLHPAGPLLVPH  373

Query  1404  MAMDSCNMLGYYIPKETQILVNVWAIGRDPKTWKDPLKFKPERFLEPNMADFKGHHFEFI  1583
              A D   + GY +PK TQ+LVNVWA+GRDP TW DP  F+P+RFL   + D +G HFE I
Sbjct  374   KANDDVEINGYIVPKNTQVLVNVWALGRDPTTWSDPKIFEPKRFLGSEI-DVRGQHFELI  432

Query  1584  PFGSGRRMCPALPLASRMLPLALGSVLHSFDWVLGHGMEPSQMDMKERMGITLRKATPLK  1763
             PFG+GRR+CP LPLA RM+ L L + +H+ DW L  GM+P  +DM E+ G+++ KA PL+
Sbjct  433   PFGAGRRICPGLPLAYRMVHLMLAAFIHNIDWKLEEGMKPEDLDMDEKYGLSVHKALPLE  492

Query  1764  AIPVP  1778
             AIP+P
Sbjct  493   AIPIP  497


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 94/217 (43%), Gaps = 44/217 (20%)
 Frame = +3

Query  630   GQHWRMLRRLCTTEFFVTSRLDALRGVRTKCIDHMVRYMREAGNSGTAAIDVGRFFFLMS  809
                WR +R++C    F T RLDA +G+R + +  +  Y+  +  S   A++VG   F  S
Sbjct  635   SSQWRNMRKMCKENIFATPRLDANQGLRQEKLQELRDYLHRSSLS-RKAVNVGDAVFTTS  693

Query  810   FNLIGNLMFSKDLLDPRSERGAKFFYHAGKVMEFAGKPNVADFFPLLRWLDPQGIRRMTQ  989
              NL+   +FSKD  +  S+   K      +++                            
Sbjct  694   LNLMSRTLFSKDFANYGSDSSQKL----KEIL----------------------------  721

Query  990   FHVNKAFDIAGDYLKERMESMNAGGNDEKKKDYMDVLLQYRGDLVEGPARFSSRTINVIL  1169
                   F+I  D + ER++    G +  KK D ++ LL +    +     F    +  +L
Sbjct  722   ------FEIFDDIIDERVQVR--GSSKTKKNDLLETLLDHS---IRNVFEFGRNDLKHLL  770

Query  1170  FEMFTAGTDTTTSTLEWAMTELLHNPSSLQKVQAELR  1280
              ++F AGTDTT + +E  M+ELL NP  L K++   R
Sbjct  771   LDLFVAGTDTTAAAVERTMSELLRNPDKLLKLEQSSR  807



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6102737431694