BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22908_g1_i5 len=2431 path=[1:0-655 @657@!:656-1431 1433:1432-1510
1512:1511-1699 1701:1700-1810 1812:1811-2138 2140:2139-2430]

Length=2431
                                                                      Score     E

ref|XP_006344615.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1123   0.0      
ref|XP_004230202.1|  PREDICTED: probable Xaa-Pro aminopeptidase P      1120   0.0      
ref|XP_002284554.2|  PREDICTED: probable Xaa-Pro aminopeptidase P      1078   0.0      Vitis vinifera
ref|XP_007204965.1|  hypothetical protein PRUPE_ppa002173mg            1070   0.0      
ref|XP_008246461.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1066   0.0      
ref|XP_011092035.1|  PREDICTED: probable Xaa-Pro aminopeptidase P      1061   0.0      
ref|XP_006472020.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1059   0.0      
ref|XP_009376668.1|  PREDICTED: probable Xaa-Pro aminopeptidase P      1047   0.0      
ref|XP_010255999.1|  PREDICTED: probable Xaa-Pro aminopeptidase P      1039   0.0      
emb|CDP15509.1|  unnamed protein product                               1037   0.0      
emb|CBI36798.3|  unnamed protein product                               1037   0.0      
gb|KDP23512.1|  hypothetical protein JCGZ_23345                        1030   0.0      
gb|KDO56310.1|  hypothetical protein CISIN_1g005183mg                  1030   0.0      
ref|XP_007030823.1|  Metallopeptidase M24 family protein isoform 1     1026   0.0      
ref|XP_004302424.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1025   0.0      
ref|XP_008454548.1|  PREDICTED: probable Xaa-Pro aminopeptidase P      1019   0.0      
ref|XP_004139175.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1018   0.0      
ref|XP_003554659.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1017   0.0      
ref|XP_010025187.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...   1016   0.0      
ref|XP_010092819.1|  putative Xaa-Pro aminopeptidase P                 1016   0.0      
ref|XP_011023624.1|  PREDICTED: probable Xaa-Pro aminopeptidase P      1013   0.0      
ref|XP_004156420.1|  PREDICTED: LOW QUALITY PROTEIN: probable Xaa...   1011   0.0      
ref|XP_002512383.1|  xaa-pro aminopeptidase, putative                  1008   0.0      Ricinus communis
ref|XP_007147048.1|  hypothetical protein PHAVU_006G091700g            1005   0.0      
ref|XP_003626286.1|  Xaa-Pro aminopeptidase                            1003   0.0      
ref|XP_010546700.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       995   0.0      
ref|XP_004494614.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    995   0.0      
ref|XP_010674747.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       994   0.0      
gb|KFK37952.1|  hypothetical protein AALP_AA3G051400                    988   0.0      
ref|XP_006408085.1|  hypothetical protein EUTSA_v10020169mg             983   0.0      
ref|NP_187186.5|  Metallopeptidase M24 family protein                   983   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147248.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       982   0.0      
gb|KDO56311.1|  hypothetical protein CISIN_1g005183mg                   981   0.0      
ref|XP_008802675.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    981   0.0      
emb|CDY27774.1|  BnaA05g31830D                                          979   0.0      
emb|CDY05161.1|  BnaC05g46420D                                          978   0.0      
ref|XP_010485976.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       977   0.0      
gb|KHG22219.1|  putative Xaa-Pro aminopeptidase P                       976   0.0      
ref|XP_009396833.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       976   0.0      
ref|XP_010935071.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       971   0.0      
ref|XP_006472019.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    969   0.0      
ref|XP_010464059.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    968   0.0      
ref|XP_006299176.1|  hypothetical protein CARUB_v10015320mg             967   0.0      
ref|XP_010426180.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    966   0.0      
ref|XP_002319540.2|  hypothetical protein POPTR_0013s02230g             961   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010025188.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    949   0.0      
ref|XP_006838262.1|  hypothetical protein AMTR_s00103p00064920          949   0.0      
gb|EPS67046.1|  hypothetical protein M569_07730                         941   0.0      
gb|KEH24524.1|  Xaa-pro aminopeptidase P                                933   0.0      
gb|ACN39937.1|  unknown                                                 921   0.0      Picea sitchensis
ref|XP_003557401.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    920   0.0      
ref|NP_001168142.1|  uncharacterized protein LOC100381889               918   0.0      Zea mays [maize]
tpg|DAA59962.1|  TPA: hypothetical protein ZEAMMB73_367051              918   0.0      
ref|XP_002461663.1|  hypothetical protein SORBIDRAFT_02g006140          909   0.0      Sorghum bicolor [broomcorn]
ref|XP_010464060.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    906   0.0      
ref|XP_010426246.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    904   0.0      
ref|XP_008651630.1|  PREDICTED: uncharacterized protein LOC100381...    904   0.0      
gb|EYU37529.1|  hypothetical protein MIMGU_mgv1a019508mg                893   0.0      
ref|NP_001059149.1|  Os07g0205700                                       892   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAN82623.1|  hypothetical protein VITISV_002314                     880   0.0      Vitis vinifera
gb|KEH24523.1|  Xaa-pro aminopeptidase P                                879   0.0      
gb|EYU34859.1|  hypothetical protein MIMGU_mgv1a004042mg                876   0.0      
gb|EEC81711.1|  hypothetical protein OsI_25321                          860   0.0      Oryza sativa Indica Group [Indian rice]
gb|KEH24522.1|  Xaa-pro aminopeptidase P                                845   0.0      
ref|XP_008246462.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    836   0.0      
gb|KDO56312.1|  hypothetical protein CISIN_1g005183mg                   832   0.0      
ref|XP_006657547.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    825   0.0      
ref|XP_001784361.1|  predicted protein                                  831   0.0      
ref|XP_002884508.1|  aminopeptidase                                     822   0.0      
ref|XP_008802678.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    819   0.0      
gb|AAF27041.1|AC009177_31  putative aminopeptidase                      815   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KCW61788.1|  hypothetical protein EUGRSUZ_H04494                     799   0.0      
ref|XP_002984553.1|  hypothetical protein SELMODRAFT_445942             803   0.0      
gb|KEH24525.1|  Xaa-pro aminopeptidase P                                797   0.0      
ref|XP_002965439.1|  hypothetical protein SELMODRAFT_266905             785   0.0      
ref|XP_008802677.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    772   0.0      
ref|XP_007030824.1|  Metallopeptidase M24 family protein isoform 2      764   0.0      
ref|XP_006375757.1|  hypothetical protein POPTR_0013s02230g             754   0.0      
ref|XP_007030825.1|  Metallopeptidase M24 family protein isoform 3      753   0.0      
ref|XP_008802676.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    710   0.0      
ref|XP_009626586.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       673   0.0      
ref|XP_009763066.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       671   0.0      
gb|KHG06386.1|  putative Xaa-Pro aminopeptidase P                       656   0.0      
ref|XP_006433333.1|  hypothetical protein CICLE_v100005701mg            634   0.0      
ref|XP_006433332.1|  hypothetical protein CICLE_v100005701mg            633   0.0      
ref|XP_002958447.1|  hypothetical protein VOLCADRAFT_77935              610   0.0      
ref|XP_005647728.1|  Creatinase/aminopeptidase                          605   0.0      
emb|CEG00173.1|  Creatinase                                             604   0.0      
ref|XP_003082710.1|  putative X-prolyl aminopeptidase (ISS)             606   0.0      
ref|XP_005847344.1|  hypothetical protein CHLNCDRAFT_23797              598   0.0      
emb|CDS07624.1|  hypothetical protein LRAMOSA01573                      591   0.0      
ref|XP_001421129.1|  predicted protein                                  589   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_002503206.1|  peptidase                                          587   0.0      Micromonas commoda
ref|XP_001422825.1|  predicted protein                                  585   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_003347197.1|  hypothetical protein SMAC_08089                    580   0.0      
ref|XP_009850898.1|  hypothetical protein NEUTE1DRAFT_122163            575   0.0      
ref|XP_957236.1|  hypothetical protein NCU00112                         575   0.0      Neurospora crassa OR74A
sp|Q5AVF0.2|AMPP1_EMENI  RecName: Full=Probable Xaa-Pro aminopept...    576   0.0      Aspergillus nidulans
sp|Q7RYL6.2|AMPP1_NEUCR  RecName: Full=Probable Xaa-Pro aminopept...    577   0.0      Neurospora crassa
ref|XP_007727599.1|  xaa-Pro aminopeptidase                             570   0.0      
ref|XP_001216942.1|  hypothetical protein ATEG_08321                    571   0.0      Aspergillus terreus NIH2624
ref|XP_001274245.1|  Exocyst complex component Sec8, putative           566   0.0      Aspergillus clavatus NRRL 1
ref|XP_753831.1|  aminopeptidase P                                      564   0.0      Aspergillus fumigatus Af293
ref|XP_007792825.1|  putative xaa-pro aminopeptidase protein            564   0.0      
ref|XP_001838946.1|  aminopeptidase P                                   562   0.0      Coprinopsis cinerea okayama7#130
gb|KIN06180.1|  hypothetical protein OIDMADRAFT_141796                  561   0.0      
ref|XP_001259881.1|  xaa-pro aminopeptidase                             563   0.0      Aspergillus fischeri NRRL 181
ref|XP_007513735.1|  unnamed protein product                            565   0.0      
gb|KFZ06986.1|  hypothetical protein V501_06890                         561   0.0      
ref|XP_005705542.1|  X-Pro dipeptidase isoform 2                        565   0.0      
gb|KFY72923.1|  hypothetical protein V499_06965                         561   0.0      
gb|EPS34624.1|  hypothetical protein PDE_09588                          558   0.0      
gb|KFZ15919.1|  hypothetical protein V502_05345                         560   0.0      
gb|KFY81379.1|  hypothetical protein V500_11470                         560   0.0      
ref|XP_006433331.1|  hypothetical protein CICLE_v100005701mg            550   0.0      
sp|A2QGR5.1|AMPP1_ASPNC  RecName: Full=Probable Xaa-Pro aminopept...    556   0.0      Aspergillus niger CBS 513.88
ref|XP_005705543.1|  X-Pro dipeptidase isoform 1                        566   0.0      
ref|XP_009157123.1|  X-Pro aminopeptidase                               557   0.0      
gb|KDQ10491.1|  hypothetical protein BOTBODRAFT_36195                   555   0.0      
ref|XP_001390304.2|  hypothetical protein ANI_1_500034                  556   0.0      Aspergillus niger CBS 513.88
ref|XP_008727308.1|  hypothetical protein G647_04748                    556   0.0      
ref|XP_002837289.1|  hypothetical protein                               555   0.0      Tuber melanosporum Mel28
ref|XP_003663373.1|  hypothetical protein MYCTH_2305258                 555   0.0      
ref|XP_007736361.1|  xaa-Pro aminopeptidase                             555   0.0      
ref|XP_002482106.1|  aminopeptidase P, putative                         556   0.0      Talaromyces stipitatus ATCC 10500
gb|KFY64490.1|  hypothetical protein V496_03218                         556   0.0      
gb|EWM30511.1|  putative xaa-pro aminopeptidase p                       560   0.0      
gb|KFY76172.1|  hypothetical protein V498_09726                         556   0.0      
gb|KIL60909.1|  hypothetical protein M378DRAFT_193546                   555   0.0      
ref|XP_003655342.1|  hypothetical protein THITE_2118945                 553   0.0      
ref|XP_007738872.1|  xaa-Pro aminopeptidase                             553   0.0      
ref|XP_006692714.1|  putative cytoplasm protein                         556   0.0      
gb|KFY15244.1|  hypothetical protein V492_02131                         553   0.0      
sp|C0NDZ7.1|AMPP1_AJECG  RecName: Full=Probable Xaa-Pro aminopept...    550   0.0      Histoplasma capsulatum G186AR
gb|EYU44663.1|  hypothetical protein MIMGU_mgv1a002786mg                551   0.0      
gb|EIE83834.1|  hypothetical protein RO3G_08539                         549   0.0      
ref|XP_001542821.1|  hypothetical protein HCAG_02992                    549   0.0      Histoplasma capsulatum NAm1
ref|XP_007755842.1|  xaa-Pro aminopeptidase                             548   0.0      
ref|XP_007804168.1|  Xaa-Pro aminopeptidase P                           548   0.0      
gb|KFY39396.1|  hypothetical protein V494_03998                         550   0.0      
gb|EGC44919.1|  aminopeptidase                                          547   0.0      
gb|KEQ71118.1|  putative Xaa-pro aminopeptidase P                       546   0.0      
ref|XP_007848100.1|  aminopeptidase p                                   548   0.0      
gb|EPB91827.1|  hypothetical protein HMPREF1544_01335                   545   0.0      
emb|CEL58929.1|  X-Pro aminopeptidase                                   546   0.0      
ref|XP_006969727.1|  X-Prolyl aminopeptidase                            545   0.0      
gb|EFX00736.1|  xaa-pro aminopeptidase                                  548   0.0      
gb|ELR10443.1|  hypothetical protein GMDG_00855                         546   2e-180   
ref|XP_006088172.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     545   2e-180   
ref|XP_006088171.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     545   3e-180   
gb|KEQ89621.1|  peptidase M24                                           543   3e-180   
ref|XP_005874614.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X3     545   4e-180   
ref|XP_005874612.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     545   4e-180   
ref|XP_003755440.1|  PREDICTED: xaa-Pro aminopeptidase 1                543   5e-180   
gb|EPQ12889.1|  Xaa-Pro aminopeptidase 1                                544   5e-180   
ref|XP_005874613.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     544   6e-180   
ref|XP_007592836.1|  metallopeptidase family M24                        543   6e-180   
gb|KIJ15105.1|  hypothetical protein PAXINDRAFT_169294                  542   7e-180   
ref|XP_003231471.1|  aminopeptidase                                     544   7e-180   
gb|KFY22564.1|  hypothetical protein V491_02759                         543   1e-179   
ref|XP_005785544.1|  hypothetical protein EMIHUDRAFT_63427              544   1e-179   
ref|XP_004579920.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     543   1e-179   
ref|XP_002621127.1|  xaa-pro aminopeptidase                             541   2e-179   Blastomyces gilchristii SLH14081
gb|KEF61408.1|  xaa-Pro aminopeptidase                                  541   2e-179   
ref|XP_008142509.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     542   2e-179   
ref|XP_006778761.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     543   2e-179   
ref|XP_008717481.1|  hypothetical protein HMPREF1541_04917              541   2e-179   
gb|KHJ36228.1|  putative metallopeptidase family m24                    543   2e-179   
ref|XP_006778760.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     543   2e-179   
sp|C5GXZ9.1|AMPP1_AJEDR  RecName: Full=Probable Xaa-Pro aminopept...    541   2e-179   Blastomyces dermatitidis ER-3
gb|EQL32794.1|  xaa-Pro aminopeptidase                                  542   5e-179   
gb|ABU48597.1|  aminopeptidase P                                        540   6e-179   Trichophyton tonsurans
gb|KFY25496.1|  hypothetical protein V493_04635                         540   9e-179   
ref|XP_004265912.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform 1      541   1e-178   
ref|XP_007781198.1|  X-Pro aminopeptidase                               540   1e-178   
gb|EGW06752.1|  Xaa-Pro aminopeptidase 1                                539   2e-178   
ref|XP_007446583.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     540   2e-178   
gb|EGD93125.1|  aminopeptidase                                          540   2e-178   
ref|XP_005063526.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     540   3e-178   
ref|XP_003045304.1|  predicted protein                                  538   3e-178   
ref|XP_007173125.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     538   4e-178   
ref|XP_007438892.1|  PREDICTED: xaa-Pro aminopeptidase 1-like iso...    538   5e-178   
ref|XP_003511990.2|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     539   1e-177   
ref|XP_009217422.1|  xaa-Pro aminopeptidase 1                           539   2e-177   
ref|XP_001229888.1|  hypothetical protein CHGG_03372                    536   3e-177   Chaetomium globosum CBS 148.51
gb|EUC55311.1|  Xaa-pro aminopeptidase P, putative                      535   8e-177   
ref|XP_010667693.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       535   1e-176   
ref|XP_003002386.1|  xaa-Pro aminopeptidase                             533   4e-176   
dbj|GAK66037.1|  creatinase/aminopeptidase                              536   5e-176   
sp|C6HSY3.1|AMPP1_AJECH  RecName: Full=Probable Xaa-Pro aminopept...    533   7e-176   Histoplasma capsulatum H143
emb|CDS08656.1|  hypothetical protein LRAMOSA10017                      532   8e-176   
ref|XP_009657602.1|  xaa-Pro aminopeptidase                             531   1e-175   
ref|XP_002433995.1|  aminopeptidase, putative                           531   4e-175   Ixodes scapularis [blacklegged tick]
ref|XP_007876858.1|  hypothetical protein PFL1_01164                    530   4e-175   
gb|ETS64187.1|  hypothetical protein PaG_01425                          535   5e-175   
gb|EGE04562.1|  aminopeptidase P                                        530   2e-174   
gb|EKG15991.1|  Creatinase                                              528   3e-174   
ref|XP_005706654.1|  X-Pro dipeptidase                                  528   4e-174   
ref|XP_011099591.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       528   5e-174   
ref|XP_680999.1|  hypothetical protein AN7730.2                         558   5e-174   Aspergillus nidulans FGSC A4
dbj|GAC74223.1|  xaa-pro aminopeptidase                                 531   5e-174   
gb|KGB77178.1|  cytoplasm protein                                       528   6e-174   
ref|XP_003196663.1|  cytoplasm protein                                  528   1e-173   
emb|CCX09767.1|  Similar to Probable Xaa-Pro aminopeptidase P; ac...    529   2e-173   
dbj|BAD45377.1|  putative Xaa-Pro aminopeptidase 2                      527   2e-173   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001512739.2|  PREDICTED: xaa-Pro aminopeptidase 1                525   4e-173   Ornithorhynchus anatinus [duck-billed platypus]
gb|EEC68306.1|  hypothetical protein OsI_36387                          526   5e-173   Oryza sativa Indica Group [Indian rice]
ref|XP_010029831.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    526   5e-173   
ref|XP_010029830.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    526   9e-173   
ref|XP_003577500.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       525   1e-172   
gb|ABA94110.1|  metallopeptidase family M24 containing protein, e...    525   1e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204612.1|  hypothetical protein PRUPE_ppa002705mg             524   3e-172   
gb|ERE78056.1|  xaa-Pro aminopeptidase 1                                523   1e-171   
gb|ERE78057.1|  xaa-Pro aminopeptidase 1                                523   2e-171   
gb|AFR98124.2|  xaa-Pro aminopeptidase                                  521   3e-171   
gb|EMF12275.1|  Creatinase/aminopeptidase                               520   4e-171   
gb|KIL95817.1|  xaa-pro aminopeptidase                                  521   4e-171   
dbj|GAA91305.1|  exocyst complex component Sec8                         518   1e-170   
ref|XP_010254935.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       520   2e-170   
gb|EUN24303.1|  hypothetical protein COCVIDRAFT_106402                  519   3e-170   
ref|XP_007697321.1|  hypothetical protein COCSADRAFT_83782              519   3e-170   
ref|XP_759880.1|  hypothetical protein UM03733.1                        521   4e-170   Ustilago maydis 521
emb|CEF74930.1|  unnamed protein product                                518   6e-170   
gb|EYB30877.1|  hypothetical protein FG05_02603                         517   8e-170   
gb|KHG00960.1|  putative xaa-pro aminopeptidase p                       518   8e-170   
gb|EMS67821.1|  Xaa-Pro aminopeptidase 1                                510   1e-169   
ref|XP_007707634.1|  hypothetical protein COCCADRAFT_84038              517   1e-169   
ref|XP_005088947.1|  PREDICTED: xaa-Pro aminopeptidase 1-like           516   1e-169   
ref|XP_009142233.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       516   3e-169   
ref|XP_007173124.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X1     514   4e-169   
ref|XP_004512011.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    516   4e-169   
gb|KGN48807.1|  hypothetical protein Csa_6G501960                       515   7e-169   
ref|XP_009263316.1|  hypothetical protein FPSE_11924                    514   1e-168   
gb|KDB11556.1|  Xaa-Pro aminopeptidase                                  513   1e-168   
ref|XP_008023181.1|  hypothetical protein SETTUDRAFT_128091             514   2e-168   
ref|XP_003537557.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    514   2e-168   
emb|CCT69308.1|  probable aminopeptidase P, cytoplasmic                 512   4e-168   
gb|EHA21208.1|  hypothetical protein ASPNIDRAFT_213466                  541   1e-167   
gb|ENH74646.1|  Putative Xaa-Pro aminopeptidase P                       511   1e-167   
gb|EXM23689.1|  xaa-Pro aminopeptidase                                  511   1e-167   
ref|XP_382779.1|  hypothetical protein FG02603.1                        511   2e-167   Fusarium graminearum PH-1
gb|EMT70711.1|  Putative Xaa-Pro aminopeptidase P                       511   2e-167   
gb|EXK92152.1|  xaa-Pro aminopeptidase                                  511   2e-167   
ref|XP_010029829.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       511   3e-167   
gb|EXK92149.1|  xaa-Pro aminopeptidase                                  511   3e-167   
dbj|GAC95812.1|  hypothetical protein PHSY_003389                       526   3e-167   
gb|EXM23686.1|  xaa-Pro aminopeptidase                                  511   3e-167   
ref|XP_011025722.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       511   4e-167   
gb|EXL98857.1|  xaa-Pro aminopeptidase                                  511   4e-167   
gb|KCW61794.1|  hypothetical protein EUGRSUZ_H04494                     501   4e-167   
gb|EWY91671.1|  xaa-Pro aminopeptidase                                  509   4e-167   
gb|KFK30295.1|  hypothetical protein AALP_AA7G243200                    510   5e-167   
gb|EWZ38338.1|  xaa-Pro aminopeptidase                                  509   5e-167   
gb|EGU78527.1|  hypothetical protein FOXB_10957                         509   6e-167   
ref|XP_003611940.1|  Xaa-Pro aminopeptidase                             510   8e-167   
gb|EXL57801.1|  xaa-Pro aminopeptidase                                  509   1e-166   
ref|XP_007005990.1|  hypothetical protein TREMEDRAFT_32810              509   1e-166   
gb|EXL57798.1|  xaa-Pro aminopeptidase                                  510   1e-166   
gb|EXA45929.1|  xaa-Pro aminopeptidase                                  510   1e-166   
gb|EXK40408.1|  xaa-Pro aminopeptidase                                  508   1e-166   
gb|EWY91668.1|  xaa-Pro aminopeptidase                                  509   1e-166   
gb|EWZ38335.1|  xaa-Pro aminopeptidase                                  509   1e-166   
gb|EXK40405.1|  xaa-Pro aminopeptidase                                  509   2e-166   
ref|XP_008142510.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     508   2e-166   
ref|XP_004579921.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     509   2e-166   
ref|XP_008104818.1|  PREDICTED: LOW QUALITY PROTEIN: xaa-Pro amin...    508   3e-166   
ref|XP_004143498.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    508   4e-166   
ref|XP_002310793.2|  aminopeptidase P family protein                    508   1e-165   Populus trichocarpa [western balsam poplar]
emb|CDP02808.1|  unnamed protein product                                507   1e-165   
ref|XP_008440683.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       507   1e-165   
ref|XP_004265914.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform 3      506   2e-165   
ref|XP_005063527.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     506   3e-165   
ref|XP_007446584.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     506   3e-165   
gb|ESU08063.1|  hypothetical protein FGSG_02603                         506   3e-165   
ref|NP_001276265.1|  probable Xaa-Pro aminopeptidase P-like             506   5e-165   
gb|EWG49720.1|  xaa-Pro aminopeptidase                                  504   5e-165   
gb|EWG49716.1|  xaa-Pro aminopeptidase                                  505   5e-165   
ref|XP_005536250.1|  X-prolyl aminopeptidase, cytosolic aminopept...    518   8e-165   
ref|XP_008619953.1|  hypothetical protein SDRG_15555                    503   2e-164   
ref|XP_003174169.1|  aminopeptidase P                                   502   5e-164   
ref|XP_504135.1|  YALI0E19184p                                          503   7e-164   
ref|XP_001767734.1|  predicted protein                                  502   1e-163   
gb|KDO26970.1|  hypothetical protein SPRG_07683                         501   2e-163   
ref|XP_006856107.1|  hypothetical protein AMTR_s00059p00137420          500   2e-163   
ref|XP_009590485.1|  PREDICTED: LOW QUALITY PROTEIN: probable Xaa...    501   2e-163   
gb|KDO79474.1|  hypothetical protein CISIN_1g006359mg                   499   5e-163   
ref|XP_006466732.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    499   7e-163   
ref|XP_009830919.1|  hypothetical protein H257_07179                    499   8e-163   
gb|KHN36146.1|  Putative Xaa-Pro aminopeptidase P                       508   2e-162   
ref|XP_006425730.1|  hypothetical protein CICLE_v10025046mg             499   4e-162   
ref|XP_005535315.1|  cytoplasmic aminopeptidase P                       496   2e-161   
ref|XP_002869024.1|  ATAPP1                                             494   4e-161   
gb|ABA94111.2|  metallopeptidase family M24 containing protein, e...    495   6e-161   
gb|EFA82726.1|  peptidase M24 family protein                            493   3e-160   
ref|XP_007613849.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X2     494   3e-160   
ref|XP_004317567.1|  PREDICTED: xaa-Pro aminopeptidase 1-like           496   3e-160   
gb|EWC45631.1|  putative Xaa-Pro aminopeptidase P                       491   4e-160   
emb|CDX75595.1|  BnaA01g01070D                                          492   5e-160   
ref|XP_001948381.2|  PREDICTED: xaa-Pro aminopeptidase 1                491   7e-160   
ref|XP_007586065.1|  putative xaa-pro aminopeptidase protein            489   1e-159   
ref|XP_002848784.1|  aminopeptidase P                                   490   3e-159   
gb|EEE52228.1|  hypothetical protein OsJ_34153                          494   4e-159   
gb|KHN42010.1|  Putative Xaa-Pro aminopeptidase P                       490   2e-158   
ref|XP_008876514.1|  hypothetical protein H310_11569                    487   2e-158   
gb|KDO79475.1|  hypothetical protein CISIN_1g006359mg                   488   4e-158   
gb|KHM48975.1|  peptidase M24                                           484   1e-157   
gb|KDE08101.1|  X-Pro aminopeptidase                                    486   1e-157   
ref|XP_004265913.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform 2      485   1e-157   
gb|EEE52227.1|  hypothetical protein OsJ_34152                          485   2e-157   
ref|XP_008895211.1|  hypothetical protein PPTG_04696                    484   3e-157   
gb|ETM38741.1|  hypothetical protein L914_15067                         484   4e-157   
gb|ETI38700.1|  hypothetical protein F443_15665                         484   5e-157   
gb|ETL32348.1|  hypothetical protein L916_15100                         484   7e-157   
ref|XP_001799625.1|  hypothetical protein SNOG_09330                    484   7e-157   
gb|ETO67463.1|  hypothetical protein F444_15647                         483   9e-157   
gb|ETP36649.1|  hypothetical protein F442_15506                         483   2e-156   
ref|XP_009862368.1|  PREDICTED: xaa-Pro aminopeptidase 1                481   3e-156   
gb|ETP08608.1|  hypothetical protein F441_15485                         482   4e-156   
gb|ETK78901.1|  hypothetical protein L915_15208                         481   6e-156   
gb|ETL85591.1|  hypothetical protein L917_14930                         481   1e-155   
ref|XP_002905578.1|  xaa-Pro aminopeptidase, putative                   479   3e-155   
emb|CDX69244.1|  BnaC01g02090D                                          479   9e-155   
ref|XP_004579922.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X3     475   1e-154   
gb|EZF29232.1|  hypothetical protein H101_07090                         475   1e-154   
gb|KDO79476.1|  hypothetical protein CISIN_1g006359mg                   475   8e-154   
ref|XP_005063528.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X3     473   1e-153   
ref|XP_008142511.1|  PREDICTED: xaa-Pro aminopeptidase 1 isoform X3     473   1e-153   
ref|XP_001652979.1|  xaa-pro aminopeptidase                             474   3e-153   
ref|WP_006929060.1|  peptidase M24                                      471   1e-152   
ref|XP_010228239.1|  PREDICTED: probable Xaa-Pro aminopeptidase P...    472   1e-152   
gb|KDO79478.1|  hypothetical protein CISIN_1g006359mg                   470   3e-152   
ref|XP_009539479.1|  hypothetical protein PHYSODRAFT_534742             471   5e-152   
ref|XP_001931417.1|  Xaa-Pro dipeptidase                                469   8e-152   
gb|ETN64356.1|  xaa-Pro aminopeptidase 1                                471   1e-151   
ref|XP_002137619.1|  GA27324                                            468   4e-151   
ref|WP_024469233.1|  peptidase M24                                      462   4e-149   
ref|WP_024753214.1|  peptidase M24                                      462   6e-149   
sp|D4D891.2|AMPP1_TRIVH  RecName: Full=Probable Xaa-Pro aminopept...    465   9e-149   
ref|XP_003014982.1|  hypothetical protein ARB_06742                     465   1e-148   
ref|WP_029409898.1|  peptidase M24                                      459   4e-148   
ref|XP_002296377.1|  predicted protein                                  462   4e-148   
ref|XP_003401142.1|  PREDICTED: xaa-Pro aminopeptidase 1-like           461   4e-148   
ref|WP_024465631.1|  peptidase M24                                      459   6e-148   
ref|WP_024467369.1|  peptidase M24                                      459   8e-148   
gb|EFW37431.1|  Creatinase                                              458   1e-147   
ref|XP_002016792.1|  GL21958                                            458   1e-147   
ref|WP_029029464.1|  X-Pro aminopeptidase                               458   2e-147   
tpg|DAA59963.1|  TPA: hypothetical protein ZEAMMB73_367051              452   5e-147   
ref|WP_029409093.1|  peptidase M24                                      457   5e-147   
ref|WP_020965432.1|  peptidase, M24                                     457   5e-147   
ref|WP_021588605.1|  metallopeptidase family M24                        457   6e-147   
ref|XP_003490556.1|  PREDICTED: xaa-Pro aminopeptidase 1-like           456   2e-146   
ref|XP_006617099.1|  PREDICTED: xaa-Pro aminopeptidase 1-like iso...    456   3e-146   
ref|XP_009589418.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       442   5e-146   
ref|XP_002619631.1|  hypothetical protein CLUG_00790                    458   8e-146   
ref|XP_002678353.1|  xaa-pro aminopeptidase                             456   1e-145   
ref|XP_394094.2|  PREDICTED: xaa-Pro aminopeptidase 1-like isofor...    454   2e-145   
ref|WP_025881348.1|  peptidase M24                                      452   3e-145   
ref|WP_004379826.1|  peptidase M24                                      452   5e-145   
gb|AAY19278.1|  aminopeptidase P                                        451   2e-144   
ref|WP_024508333.1|  X-Pro aminopeptidase                               451   2e-144   
gb|EZF27353.1|  hypothetical protein H100_00649                         449   4e-144   
ref|WP_028899648.1|  peptidase M24                                      449   4e-144   
ref|XP_009767904.1|  PREDICTED: probable Xaa-Pro aminopeptidase P       436   4e-144   
ref|WP_022391521.1|  peptidase M24 family                               449   6e-144   
ref|WP_008762023.1|  peptidase M24                                      447   2e-143   
ref|WP_014131141.1|  X-Pro aminopeptidase                               448   3e-143   
gb|KDO79477.1|  hypothetical protein CISIN_1g006359mg                   446   3e-143   
ref|WP_016268835.1|  xaa-Pro aminopeptidase                             446   1e-142   
ref|WP_022470328.1|  peptidase M24 family                               445   2e-142   
ref|WP_032536178.1|  MULTISPECIES: peptidase M24                        445   2e-142   
ref|WP_022012303.1|  hypothetical protein                               445   2e-142   
ref|XP_002590352.1|  hypothetical protein BRAFLDRAFT_279410             447   3e-142   
ref|WP_005782151.1|  peptidase M24                                      444   3e-142   
ref|WP_005811403.1|  peptidase M24                                      444   3e-142   
ref|WP_032531571.1|  peptidase M24                                      444   4e-142   
gb|KFX73981.1|  peptidase M24                                           444   4e-142   
ref|WP_032539199.1|  peptidase M24                                      444   4e-142   
gb|AHF13186.1|  peptidase M24                                           444   6e-142   
ref|WP_011159055.1|  X-Pro aminopeptidase                               444   6e-142   
ref|WP_025070898.1|  peptidase M24                                      443   1e-141   
ref|WP_005822143.1|  peptidase M24                                      443   1e-141   
ref|WP_021890944.1|  hypothetical protein                               442   2e-141   
ref|WP_008862379.1|  peptidase M24                                      442   2e-141   
ref|WP_040933033.1|  peptidase M24                                      442   2e-141   
ref|WP_027572564.1|  X-Pro aminopeptidase                               442   4e-141   
ref|WP_012496951.1|  X-Pro aminopeptidase                               442   5e-141   
emb|CDW53517.1|  xaa Pro aminopeptidase 1                               442   8e-141   
ref|WP_009132575.1|  hypothetical protein                               441   1e-140   
ref|WP_011663550.1|  X-Pro aminopeptidase                               441   1e-140   
ref|WP_036024907.1|  X-Pro aminopeptidase                               441   1e-140   
ref|WP_032581349.1|  peptidase M24                                      440   2e-140   
ref|WP_021283721.1|  hypothetical protein                               440   2e-140   
ref|WP_032138531.1|  peptidase M24                                      440   2e-140   
ref|WP_012220078.1|  peptidase M24                                      439   3e-140   
ref|WP_005814350.1|  peptidase M24                                      439   3e-140   
ref|WP_021656067.1|  Creatinase                                         439   3e-140   
ref|WP_007662113.1|  MULTISPECIES: peptidase M24                        439   5e-140   
ref|WP_034467471.1|  X-Pro aminopeptidase                               439   5e-140   
ref|WP_011440906.1|  X-Pro aminopeptidase                               439   5e-140   
ref|WP_027315104.1|  X-Pro aminopeptidase                               439   5e-140   
ref|WP_010957360.1|  peptidase M24                                      439   5e-140   
ref|WP_005769357.1|  peptidase M24                                      439   6e-140   
ref|WP_008770207.1|  peptidase M24                                      438   7e-140   
ref|WP_026051218.1|  peptidase M24                                      438   7e-140   
ref|WP_005950280.1|  MULTISPECIES: peptidase M24                        439   7e-140   
ref|WP_032574849.1|  peptidase M24                                      438   7e-140   
ref|WP_025814639.1|  peptidase M24                                      438   8e-140   
ref|WP_011203603.1|  peptidase M24                                      438   8e-140   
ref|WP_032581803.1|  peptidase M24                                      438   8e-140   
ref|WP_007088233.1|  peptidase M24                                      438   8e-140   
ref|WP_032568672.1|  peptidase M24                                      438   9e-140   
ref|WP_022300898.1|  MULTISPECIES: putative aminopeptidase              438   1e-139   
ref|WP_032589060.1|  peptidase M24                                      438   1e-139   
ref|WP_025075473.1|  peptidase M24                                      438   1e-139   
ref|WP_032574065.1|  peptidase M24                                      437   1e-139   
ref|WP_032529630.1|  peptidase M24                                      437   1e-139   
ref|WP_032577115.1|  peptidase M24                                      437   1e-139   
ref|WP_011473721.1|  X-Pro aminopeptidase                               438   1e-139   
ref|WP_003601828.1|  X-Pro aminopeptidase                               438   1e-139   
ref|WP_028465851.1|  X-Pro aminopeptidase                               438   2e-139   
ref|WP_032563596.1|  peptidase M24                                      437   2e-139   
ref|WP_005797623.1|  peptidase M24                                      437   2e-139   
ref|WP_012570921.1|  peptidase M24                                      438   2e-139   
ref|WP_032561892.1|  peptidase M24                                      437   2e-139   
ref|WP_032586495.1|  peptidase M24                                      437   2e-139   
ref|WP_028901632.1|  peptidase M24                                      437   2e-139   
emb|CDR36473.1|  CYFA0S01e01772g1_1                                     441   2e-139   
gb|EDO55526.1|  Creatinase                                              438   2e-139   
ref|WP_038598163.1|  peptidase M24                                      437   2e-139   
ref|WP_008661879.1|  MULTISPECIES: peptidase M24                        437   3e-139   
ref|WP_025784244.1|  peptidase M24                                      437   3e-139   
gb|AHN20361.1|  peptidase M24                                           437   3e-139   
ref|WP_005675406.1|  peptidase M24                                      437   3e-139   
ref|WP_005804121.1|  peptidase M24                                      436   3e-139   
ref|WP_009037305.1|  MULTISPECIES: peptidase M24                        436   4e-139   
gb|EOS11534.1|  xaa-Pro aminopeptidase                                  437   4e-139   
ref|WP_005681722.1|  peptidase M24                                      436   4e-139   
gb|EEC68307.1|  hypothetical protein OsI_36388                          441   4e-139   
ref|WP_028178288.1|  MULTISPECIES: X-Pro aminopeptidase                 437   5e-139   
ref|WP_008997823.1|  peptidase M24                                      436   5e-139   
ref|WP_007600874.1|  X-Pro aminopeptidase                               436   6e-139   
ref|WP_012456688.1|  X-Pro aminopeptidase                               436   6e-139   
ref|WP_032565490.1|  peptidase M24                                      436   6e-139   
ref|WP_032602525.1|  peptidase M24                                      436   8e-139   
ref|WP_022041634.1|  uncharacterized protein                            436   8e-139   
ref|WP_028138059.1|  X-Pro aminopeptidase                               436   9e-139   
ref|WP_025068785.1|  peptidase M24                                      436   9e-139   
ref|WP_032582634.1|  peptidase M24                                      435   9e-139   
ref|WP_021848669.1|  creatinase                                         435   1e-138   
ref|WP_018322542.1|  X-Pro aminopeptidase                               436   1e-138   
ref|WP_013501597.1|  X-Pro aminopeptidase                               436   1e-138   
ref|WP_015824557.1|  X-Pro aminopeptidase                               436   1e-138   
ref|WP_032602198.1|  peptidase M24                                      435   1e-138   
ref|WP_002712892.1|  hypothetical protein                               436   1e-138   
ref|WP_032538884.1|  peptidase M24                                      435   1e-138   
ref|WP_022383519.1|  xaa-Pro aminopeptidase                             435   1e-138   
ref|WP_027556905.1|  X-Pro aminopeptidase                               436   2e-138   
ref|WP_032558924.1|  peptidase M24                                      435   2e-138   
ref|WP_008779986.1|  peptidase M24                                      435   2e-138   
ref|WP_032594907.1|  peptidase M24                                      435   2e-138   
ref|WP_015952661.1|  X-Pro aminopeptidase                               435   2e-138   
ref|WP_028145519.1|  MULTISPECIES: X-Pro aminopeptidase                 435   2e-138   
ref|WP_009737195.1|  X-Pro aminopeptidase                               435   2e-138   
ref|WP_028905367.1|  peptidase M24                                      435   2e-138   
ref|WP_032588674.1|  peptidase M24                                      434   2e-138   
ref|WP_034522865.1|  peptidase M24                                      435   2e-138   
ref|WP_038971243.1|  X-Pro aminopeptidase                               435   2e-138   
ref|WP_032569243.1|  peptidase M24                                      434   3e-138   
ref|WP_005791508.1|  peptidase M24                                      434   3e-138   
ref|WP_010218818.1|  X-Pro aminopeptidase                               434   3e-138   
gb|EIY73924.1|  hypothetical protein HMPREF1073_03522                   435   3e-138   
ref|WP_008773679.1|  peptidase M24                                      434   3e-138   
ref|WP_022348266.1|  uncharacterized protein                            434   3e-138   
gb|EXY49490.1|  metallopeptidase M24 family protein                     434   3e-138   
ref|WP_011997381.1|  peptidase M24                                      435   3e-138   
ref|WP_036651229.1|  peptidase M24                                      434   3e-138   
ref|WP_004366673.1|  peptidase M24                                      434   3e-138   
ref|WP_032590799.1|  peptidase M24                                      434   3e-138   
ref|WP_018363341.1|  peptidase M24                                      434   3e-138   
ref|WP_036618593.1|  peptidase M24                                      434   4e-138   
ref|WP_007613515.1|  X-Pro aminopeptidase                               434   4e-138   
ref|WP_005867236.1|  MULTISPECIES: peptidase M24                        434   4e-138   
ref|WP_032580543.1|  peptidase M24                                      434   5e-138   
ref|WP_011966798.1|  peptidase M24                                      434   5e-138   
ref|WP_028096574.1|  X-Pro aminopeptidase                               436   5e-138   
gb|EYA31662.1|  metallopeptidase M24 family protein                     433   6e-138   
gb|EXZ76696.1|  metallopeptidase M24 family protein                     433   6e-138   
ref|WP_024362754.1|  peptidase M24                                      433   6e-138   
ref|WP_032584698.1|  peptidase M24                                      433   6e-138   
ref|WP_014709510.1|  peptidase M24                                      434   6e-138   
ref|WP_032571491.1|  peptidase M24                                      433   6e-138   
ref|WP_009275603.1|  MULTISPECIES: peptidase M24                        433   7e-138   
ref|WP_004354926.1|  peptidase M24                                      433   7e-138   
gb|EXY32754.1|  metallopeptidase M24 family protein                     433   7e-138   
gb|EXZ47221.1|  metallopeptidase M24 family protein                     432   8e-138   
ref|WP_032534106.1|  peptidase M24                                      433   8e-138   
ref|WP_008661418.1|  MULTISPECIES: peptidase M24                        433   8e-138   
ref|WP_021432680.1|  metallopeptidase M24 family protein [              433   8e-138   
ref|WP_010993671.1|  peptidase M24                                      433   8e-138   



>ref|XP_006344615.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Solanum tuberosum]
Length=707

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/688 (80%), Positives = 611/688 (89%), Gaps = 3/688 (0%)
 Frame = +3

Query  138   HYHTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLD  317
             HY  R  RF   SLPI RKL    KF S S N   L VR+SS+I AKPS EFQKK  G +
Sbjct  20    HYPPRSFRFLSFSLPIFRKLGICPKFLSKSPN---LTVRSSSSITAKPSWEFQKKGSGKE  76

Query  318   QEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKD  497
             Q+++LRALR++F+RP +N+DAYIIPSQDAHQSEFIA+CYMRR YISGFTGSAGTAVVTKD
Sbjct  77    QDNKLRALREIFTRPGVNVDAYIIPSQDAHQSEFIAECYMRRTYISGFTGSAGTAVVTKD  136

Query  498   KAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDA  677
             KAALWTDGRYFLQAEKQL+SSW LMR+GN GVPTPS+WLN+VL+PG RIGIDPFLFSSDA
Sbjct  137   KAALWTDGRYFLQAEKQLNSSWDLMRAGNMGVPTPSQWLNTVLAPGCRIGIDPFLFSSDA  196

Query  678   AEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLR  857
             A+E KEDISKGNHELVFL + NLVDEIWKESRP PPK+PIR+HDLKYAG +VSSKL  LR
Sbjct  197   AKEFKEDISKGNHELVFLYDFNLVDEIWKESRPNPPKEPIRLHDLKYAGVNVSSKLSCLR  256

Query  858   SDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEV  1037
             S+L NAG+SAIVISMLDEIAWLLNLRG+D+RHSPVMYAYL+VEIDG KLF+DD+K+TPEV
Sbjct  257   SELRNAGASAIVISMLDEIAWLLNLRGNDIRHSPVMYAYLVVEIDGVKLFVDDTKVTPEV  316

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
             M++L + G+ELRAYESILSEIESLA KGANLWLD S+VNAAI NAY++AC +Y      K
Sbjct  317   MEHLTNAGIELRAYESILSEIESLAAKGANLWLDTSSVNAAIVNAYESACYKYPWDSATK  376

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
              R K++ NLD+NG SG P A+YRSSPVS++KAVKN AELEGM+NCHLRDAAALA FWAWL
Sbjct  377   SRKKRTANLDSNGQSGGPCAVYRSSPVSLSKAVKNDAELEGMRNCHLRDAAALAQFWAWL  436

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+EI +DV LTEVEVA+KLLEFRS Q GFLDTSFDTISGSGANGAIIHYKPE DSCS V+
Sbjct  437   EDEIQRDVVLTEVEVADKLLEFRSHQDGFLDTSFDTISGSGANGAIIHYKPESDSCSTVD  496

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               +LFLLDSG QY+DGTTDITRTVHFGEPS+RE+ECFTRVLQGHIALDQAVFPENTPGFV
Sbjct  497   GKKLFLLDSGGQYIDGTTDITRTVHFGEPSARERECFTRVLQGHIALDQAVFPENTPGFV  556

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGP  ISFRFGN+TP++ GM+VSNEPGYY
Sbjct  557   LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPHSISFRFGNITPLLTGMIVSNEPGYY  616

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             EDH FGIRIENLLYVKE DTPNRFGGIGYLGFEKLTFVPIQ KLVD+S+LS AEV WLNS
Sbjct  617   EDHHFGIRIENLLYVKEEDTPNRFGGIGYLGFEKLTFVPIQTKLVDISLLSVAEVEWLNS  676

Query  2118  YHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             YHLQVWEKVS L+DG AR+WLWNNT+PI
Sbjct  677   YHLQVWEKVSPLLDGSARQWLWNNTQPI  704



>ref|XP_004230202.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Solanum lycopersicum]
Length=707

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/688 (80%), Positives = 611/688 (89%), Gaps = 3/688 (0%)
 Frame = +3

Query  138   HYHTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLD  317
             HY  R  RF   SLPI RKL    KF S S     L VR+SS+I AKPS EFQKK  G +
Sbjct  20    HYPPRSFRFLTFSLPIFRKLGICPKFLSKSPK---LTVRSSSSITAKPSWEFQKKDSGKE  76

Query  318   QEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKD  497
             Q+++LRALR++F+ P +N+DAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKD
Sbjct  77    QDNKLRALREIFTGPGVNVDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKD  136

Query  498   KAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDA  677
             KAALWTDGRYFLQAEKQL+SSW LMR+GN GVPTPS+WLN+VL+PG RIGIDPFLFSSDA
Sbjct  137   KAALWTDGRYFLQAEKQLNSSWDLMRAGNMGVPTPSQWLNTVLAPGCRIGIDPFLFSSDA  196

Query  678   AEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLR  857
             A+E KEDISKGNHELVFL + NLVDEIWKESRP PPK+PIR+HDLKYAG +VSSKL  LR
Sbjct  197   AKEFKEDISKGNHELVFLYDFNLVDEIWKESRPNPPKEPIRLHDLKYAGVNVSSKLSCLR  256

Query  858   SDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEV  1037
             S+L NAG+SAIVISMLDEIAWLLNLRG+D+RHSPVMYAYL+VEIDGAKLF+DD+K+TPEV
Sbjct  257   SELRNAGASAIVISMLDEIAWLLNLRGNDIRHSPVMYAYLVVEIDGAKLFVDDTKVTPEV  316

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
             M++L + G+ELRAYESILSEIESLA KGANLWLD S+VNAAI NAY++AC +Y      K
Sbjct  317   MEHLTNAGIELRAYESILSEIESLAAKGANLWLDTSSVNAAIVNAYESACYKYPWDSATK  376

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
              R K++ NL++NG SG P A+YRSSPVS++KAVKN AELEGM+NCHLRDAAALA FWAWL
Sbjct  377   SRKKRNANLNSNGQSGGPCAVYRSSPVSLSKAVKNDAELEGMRNCHLRDAAALAQFWAWL  436

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+EI +DV LTEVEVA+KLLEFRS Q GFLDTSFDTISGSGANGAIIHYKPE DSCS V+
Sbjct  437   EDEIQRDVVLTEVEVADKLLEFRSHQDGFLDTSFDTISGSGANGAIIHYKPESDSCSTVD  496

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               +LFLLDSG QY+DGTTDITRTVHFGEPS+REKECFTRVLQGHIALDQAVFPENTPGFV
Sbjct  497   GKKLFLLDSGGQYIDGTTDITRTVHFGEPSAREKECFTRVLQGHIALDQAVFPENTPGFV  556

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGP  ISFRFGN+TP++ GM+VSNEPGYY
Sbjct  557   LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPHSISFRFGNITPLLTGMIVSNEPGYY  616

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             EDH FGIRIENLLYVKE DTPNRFGGIGYLGFEKLTFVPIQ KLVD+S+LS AEV WLNS
Sbjct  617   EDHHFGIRIENLLYVKEEDTPNRFGGIGYLGFEKLTFVPIQTKLVDISLLSVAEVEWLNS  676

Query  2118  YHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             YHLQVWEKVS L+DG AR+WLWNNT+PI
Sbjct  677   YHLQVWEKVSPLLDGSARQWLWNNTQPI  704



>ref|XP_002284554.2| PREDICTED: probable Xaa-Pro aminopeptidase P [Vitis vinifera]
Length=714

 Score =  1078 bits (2787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/686 (76%), Positives = 597/686 (87%), Gaps = 0/686 (0%)
 Frame = +3

Query  144   HTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQE  323
             H R   F   SLPI  K   P  F   S N  + +VRN ++I AKPSS+F+KK    +Q+
Sbjct  26    HPRCLHFLSHSLPIFYKFKSPHSFCPKSQNRPIFLVRNCASITAKPSSQFRKKSADSEQD  85

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             ++LR+LR+LFS+P I IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDKA
Sbjct  86    EKLRSLRELFSKPGIGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKA  145

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             ALWTDGRYFLQAEKQLSS+WILMR+GN+GVPT SEWLN VL+PG RIGIDPFLFSSDAAE
Sbjct  146   ALWTDGRYFLQAEKQLSSNWILMRAGNYGVPTTSEWLNDVLAPGCRIGIDPFLFSSDAAE  205

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             ELKE I+K NHELV+L +LNLVDEIWKESRP+PP+KPIRVH+L YAG DVSSKL SLRS+
Sbjct  206   ELKEAIAKKNHELVYLYDLNLVDEIWKESRPEPPRKPIRVHELTYAGLDVSSKLSSLRSE  265

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             LI+AG SAIV+SMLDE++WLLNLRG+DV +SPVMYAYLIVEIDGAKLFIDDSK++PEVMD
Sbjct  266   LIDAGCSAIVVSMLDEVSWLLNLRGNDVPNSPVMYAYLIVEIDGAKLFIDDSKVSPEVMD  325

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +LK+ G+ELR YESIL+EI++LA KGA+LWLD S+VNAAI N Y+ ACD+YS S   K++
Sbjct  326   HLKNAGIELRPYESILAEIKNLAAKGAHLWLDTSSVNAAIVNTYEAACDQYSGSLDNKRK  385

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             NK       NG SG P  +Y+ SP+ +AKAVKN AELEGM+N HLRDAAALA FW+WLEE
Sbjct  386   NKSEAYGVANGQSGVPTGVYKISPILLAKAVKNQAELEGMRNSHLRDAAALAQFWSWLEE  445

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             EI K V LTEV+VA+KLL+FRS Q GFLDTSFDTIS SGANGAIIHYKP PDSCSIV+  
Sbjct  446   EILKGVLLTEVDVADKLLQFRSMQAGFLDTSFDTISASGANGAIIHYKPNPDSCSIVDVK  505

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             ++FLLDSGAQY+DGTTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVFPENTPGFVLD
Sbjct  506   KMFLLDSGAQYIDGTTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVFPENTPGFVLD  565

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYED  1943
             AFARS LWK+GLDYRHGTGHGVGAALNVHEGPQ ISFRFGNMTP+  GM+VSNEPGYYED
Sbjct  566   AFARSFLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRFGNMTPLQKGMIVSNEPGYYED  625

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
             H+FGIRIENLL VKEMDTPNRFGGIGYLGFEKLTFVPIQ +LV+LS+LS AE+ WLN YH
Sbjct  626   HAFGIRIENLLCVKEMDTPNRFGGIGYLGFEKLTFVPIQNELVELSLLSTAEIDWLNDYH  685

Query  2124  LQVWEKVSGLVDGRAREWLWNNTRPI  2201
              +VWEKVS L+DG AR+WLW+NTRP+
Sbjct  686   SEVWEKVSPLLDGSARQWLWDNTRPL  711



>ref|XP_007204965.1| hypothetical protein PRUPE_ppa002173mg [Prunus persica]
 gb|EMJ06164.1| hypothetical protein PRUPE_ppa002173mg [Prunus persica]
Length=706

 Score =  1070 bits (2766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/686 (76%), Positives = 591/686 (86%), Gaps = 0/686 (0%)
 Frame = +3

Query  144   HTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQE  323
             H+R+ RF  +SLPI        K  + S    +L VRN ++I+AKPSSE + K    D +
Sbjct  18    HSRYFRFLSLSLPIFHSSKSHPKIFTISPKAPLLTVRNCTSISAKPSSELRNKRSNSDSD  77

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             ++LRALR+LFS+P + IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDKA
Sbjct  78    EKLRALRELFSKPSVGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKA  137

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             ALWTDGRYFLQAEKQLSSSWILMR+G+ GVPT  EWLN VL+PG R+GIDPFLFSSDAAE
Sbjct  138   ALWTDGRYFLQAEKQLSSSWILMRAGSLGVPTTIEWLNDVLAPGGRVGIDPFLFSSDAAE  197

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             ELK+ I+K NHELVFL + NLVDE+W +SRP+PP KPIRVHDLKYAG DV+SKL SLRS+
Sbjct  198   ELKQGIAKKNHELVFLYDKNLVDEVWNKSRPKPPNKPIRVHDLKYAGVDVASKLLSLRSE  257

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L ++GSSAIVISMLDEIAWLLNLRGSDV HSPVMYAYLIVE D AKLFID SK++ EVMD
Sbjct  258   LADSGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVETDKAKLFIDTSKVSTEVMD  317

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +LK+ G+ELR Y+SILSE+E LA +GAN+WLD S+VNAAI   + +AC+RY +S   K +
Sbjct  318   HLKNAGIELRPYDSILSEVEGLAAQGANVWLDISSVNAAIVKTFNSACERYYQSLESKTK  377

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             +K     D+NG SG P  +YR SP+S+AKAVKN +ELEGM++CHLRDAAAL  FW W+EE
Sbjct  378   SKTKMYDDSNGWSGGPTGIYRVSPISLAKAVKNDSELEGMRSCHLRDAAALVQFWVWMEE  437

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             +I K+V LTEVEVA+KLLEFRS Q GFLDTSFDTISGSGANGAIIHY+ EPDSCS+V+  
Sbjct  438   QIKKNVKLTEVEVADKLLEFRSAQPGFLDTSFDTISGSGANGAIIHYRAEPDSCSVVDDK  497

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             +LFLLDSG QYVDGTTDITRTVHFGEP  R+KECFTRVLQGHIALDQAVFPENTPGFVLD
Sbjct  498   KLFLLDSGGQYVDGTTDITRTVHFGEPPLRQKECFTRVLQGHIALDQAVFPENTPGFVLD  557

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYED  1943
             AFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTP+  GM+VSNEPGYYED
Sbjct  558   AFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPLQKGMIVSNEPGYYED  617

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
             H+FGIRIENLL VKE+DTPNRFGGIGYLGFEKLTFVPIQAKL+DLS+LSAAE  WLN YH
Sbjct  618   HAFGIRIENLLVVKEVDTPNRFGGIGYLGFEKLTFVPIQAKLIDLSLLSAAEFDWLNDYH  677

Query  2124  LQVWEKVSGLVDGRAREWLWNNTRPI  2201
              QVWEKVS LVDG AREWLWNNTRP+
Sbjct  678   SQVWEKVSPLVDGCAREWLWNNTRPL  703



>ref|XP_008246461.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Prunus 
mume]
Length=706

 Score =  1066 bits (2758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/686 (76%), Positives = 590/686 (86%), Gaps = 0/686 (0%)
 Frame = +3

Query  144   HTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQE  323
             H+ + RF  +SLPI        K  + S    +L VRN ++ +AKPSSE + K    D +
Sbjct  18    HSHYFRFLSLSLPIFHSSKSHPKIFTISPKAPLLTVRNCTSFSAKPSSELRNKRSNSDSD  77

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             ++LRALR+LFS+P + IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDKA
Sbjct  78    EKLRALRELFSKPSVGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKA  137

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             ALWTDGRYFLQAEKQLSSSWILMR+G+ GVPT  EWLN VL+PG R+GIDPFLFSSDAAE
Sbjct  138   ALWTDGRYFLQAEKQLSSSWILMRAGSLGVPTTIEWLNDVLAPGGRVGIDPFLFSSDAAE  197

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             ELK+ I+K NHELVFL + NLVDE+W +SRP+PP KPIRVHDLKYAG DV+SKL SLRS+
Sbjct  198   ELKQGIAKKNHELVFLYDKNLVDEVWNKSRPKPPNKPIRVHDLKYAGVDVASKLLSLRSE  257

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L ++GSSAIVISMLDEIAWLLNLRGSDV HSPVMYAYLIVE D AKLFID SK++ EVMD
Sbjct  258   LADSGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVETDKAKLFIDTSKVSAEVMD  317

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +LK+ G+ELR Y+SILSE+E LA +GAN+WLD S+VNAAI   + +AC+RY +S   K +
Sbjct  318   HLKNAGIELRPYDSILSEVEGLAAQGANVWLDISSVNAAIVKTFNSACERYYQSLESKTK  377

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             +K     D+NG SG P  +YR SP+S+AKAVKN +ELEGM++CHLRDAAAL  FW W+EE
Sbjct  378   SKTKMYDDSNGWSGGPTGIYRVSPISLAKAVKNDSELEGMRSCHLRDAAALVQFWVWMEE  437

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             +I K++ LTEVEVA+KLLEFRS Q GFLDTSFDTISGSGANGAIIHY+ EPDSCS+V+  
Sbjct  438   QIKKNMKLTEVEVADKLLEFRSAQPGFLDTSFDTISGSGANGAIIHYRAEPDSCSVVDDK  497

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             +LFLLDSG QYVDGTTDITRTVHFGEP SR+KECFTRVLQGHIALDQAVFPENTPGFVLD
Sbjct  498   KLFLLDSGGQYVDGTTDITRTVHFGEPPSRQKECFTRVLQGHIALDQAVFPENTPGFVLD  557

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYED  1943
             AFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTP+  GM+VSNEPGYYED
Sbjct  558   AFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPLQKGMIVSNEPGYYED  617

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
             H+FGIRIENLL VKE+DTPNRFGGIGYLGFEKLTFVPIQAKL+DLS+LSAAE  WLN YH
Sbjct  618   HAFGIRIENLLVVKEVDTPNRFGGIGYLGFEKLTFVPIQAKLIDLSLLSAAEFDWLNDYH  677

Query  2124  LQVWEKVSGLVDGRAREWLWNNTRPI  2201
              QVWEKVS LVDG AREWLWNNTRP+
Sbjct  678   SQVWEKVSPLVDGYAREWLWNNTRPL  703



>ref|XP_011092035.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Sesamum indicum]
Length=697

 Score =  1061 bits (2744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/655 (79%), Positives = 585/655 (89%), Gaps = 0/655 (0%)
 Frame = +3

Query  237   RVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSE  416
             R  ++R S++I AKPSSE +KK +  + +++L ALR+LFSRP+INIDAYIIPSQDAHQSE
Sbjct  40    RRSVIRISASITAKPSSELRKKHKSSEPDEKLVALRELFSRPNINIDAYIIPSQDAHQSE  99

Query  417   FIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVP  596
             F ++CY RRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAE+QLSSSWILMR+GN+GVP
Sbjct  100   FTSECYARRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEQQLSSSWILMRAGNFGVP  159

Query  597   TPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRP  776
             T SEWLN +LSPG RIGIDPFLFSSDAAEELKE IS+ NHELV+L ++NLVDE+WK+SRP
Sbjct  160   TTSEWLNGILSPGCRIGIDPFLFSSDAAEELKEAISQKNHELVYLYDVNLVDEMWKDSRP  219

Query  777   QPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHS  956
             +PP + IR+HD+KYAG DVSSKL SLRS+LI+AGSSAIVISMLDEIAWLLNLRGSDV HS
Sbjct  220   KPPNRHIRLHDVKYAGVDVSSKLSSLRSELISAGSSAIVISMLDEIAWLLNLRGSDVPHS  279

Query  957   PVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWL  1136
             PVMYAYL+VEIDGAKLFIDD+K+ PEV  YLK+ G+ELR YESILSEIESLA KGA LWL
Sbjct  280   PVMYAYLVVEIDGAKLFIDDAKLNPEVNHYLKNAGIELRPYESILSEIESLALKGACLWL  339

Query  1137  DKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAV  1316
             D S+V+AAI N +K+ACD+Y  + G+   NKK+     +G S  P A+YRSSPVS+AKAV
Sbjct  340   DTSSVSAAIVNTFKSACDKYISTAGVVNSNKKTVPNSPDGQSCGPTAVYRSSPVSLAKAV  399

Query  1317  KNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTS  1496
             KN AELEGM+NCHLRDAAALA FWAWLEEEI   V LTEV+V++KLLEFRS+Q GF+ TS
Sbjct  400   KNEAELEGMRNCHLRDAAALAQFWAWLEEEISNGVILTEVDVSDKLLEFRSRQDGFIGTS  459

Query  1497  FDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSRE  1676
             FDTISGSGANGAIIHYKPEP+SCSI++  +LFLLDSGAQY+DGTTDITRTVHFG+PSSRE
Sbjct  460   FDTISGSGANGAIIHYKPEPNSCSIIDAEKLFLLDSGAQYIDGTTDITRTVHFGQPSSRE  519

Query  1677  KECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEG  1856
             KECFTRVLQGHIALDQA+FPEN PGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEG
Sbjct  520   KECFTRVLQGHIALDQAIFPENYPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEG  579

Query  1857  PQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFE  2036
             PQ ISFRFGNMTP++ GMVVSNEPGYYEDH+FGIRIENLLYVKE +TPNRFGG+ YLGFE
Sbjct  580   PQSISFRFGNMTPLLKGMVVSNEPGYYEDHAFGIRIENLLYVKEANTPNRFGGVEYLGFE  639

Query  2037  KLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             KLTFVPIQAKLVDLS+LS AE+ WLN YH QVWEKVS L+DG A EWLWNNTRP+
Sbjct  640   KLTFVPIQAKLVDLSLLSTAEIDWLNDYHGQVWEKVSPLLDGPAYEWLWNNTRPL  694



>ref|XP_006472020.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like isoform X2 
[Citrus sinensis]
 gb|KDO56309.1| hypothetical protein CISIN_1g005183mg [Citrus sinensis]
Length=710

 Score =  1059 bits (2739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/690 (76%), Positives = 592/690 (86%), Gaps = 6/690 (1%)
 Frame = +3

Query  147   TRHS--RFPLIS-LPIPRKLHYPLKFPSSSANCRV--LIVRNSSNIAAKPSSEFQKKPRG  311
             TR S  RF ++S L +P   H      S S N     L +RN ++I AKPSSEF +    
Sbjct  19    TRSSYLRFRILSSLSLPPIFHNSQTRLSFSKNYTRPHLFIRNCTSITAKPSSEFNRNRTQ  78

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
                +++LRALR+LFSRP +NIDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVT
Sbjct  79    DAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVT  138

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             KDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT  EWLN VL+PG R+GIDPFLFSS
Sbjct  139   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTTFEWLNDVLAPGGRVGIDPFLFSS  198

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             DAAEELKE I+K NHELV+L +LNLVD IWKESRP+PP KPIRVH LKYAG DV+SKL S
Sbjct  199   DAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSS  258

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPVMYAYLIVE+D AKLF+DDSK+TP
Sbjct  259   LRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTP  318

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD S+VNAAI N Y+ A ++Y  S  
Sbjct  319   DVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNN  378

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
               K++K   + DT G SG P  ++R+SP++ +KAVKNSAELEGM N HLRDAAALA FW 
Sbjct  379   -NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWV  437

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFDTISGSGANGAIIHYKPEP  CS+
Sbjct  438   WLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSV  497

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             V+  +LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTRVLQGHIALDQA+FP++TPG
Sbjct  498   VDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPG  557

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+V GM+VSNEPG
Sbjct  558   FVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPG  617

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYEDH+FGIRIENLLYVKE+ TPNRFGG+ YLGFEKLTFVPIQ KLVDLS+LSAAE+ WL
Sbjct  618   YYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWL  677

Query  2112  NSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             N+YH QVWEKVS L+DG AR+WLWNNTRP+
Sbjct  678   NNYHSQVWEKVSPLLDGFARQWLWNNTRPV  707



>ref|XP_009376668.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Pyrus x bretschneideri]
 ref|XP_009376674.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Pyrus x bretschneideri]
Length=705

 Score =  1047 bits (2707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/682 (75%), Positives = 586/682 (86%), Gaps = 4/682 (1%)
 Frame = +3

Query  159   RFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQED-RLR  335
             RF  +SLPI        K  + +    V+ +RN S+I+AKPSSE + K    D  D +LR
Sbjct  24    RFLPLSLPIFHNSKSHPKIFTITPKAPVMTIRNCSSISAKPSSELRNKRSSSDSSDEKLR  83

Query  336   ALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWT  515
             ALRQLFS+P + IDAYIIPSQDAHQSEFIA+CYMRR +ISGFTGSAGTAVVTKDKAALWT
Sbjct  84    ALRQLFSKPGVGIDAYIIPSQDAHQSEFIAECYMRRTFISGFTGSAGTAVVTKDKAALWT  143

Query  516   DGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKE  695
             DGRYFLQAEKQLSSSWILMR+G+ GVPT  EWLN+VL+PG R+GIDPFLFSS+AAEELK+
Sbjct  144   DGRYFLQAEKQLSSSWILMRAGSLGVPTTIEWLNNVLAPGGRVGIDPFLFSSEAAEELKQ  203

Query  696   DISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINA  875
              I+K NHELVFL + NLVDE+W ESRP+PP KP+RVHDLKYAG DV+SKL SLRS+L +A
Sbjct  204   GIAKKNHELVFLYDKNLVDEVWNESRPKPPNKPVRVHDLKYAGVDVASKLLSLRSELADA  263

Query  876   GSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKS  1055
             GSSAI+ISMLDE+AWLLNLRGSDV HSPVMYAYLIVEID AKLFID SK++ EVMD+LK 
Sbjct  264   GSSAIIISMLDEVAWLLNLRGSDVPHSPVMYAYLIVEIDKAKLFIDTSKVSTEVMDHLKQ  323

Query  1056  VGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKS  1235
              G+EL  Y+SILSE+ESLA +GA +W+D S++NAAI N + +AC+RY  S   K+++K  
Sbjct  324   AGIELLPYDSILSEVESLAAQGAKVWMDISSLNAAIVNTFNSACERYYESLESKRKSKSD  383

Query  1236  TNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICK  1415
                D+NG SG P  +YR SPVS+AKAVKN +ELEGMQ+CHLRDAAAL  FW W+EE+I +
Sbjct  384   ---DSNGWSGGPTGIYRVSPVSLAKAVKNDSELEGMQSCHLRDAAALVQFWVWMEEKINE  440

Query  1416  DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFL  1595
             +V LTEVEVAEKLLEFRS Q GFLDTSFDTISGSGANGAIIHY+ EPDSCS+V+  +LFL
Sbjct  441   NVKLTEVEVAEKLLEFRSAQSGFLDTSFDTISGSGANGAIIHYRAEPDSCSVVDDKKLFL  500

Query  1596  LDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFAR  1775
             LDSG QYVDGTTDITRTVHFGEP+SR+KECFTRVLQGHIALD+AVFPEN PGFVLDAFAR
Sbjct  501   LDSGGQYVDGTTDITRTVHFGEPTSRQKECFTRVLQGHIALDEAVFPENMPGFVLDAFAR  560

Query  1776  SSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFG  1955
             SSLWK+GLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTP+  GM+VSNEPGYYEDH+FG
Sbjct  561   SSLWKIGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPLQKGMIVSNEPGYYEDHAFG  620

Query  1956  IRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVW  2135
             IRIENLL VKE++TPNRFGGI YLGFEKLTFVPIQAK++DLS+LSAAE  WLN YH QVW
Sbjct  621   IRIENLLVVKEVNTPNRFGGIIYLGFEKLTFVPIQAKMIDLSLLSAAEFDWLNDYHSQVW  680

Query  2136  EKVSGLVDGRAREWLWNNTRPI  2201
             EKVS LV+G AR+WLW+NTRP+
Sbjct  681   EKVSPLVEGSARQWLWDNTRPL  702



>ref|XP_010255999.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nelumbo nucifera]
Length=718

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/686 (75%), Positives = 585/686 (85%), Gaps = 0/686 (0%)
 Frame = +3

Query  144   HTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQE  323
               R   F  +S+P   ++    +    S N ++L+VRN  +I AKPSSE QKK      +
Sbjct  30    QARCLHFLSLSVPFFGRIKTQQRIHRRSPNLQLLVVRNCGSITAKPSSEIQKKRDDSKPD  89

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             ++LRALR+LFSRP + IDAYIIPSQDAHQSEFIA+C+MRR YISGFTGSAGTAVVTKDKA
Sbjct  90    EKLRALRELFSRPGVGIDAYIIPSQDAHQSEFIAECFMRRTYISGFTGSAGTAVVTKDKA  149

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             ALWTDGRYFLQAEKQLS SWILMR+GN+GVPT  EWLN VL PG R+GIDPFLFSSDAAE
Sbjct  150   ALWTDGRYFLQAEKQLSPSWILMRAGNFGVPTTGEWLNEVLVPGCRVGIDPFLFSSDAAE  209

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             ELK+ ISK NH+LV+L +LNLVDEIWKESRP+ P+KPIRVH++KYAG DVSSKL SLRSD
Sbjct  210   ELKDTISKRNHQLVYLYDLNLVDEIWKESRPKLPQKPIRVHNIKYAGVDVSSKLSSLRSD  269

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L+  G SAIVISMLDE+AWLLNLRG+DV HSPVMYAYL +EIDGAKLFID+SK++ EVMD
Sbjct  270   LVEVGCSAIVISMLDEVAWLLNLRGNDVPHSPVMYAYLSIEIDGAKLFIDNSKVSKEVMD  329

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +LK+ GVELR YESILSEIESLA KGA LWLD S+VNAAI   Y++ACD++  +   K +
Sbjct  330   HLKNSGVELRPYESILSEIESLATKGAQLWLDTSSVNAAIVATYRSACDKFLGNLQKKGK  389

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             N K  + +  G S  P  +Y+ SPV+ AKAVKN AELEGMQN HLRDAAAL+ FWAWLEE
Sbjct  390   NNKGKHEELIGESEGPVGIYKVSPVTFAKAVKNPAELEGMQNSHLRDAAALSQFWAWLEE  449

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             EI  +V LTEV+VA+KLLEFR+KQ GF+DTSFDTIS SG NGAIIHYKPEP SCS+V+ +
Sbjct  450   EIHNNVVLTEVQVADKLLEFRAKQAGFMDTSFDTISASGGNGAIIHYKPEPKSCSVVDAN  509

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             +LFLLDSGAQY+DGTTDITRTVHFGEP+SR+KECFTRVLQGHIALDQAVFPENTPGFVLD
Sbjct  510   KLFLLDSGAQYIDGTTDITRTVHFGEPTSRQKECFTRVLQGHIALDQAVFPENTPGFVLD  569

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYED  1943
             AFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFRFGNMTP+  GM+VSNEPGYYED
Sbjct  570   AFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRFGNMTPLQKGMIVSNEPGYYED  629

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
             HSFGIRIENLL+VKE++TPN FGG  YLGFEK+TFVPIQ+KLVDLS+LS AEV WLN YH
Sbjct  630   HSFGIRIENLLFVKEVETPNNFGGNAYLGFEKMTFVPIQSKLVDLSLLSIAEVNWLNDYH  689

Query  2124  LQVWEKVSGLVDGRAREWLWNNTRPI  2201
              QVWEKVS L+DG AR+WLWNNTRP+
Sbjct  690   SQVWEKVSPLLDGSARQWLWNNTRPL  715



>emb|CDP15509.1| unnamed protein product [Coffea canephora]
Length=705

 Score =  1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/702 (74%), Positives = 592/702 (84%), Gaps = 22/702 (3%)
 Frame = +3

Query  144   HTRHSRFPLI--------SLPIPRKLHY-PLKFPSSSANCRVLIVRNSS-NIAAKPSSEF  293
             H R+S +  +        S PI  K ++    FP +S      IVRNSS +I AKPSSE 
Sbjct  7     HLRNSHYCFLPKIRNFSFSFPISHKFNFINPNFPQNSKTYPTFIVRNSSGSITAKPSSEL  66

Query  294   QKKPRG------LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYIS  455
             +KK RG       D + +L  LR+LFS+P+INIDAYIIPSQDAHQSEFIA+CYMRRAYIS
Sbjct  67    RKK-RGNDSDSCSDSDQKLGDLRELFSKPNINIDAYIIPSQDAHQSEFIAECYMRRAYIS  125

Query  456   GFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPG  635
             GFTGSAGTAVVTKDKAALWTDGRYFLQAE+QLSSSWILMR+GN GVPT +EWLNSVL+PG
Sbjct  126   GFTGSAGTAVVTKDKAALWTDGRYFLQAEQQLSSSWILMRAGNMGVPTTNEWLNSVLAPG  185

Query  636   SRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLK  815
              RIGIDPFLFSSDAAEELKE ISK  HELV+L + NLVDE+W  SRP+ P KPIR+HDLK
Sbjct  186   CRIGIDPFLFSSDAAEELKEAISKRKHELVYLYDCNLVDEVWNASRPKAPNKPIRLHDLK  245

Query  816   YAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDG  995
             YAG DVSSKL SLRS+L  AG+SAIVISMLDE+AWLLNLRG D+ HSPVMYAYLIVEIDG
Sbjct  246   YAGLDVSSKLSSLRSELAGAGASAIVISMLDEVAWLLNLRGKDIPHSPVMYAYLIVEIDG  305

Query  996   AKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAY  1175
             AKLF D+SK+T EVM+YLK+ G++L  YESILSEIESLAE+GA LWLD S++NAAI N Y
Sbjct  306   AKLFTDNSKVTSEVMEYLKNAGIDLCPYESILSEIESLAERGAGLWLDTSSINAAIVNTY  365

Query  1176  KTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCH  1355
             ++ACD+Y    G +   ++S     NG S   +A+YRSSP+S+AKAVKN AELEGM+NCH
Sbjct  366   RSACDKYFSGRGYQNEIERS-----NGESSGRYAVYRSSPISLAKAVKNDAELEGMRNCH  420

Query  1356  LRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             LRD AALA FW+WLEEEI KDV LTEV+VA+KLLEFRS Q GFLDTSFDTISGSGANGAI
Sbjct  421   LRDGAALAQFWSWLEEEILKDVVLTEVQVADKLLEFRSMQDGFLDTSFDTISGSGANGAI  480

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIA  1715
             IHYKPE  +CSIV+  +LFLLDSGAQY DGTTD+TRTVHFGEPSSR++ECFTRVLQGHIA
Sbjct  481   IHYKPEQGTCSIVHADKLFLLDSGAQYHDGTTDVTRTVHFGEPSSRQRECFTRVLQGHIA  540

Query  1716  LDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTP  1895
             LDQAVFPENTPGFVLDAFARS+LWK+GLDYRHGTGHGVGAALNVHEGPQ ISFRFGNMTP
Sbjct  541   LDQAVFPENTPGFVLDAFARSALWKIGLDYRHGTGHGVGAALNVHEGPQSISFRFGNMTP  600

Query  1896  MVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVD  2075
             ++ GMVVSNEPGYYEDHSFGIRIENLL+VKE+DTPN +GG  YLGFEKLTFVPIQ KL++
Sbjct  601   LLKGMVVSNEPGYYEDHSFGIRIENLLFVKELDTPNNYGGHAYLGFEKLTFVPIQTKLIE  660

Query  2076  LSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +S+LS AE+ W+N YH QVWEKVS L+DG AR+WLWNNTRP+
Sbjct  661   VSLLSDAEINWVNDYHKQVWEKVSTLLDGSARQWLWNNTRPL  702



>emb|CBI36798.3| unnamed protein product [Vitis vinifera]
Length=691

 Score =  1037 bits (2681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/686 (74%), Positives = 581/686 (85%), Gaps = 23/686 (3%)
 Frame = +3

Query  144   HTRHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQE  323
             H R   F   SLPI  K   P  F   S N  + +VRN ++I AKPSS+F+KK    +Q+
Sbjct  26    HPRCLHFLSHSLPIFYKFKSPHSFCPKSQNRPIFLVRNCASITAKPSSQFRKKSADSEQD  85

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             ++LR+LR+LFS+P I IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDKA
Sbjct  86    EKLRSLRELFSKPGIGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKA  145

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             ALWTDGRYFLQAEKQLSS+WILMR+GN+GVPT SEWLN VL+PG RIGIDPFLFSSDAAE
Sbjct  146   ALWTDGRYFLQAEKQLSSNWILMRAGNYGVPTTSEWLNDVLAPGCRIGIDPFLFSSDAAE  205

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             ELKE I+K NHELV+L +LNLVDEIWKESRP+PP+KPIRVH+L YAG DVSSKL SLRS+
Sbjct  206   ELKEAIAKKNHELVYLYDLNLVDEIWKESRPEPPRKPIRVHELTYAGLDVSSKLSSLRSE  265

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             LI+AG SAIV+SMLDE++WLLNLRG+DV +SPVMYAYLIVEIDGAKLFIDDSK++PEVMD
Sbjct  266   LIDAGCSAIVVSMLDEVSWLLNLRGNDVPNSPVMYAYLIVEIDGAKLFIDDSKVSPEVMD  325

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +LK+ G+ELR YESIL+EI++LA KGA+LWLD S+                       ++
Sbjct  326   HLKNAGIELRPYESILAEIKNLAAKGAHLWLDTSS-----------------------RK  362

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             NK       NG SG P  +Y+ SP+ +AKAVKN AELEGM+N HLRDAAALA FW+WLEE
Sbjct  363   NKSEAYGVANGQSGVPTGVYKISPILLAKAVKNQAELEGMRNSHLRDAAALAQFWSWLEE  422

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             EI K V LTEV+VA+KLL+FRS Q GFLDTSFDTIS SGANGAIIHYKP PDSCSIV+  
Sbjct  423   EILKGVLLTEVDVADKLLQFRSMQAGFLDTSFDTISASGANGAIIHYKPNPDSCSIVDVK  482

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             ++FLLDSGAQY+DGTTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVFPENTPGFVLD
Sbjct  483   KMFLLDSGAQYIDGTTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVFPENTPGFVLD  542

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYED  1943
             AFARS LWK+GLDYRHGTGHGVGAALNVHEGPQ ISFRFGNMTP+  GM+VSNEPGYYED
Sbjct  543   AFARSFLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRFGNMTPLQKGMIVSNEPGYYED  602

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
             H+FGIRIENLL VKEMDTPNRFGGIGYLGFEKLTFVPIQ +LV+LS+LS AE+ WLN YH
Sbjct  603   HAFGIRIENLLCVKEMDTPNRFGGIGYLGFEKLTFVPIQNELVELSLLSTAEIDWLNDYH  662

Query  2124  LQVWEKVSGLVDGRAREWLWNNTRPI  2201
              +VWEKVS L+DG AR+WLW+NTRP+
Sbjct  663   SEVWEKVSPLLDGSARQWLWDNTRPL  688



>gb|KDP23512.1| hypothetical protein JCGZ_23345 [Jatropha curcas]
Length=713

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/654 (76%), Positives = 572/654 (87%), Gaps = 1/654 (0%)
 Frame = +3

Query  243   LIVRNSSNIAAKPSSEFQK-KPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEF  419
             L+++N S I AKPSS+ ++ +    + +++L ALR+LFS+P I IDAYIIPSQDAHQSEF
Sbjct  57    LLIKNCSPITAKPSSQIRRSRTNKSEPDEKLLALRELFSKPGIGIDAYIIPSQDAHQSEF  116

Query  420   IADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPT  599
             IA+CYMRRAYISGFTGSAGTAVVTK+ A LWTDGRYFLQAEKQL+S+W LMR+GN GVPT
Sbjct  117   IAECYMRRAYISGFTGSAGTAVVTKENAVLWTDGRYFLQAEKQLNSNWTLMRAGNLGVPT  176

Query  600   PSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQ  779
               EWLN VLSPG+++GIDPFLFS DAAEELKE I++ NH+LV+L +LNLVDEIWKESRP 
Sbjct  177   TIEWLNDVLSPGAKVGIDPFLFSFDAAEELKEAIARKNHKLVYLYDLNLVDEIWKESRPN  236

Query  780   PPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSP  959
             PP KPIRVH LKYAG DV SKL  LRS+L++AGSSAIVISMLDEIAWLLNLRG DV HSP
Sbjct  237   PPNKPIRVHHLKYAGVDVVSKLSFLRSELLDAGSSAIVISMLDEIAWLLNLRGGDVPHSP  296

Query  960   VMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLD  1139
             VMYAYLIVEIDGAKLF+D+SK+TPEV+D+LKS GVELR Y++ILSEIESLA +GA LWLD
Sbjct  297   VMYAYLIVEIDGAKLFVDNSKVTPEVLDHLKSAGVELRPYDAILSEIESLAARGAELWLD  356

Query  1140  KSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVK  1319
              S+VNAAI N YK+A DR+  + G K   K      +NG S  P  +Y++SP+S+AKA+K
Sbjct  357   TSSVNAAIVNIYKSASDRHLENLGSKNNGKTKIYNSSNGQSLGPSGVYKASPISLAKALK  416

Query  1320  NSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSF  1499
             N AELEGM+N HLRDAAALA FW WLEEEI KDV LTEV+VA+KLLEFRS Q GF+DTSF
Sbjct  417   NPAELEGMRNSHLRDAAALAQFWTWLEEEIHKDVKLTEVDVADKLLEFRSNQAGFIDTSF  476

Query  1500  DTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREK  1679
             DTISGSGANGAIIHYKPEP++CSIV+  +LFLLDSGAQY+DGTTDITRTVHFGEPS+ EK
Sbjct  477   DTISGSGANGAIIHYKPEPETCSIVDSKKLFLLDSGAQYIDGTTDITRTVHFGEPSAYEK  536

Query  1680  ECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGP  1859
             ECFTRVLQGHIALDQAVFPENTPGFVLD+FARSSLWK+GLDYRHGTGHGVGAALNVHEGP
Sbjct  537   ECFTRVLQGHIALDQAVFPENTPGFVLDSFARSSLWKIGLDYRHGTGHGVGAALNVHEGP  596

Query  1860  QGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEK  2039
             Q ISFR+GNMTP+  GM+VSNEPGYYEDH+FGIRIENLL+VK +DTPNRFGG  YLGFEK
Sbjct  597   QSISFRYGNMTPLQKGMIVSNEPGYYEDHAFGIRIENLLHVKSIDTPNRFGGTEYLGFEK  656

Query  2040  LTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             LTF PIQAKLVDLS+LSA+E+ WLN YH QVWEKVS L+DG AR+WLWNNTRP+
Sbjct  657   LTFFPIQAKLVDLSLLSASEIDWLNDYHSQVWEKVSPLLDGPARQWLWNNTRPL  710



>gb|KDO56310.1| hypothetical protein CISIN_1g005183mg [Citrus sinensis]
Length=692

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/672 (76%), Positives = 576/672 (86%), Gaps = 6/672 (1%)
 Frame = +3

Query  147   TRHS--RFPLIS-LPIPRKLHYPLKFPSSSANCRV--LIVRNSSNIAAKPSSEFQKKPRG  311
             TR S  RF ++S L +P   H      S S N     L +RN ++I AKPSSEF +    
Sbjct  19    TRSSYLRFRILSSLSLPPIFHNSQTRLSFSKNYTRPHLFIRNCTSITAKPSSEFNRNRTQ  78

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
                +++LRALR+LFSRP +NIDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVT
Sbjct  79    DAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVT  138

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             KDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT  EWLN VL+PG R+GIDPFLFSS
Sbjct  139   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTTFEWLNDVLAPGGRVGIDPFLFSS  198

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             DAAEELKE I+K NHELV+L +LNLVD IWKESRP+PP KPIRVH LKYAG DV+SKL S
Sbjct  199   DAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSS  258

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPVMYAYLIVE+D AKLF+DDSK+TP
Sbjct  259   LRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTP  318

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD S+VNAAI N Y+ A ++Y  S  
Sbjct  319   DVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNN  378

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
               K++K   + DT G SG P  ++R+SP++ +KAVKNSAELEGM N HLRDAAALA FW 
Sbjct  379   -NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWV  437

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFDTISGSGANGAIIHYKPEP  CS+
Sbjct  438   WLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSV  497

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             V+  +LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTRVLQGHIALDQA+FP++TPG
Sbjct  498   VDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPG  557

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+V GM+VSNEPG
Sbjct  558   FVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPG  617

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYEDH+FGIRIENLLYVKE+ TPNRFGG+ YLGFEKLTFVPIQ KLVDLS+LSAAE+ WL
Sbjct  618   YYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWL  677

Query  2112  NSYHLQVWEKVS  2147
             N+YH QVWEKVS
Sbjct  678   NNYHSQVWEKVS  689



>ref|XP_007030823.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY11325.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=710

 Score =  1026 bits (2653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/686 (73%), Positives = 581/686 (85%), Gaps = 5/686 (1%)
 Frame = +3

Query  159   RFPLIS--LPIPRKLHY-PLKFPSSSANCRVLIV--RNSSNIAAKPSSEFQKKPRGLDQE  323
             RFP  S  LPI  K    P  +  S      L +   +S ++ AKPSSE  +     + +
Sbjct  22    RFPFFSFSLPIFHKFKINPTIYKKSQKGPPFLTLWCCSSGSVTAKPSSELSRNRAVQEPD  81

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             +++ ALRQLFS+P I IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDKA
Sbjct  82    EKVLALRQLFSKPGIGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKA  141

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             ALWTDGRYFLQAEKQLSSSW LMR+GN GVPT S+WLN +L+PG  +GIDPFLFS DAAE
Sbjct  142   ALWTDGRYFLQAEKQLSSSWTLMRAGNLGVPTTSQWLNDILAPGGTVGIDPFLFSYDAAE  201

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             ELKE ISK N ELV+L +LNLVDEIWKESRP+PP KPIRVHDLKYAG DV SKL SL+++
Sbjct  202   ELKEAISKKNLELVYLYDLNLVDEIWKESRPKPPNKPIRVHDLKYAGLDVVSKLSSLKAE  261

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L+  GSSAIVISMLDE AWLLNLRGSDV HS VMYAYLIVE+D AKLF+D+SK+TPEVMD
Sbjct  262   LVGTGSSAIVISMLDEAAWLLNLRGSDVPHSSVMYAYLIVEVDAAKLFVDNSKVTPEVMD  321

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +LK+ GVELR Y+SILSEI  LA +GANLWLD S+VNAAI   YK+ACD+Y  + G + +
Sbjct  322   HLKNAGVELRPYDSILSEIRRLAAQGANLWLDTSSVNAAIVETYKSACDKYLMNHGSRGK  381

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
              K     ++NGLS  P  +Y  SP+S+AKA+KN  ELEGMQN HLRDAAALA FW+WLEE
Sbjct  382   IKNKRYGESNGLSIGPSGVYMPSPISLAKALKNPTELEGMQNSHLRDAAALAQFWSWLEE  441

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             EI K+V LTEV+VA+KLLEFRSKQ GFLDTSFDTISGSGANGAIIHYKPEP+SCS+V+ +
Sbjct  442   EIHKNVKLTEVDVADKLLEFRSKQDGFLDTSFDTISGSGANGAIIHYKPEPESCSVVDPN  501

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             +LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTRVL+GHIALDQAVFPENTPGFVLD
Sbjct  502   KLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLKGHIALDQAVFPENTPGFVLD  561

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYED  1943
             AFARS+LWK+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GNMTP+  GM+VSNEPGYYED
Sbjct  562   AFARSALWKIGLDYRHGTGHGVGAALNVHEGPQSISYRYGNMTPLQKGMIVSNEPGYYED  621

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
             H+FGIRIENLL V+E++TPNR+GG+ YLGFEKLTF PIQ KLVDLS+LS  E+ WLN+YH
Sbjct  622   HAFGIRIENLLCVQEINTPNRYGGVEYLGFEKLTFCPIQTKLVDLSLLSVEEIGWLNNYH  681

Query  2124  LQVWEKVSGLVDGRAREWLWNNTRPI  2201
              QVWEKVS L++G AR+WLW+NTRP+
Sbjct  682   SQVWEKVSPLLEGSARQWLWDNTRPV  707



>ref|XP_004302424.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Fragaria vesca 
subsp. vesca]
Length=697

 Score =  1025 bits (2651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/651 (76%), Positives = 571/651 (88%), Gaps = 2/651 (0%)
 Frame = +3

Query  249   VRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIAD  428
             +R+ ++I+AKPSS+ + K R    + +LRALR LF  P + IDAY+IPSQDAHQSEFIA+
Sbjct  46    IRSCTSISAKPSSDLRPKRRAAASDAKLRALRNLF--PGVGIDAYVIPSQDAHQSEFIAE  103

Query  429   CYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSE  608
             CYMRR +ISGFTGSAGTAVVTKDKAALWTDGRYFLQAE QLSSSWILMR+GN+GVPT  E
Sbjct  104   CYMRRTFISGFTGSAGTAVVTKDKAALWTDGRYFLQAENQLSSSWILMRAGNFGVPTTIE  163

Query  609   WLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPK  788
             WLN VL+PG R+GIDPFLFSSDAAEELK+ I+K NHELVFL + NLVDEIW++SRP+PP 
Sbjct  164   WLNDVLAPGGRVGIDPFLFSSDAAEELKQGIAKNNHELVFLYDKNLVDEIWEDSRPEPPN  223

Query  789   KPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMY  968
             KPIRVH+L+YAG DV+SKL SLR++L  AGSSAIVISMLDEIAWLLNLRGSDV HSPVMY
Sbjct  224   KPIRVHELRYAGVDVASKLSSLRNELAAAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMY  283

Query  969   AYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKST  1148
             AYLIVE+D AKLF+D SK+  EV+ +L++ G+ELR Y+SILSE+ESLA KGA +WLD S+
Sbjct  284   AYLIVELDKAKLFVDTSKVGAEVLGHLENAGIELRPYDSILSEVESLAAKGAKIWLDASS  343

Query  1149  VNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSA  1328
             VNAAI + Y TAC++Y  S  IK+++K     D+NG S  P  +YR SP+S+AKA+KN A
Sbjct  344   VNAAIVHTYNTACEKYYESLEIKRKSKTKAYEDSNGWSEGPTGMYRVSPISLAKALKNDA  403

Query  1329  ELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTI  1508
             ELEGM+NCHLRDAAAL  FW W+EE+I K+V LTEVEVAEKLLEFRS Q GFLDTSFDTI
Sbjct  404   ELEGMRNCHLRDAAALTQFWVWIEEQINKNVKLTEVEVAEKLLEFRSTQPGFLDTSFDTI  463

Query  1509  SGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECF  1688
             SGSGANGAIIHYKPEPDSCS++++ +LFLLDSGAQYVDGTTDITRTVHFGEP++R+K+CF
Sbjct  464   SGSGANGAIIHYKPEPDSCSVLDKKKLFLLDSGAQYVDGTTDITRTVHFGEPTARQKDCF  523

Query  1689  TRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGI  1868
             TRVLQGHIALDQAVFPENTPGFVLDAFARS LWK+GLDYRHGTGHGVGAALNVHEGPQ I
Sbjct  524   TRVLQGHIALDQAVFPENTPGFVLDAFARSFLWKIGLDYRHGTGHGVGAALNVHEGPQSI  583

Query  1869  SFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTF  2048
             SFR+GN TP+  GM+VSNEPGYYEDH+FGIRIENLL VKE+DTPNRFGGI YLGFEKLTF
Sbjct  584   SFRYGNTTPLQSGMIVSNEPGYYEDHAFGIRIENLLVVKEVDTPNRFGGIEYLGFEKLTF  643

Query  2049  VPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             VPIQAKL++LS+LSAAE  WLN YH QVW+KVS L+DG AR+WLW+NTRP+
Sbjct  644   VPIQAKLIELSLLSAAEFDWLNDYHSQVWDKVSPLLDGPARQWLWDNTRPL  694



>ref|XP_008454548.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Cucumis melo]
Length=711

 Score =  1019 bits (2634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/666 (74%), Positives = 575/666 (86%), Gaps = 4/666 (1%)
 Frame = +3

Query  213   FPSSSANCRVLIVRNSSNIAAKPSSEFQK-KPRGLDQEDRLRALRQLFSRPDINIDAYII  389
             F + S+  R   VR+ S+I AKPSSE ++ +P   + + +LRALR LFS+PDI IDAYII
Sbjct  44    FAAISSRLRRSTVRSCSSITAKPSSEIRRTRPNNDEPDSKLRALRDLFSKPDIGIDAYII  103

Query  390   PSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWIL  569
             PSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVT DKAALWTDGRYFLQAEKQL+SSW L
Sbjct  104   PSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTSDKAALWTDGRYFLQAEKQLNSSWTL  163

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDP--FLFSSDAAEELKEDISKGNHELVFLSNLN  743
             MR+GN GVPTPSEWL  +L+PG  +GIDP    FS+DAAE+LKE +S+ NH+LV+L + N
Sbjct  164   MRAGNHGVPTPSEWLADILAPGGVVGIDPGAVSFSADAAEDLKETVSRKNHKLVYLYDYN  223

Query  744   LVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWL  923
             LVDEIWK+SRP+PP+ PIRVHDL+YAG DV+SKL SLRS+L  AGSSAI+IS+LDEIAWL
Sbjct  224   LVDEIWKDSRPKPPRGPIRVHDLRYAGLDVASKLASLRSELKEAGSSAIIISVLDEIAWL  283

Query  924   LNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseie  1103
             LNLRGSDV +SPVMYAYL+VE+DGAKLF+D+ K+T EVMD+LK+ GVELR Y+SI+S IE
Sbjct  284   LNLRGSDVPNSPVMYAYLLVELDGAKLFVDNCKVTSEVMDHLKTAGVELRPYDSIISAIE  343

Query  1104  slAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALY  1283
             +LAEKGANLWLD S++NAAI NAY++ACD+Y    G K++ K  T+  +N   G P  +Y
Sbjct  344   NLAEKGANLWLDTSSINAAIANAYRSACDKYFIRLGNKRKGKGKTSETSNSQVG-PTGVY  402

Query  1284  RSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEF  1463
             +SSP+SMAKA+KN AELEGM+N HLRDAAALA FW WLE+EI   V LTEVEVA+KLLEF
Sbjct  403   KSSPISMAKAIKNYAELEGMRNSHLRDAAALAQFWFWLEQEILNGVKLTEVEVADKLLEF  462

Query  1464  RSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITR  1643
             R KQ GF+DTSFDTIS SGANGAIIHYKPEP  CS+V+ ++LFLLDSGAQYVDGTTDITR
Sbjct  463   RKKQDGFVDTSFDTISASGANGAIIHYKPEPSDCSVVDANKLFLLDSGAQYVDGTTDITR  522

Query  1644  TVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGH  1823
             TVHFGEP++R+KECFTRVLQGHIALDQAVFP++TPGFVLDAFARSSLWK+GLDYRHGTGH
Sbjct  523   TVHFGEPTTRQKECFTRVLQGHIALDQAVFPQDTPGFVLDAFARSSLWKIGLDYRHGTGH  582

Query  1824  GVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPN  2003
             GVGAALNVHEGPQ ISFRFGNMT +  GM+VSNEPGYYEDHSFGIRIENLL VK+ DTPN
Sbjct  583   GVGAALNVHEGPQSISFRFGNMTGLHSGMIVSNEPGYYEDHSFGIRIENLLIVKDADTPN  642

Query  2004  RFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLW  2183
              FGGIGYLGFEKLTFVPIQ KLVD+++LS  EV WLN YH QVWEKVS L++G AR+WLW
Sbjct  643   HFGGIGYLGFEKLTFVPIQTKLVDITLLSVEEVNWLNDYHSQVWEKVSPLLEGSARQWLW  702

Query  2184  NNTRPI  2201
             NNTRP+
Sbjct  703   NNTRPL  708



>ref|XP_004139175.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Cucumis sativus]
 gb|KGN60914.1| hypothetical protein Csa_2G022830 [Cucumis sativus]
Length=709

 Score =  1018 bits (2631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/648 (76%), Positives = 567/648 (88%), Gaps = 2/648 (0%)
 Frame = +3

Query  261   SNIAAKPSSEFQKKPRGLDQED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYM  437
             S+I AKPSSE ++     D+ D +LRALR LFS+P+I IDAYIIPSQDAHQSEFIA+CYM
Sbjct  60    SSITAKPSSEIRRNRTNNDEPDSKLRALRDLFSKPNIGIDAYIIPSQDAHQSEFIAECYM  119

Query  438   RRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLN  617
             RRAYISGFTGSAGTAVVT DKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPTPSEWL 
Sbjct  120   RRAYISGFTGSAGTAVVTNDKAALWTDGRYFLQAEKQLNSSWTLMRAGNHGVPTPSEWLA  179

Query  618   SVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPI  797
              +L+PG  +GIDPFLFS+DAAE+LKE IS+ NH+LV+L + NLVD IWK+SR +PP+ PI
Sbjct  180   DILAPGGVVGIDPFLFSADAAEDLKETISRKNHKLVYLYDYNLVDAIWKDSRSKPPRGPI  239

Query  798   RVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYL  977
             RVHDL+YAG DV+SKL SLRS+L  AGSSAI+ISMLDEIAWLLNLRGSDV +SPVMYAYL
Sbjct  240   RVHDLRYAGLDVASKLASLRSELKEAGSSAIIISMLDEIAWLLNLRGSDVPNSPVMYAYL  299

Query  978   IVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNA  1157
             +VE+DGAKLF+DD K+T EVMD+LK+ GVELR Y+SI+S IE+LAEKGANLWLD S++NA
Sbjct  300   LVELDGAKLFVDDCKVTSEVMDHLKTAGVELRPYDSIISAIENLAEKGANLWLDTSSINA  359

Query  1158  AITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELE  1337
             AI NAY++ACD+Y    G K++ K  T+  +N   G P  +Y+SSP+SMAKA+KN AELE
Sbjct  360   AIANAYRSACDKYFIRLGNKRKGKSKTSETSNSQVG-PTGVYKSSPISMAKAIKNYAELE  418

Query  1338  GMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGS  1517
             GM+N HLRDAAALA FW WLE+EI   V LTEVEVA+KLLEFR KQ GF+DTSFDTIS S
Sbjct  419   GMRNSHLRDAAALAQFWFWLEQEILNGVKLTEVEVADKLLEFRKKQDGFVDTSFDTISAS  478

Query  1518  GANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRV  1697
             GANGAIIHYKPEP  CS+V+ ++LFLLDSGAQYVDGTTDITRTVHFGEP++R+KECFTRV
Sbjct  479   GANGAIIHYKPEPSDCSVVDANKLFLLDSGAQYVDGTTDITRTVHFGEPTARQKECFTRV  538

Query  1698  LQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR  1877
             LQGHIALDQAVFP++TPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR
Sbjct  539   LQGHIALDQAVFPQDTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFR  598

Query  1878  FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPI  2057
             FGNMT +  GM+VSNEPGYYEDHSFGIRIENLL VK+ +TPN FGGIGYLGFEKLTFVPI
Sbjct  599   FGNMTGLHNGMIVSNEPGYYEDHSFGIRIENLLIVKDANTPNHFGGIGYLGFEKLTFVPI  658

Query  2058  QAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             Q KLVD+++LSA+EV WLN YH QVWEKVS L++G A EWLWNNT+P+
Sbjct  659   QTKLVDITLLSASEVNWLNDYHSQVWEKVSPLLEGSASEWLWNNTQPL  706



>ref|XP_003554659.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Glycine 
max]
 gb|KHN43286.1| Putative Xaa-Pro aminopeptidase P [Glycine soja]
Length=698

 Score =  1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/678 (74%), Positives = 578/678 (85%), Gaps = 6/678 (1%)
 Frame = +3

Query  177   LPIPRKLHYPLKF--PSSSANCRVLIVRN-SSNIAAKPSSEFQKKPRGLDQEDRLRALRQ  347
             LP+P  L  P  F    +S +     +RN SS+   KPSS+ +K     + + +L ALR 
Sbjct  19    LPLPLCLSSPNPFFYKLNSHSKPFFTIRNCSSSFKVKPSSQIKKIRAEAELDPKLTALRN  78

Query  348   LFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRY  527
             LFS+P +NIDAY+IPSQDAHQSEFIA+CY RRAYISGFTGSAGTAVVTKDKAALWTDGRY
Sbjct  79    LFSKPGVNIDAYVIPSQDAHQSEFIAECYSRRAYISGFTGSAGTAVVTKDKAALWTDGRY  138

Query  528   FLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISK  707
             FLQAEKQLSS+WILMR+GN GVPT SEWLN VL+PG R+GIDPFLF+SDAAEELK  ISK
Sbjct  139   FLQAEKQLSSNWILMRAGNPGVPTASEWLNDVLAPGGRVGIDPFLFTSDAAEELKGVISK  198

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
              NHELV+L N NLVDEIWKESRP+PP  P+RVH+LKYAG DV+SKL SLRS+L+NAGSSA
Sbjct  199   NNHELVYLYNSNLVDEIWKESRPKPPNNPVRVHNLKYAGLDVASKLSSLRSELVNAGSSA  258

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
             IVISMLDEIAWLLNLRGSD+ HSPV+YAYLIVE+ GAKLFIDDSK+T EV D+LK    E
Sbjct  259   IVISMLDEIAWLLNLRGSDIPHSPVVYAYLIVEVSGAKLFIDDSKVTEEVSDHLKKADTE  318

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLD  1247
             +R Y S++SEIE LA +GA+LWLD S+VNAAI NAY+ ACDRY ++   + ++K  TN  
Sbjct  319   IRPYNSVISEIERLAARGASLWLDTSSVNAAIVNAYRAACDRYYQN--CENKHKTRTN-G  375

Query  1248  TNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGL  1427
              +G S  P ++++ SPVS AKA+KN +ELEGM+NCHLRDAAALA FW WLE EI KD  L
Sbjct  376   FDGSSDVPFSVHKVSPVSQAKAIKNESELEGMRNCHLRDAAALAQFWDWLETEITKDRIL  435

Query  1428  TEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSG  1607
             TEVEV++KLLEFRSKQ GFLDTSFDTISGSG NGAIIHYKPEP+SCS V+ ++LFLLDSG
Sbjct  436   TEVEVSDKLLEFRSKQAGFLDTSFDTISGSGPNGAIIHYKPEPESCSSVDANKLFLLDSG  495

Query  1608  AQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLW  1787
             AQYVDGTTDITRTVHFG+P++REKECFTRVLQGHIALDQ+VFPENTPGFVLDAFARS LW
Sbjct  496   AQYVDGTTDITRTVHFGKPTAREKECFTRVLQGHIALDQSVFPENTPGFVLDAFARSFLW  555

Query  1788  KVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIE  1967
             KVGLDYRHGTGHGVGAALNVHEGPQ IS R+GN+TP+V GM+VSNEPGYYEDH+FGIRIE
Sbjct  556   KVGLDYRHGTGHGVGAALNVHEGPQSISHRYGNLTPLVKGMIVSNEPGYYEDHAFGIRIE  615

Query  1968  NLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVS  2147
             NLLYV+  +TPNRFGGI YLGFEKLT+VPIQ KLVDLS+LSAAE+ WLN+YH  VWEKVS
Sbjct  616   NLLYVRNAETPNRFGGIEYLGFEKLTYVPIQIKLVDLSLLSAAEIDWLNNYHSLVWEKVS  675

Query  2148  GLVDGRAREWLWNNTRPI  2201
              L+DG AR+WLWNNTRPI
Sbjct  676   PLMDGSARQWLWNNTRPI  693



>ref|XP_010025187.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Eucalyptus 
grandis]
 gb|KCW61787.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
Length=706

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/697 (72%), Positives = 587/697 (84%), Gaps = 26/697 (4%)
 Frame = +3

Query  147   TRHSRFPLISLPIPRKLHYPLKFPSS-----------SANCRVLIVRNSSNIAAKPSSEF  293
             +R  RF L +L +P        FPSS           +A  R  +VR+  ++ AKPSSE 
Sbjct  21    SRPLRFRLFALSLPL-------FPSSWRSPSERLARPAAGPRFRVVRSCGSVTAKPSSEI  73

Query  294   QKKPRGLDQED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGS  470
              ++  G  + D +LRALR+LF+RP I IDAYI+PSQDAHQSEFIA+CY RRAYISGFTGS
Sbjct  74    GRRGGGWPEPDEKLRALRELFTRPGIGIDAYIVPSQDAHQSEFIAECYTRRAYISGFTGS  133

Query  471   AGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGI  650
             AGTAVVTKDKAALWTDGRYFLQAE QL+SSWILMR+GN GVPT SEWLN VL+PG RIGI
Sbjct  134   AGTAVVTKDKAALWTDGRYFLQAENQLNSSWILMRAGNLGVPTTSEWLNDVLAPGCRIGI  193

Query  651   DPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGAD  830
             DPFLFSSDAAEELKE I+K NHELV L N+NLVDE+WKE RP+PP KP+R+HDLK+AG D
Sbjct  194   DPFLFSSDAAEELKEAIAKKNHELVLLYNINLVDEVWKE-RPKPPNKPVRIHDLKFAGLD  252

Query  831   VSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFI  1010
             V+SKL  LR++ ++AG+SAI+ISMLDE+AWLLNLRG+DV +SPV+YAYL+V+ + A+LF+
Sbjct  253   VASKLSFLRAEFVDAGASAIIISMLDEVAWLLNLRGNDVPNSPVVYAYLLVKTETAELFV  312

Query  1011  DDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACD  1190
             D SKITPEVMD+LK+ GVELR Y+ ILSEIE+LA++G NLWLD S+VNAAI N YK+ACD
Sbjct  313   DSSKITPEVMDHLKNAGVELRPYDKILSEIENLAKQGRNLWLDTSSVNAAIVNTYKSACD  372

Query  1191  RYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAA  1370
             +Y     + K++K   + D NG S  P  +YR+SP+S+AKAVKN AEL+GM+N HLRDAA
Sbjct  373   KY-----LNKKSKARVH-DYNGRSAMPSGVYRASPISLAKAVKNDAELQGMRNSHLRDAA  426

Query  1371  ALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKP  1550
             ALAHFW WLEEEI +   LTEVEVA+KLLEFRSKQ GF+DTSFDTIS SGANGA+IHYKP
Sbjct  427   ALAHFWVWLEEEINRGAKLTEVEVADKLLEFRSKQDGFIDTSFDTISASGANGAVIHYKP  486

Query  1551  EPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAV  1730
             EP SCS+++  +LFLLDSGAQYVDGTTDITRTVHFGEP+ R+KECFTRVLQGH+ALDQAV
Sbjct  487   EPGSCSVLDVEKLFLLDSGAQYVDGTTDITRTVHFGEPTPRQKECFTRVLQGHMALDQAV  546

Query  1731  FPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGM  1910
             FPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GN+T +  GM
Sbjct  547   FPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNLTSLQKGM  606

Query  1911  VVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILS  2090
             VVSNEPGYYEDH+FGIRIENLL V EM+TPNRFGG+GYLGFEKLTFVPIQ K+VD ++LS
Sbjct  607   VVSNEPGYYEDHAFGIRIENLLSVVEMNTPNRFGGVGYLGFEKLTFVPIQTKMVDSALLS  666

Query  2091  AAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +AE+ WLN YH QVWEKVS L+DG AR+WLW+NTRP+
Sbjct  667   SAEIDWLNDYHAQVWEKVSPLLDGSARQWLWDNTRPL  703



>ref|XP_010092819.1| putative Xaa-Pro aminopeptidase P [Morus notabilis]
 gb|EXB52559.1| putative Xaa-Pro aminopeptidase P [Morus notabilis]
Length=748

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/667 (75%), Positives = 573/667 (86%), Gaps = 6/667 (1%)
 Frame = +3

Query  150   RHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDR  329
             R+ RF  IS P+  K  + L FP+ S     LIVRN S+++ K  SEF+K     + +++
Sbjct  23    RYLRFFPISFPVFPKSKF-LNFPTKSPP---LIVRNCSSVSTKTPSEFRKNRAVSEPDEK  78

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             LRALRQLFS+P + IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDKAAL
Sbjct  79    LRALRQLFSKPGVGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKAAL  138

Query  510   WTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEEL  689
             WTDGRYFLQA+KQLSSSWILMR+GN GVPT SEWL+ VL+PG R+GIDPFLFS+DAAEEL
Sbjct  139   WTDGRYFLQADKQLSSSWILMRAGNLGVPTSSEWLSDVLAPGGRVGIDPFLFSADAAEEL  198

Query  690   KEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLI  869
             ++ I+K NHELVFL + NLVDEIWKE+RP+PP K IRVHDLKYAG DV+SK  +LRS+L+
Sbjct  199   RDAIAKKNHELVFLYDTNLVDEIWKEARPKPPNKLIRVHDLKYAGLDVASKFSTLRSELV  258

Query  870   NAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYL  1049
             NAGSSAIVISMLDEIAWL NLRG+D+ HSPVMYAYLIVEI+ AKLF+D+SK+ P+VM++L
Sbjct  259   NAGSSAIVISMLDEIAWLSNLRGNDIPHSPVMYAYLIVEINKAKLFVDNSKVNPDVMEHL  318

Query  1050  KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNK  1229
             KS GVEL  Y++ILSE++SLA +GA LWLD+S+VNAAI N Y  AC++  +   I+K NK
Sbjct  319   KSAGVELMPYDTILSEVKSLAAQGARLWLDRSSVNAAIVNTYTAACEKQYKH--IEKTNK  376

Query  1230  KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEI  1409
                N+D NG S  P  +Y++SPVS+AKA+K +AELEGMQNCHLRDAAALA FWAWLEEEI
Sbjct  377   SQKNVDLNGWSTAPAGIYKASPVSLAKAIKTAAELEGMQNCHLRDAAALAQFWAWLEEEI  436

Query  1410  CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHEL  1589
              KDV LTEVEVA++LLEFRS+Q GF+ TSFDTISGSG NGAIIHYKPEP SCSIV+ ++L
Sbjct  437   HKDVKLTEVEVADQLLEFRSRQSGFIGTSFDTISGSGPNGAIIHYKPEPASCSIVDGNKL  496

Query  1590  FLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAF  1769
             FLLDSG QYVDGTTDITRTVHFGEP + EKECFTRVLQGHIALDQAVFPENTPGFVLDAF
Sbjct  497   FLLDSGGQYVDGTTDITRTVHFGEPKAWEKECFTRVLQGHIALDQAVFPENTPGFVLDAF  556

Query  1770  ARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHS  1949
             ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPGYYEDH+
Sbjct  557   ARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQKGMIVSNEPGYYEDHA  616

Query  1950  FGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQ  2129
             FGIRIENL+ VKE DTP RFGGI YLGFEKLTFVPIQAKL+DL++LSA E+ WLN YH Q
Sbjct  617   FGIRIENLIVVKEADTPIRFGGIEYLGFEKLTFVPIQAKLIDLTLLSAEEITWLNDYHSQ  676

Query  2130  VWEKVSG  2150
             VWEK  G
Sbjct  677   VWEKGRG  683



>ref|XP_011023624.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Populus euphratica]
Length=708

 Score =  1013 bits (2620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/658 (75%), Positives = 578/658 (88%), Gaps = 9/658 (1%)
 Frame = +3

Query  243   LIVRNSSN--IAAKPSSEFQK-KPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQS  413
             +I+RN ++  + AKPSS+ ++ + +  + +++L+ALR+LFS+P I IDAYIIPSQDAHQS
Sbjct  52    IIIRNCTSPPVYAKPSSQIRRSRAKKWEPDEKLQALRELFSKPGIGIDAYIIPSQDAHQS  111

Query  414   EFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGV  593
             EFIA+CYMRR YISGFTGSAGTAVVTK+KAALWTDGRYFLQAEKQL+S+WILMR+GN GV
Sbjct  112   EFIAECYMRRTYISGFTGSAGTAVVTKEKAALWTDGRYFLQAEKQLNSNWILMRAGNPGV  171

Query  594   PTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESR  773
             PT SEWLN VL+PG+++G+DPFLFS DAAEELKE I+K NH+LV+L N NLVDEIWK SR
Sbjct  172   PTTSEWLNDVLAPGAKVGVDPFLFSFDAAEELKEAIAKKNHKLVYLYNPNLVDEIWKGSR  231

Query  774   PQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRH  953
             P PP KPIR+H+LKYAG DV+SKL  LRS+L++  SSAI++SMLDEIAWLLNLRG DV H
Sbjct  232   PMPPNKPIRIHELKYAGVDVASKLSFLRSELLDTCSSAIIVSMLDEIAWLLNLRGGDVPH  291

Query  954   SPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLW  1133
             SPVMYAYLIVE+DGAKLF+D+SK+TPEV+++LK+ GVEL+ Y++ILSEIESLA KGA LW
Sbjct  292   SPVMYAYLIVEVDGAKLFVDNSKVTPEVLNHLKNAGVELKPYDTILSEIESLAAKGAELW  351

Query  1134  LDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLD--TNGLSGQPHALYRSSPVSMA  1307
              D S+VNAAI N YK+ACDR+     I   ++K  NL   +N  S  P  +YR+SP+S+A
Sbjct  352   FDTSSVNAAIVNTYKSACDRHFE---IHASDRKG-NLHNGSNDQSWGPSGVYRASPISLA  407

Query  1308  KAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFL  1487
             KA+KNSAELEGM N HLRDAAALA FW WLEEEI KDV LTEV+VA+KLLEFRSKQ GF+
Sbjct  408   KAMKNSAELEGMHNSHLRDAAALAEFWLWLEEEIDKDVKLTEVDVADKLLEFRSKQAGFI  467

Query  1488  DTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPS  1667
             DTSFDTISGSGANGAIIHYKPEP+SCS+V+  +LFLLDSGAQYVDGTTDITRTVHFGEP+
Sbjct  468   DTSFDTISGSGANGAIIHYKPEPESCSVVDPKKLFLLDSGAQYVDGTTDITRTVHFGEPT  527

Query  1668  SREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNV  1847
             +REKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNV
Sbjct  528   AREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNV  587

Query  1848  HEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYL  2027
             HEGPQ ISFR+GN TP+  GM+VSNEPGYYEDH+FGIRIENLL VK++DTPN +GGI YL
Sbjct  588   HEGPQSISFRYGNTTPLQKGMIVSNEPGYYEDHAFGIRIENLLCVKQVDTPNCYGGIEYL  647

Query  2028  GFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             GFEKLT+VPIQ KLVDLS+L+ AEV WLN+YH QVWEKVS L+DG AREWLWNNTRP+
Sbjct  648   GFEKLTYVPIQTKLVDLSLLTVAEVDWLNNYHAQVWEKVSPLLDGSAREWLWNNTRPL  705



>ref|XP_004156420.1| PREDICTED: LOW QUALITY PROTEIN: probable Xaa-Pro aminopeptidase 
P-like [Cucumis sativus]
Length=710

 Score =  1011 bits (2615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/649 (76%), Positives = 563/649 (87%), Gaps = 3/649 (0%)
 Frame = +3

Query  261   SNIAAKPSSEFQKKPRGLDQED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYM  437
             S+I AKPSSE ++     D+ D +LRALR LFS+P+I IDAYIIPSQDAHQSEFIA+CYM
Sbjct  60    SSITAKPSSEIRRNRTNNDEPDSKLRALRDLFSKPNIGIDAYIIPSQDAHQSEFIAECYM  119

Query  438   RRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLN  617
             RRAYISGFTGSAGTAVVT DKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPTPSEWL 
Sbjct  120   RRAYISGFTGSAGTAVVTNDKAALWTDGRYFLQAEKQLNSSWTLMRAGNHGVPTPSEWLA  179

Query  618   SVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPI  797
              +L+PG  +GIDPFLFS+DAAE+LKE IS+ NH+LV+L + NLVD IWK+SR +PP+ PI
Sbjct  180   DILAPGGVVGIDPFLFSADAAEDLKETISRKNHKLVYLYDYNLVDAIWKDSRSKPPRGPI  239

Query  798   RVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYL  977
             RVHDL+YAG DV+SKL SLRS+L  AGSSAI+ISMLDEIAWLLNLRGSDV +SPVMYAYL
Sbjct  240   RVHDLRYAGLDVASKLASLRSELKEAGSSAIIISMLDEIAWLLNLRGSDVPNSPVMYAYL  299

Query  978   IVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl-AEKGANLWLDKSTVN  1154
             +VE+DGAKLF+DD K+T EVMD+LK+ GVELR Y+SI+S IE     KGANLWLD S++N
Sbjct  300   LVELDGAKLFVDDCKVTSEVMDHLKTAGVELRPYDSIISAIEKXFGRKGANLWLDTSSIN  359

Query  1155  AAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAEL  1334
             AAI NAY++ACD+Y    G K++ K  T+  +N   G P  +Y+SSP+SMAKA+KN AEL
Sbjct  360   AAIANAYRSACDKYFIRLGNKRKGKSKTSETSNSQVG-PTGVYKSSPISMAKAIKNYAEL  418

Query  1335  EGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
             EGM+N HLRDAAALA FW WLE+EI   V LTEVEVA+KLLEFR KQ GF+DTSFDTIS 
Sbjct  419   EGMRNSHLRDAAALAQFWFWLEQEILNGVKLTEVEVADKLLEFRKKQDGFVDTSFDTISA  478

Query  1515  SGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTR  1694
             SGANGAIIHYKPEP  CS+V+ ++LFLLDSGAQYVDGTTDITRTVHFGEP++R+KECFTR
Sbjct  479   SGANGAIIHYKPEPSDCSVVDANKLFLLDSGAQYVDGTTDITRTVHFGEPTARQKECFTR  538

Query  1695  VLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISF  1874
             VLQGHIALDQAVFP++TPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISF
Sbjct  539   VLQGHIALDQAVFPQDTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISF  598

Query  1875  RFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVP  2054
             RFGNMT +  GM+VSNEPGYYEDHSFGIRIENLL VK+ DTPN FGGIGYLGFEKLTFVP
Sbjct  599   RFGNMTGLHNGMIVSNEPGYYEDHSFGIRIENLLIVKDADTPNHFGGIGYLGFEKLTFVP  658

Query  2055  IQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             IQ KLVD+++LSAAEV WLN YH QVWEKVS L++G A EWLWNNT+P+
Sbjct  659   IQTKLVDITLLSAAEVNWLNDYHSQVWEKVSPLLEGSASEWLWNNTQPL  707



>ref|XP_002512383.1| xaa-pro aminopeptidase, putative [Ricinus communis]
 gb|EEF49835.1| xaa-pro aminopeptidase, putative [Ricinus communis]
Length=701

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/656 (75%), Positives = 563/656 (86%), Gaps = 3/656 (0%)
 Frame = +3

Query  243   LIVRNSSNIAAKPSSEFQKKPRGLDQED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEF  419
               + N S+I AKPSS+ ++      + D +L ALR+LFS+P I IDAYIIPSQDAHQSEF
Sbjct  43    FFIHNCSSITAKPSSQVRRSSTNKSEPDEKLSALRELFSKPGIGIDAYIIPSQDAHQSEF  102

Query  420   IADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPT  599
             IA+CYMRRAYISGFTGSAGTAVVTK+ AALWTDGRYFLQAEKQL+SSW LMR+GN G+PT
Sbjct  103   IAECYMRRAYISGFTGSAGTAVVTKENAALWTDGRYFLQAEKQLNSSWTLMRAGNLGIPT  162

Query  600   PSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQ  779
               EWLN VL PG+++GIDPFLFS DAAEELK+ ISK NH+L++L +LNLVDEIWKE RP+
Sbjct  163   TIEWLNDVLPPGAKVGIDPFLFSFDAAEELKDAISKKNHKLIYLYDLNLVDEIWKEPRPK  222

Query  780   PPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSP  959
             PP KPIRVHD+KYAG DV SKL +LRS L++AGSSAIVISMLDEIAWLLNLRG DV +SP
Sbjct  223   PPNKPIRVHDIKYAGVDVVSKLSTLRSLLLDAGSSAIVISMLDEIAWLLNLRGGDVPNSP  282

Query  960   VMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLD  1139
             VMYAYLIVEIDGAKLF+D+SK+TPEV+++LK+  VEL+ Y++ILSEIE LA +G  LWLD
Sbjct  283   VMYAYLIVEIDGAKLFVDNSKVTPEVLNHLKNASVELKPYDTILSEIERLAAQGTELWLD  342

Query  1140  KSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVK  1319
              S+VNAAI N YK+ACDR+    G K  +K      +N  S     +YR+SP+S+AKAVK
Sbjct  343   TSSVNAAIVNTYKSACDRHLADFGSKNHSKNDKYNGSNCQSWGHTGVYRASPISLAKAVK  402

Query  1320  NSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSF  1499
             N AELEGM+N HLRDAAALA FWAWLEEEI KDV LTEV+V+EKLLEFRSKQ GF+DTSF
Sbjct  403   NPAELEGMRNSHLRDAAALAQFWAWLEEEIHKDVKLTEVDVSEKLLEFRSKQAGFVDTSF  462

Query  1500  DTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREK  1679
             DTI GSGANGAIIHYKPEPDSCS+V++ +L LLDSGAQYVDGTTDITRTVHF EP+ REK
Sbjct  463   DTICGSGANGAIIHYKPEPDSCSVVDKKKLLLLDSGAQYVDGTTDITRTVHFSEPTPREK  522

Query  1680  ECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGP  1859
             ECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGP
Sbjct  523   ECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGP  582

Query  1860  QGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEK  2039
             Q ISFR+GN TP+  GM+VSNEPGYYEDH+FGIRIENLL+VKE DTPNRFGGI YLGFEK
Sbjct  583   QSISFRYGNTTPLQKGMIVSNEPGYYEDHAFGIRIENLLHVKEADTPNRFGGIEYLGFEK  642

Query  2040  LTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGL--VDGRAREWLWNNTRPI  2201
             LTF+PIQ KLVDLS+LSA E+ WL+ YH QVWEKVS L  VD  A++WLWNNTRP+
Sbjct  643   LTFLPIQTKLVDLSLLSANEIDWLDDYHSQVWEKVSPLLDVDSPAQQWLWNNTRPL  698



>ref|XP_007147048.1| hypothetical protein PHAVU_006G091700g [Phaseolus vulgaris]
 gb|ESW19042.1| hypothetical protein PHAVU_006G091700g [Phaseolus vulgaris]
Length=701

 Score =  1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/691 (73%), Positives = 581/691 (84%), Gaps = 14/691 (2%)
 Frame = +3

Query  147   TRHSRFPL-ISLPIPRKLHYPLKFPSSSANCRVLIVRN--SSNIAAKPSSEFQKKPRGLD  317
             TR   FPL + L  P  + + LK     +N     VRN  SS+   KPSSE  +KP    
Sbjct  14    TRSLFFPLPLFLSRPNPIFFNLK-----SNKPSFTVRNCGSSSFKVKPSSEI-RKPLAES  67

Query  318   QED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTK  494
             Q D +L ALR+LFS+P ++IDAY+IPSQDAHQSEFIA+CY RRAYISGFTGSAGTAVVTK
Sbjct  68    QPDAKLTALRRLFSQPGVDIDAYVIPSQDAHQSEFIAECYTRRAYISGFTGSAGTAVVTK  127

Query  495   DKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSD  674
             DKAALWTDGRYFLQAEKQLSS+WILMR+GN GVPT SEWLN VL+PG R+GIDPFLF+SD
Sbjct  128   DKAALWTDGRYFLQAEKQLSSNWILMRAGNPGVPTASEWLNEVLAPGGRVGIDPFLFTSD  187

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
             AAEELK  ISK +HELV+L N NLVDEIWKESRP+PP  P+RVHDLKYAG DV+SKL SL
Sbjct  188   AAEELKGVISKKDHELVYLYNSNLVDEIWKESRPKPPNNPVRVHDLKYAGLDVASKLSSL  247

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             RS+L+NAGSSAIVISMLDEIAWLLNLRG+D+ HSPV+YAYLIVEI GAKLF+DDSK+T E
Sbjct  248   RSELVNAGSSAIVISMLDEIAWLLNLRGNDIPHSPVVYAYLIVEIAGAKLFVDDSKVTEE  307

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V D+LK   +++R Y SI+SEIE LA +GA LWLD S+VN AI NAY  ACD+Y ++   
Sbjct  308   VRDHLKKANIQIRPYNSIISEIERLAAQGAPLWLDTSSVNVAIVNAYGAACDKYYQNR--  365

Query  1215  KKRNKKSTNLDTNGL--SGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
             +K++K  TN     +  S  P A+++ SPVS++KA+KN +ELEGMQNCHLRDAAALA FW
Sbjct  366   EKKHKTRTNSFDGYIESSDLPFAVHKVSPVSISKAIKNESELEGMQNCHLRDAAALAQFW  425

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
              WLE EI KD  LTEVEV++KLL+FRSKQ  FLDTSFDTISGSG NGAIIHYKPEP+SCS
Sbjct  426   DWLETEITKDRTLTEVEVSDKLLDFRSKQADFLDTSFDTISGSGPNGAIIHYKPEPESCS  485

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              V+ ++LFLLDSGAQYVDGTTDITRTVHFG+P++REKECFTRVLQGHIALDQ+VFPENTP
Sbjct  486   FVDANKLFLLDSGAQYVDGTTDITRTVHFGKPTAREKECFTRVLQGHIALDQSVFPENTP  545

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEP  1928
             GFVLDAFARS LWKVGLDYRHGTGHGVGAALNVHEGPQ IS RFGN TP++ GMVVSNEP
Sbjct  546   GFVLDAFARSFLWKVGLDYRHGTGHGVGAALNVHEGPQSISHRFGNFTPLMKGMVVSNEP  605

Query  1929  GYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAW  2108
             GYYEDH+FGIRIENLLYV+ ++TPNRFGGI YLGFEKLT+VPIQ KLVDLS+LSAAE+ W
Sbjct  606   GYYEDHAFGIRIENLLYVRNVETPNRFGGIQYLGFEKLTYVPIQIKLVDLSLLSAAEIDW  665

Query  2109  LNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             LN+YH  VWEKVS L+DG A +WLW+NTRPI
Sbjct  666   LNNYHSLVWEKVSSLLDGSALQWLWSNTRPI  696



>ref|XP_003626286.1| Xaa-Pro aminopeptidase [Medicago truncatula]
 gb|AES82504.1| Xaa-pro aminopeptidase P [Medicago truncatula]
Length=713

 Score =  1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/689 (72%), Positives = 581/689 (84%), Gaps = 11/689 (2%)
 Frame = +3

Query  153   HSRFPLISL-PIPRKLHYPLKFPSSSANCRVLI-VRN---SSNIAAKPSSEFQK-KPRGL  314
             HS FP ++L PI     +  KF S+  N      +RN   S++I+AKPSS+ +K +    
Sbjct  25    HSSFPTLNLNPI-----FFYKFKSNKHNKPPFFSIRNCTTSNSISAKPSSQLRKNRSSNS  79

Query  315   DQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTK  494
             D + +L ALR+LFS+PD++IDAYIIPSQDAHQSEFIA  Y RR YIS FTGS GTAVVT 
Sbjct  80    DSDPKLTALRRLFSKPDVSIDAYIIPSQDAHQSEFIAQSYARRKYISAFTGSNGTAVVTN  139

Query  495   DKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSD  674
             DKAALWTDGRYFLQAEKQL+S+WILMR+GN GVPT SEWLN VL+PG+R+GIDPFLF+SD
Sbjct  140   DKAALWTDGRYFLQAEKQLNSNWILMRAGNPGVPTTSEWLNEVLAPGARVGIDPFLFTSD  199

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
             AAEELK  ISK NHELV+L N NLVDEIWKE+RP+PP KP+RVH LKYAG DV+SKL SL
Sbjct  200   AAEELKHVISKKNHELVYLYNSNLVDEIWKEARPEPPNKPVRVHGLKYAGLDVASKLSSL  259

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             RS+L+ AGSSAI+++ LDEIAWLLNLRGSD+ HSPV+YAYLIVEIDGAKLFID+SK+T E
Sbjct  260   RSELVQAGSSAIIVTALDEIAWLLNLRGSDIPHSPVVYAYLIVEIDGAKLFIDNSKVTEE  319

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V D+LK   +E+R Y SI+SEIE+LA +G++LWLD S+VNAAI NAYK ACDRY ++   
Sbjct  320   VDDHLKKANIEIRPYNSIVSEIENLAARGSSLWLDTSSVNAAIVNAYKAACDRYYQNYES  379

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
             K + +      +   S  P A+++SSPVS+AKA+KN  EL+GMQ CHLRDAAALA FW W
Sbjct  380   KHKTRSKGFDGSIANSDVPIAVHKSSPVSLAKAIKNETELKGMQECHLRDAAALAQFWDW  439

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+EI  D  LTEVEV++KLLEFRSKQ GFLDTSFDTISGSG NGAIIHYKPEP SCS V
Sbjct  440   LEKEITNDRILTEVEVSDKLLEFRSKQAGFLDTSFDTISGSGPNGAIIHYKPEPGSCSTV  499

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             + ++LFLLDSGAQYVDGTTDITRTVHFG+P++REKECFTRVLQGHIALDQAVFPE+TPGF
Sbjct  500   DANKLFLLDSGAQYVDGTTDITRTVHFGKPTTREKECFTRVLQGHIALDQAVFPEDTPGF  559

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             VLDAFARS LWKVGLDYRHGTGHGVGAALNVHEGPQGIS+R+GN+TP+V GM+VSNEPGY
Sbjct  560   VLDAFARSFLWKVGLDYRHGTGHGVGAALNVHEGPQGISYRYGNLTPLVNGMIVSNEPGY  619

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YEDH+FGIRIENLLYV+ ++TPNRFGGI YLGFEKLT+VPIQ KLVD+S+LS  E+ WLN
Sbjct  620   YEDHAFGIRIENLLYVRNVETPNRFGGIQYLGFEKLTYVPIQIKLVDVSLLSTTEIDWLN  679

Query  2115  SYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +YH  VWEKVS L+DG AR+WLWNNT+PI
Sbjct  680   NYHSVVWEKVSPLLDGSARQWLWNNTQPI  708



>ref|XP_010546700.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Tarenaya hassleriana]
Length=708

 Score =   995 bits (2572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/683 (71%), Positives = 567/683 (83%), Gaps = 9/683 (1%)
 Frame = +3

Query  156   SRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLR  335
             +  PLI   +P     PL+       C     + SS+  AKPSSE ++       + +L 
Sbjct  31    TSLPLIHRKLPYTPFLPLR-------CYAGGDKGSSSFTAKPSSEIRRARSHTKPDQKLD  83

Query  336   ALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWT  515
             ALR+LFS P + IDAY+IPSQDAHQSEFIA+CY RR YISGFTGSAGTAVVTKDKAALWT
Sbjct  84    ALRRLFSEPGVGIDAYVIPSQDAHQSEFIAECYARRTYISGFTGSAGTAVVTKDKAALWT  143

Query  516   DGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKE  695
             DGRYFLQAEKQLSSSWILMR+GN GVPT SEW+  VL+PG R+GIDPFLFS+DAAEELKE
Sbjct  144   DGRYFLQAEKQLSSSWILMRTGNLGVPTASEWITDVLAPGGRVGIDPFLFSADAAEELKE  203

Query  696   DISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINA  875
              I+K NHELVFL N+NLVDEIWKESRP+PP KPIRVH LKYAG DV+SKL SLR +L++A
Sbjct  204   AIAKKNHELVFLYNVNLVDEIWKESRPKPPSKPIRVHGLKYAGLDVASKLSSLRGELMDA  263

Query  876   GSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKS  1055
             G+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE+D AKLF+D+SK+T EV D+L+ 
Sbjct  264   GASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDRAKLFVDNSKVTTEVRDHLEK  323

Query  1056  VGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKS  1235
              GVELR Y+S+LSEIESLA+  A LW+D ST+N AI + YKTAC++YS     K + K  
Sbjct  324   AGVELRPYDSVLSEIESLAQLRAQLWMDPSTLNIAIISTYKTACEKYSGKSEGKNKPKTK  383

Query  1236  TNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICK  1415
                D+NG S +   ++R SP+S AKA+KN AEL+GM+N HLRDAAALAHFWAWL+EE+ K
Sbjct  384   IADDSNGYSAKSSGIFRPSPISWAKAIKNDAELQGMKNSHLRDAAALAHFWAWLDEEVHK  443

Query  1416  DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFL  1595
             +  LTEV+ AEKLLEFRSKQ  F+DTSFDTISGSGANGA+IHYKPEPDSCS+V+  +LFL
Sbjct  444   N-DLTEVDAAEKLLEFRSKQDSFMDTSFDTISGSGANGAVIHYKPEPDSCSVVDPKKLFL  502

Query  1596  LDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFAR  1775
             LDSGAQYVDGTTDITRTVHF EP++REKECFTRVL+GHIALDQAVFPE TPGFVLDAFAR
Sbjct  503   LDSGAQYVDGTTDITRTVHFSEPTAREKECFTRVLKGHIALDQAVFPEGTPGFVLDAFAR  562

Query  1776  SSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFG  1955
             SSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPGYYEDH+FG
Sbjct  563   SSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQTGMIVSNEPGYYEDHAFG  622

Query  1956  IRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVW  2135
             IRIENLL VK+ +T NRFGG+ YLGFEKLTF PIQ K+VD+S+LS  E+ WLNSYH +VW
Sbjct  623   IRIENLLVVKDAETSNRFGGVAYLGFEKLTFFPIQTKMVDVSLLSETEIEWLNSYHTEVW  682

Query  2136  EKVSGLVD-GRAREWLWNNTRPI  2201
             EKVS L++ G +R WLW NTRP+
Sbjct  683   EKVSPLLEGGSSRNWLWENTRPL  705



>ref|XP_004494614.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Cicer arietinum]
Length=701

 Score =   995 bits (2572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/672 (72%), Positives = 560/672 (83%), Gaps = 12/672 (2%)
 Frame = +3

Query  210   KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYII  389
             KF S +       +RN ++I AKPSS+  K     + + +L ALR+LFS+PD++IDAYII
Sbjct  33    KFKSYNPKLPFFAIRNCTSITAKPSSQLPKHRTDSEPDLKLTALRRLFSKPDVSIDAYII  92

Query  390   PSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWIL  569
             PSQDAHQSEFIA+CY RRAYIS FTGS+GTAVVT DKAALWTDGRYFLQAEKQL+S+WIL
Sbjct  93    PSQDAHQSEFIAECYGRRAYISAFTGSSGTAVVTTDKAALWTDGRYFLQAEKQLNSNWIL  152

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MR+GN GVPT SEWLN VL PG R+GIDPFLF+SDAAEELK  ISK NHELV+L N NLV
Sbjct  153   MRAGNPGVPTTSEWLNEVLPPGGRVGIDPFLFTSDAAEELKHVISKKNHELVYLYNSNLV  212

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIWKESRPQPP KP+RVHDLKYAG DV+SKL SLRS+L+ AGSSAI++S LDEIAWLLN
Sbjct  213   DEIWKESRPQPPNKPVRVHDLKYAGLDVASKLSSLRSELVKAGSSAIIVSALDEIAWLLN  272

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             LRGSD+ HSPV+YAYLIVEI GAKLFID SK+T EV D+LK   +E+  Y SI+SEIE+L
Sbjct  273   LRGSDIPHSPVVYAYLIVEIGGAKLFIDGSKVTEEVDDHLKKANIEIMPYNSIISEIENL  332

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQ------P  1271
             A + A+LWLD S+VNAAI NAYK ACDRY +    K + +        G  G       P
Sbjct  333   AAQCASLWLDTSSVNAAIVNAYKAACDRYYQKYESKHKTRN------KGFHGSIENLVVP  386

Query  1272  HALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEK  1451
              A+++ SP+S+AKA+KN  ELEGMQ CHLRDAAA+A FW WLE EI     LTEVE ++K
Sbjct  387   IAIHKFSPISLAKAIKNETELEGMQGCHLRDAAAVAQFWDWLETEITNKRILTEVEASDK  446

Query  1452  LLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTT  1631
             LLEFRSKQ GFLDTSFDTISGSG NGAIIHYKPEP+SCSIV+ ++LFLLDSGAQYVDGTT
Sbjct  447   LLEFRSKQDGFLDTSFDTISGSGPNGAIIHYKPEPESCSIVDANKLFLLDSGAQYVDGTT  506

Query  1632  DITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRH  1811
             DITRTVHFG+P++REKECFTRVLQGHIALDQAVFPENTPGFVLDAFARS LWK GLDYRH
Sbjct  507   DITRTVHFGKPTAREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSFLWKAGLDYRH  566

Query  1812  GTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEM  1991
             GTGHGVGAALNVHEGPQ IS+R+GN+TP+V GM+VSNEPGYYEDH+FGIRIENLLYV+  
Sbjct  567   GTGHGVGAALNVHEGPQSISYRYGNLTPLVNGMIVSNEPGYYEDHAFGIRIENLLYVRNA  626

Query  1992  DTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAR  2171
             +TPNRFGGI YLGFEKLT+VPIQ K+VD+S+LSA E+ WLN+YH  VWEKVS L++G A 
Sbjct  627   ETPNRFGGIQYLGFEKLTYVPIQIKMVDVSLLSATEIDWLNNYHSLVWEKVSPLLEGSAH  686

Query  2172  EWLWNNTRPIDS  2207
             +WLWNNTRPI S
Sbjct  687   QWLWNNTRPITS  698



>ref|XP_010674747.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Beta vulgaris subsp. 
vulgaris]
Length=706

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/692 (72%), Positives = 568/692 (82%), Gaps = 12/692 (2%)
 Frame = +3

Query  144   HTRHSRFPLISLPIPRKLHYPLKFPSS----SANCRVL-IVRNSSNIAAKPSSEFQK-KP  305
             H R   F  +SL  P  L+Y LK P S    S N     +++  S+  AKPSSE +K K 
Sbjct  17    HLRPQYFRFLSLSSP-PLYYRLKSPPSISRISPNFSSFSLIKCCSSFTAKPSSELRKLKQ  75

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
                  + +LR LR+ F++P + IDAYIIPSQDAHQSEFIA+C+MRRAYISGFTGSAGTAV
Sbjct  76    VNSTGDAKLRELREQFTKPGVGIDAYIIPSQDAHQSEFIAECFMRRAYISGFTGSAGTAV  135

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VTKDKAALWTDGRYFLQAEKQLSS WILMR+GN GVPT SEWL+ VL+PGSR+GIDPFLF
Sbjct  136   VTKDKAALWTDGRYFLQAEKQLSSDWILMRAGNMGVPTMSEWLDDVLTPGSRVGIDPFLF  195

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S DAAEEL++DISK NHELV LS  NLVDEIWKESRP+PP KP+R+H+LKYAG DVS KL
Sbjct  196   SFDAAEELRDDISKKNHELVLLSKSNLVDEIWKESRPKPPSKPVRLHELKYAGVDVSWKL  255

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
               LRS L N   SAIVI+ LDEIAWLLNLRGSD+ +SPVMYAYL+VE D AKLFID+SKI
Sbjct  256   SWLRSQLANDDCSAIVITRLDEIAWLLNLRGSDIPNSPVMYAYLVVETDQAKLFIDESKI  315

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
             T EVMDYL++ GVELR Y+SIL  +E+LA  GA+L +D +TVNAAI N +K A   +   
Sbjct  316   TSEVMDYLQNAGVELRPYDSILKAVENLAVDGAHLLIDTATVNAAIVNTFKLAAKNFD--  373

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
                KK  K      +NG   +  A++RSSP+S+AKA+KN AE+EGM+N HLRDAAALA F
Sbjct  374   ---KKERKSKLYGSSNGGFDRATAVHRSSPISIAKALKNDAEIEGMRNSHLRDAAALAQF  430

Query  1386  WAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             W+WLE EI KD  LTEVEVA+KLLEFRSKQ GF+DTSFDTISGSG NGAIIHYKPEPDSC
Sbjct  431   WSWLETEIHKDATLTEVEVADKLLEFRSKQDGFVDTSFDTISGSGPNGAIIHYKPEPDSC  490

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             SIV+  +LFLLDSGAQY+DGTTDITRTVHF EP+ REKECFTRVLQGHIALDQAVFPENT
Sbjct  491   SIVDPEKLFLLDSGAQYIDGTTDITRTVHFREPTPREKECFTRVLQGHIALDQAVFPENT  550

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNE  1925
             PGFVLDAFARSSLWK GLDYRHGTGHGVGAALNVHEGPQ ISFRFGN+TP+  GM+VSNE
Sbjct  551   PGFVLDAFARSSLWKAGLDYRHGTGHGVGAALNVHEGPQSISFRFGNLTPLQKGMIVSNE  610

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYEDH+FGIRIENLL+VKE+ TPNRFGG+GYLGFEKLTF PIQ KL+DLS+ SAAEV 
Sbjct  611   PGYYEDHAFGIRIENLLFVKEIATPNRFGGVGYLGFEKLTFAPIQIKLIDLSLFSAAEVD  670

Query  2106  WLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             WL+ YH QVW+KVS L+DG AR+WLW NTRP+
Sbjct  671   WLDDYHEQVWQKVSPLLDGSARQWLWGNTRPL  702



>gb|KFK37952.1| hypothetical protein AALP_AA3G051400 [Arabis alpina]
Length=710

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/692 (69%), Positives = 580/692 (84%), Gaps = 7/692 (1%)
 Frame = +3

Query  141   YHTRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKP  305
             + +R+S  P +    SLP I RKL Y       S  C      +SS+   KPS E ++  
Sbjct  18    FTSRYSHSPFLRNFKSLPLIHRKLPYNNHL--LSVRCHTTSSGSSSSFTEKPSKEIRRNR  75

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
               +  +++L ++R+LFS P + IDAYIIPSQDAHQSEFIA+CY RRA+ISGFTGSAGTAV
Sbjct  76    PEVVVDEKLTSIRKLFSNPSVGIDAYIIPSQDAHQSEFIAECYARRAFISGFTGSAGTAV  135

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VT+DKAALWTDGRYFLQAEKQL+SSWILMR+GN GVPT SEW+  VL+PG R+GIDPFLF
Sbjct  136   VTRDKAALWTDGRYFLQAEKQLNSSWILMRAGNTGVPTASEWIADVLAPGGRVGIDPFLF  195

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S+DAAEELKE ISK NHELV+L N+NLVDEIWK+SRP+PP K IR+HDLKYAG DV+SKL
Sbjct  196   SADAAEELKEAISKKNHELVYLYNVNLVDEIWKDSRPKPPSKHIRIHDLKYAGVDVASKL  255

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
              +LR+++++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYL+VE+D AKLF+D +K+
Sbjct  256   LALRNEIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLVVEVDQAKLFVDSAKV  315

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
             T EV ++L   G+ELR Y+SILSEI+SLA +GA L +D ST+N AI + YK+AC+RYSR 
Sbjct  316   TAEVKNHLTDAGIELRTYDSILSEIDSLASRGAQLLMDPSTLNVAIISTYKSACERYSRM  375

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
                + + K+  ++ ++G S +P  ++R SP+S AKA+KN AEL+GM+N HLRDAAALAHF
Sbjct  376   SENQDKAKEKLSVGSSGYSAKPSGIFRPSPISWAKAIKNGAELQGMKNSHLRDAAALAHF  435

Query  1386  WAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             WAWLEEE+ K+V LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SC
Sbjct  436   WAWLEEEVHKNVNLTEVDVADRLLEFRSMQDGFMDTSFDTISGSGANGAIIHYKPEPESC  495

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALD+AVFPE T
Sbjct  496   SRVDPQKLFLLDSGAQYVDGTTDITRTVHFTEPSAREKECFTRVLQGHIALDEAVFPEGT  555

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNE  1925
             PGFVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQGISFR+GNMTP+  GM+VSNE
Sbjct  556   PGFVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQGISFRYGNMTPLQNGMIVSNE  615

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYEDH+FGIRIENLL+V++ +TPNRFG   YLGFEKLTF PIQAK++D+S+L   E+ 
Sbjct  616   PGYYEDHAFGIRIENLLHVRDAETPNRFGVATYLGFEKLTFFPIQAKMIDVSLLFHGEID  675

Query  2106  WLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             WLN+YH +VWEKVS L++G  R+WLWNNTRP+
Sbjct  676   WLNNYHTEVWEKVSPLLEGPTRQWLWNNTRPL  707



>ref|XP_006408085.1| hypothetical protein EUTSA_v10020169mg [Eutrema salsugineum]
 gb|ESQ49538.1| hypothetical protein EUTSA_v10020169mg [Eutrema salsugineum]
Length=707

 Score =   983 bits (2540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/645 (73%), Positives = 556/645 (86%), Gaps = 0/645 (0%)
 Frame = +3

Query  267   IAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRA  446
               AKPS E +K    +  +++L ALR+ FS P + IDAYIIPSQDAHQSEFIADCY RRA
Sbjct  60    FTAKPSKEIRKSRTEVVLDEKLIALRKQFSEPGVGIDAYIIPSQDAHQSEFIADCYARRA  119

Query  447   YISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVL  626
             +ISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQL++SW+LMR+GN GVPT SEW+  VL
Sbjct  120   FISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLNASWVLMRAGNPGVPTASEWVADVL  179

Query  627   SPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVH  806
             +PG R+GIDPFLFS+DAAEELKE I+K NHELV+L N NLVDEIWK+SRP+PP K IRVH
Sbjct  180   APGGRVGIDPFLFSADAAEELKEAIAKKNHELVYLYNANLVDEIWKDSRPKPPSKQIRVH  239

Query  807   DLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVE  986
             DLKYAG DV+SKL +LR+++++AG+S+IVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE
Sbjct  240   DLKYAGVDVASKLAALRNEIMDAGASSIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVE  299

Query  987   IDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAIT  1166
             +D AKLF+D+SK+T EV D+L + G+ELR Y+SILSEI+SLA +GA L +D ST+N AI 
Sbjct  300   VDQAKLFVDNSKVTAEVKDHLTNAGIELRPYDSILSEIDSLAARGAQLLMDPSTLNVAII  359

Query  1167  NAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQ  1346
             + YK+AC++YS       + K   ++ ++G S +P  +YR SP+S AKA+KN AEL GM+
Sbjct  360   STYKSACEKYSSKSENPDKAKTKLSIGSSGYSVKPSGIYRPSPISWAKAIKNDAELHGMK  419

Query  1347  NCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGAN  1526
             N HLRDAAALAHFWAWLEEE+ K+V LTEV+VA++LLEFRS Q GF+DTSFDTISGSGAN
Sbjct  420   NSHLRDAAALAHFWAWLEEEVHKNVNLTEVDVADRLLEFRSMQDGFMDTSFDTISGSGAN  479

Query  1527  GAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQG  1706
             GAIIHYKPEP+SCS V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQG
Sbjct  480   GAIIHYKPEPESCSRVDPQKLFLLDSGAQYVDGTTDITRTVHFTEPSAREKECFTRVLQG  539

Query  1707  HIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGN  1886
             HIALDQAVFPE TPGFVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GN
Sbjct  540   HIALDQAVFPEGTPGFVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGN  599

Query  1887  MTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAK  2066
             M P+  GM+VSNEPGYYEDH+FGIRIENLL+VK+ +TPNRFGG  YLGFEKLTF PIQ K
Sbjct  600   MNPLQNGMIVSNEPGYYEDHAFGIRIENLLHVKDAETPNRFGGATYLGFEKLTFFPIQTK  659

Query  2067  LVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +VD+S+LS AE+ WLN+YH +VWEKVS L++G  ++WLWNNTRP+
Sbjct  660   MVDISLLSHAEIDWLNNYHAEVWEKVSPLLEGPTQQWLWNNTRPL  704



>ref|NP_187186.5| Metallopeptidase M24 family protein [Arabidopsis thaliana]
 gb|AAL84973.1| AT3g05350/T12H1_32 [Arabidopsis thaliana]
 gb|AAN46861.1| At3g05350/T12H1_32 [Arabidopsis thaliana]
 gb|AEE74224.1| Metallopeptidase M24 family protein [Arabidopsis thaliana]
Length=710

 Score =   983 bits (2540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/684 (71%), Positives = 571/684 (83%), Gaps = 6/684 (1%)
 Frame = +3

Query  156   SRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSN-IAAKPSSEFQKKPRGLDQEDRL  332
             S F  +SL I RKL Y    P   A C      +SS+   AK S E +K    +  +++L
Sbjct  28    SNFNSLSL-IHRKLPYK---PLFGARCHASSSSSSSSSFTAKSSKEIRKAQTKVVVDEKL  83

Query  333   RALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALW  512
              ++R+LFS P + IDAYIIPSQDAHQSEFIA+CY RRAYISGFTGSAGTAVVTKDKAALW
Sbjct  84    SSIRRLFSEPGVGIDAYIIPSQDAHQSEFIAECYARRAYISGFTGSAGTAVVTKDKAALW  143

Query  513   TDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELK  692
             TDGRYFLQAEKQL+SSWILMR+GN GVPT SEW+  VL+PG R+GIDPFLFS+DAAEELK
Sbjct  144   TDGRYFLQAEKQLNSSWILMRAGNPGVPTASEWIADVLAPGGRVGIDPFLFSADAAEELK  203

Query  693   EDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLIN  872
             E I+K NHELV+L N+NLVDEIWK+SRP+PP + IR+HDLKYAG DV+SKL SLR+ +++
Sbjct  204   EVIAKKNHELVYLYNVNLVDEIWKDSRPKPPSRQIRIHDLKYAGLDVASKLLSLRNQIMD  263

Query  873   AGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLK  1052
             AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE+D A+LF+D+SK+T EV D+LK
Sbjct  264   AGTSAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDQAQLFVDNSKVTVEVKDHLK  323

Query  1053  SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKK  1232
             + G+ELR Y+SIL  I+SLA +GA L +D ST+N AI + YK+AC+RYSR+   + + K 
Sbjct  324   NAGIELRPYDSILQGIDSLAARGAQLLMDPSTLNVAIISTYKSACERYSRNFESEAKVKT  383

Query  1233  STNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEIC  1412
                  ++G +  P  +Y  SP+S AKA+KN AEL+GM+N HLRDAAALAHFWAWLEEE+ 
Sbjct  384   KFTDSSSGYTANPSGIYMQSPISWAKAIKNDAELKGMKNSHLRDAAALAHFWAWLEEEVH  443

Query  1413  KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELF  1592
             K+  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SCS V+  +LF
Sbjct  444   KNANLTEVDVADRLLEFRSMQDGFMDTSFDTISGSGANGAIIHYKPEPESCSRVDPQKLF  503

Query  1593  LLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFA  1772
             LLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE TPGFVLD FA
Sbjct  504   LLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPGFVLDGFA  563

Query  1773  RSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSF  1952
             RSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPGYYEDH+F
Sbjct  564   RSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPGYYEDHAF  623

Query  1953  GIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQV  2132
             GIRIENLL+V++ +TPNRFGG  YLGFEKLTF PIQ K+VD+S+LS  EV WLNSYH +V
Sbjct  624   GIRIENLLHVRDAETPNRFGGATYLGFEKLTFFPIQTKMVDVSLLSDTEVDWLNSYHAEV  683

Query  2133  WEKVSGLVDGR-AREWLWNNTRPI  2201
             WEKVS L++G   ++WLWNNTRP+
Sbjct  684   WEKVSPLLEGSTTQQWLWNNTRPL  707



>ref|XP_009147248.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Brassica rapa]
Length=696

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/692 (70%), Positives = 571/692 (83%), Gaps = 24/692 (3%)
 Frame = +3

Query  147   TRHSRFPLI----SLPIPRKLHYPLKFPSS---SANCRVLIVRNSSNIAAKPSSEFQKKP  305
             +R+SR P +    SLP+  +     K P +    A C       SS+  AK S E +K  
Sbjct  19    SRYSRSPFLRNFSSLPLIHR-----KLPRNHLLGARCEA-----SSSFTAKSSKEIRKAR  68

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
                  +++L ALRQ FS+P + IDAYI+PSQDAHQSEFIA+CY RRA+ISGFTGSAGTAV
Sbjct  69    AEAVVDEKLTALRQQFSKPGVGIDAYIVPSQDAHQSEFIAECYARRAFISGFTGSAGTAV  128

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VTKDKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+ G R+GIDPFLF
Sbjct  129   VTKDKAALWTDGRYFLQAEKQLNSSWTLMRAGNPGVPTASEWVADVLASGGRVGIDPFLF  188

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S+DAAEELKE I+K NHELV+L N+NLVDEIWK+SRP+PP K IRVHDLKYAG DV+SKL
Sbjct  189   SADAAEELKEAIAKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRVHDLKYAGVDVASKL  248

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
              SLR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMY+YLIVE+D A+LF+DDSK+
Sbjct  249   LSLRNAIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYSYLIVEVDQAQLFVDDSKV  308

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
               EV D+LK+ G+ELR Y+SIL EI+SLA +GA L +D ST+N AI + YK+AC++YS  
Sbjct  309   NEEVKDHLKNAGIELRPYDSILQEIDSLAARGAQLLMDPSTLNVAIISTYKSACEKYSSK  368

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
             P  K++        T+G S +P  +Y  SP+S +KA+KN AEL+GM+N HLRDAAALAHF
Sbjct  369   PESKEKF-------TDGSSTKPSGIYMQSPISWSKAIKNDAELQGMKNSHLRDAAALAHF  421

Query  1386  WAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             WAWLEEE+ K+  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SC
Sbjct  422   WAWLEEEVHKNENLTEVDVADRLLEFRSVQDGFMDTSFDTISGSGANGAIIHYKPEPESC  481

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S V+ H+LFLLDSGAQYVDGTTDITRT HF EPS+REKECFTRVLQGHIALDQAVFPE T
Sbjct  482   SRVDPHKLFLLDSGAQYVDGTTDITRTAHFSEPSAREKECFTRVLQGHIALDQAVFPEGT  541

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNE  1925
             PGFVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNE
Sbjct  542   PGFVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPIQSGMIVSNE  601

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYEDH+FGIRIENLL+VK+ +TPNRFGG  YLGFEKLTF PIQ K+VD+S LS AE+ 
Sbjct  602   PGYYEDHAFGIRIENLLHVKDAETPNRFGGATYLGFEKLTFFPIQTKMVDVSFLSHAEID  661

Query  2106  WLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             WLNSYH +VWEKVS L++G  ++WLWNNTRP+
Sbjct  662   WLNSYHAEVWEKVSPLLEGPTQQWLWNNTRPL  693



>gb|KDO56311.1| hypothetical protein CISIN_1g005183mg [Citrus sinensis]
Length=670

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/606 (79%), Positives = 535/606 (88%), Gaps = 1/606 (0%)
 Frame = +3

Query  243   LIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFI  422
             L +RN ++I AKPSSEF +       +++LRALR+LFSRP +NIDAYIIPSQDAHQSEFI
Sbjct  56    LFIRNCTSITAKPSSEFNRNRTQDAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFI  115

Query  423   ADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTP  602
             A+CYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT 
Sbjct  116   AECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTT  175

Query  603   SEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQP  782
              EWLN VL+PG R+GIDPFLFSSDAAEELKE I+K NHELV+L +LNLVD IWKESRP+P
Sbjct  176   FEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKP  235

Query  783   PKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPV  962
             P KPIRVH LKYAG DV+SKL SLRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPV
Sbjct  236   PNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPV  295

Query  963   MYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDK  1142
             MYAYLIVE+D AKLF+DDSK+TP+VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD 
Sbjct  296   MYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDP  355

Query  1143  STVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKN  1322
             S+VNAAI N Y+ A ++Y  S    K++K   + DT G SG P  ++R+SP++ +KAVKN
Sbjct  356   SSVNAAIMNTYEIAIEKYLTSNN-NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKN  414

Query  1323  SAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFD  1502
             SAELEGM N HLRDAAALA FW WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFD
Sbjct  415   SAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFD  474

Query  1503  TISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKE  1682
             TISGSGANGAIIHYKPEP  CS+V+  +LFLLDSGAQYVDGTTDITRTVHFGEP++REKE
Sbjct  475   TISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKE  534

Query  1683  CFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQ  1862
             CFTRVLQGHIALDQA+FP++TPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ
Sbjct  535   CFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQ  594

Query  1863  GISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKL  2042
              ISFR+GNMTP+V GM+VSNEPGYYEDH+FGIRIENLLYVKE+ TPNRFGG+ YLGFEKL
Sbjct  595   SISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKL  654

Query  2043  TFVPIQ  2060
             TFVPIQ
Sbjct  655   TFVPIQ  660



>ref|XP_008802675.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   981 bits (2536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/694 (70%), Positives = 566/694 (82%), Gaps = 13/694 (2%)
 Frame = +3

Query  159   RFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNS--SNIAAKPSSEFQKKPRG--LDQED  326
             RF  +S+P   +LH            R+ +   S    I A+PSSE +KK     L ++D
Sbjct  28    RFLALSVPFLGELHTRRCVALRPRYLRLSVAARSFGDGIIARPSSELRKKQSSGSLTEDD  87

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +LRALR+LFSRP I ID YIIPSQDAHQSEFIA+C+MRRAYI+GFTGSAGTAVVTK+KAA
Sbjct  88    KLRALRELFSRPGIGIDVYIIPSQDAHQSEFIAECFMRRAYITGFTGSAGTAVVTKEKAA  147

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             LWTDGRYFLQAEKQLS  W LMRSGN GVPT  EWLN VL+PG R+GIDPFLFSSDAAEE
Sbjct  148   LWTDGRYFLQAEKQLSCDWKLMRSGNLGVPTTPEWLNDVLAPGCRVGIDPFLFSSDAAEE  207

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             LKE ISK NHELVF+   NLVDEIW +SRP+PP KP RVHD+KYAG DVS+KL SLRS+L
Sbjct  208   LKEAISKKNHELVFIYGYNLVDEIWGKSRPKPPMKPTRVHDIKYAGVDVSTKLSSLRSEL  267

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
             I  G +AIVISMLDE+AWLLN+RG+DV HSPV Y+YLIVEIDGAKLFID++K+T EVMD+
Sbjct  268   IETGCTAIVISMLDEVAWLLNMRGNDVPHSPVFYSYLIVEIDGAKLFIDEAKVTKEVMDH  327

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             LKS GVEL+ YESILSEIESLA +GA LWLD S+VNAAI + +K+AC+++      + R+
Sbjct  328   LKSAGVELKPYESILSEIESLAARGAKLWLDTSSVNAAIVSRFKSACNKHFAKFEKQARD  387

Query  1227  KK---------STNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALA  1379
             KK         +TN   +     P  LY+ SPV++AKAVKN +E++GM++CHLRDAAAL 
Sbjct  388   KKVDGETSPDMATNKHQDTRIEGPTGLYKLSPVTLAKAVKNKSEIDGMRSCHLRDAAALV  447

Query  1380  HFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
              FWAW+EEEI K+  LTEVEVA+KLLEFR KQ GF+DTSFDTISG GANGA+IHY PEPD
Sbjct  448   EFWAWMEEEIHKNAVLTEVEVADKLLEFRKKQAGFMDTSFDTISGYGANGAVIHYSPEPD  507

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             SCS+V+   LFLLDSG QYVDGTTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVFPE
Sbjct  508   SCSVVDDKNLFLLDSGGQYVDGTTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVFPE  567

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVS  1919
             +TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMT +  GMVVS
Sbjct  568   HTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTALQKGMVVS  627

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             NEPGYYED+SFGIRIENLL V+ +  PN FGGIGYLGFEKLTFVPIQ+KLVD+S+LS  E
Sbjct  628   NEPGYYEDNSFGIRIENLLLVEVVKLPNCFGGIGYLGFEKLTFVPIQSKLVDVSLLSPME  687

Query  2100  VAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             + WLN YH QVW+K+S L+ G AREWLWNNTRP+
Sbjct  688   INWLNDYHSQVWDKISPLLYGSAREWLWNNTRPL  721



>emb|CDY27774.1| BnaA05g31830D [Brassica napus]
Length=696

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/682 (70%), Positives = 562/682 (82%), Gaps = 19/682 (3%)
 Frame = +3

Query  156   SRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLR  335
             S  PLI   +PR            A C       SS+  AK S E +K       +++L 
Sbjct  31    SSLPLIHRKLPRNHLL-------GARCEA-----SSSFTAKSSKEIRKARAEAVVDEKLT  78

Query  336   ALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWT  515
             ALRQ FS+P + IDAYIIPSQDAHQSEFIA+CY RRA+ISGFTGSAGTAVVTKDKAALWT
Sbjct  79    ALRQQFSKPGVGIDAYIIPSQDAHQSEFIAECYARRAFISGFTGSAGTAVVTKDKAALWT  138

Query  516   DGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKE  695
             DGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+ G R+GIDPFLFS+DAAEELKE
Sbjct  139   DGRYFLQAEKQLNSSWTLMRAGNPGVPTASEWVADVLASGGRVGIDPFLFSADAAEELKE  198

Query  696   DISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINA  875
              I+K NHELV+L N+NLVDEIWK+SRP+PP K IRVHDLKYAG DV+SKL SLR+ +++A
Sbjct  199   AIAKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRVHDLKYAGVDVASKLLSLRNAIMDA  258

Query  876   GSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKS  1055
             G+SAIVISMLDEIAW+LNLRGSDV HSPVMY+YLIVE+D A+LF+DDSK+  EV D+LK+
Sbjct  259   GASAIVISMLDEIAWVLNLRGSDVPHSPVMYSYLIVEVDQAQLFVDDSKVNEEVKDHLKN  318

Query  1056  VGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKS  1235
              G+ELR Y+SIL EI+SLA +GA L +D ST+N AI + YK+AC+ YS  P  K++    
Sbjct  319   AGIELRPYDSILQEIDSLAARGAQLLMDPSTLNVAIISTYKSACENYSSKPESKEKF---  375

Query  1236  TNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICK  1415
                 T+G S +P  +Y  SP+S +KA+KN AEL+GM+N HLRDAAALAHFWAWLEEE+ K
Sbjct  376   ----TDGSSTKPSGIYMQSPISWSKAIKNDAELQGMKNSHLRDAAALAHFWAWLEEEVHK  431

Query  1416  DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFL  1595
             +  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SCS V+  +LFL
Sbjct  432   NENLTEVDVADRLLEFRSVQDGFMDTSFDTISGSGANGAIIHYKPEPESCSRVDPQKLFL  491

Query  1596  LDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFAR  1775
             LDSGAQYVDGTTDITRT HF EPS+REKECFTRVLQGHIALDQAVFPE TPGFVLD FAR
Sbjct  492   LDSGAQYVDGTTDITRTAHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPGFVLDGFAR  551

Query  1776  SSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFG  1955
             SSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPGYYEDH+FG
Sbjct  552   SSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPIQSGMIVSNEPGYYEDHAFG  611

Query  1956  IRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVW  2135
             IRIENLL+VK+ +TPNRFGG  YLGFEKLTF PIQ K+VD+S+LS AE+ WLNSYH +VW
Sbjct  612   IRIENLLHVKDAETPNRFGGATYLGFEKLTFFPIQTKMVDVSLLSHAEIDWLNSYHAEVW  671

Query  2136  EKVSGLVDGRAREWLWNNTRPI  2201
             EKVS L++G  ++WLWNNTRP+
Sbjct  672   EKVSPLLEGPTQQWLWNNTRPL  693



>emb|CDY05161.1| BnaC05g46420D [Brassica napus]
Length=696

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/690 (70%), Positives = 569/690 (82%), Gaps = 20/690 (3%)
 Frame = +3

Query  147   TRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRG  311
             +R+SR P +    SLP I RKL +        A C       SS+  AK S E +K    
Sbjct  19    SRYSRSPFLRNFKSLPLIHRKLPHNHLL---GARCEA-----SSSFTAKSSKEIRKARAE  70

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
                +++L ALRQ FS+P + IDAYIIPSQDAHQSEFIA+CY RRA+ISGFTGSAGTAVVT
Sbjct  71    AVVDEKLTALRQQFSKPGVGIDAYIIPSQDAHQSEFIAECYARRAFISGFTGSAGTAVVT  130

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             KDKAALWTDGRYFLQAEKQL+SSW LMR+GN GV T SEW+  VL+ G R+GIDPFLFS+
Sbjct  131   KDKAALWTDGRYFLQAEKQLNSSWTLMRAGNPGVLTASEWVADVLASGGRVGIDPFLFSA  190

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             DAAEELKE I+K NHELV+L N+NLVDEIWK SRP+PP K IRVHDLKYAG DV+SKL S
Sbjct  191   DAAEELKEAIAKKNHELVYLYNVNLVDEIWKYSRPKPPSKQIRVHDLKYAGVDVASKLSS  250

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMY+YLIVE+D A+LF+DDSK+  
Sbjct  251   LRNAIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYSYLIVEVDQAQLFVDDSKVNE  310

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV D+LK+ G+ELR Y+SIL EI+SLA +GA L +D ST+N AI + YK+ACD+YS  P 
Sbjct  311   EVKDHLKNAGIELRPYDSILQEIDSLAARGAQLLMDPSTLNVAIISTYKSACDKYSSKPE  370

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
              K++        T+G S +P  +Y  SP+S +KA+KN AEL+GM+N HLRDAAALAHFWA
Sbjct  371   SKEKF-------TDGSSTKPSGIYMQSPISWSKAIKNDAELQGMKNSHLRDAAALAHFWA  423

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLEEE+ K+  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SCS 
Sbjct  424   WLEEEVHKNENLTEVDVADRLLEFRSVQDGFMDTSFDTISGSGANGAIIHYKPEPESCSR  483

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             V+  +LFLLDSGAQYVDGTTDITRT HF EPS+REKECFTRVLQGHIALDQAVFPE TPG
Sbjct  484   VDPQKLFLLDSGAQYVDGTTDITRTAHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPG  543

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPG
Sbjct  544   FVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPIQSGMIVSNEPG  603

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYEDHSFGIRIENLL+VK+ +TPNRFGG  YLGFEKLTF PIQ K+VD+S+LS AE+ WL
Sbjct  604   YYEDHSFGIRIENLLHVKDAETPNRFGGATYLGFEKLTFFPIQTKMVDVSLLSHAEIDWL  663

Query  2112  NSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             NSYH +VWEKVS L++G  ++WLWNNTRP+
Sbjct  664   NSYHAEVWEKVSPLLEGPTQQWLWNNTRPL  693



>ref|XP_010485976.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Camelina sativa]
Length=708

 Score =   977 bits (2526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/693 (69%), Positives = 575/693 (83%), Gaps = 10/693 (1%)
 Frame = +3

Query  141   YHTRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKP  305
             + +R+S  P +    SLP I RKL Y    P     C      NSS+  AK S E +K  
Sbjct  17    FTSRYSHSPFLRNFSSLPLINRKLLYK---PPFGVRCHAS-SSNSSSFTAKSSKEIRKAQ  72

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
               +  +++L ++R+LFS P + IDAY+IPSQDAHQSEFIA+CY RRAY+SGFTGSAGTA+
Sbjct  73    TKVVVDEKLTSIRRLFSDPGVGIDAYVIPSQDAHQSEFIAECYARRAYLSGFTGSAGTAI  132

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VTKDKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+PG R+GIDPFLF
Sbjct  133   VTKDKAALWTDGRYFLQAEKQLNSSWSLMRAGNPGVPTASEWVADVLAPGGRVGIDPFLF  192

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S+DAAEELKE I+K NH+LV+L N+NLVDEIWK+SRP+PP K IR+HDLKYAG DV+SKL
Sbjct  193   SADAAEELKEVIAKKNHQLVYLYNVNLVDEIWKDSRPKPPSKQIRIHDLKYAGVDVASKL  252

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
              +LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE+D A LFID SK+
Sbjct  253   LTLRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDQAHLFIDSSKV  312

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
             T EV D+LK+ G+ELR Y+SIL EI+SLA +GA L +D S++N AI + YK+AC+RYSR+
Sbjct  313   TAEVKDHLKNAGIELRPYDSILQEIDSLAARGAQLLMDPSSLNVAIISTYKSACERYSRN  372

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
                ++R K      ++G    P  +Y  SP+S AKA+KN AEL+GM+N HLRDAAALAHF
Sbjct  373   SESEERAKPKFTDSSSGYIANPSGIYMQSPISWAKAIKNDAELQGMKNSHLRDAAALAHF  432

Query  1386  WAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             WAWLEEE+ K+  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SC
Sbjct  433   WAWLEEEVHKNANLTEVDVADRLLEFRSLQDGFMDTSFDTISGSGANGAIIHYKPEPESC  492

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE T
Sbjct  493   SRVDPKKLFLLDSGAQYVDGTTDITRTVHFSEPSTREKECFTRVLQGHIALDQAVFPEGT  552

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNE  1925
             PGFVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNM P+  GM+VSNE
Sbjct  553   PGFVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMNPLQNGMIVSNE  612

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYEDH+FGIRIENLL+V++ +TPNRFGG+ YLGFEKLTF PIQAK+VD+S+LS  E+ 
Sbjct  613   PGYYEDHAFGIRIENLLHVRDAETPNRFGGVTYLGFEKLTFFPIQAKMVDVSLLSDTEID  672

Query  2106  WLNSYHLQVWEKVSGLVDGRA-REWLWNNTRPI  2201
             WLNSYH +VWEKVS L++G + ++WLWNNTRP+
Sbjct  673   WLNSYHAEVWEKVSPLLEGSSTQQWLWNNTRPL  705



>gb|KHG22219.1| putative Xaa-Pro aminopeptidase P [Gossypium arboreum]
Length=699

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/649 (74%), Positives = 551/649 (85%), Gaps = 13/649 (2%)
 Frame = +3

Query  258   SSNIAAKPSSEFQKKPRGLDQED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCY  434
             S ++ AKPS E ++    + + D ++ ALRQLF++P I IDAYIIPSQDAHQSEFIA+CY
Sbjct  60    SGSVTAKPSWELRRNRAAVQEPDEKVDALRQLFTKPGIGIDAYIIPSQDAHQSEFIAECY  119

Query  435   MRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWL  614
             MRRAYISGFTGSAGTA+VTKDKAALWTDGRYFLQAEKQL++SW LMR+GN+GVP  SEWL
Sbjct  120   MRRAYISGFTGSAGTAIVTKDKAALWTDGRYFLQAEKQLNTSWKLMRAGNFGVPQASEWL  179

Query  615   NSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKP  794
             N VL+PG R+            EELKE ISK N ELV+L +LNLVDEIWKESRP+PP KP
Sbjct  180   NDVLAPGGRV------------EELKEVISKKNLELVYLYDLNLVDEIWKESRPKPPNKP  227

Query  795   IRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAY  974
             IRVHDLKYAG DV SKL SLR++L+ AGSSAIVISMLDE+AWLLNLRGSDV HSPVMYAY
Sbjct  228   IRVHDLKYAGIDVVSKLSSLRAELVAAGSSAIVISMLDEVAWLLNLRGSDVPHSPVMYAY  287

Query  975   LIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVN  1154
             LIVE+D AKLF+DDSK+T EVM +LK  GV+LR Y+SILSEI  LA +GA+LWLD S+VN
Sbjct  288   LIVEVDAAKLFVDDSKVTSEVMYHLKKAGVDLRPYDSILSEIRRLAAEGAHLWLDTSSVN  347

Query  1155  AAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAEL  1334
             AAI   YK ACD+Y  + G + + K     +++ L   P  +Y  SPVS+AKA+KN +EL
Sbjct  348   AAIVETYKAACDKYLMNRGSRGKRKNKQYFESDSLPVGPSGVYMQSPVSLAKALKNPSEL  407

Query  1335  EGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
             EGMQN HLRDAAALA FW WLEEEI K+V LTEV++A+KLLEFRSKQ GFLDTSFDTISG
Sbjct  408   EGMQNSHLRDAAALAQFWCWLEEEIHKNVKLTEVDLADKLLEFRSKQDGFLDTSFDTISG  467

Query  1515  SGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTR  1694
             SGANGAIIHY PE +SCS+V+ ++LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTR
Sbjct  468   SGANGAIIHYTPEAESCSVVDPNKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTR  527

Query  1695  VLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISF  1874
             VL+GHIALD+AVFPENTPGFVLDAFARS+LWK+GLDYRHGTGHGVGAALNVHEGPQ ISF
Sbjct  528   VLKGHIALDEAVFPENTPGFVLDAFARSALWKIGLDYRHGTGHGVGAALNVHEGPQSISF  587

Query  1875  RFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVP  2054
             R+GNMTP+  GM+VSNEPGYYEDH+FGIRIENLL V+E++TPNR+GGI YLGFEKLTF P
Sbjct  588   RYGNMTPLQKGMIVSNEPGYYEDHAFGIRIENLLCVQEINTPNRYGGIEYLGFEKLTFFP  647

Query  2055  IQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             IQ KLVDLS+LS  E+ WLNSYH QVWEKVS L++G AR+WLW NTRPI
Sbjct  648   IQTKLVDLSLLSIEEMEWLNSYHSQVWEKVSPLLEGSARQWLWKNTRPI  696



>ref|XP_009396833.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Musa acuminata 
subsp. malaccensis]
Length=739

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/691 (71%), Positives = 565/691 (82%), Gaps = 13/691 (2%)
 Frame = +3

Query  162   FPLISLPIPRKLHYPLKFPSSSANC----RVLIVRNSS--NIAAKPSSEFQKKP-RGLDQ  320
             F L++L +P  L   L+ PS SA      R  +   SS   I A+PSSE +K P  G D+
Sbjct  48    FRLLALSLP--LADELRAPSGSALLLPPRRFCVSARSSGDQIVARPSSEMRKNPFGGCDR  105

Query  321   ---EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
                +++LRALR+LFSRPD+ IDAYIIPSQDAHQSEFIA+C+MRRAYISGFTGSAGTAVVT
Sbjct  106   GTGDEKLRALRELFSRPDVGIDAYIIPSQDAHQSEFIAECFMRRAYISGFTGSAGTAVVT  165

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             K+ AALWTDGRYFLQAEKQLS  WILMRSGN GVPT SEWLN VL+PG RIGIDPFLFSS
Sbjct  166   KENAALWTDGRYFLQAEKQLSRDWILMRSGNHGVPTTSEWLNDVLAPGCRIGIDPFLFSS  225

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             +AAEELK++ISK +HELVFL + NL+D IW ESRP+PP  P RVHD+ YAG DVSSKLFS
Sbjct  226   NAAEELKDEISKKDHELVFLYDYNLIDVIWGESRPKPPINPTRVHDINYAGVDVSSKLFS  285

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LRS+LI AG SAI+ISMLDE+AWLLN+RG+DV +SPV Y+YL+VE++  KLFID++KIT 
Sbjct  286   LRSELIEAGGSAIIISMLDEVAWLLNMRGNDVPNSPVFYSYLLVEMNRVKLFIDNTKITM  345

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV D+L + GVELR YE IL EIE LA  GA LWLD S+VNAAI + +K+AC++++R   
Sbjct  346   EVKDHLTNAGVELRPYEGILPEIERLAASGAKLWLDPSSVNAAIVSIFKSACEKHNRKTR  405

Query  1212  IKKRNKKSTNLDTNGLSGQ-PHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
               ++ +   ++    +  + P  LY+ SPV+MAKAVKN AE+EGM N HLRDAAALA FW
Sbjct  406   KGEKKEVVASIKNQDIQAEGPFGLYKVSPVTMAKAVKNRAEIEGMHNSHLRDAAALAEFW  465

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEEEI K++  TEVEVA+KLLEFR KQ GFLDTSFDTISG GANGAIIHY P  +SCS
Sbjct  466   AWLEEEISKNIAYTEVEVADKLLEFRKKQPGFLDTSFDTISGYGANGAIIHYNPNSESCS  525

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +V    LFLLDSG QYVDGTTDITRTVHFGEPS R+KECFTRVLQGHIA+DQA+FPE TP
Sbjct  526   VVGDKNLFLLDSGGQYVDGTTDITRTVHFGEPSLRQKECFTRVLQGHIAIDQAIFPEGTP  585

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEP  1928
             GFVLD  ARS LWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMT +  GM+VSNEP
Sbjct  586   GFVLDILARSPLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTALQKGMIVSNEP  645

Query  1929  GYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAW  2108
             GYYED+SFGIRIENLL VKE++ PN +GGIGYLGFEKLTFVPIQ KLVDLS+LS AE+ W
Sbjct  646   GYYEDNSFGIRIENLLIVKEVELPNYYGGIGYLGFEKLTFVPIQNKLVDLSLLSHAEINW  705

Query  2109  LNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             LN YH QVWEKVS ++DG AREWLWNNTRPI
Sbjct  706   LNDYHAQVWEKVSPMLDGGAREWLWNNTRPI  736



>ref|XP_010935071.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Elaeis guineensis]
Length=732

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/696 (70%), Positives = 563/696 (81%), Gaps = 12/696 (2%)
 Frame = +3

Query  150   RHSRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNS--SNIAAKPSSEFQKKPRG--LD  317
             R  RF  +SLP   +LH            R  +   S    I A+PSSEF+KK       
Sbjct  34    RGFRFLALSLPFFGELHTQRCVALRPRYLRFSVAARSFGDKIVARPSSEFRKKQSSGSRT  93

Query  318   QEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKD  497
             ++++LRALR LFSRP I IDAYIIPSQDAHQSEFIA+C+MRRAYI+GFTGSAGTAV+TK+
Sbjct  94    EDEKLRALRDLFSRPGIGIDAYIIPSQDAHQSEFIAECFMRRAYITGFTGSAGTAVITKE  153

Query  498   KAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDA  677
             KAALWTDGRYFLQAEKQLS  W LMRSGN GVPT +EWLN VL+PG R+GIDPFLFSSDA
Sbjct  154   KAALWTDGRYFLQAEKQLSCDWKLMRSGNLGVPTTTEWLNDVLAPGCRVGIDPFLFSSDA  213

Query  678   AEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLR  857
             AEELKE ISK NHELVF+ + NLVDEIW ESRP+PP K  RVHD+KYAG DVS+KL SLR
Sbjct  214   AEELKEAISKKNHELVFIYDFNLVDEIWGESRPKPPMKWTRVHDIKYAGVDVSAKLSSLR  273

Query  858   SDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEV  1037
             S+L+  G +AIVISMLDE+AWLLN+RG+DV HSPV Y+YLIVE++ A+LFID +K+T EV
Sbjct  274   SELMETGCTAIVISMLDEVAWLLNMRGNDVPHSPVFYSYLIVEVNSAQLFIDKAKVTMEV  333

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
             MD+LKS G+EL+ YESILSEIESLA +GA LWLD S+VNAA+ + +K+AC+++      K
Sbjct  334   MDHLKSAGIELKPYESILSEIESLAAQGAKLWLDTSSVNAALVSRFKSACNKHLAKFENK  393

Query  1218  KRNK--------KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAA  1373
              R+K         + N   +     P  LY+ SPV +AKAVKN AE++GM++CH RDAAA
Sbjct  394   ARDKVDWETSPDMAPNKHQDARIEGPSGLYKPSPVILAKAVKNKAEIDGMRSCHFRDAAA  453

Query  1374  LAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPE  1553
             LA FWAW+EEEI  +   TEVEVA+KLLEFR KQ GF+DTSFDTISG GANGA+IHYKPE
Sbjct  454   LAEFWAWMEEEIHNNAVPTEVEVADKLLEFRKKQAGFMDTSFDTISGYGANGAVIHYKPE  513

Query  1554  PDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVF  1733
             PDSCS+V+   LFLLDSG QYVDGTTDITRTVHFGEP+ ++KECFTRVLQGHIALDQAVF
Sbjct  514   PDSCSVVDDKNLFLLDSGGQYVDGTTDITRTVHFGEPTPQQKECFTRVLQGHIALDQAVF  573

Query  1734  PENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMV  1913
             PE+TPGFVLD  ARSSLWKVGLDYRHGTGHGVGAALNVHEGPQ ISFR+GNM  +  GMV
Sbjct  574   PEHTPGFVLDVLARSSLWKVGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMAALQKGMV  633

Query  1914  VSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSA  2093
             VSNEPGYYED+SFGIRIENLL+VKE+  PN FGGIGYLGFEKLTFVPIQ+KLVD+S+LS 
Sbjct  634   VSNEPGYYEDNSFGIRIENLLHVKEVKLPNCFGGIGYLGFEKLTFVPIQSKLVDISLLSP  693

Query  2094  AEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
              E+ WLN YH QVW+KVS L+DG AREWLWNNTRP+
Sbjct  694   MEINWLNDYHSQVWDKVSPLLDGSAREWLWNNTRPL  729



>ref|XP_006472019.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like isoform X1 
[Citrus sinensis]
Length=591

 Score =   969 bits (2505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/589 (80%), Positives = 525/589 (89%), Gaps = 1/589 (0%)
 Frame = +3

Query  435   MRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWL  614
             MRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT  EWL
Sbjct  1     MRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTTFEWL  60

Query  615   NSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKP  794
             N VL+PG R+GIDPFLFSSDAAEELKE I+K NHELV+L +LNLVD IWKESRP+PP KP
Sbjct  61    NDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKP  120

Query  795   IRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAY  974
             IRVH LKYAG DV+SKL SLRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPVMYAY
Sbjct  121   IRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAY  180

Query  975   LIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVN  1154
             LIVE+D AKLF+DDSK+TP+VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD S+VN
Sbjct  181   LIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVN  240

Query  1155  AAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAEL  1334
             AAI N Y+ A ++Y  S    K++K   + DT G SG P  ++R+SP++ +KAVKNSAEL
Sbjct  241   AAIMNTYEIAIEKYLTSNN-NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAEL  299

Query  1335  EGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
             EGM N HLRDAAALA FW WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFDTISG
Sbjct  300   EGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISG  359

Query  1515  SGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTR  1694
             SGANGAIIHYKPEP  CS+V+  +LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTR
Sbjct  360   SGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTR  419

Query  1695  VLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISF  1874
             VLQGHIALDQA+FP++TPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISF
Sbjct  420   VLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISF  479

Query  1875  RFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVP  2054
             R+GNMTP+V GM+VSNEPGYYEDH+FGIRIENLLYVKE+ TPNRFGG+ YLGFEKLTFVP
Sbjct  480   RYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVP  539

Query  2055  IQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             IQ KLVDLS+LSAAE+ WLN+YH QVWEKVS L+DG AR+WLWNNTRP+
Sbjct  540   IQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSPLLDGFARQWLWNNTRPV  588



>ref|XP_010464059.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Camelina 
sativa]
Length=709

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/693 (69%), Positives = 573/693 (83%), Gaps = 9/693 (1%)
 Frame = +3

Query  141   YHTRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKP  305
             + +R+S  P +    SLP I RKL  P   P     C      +SS  A   S E +K  
Sbjct  17    FTSRYSHTPFLRNFNSLPLINRKL--PYNKPPFGVRCHASSSSSSSFTAKS-SKEIRKTQ  73

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
               +  +++L ++R+LFS P + IDAYIIPSQDAHQSEFIA+CY RRAYISGFTGSAGTA+
Sbjct  74    TKVVVDEKLTSIRRLFSNPGVGIDAYIIPSQDAHQSEFIAECYARRAYISGFTGSAGTAI  133

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VTKDKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+PG R+GIDPFLF
Sbjct  134   VTKDKAALWTDGRYFLQAEKQLNSSWSLMRAGNPGVPTASEWIADVLAPGGRVGIDPFLF  193

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S+DAAEELKE I+K NHELV+L N+NLVDEIWK+SRP+PP K IR+HDLKYAG DV+SKL
Sbjct  194   SADAAEELKEVIAKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRIHDLKYAGVDVASKL  253

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
              +LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE+D A LF+D+SK+
Sbjct  254   LTLRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDQAHLFVDNSKV  313

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
             T EV D+LK+ G+E+R Y+SIL EI+SLA +GA L +D S++N AI + YK+AC+RY+R+
Sbjct  314   TEEVKDHLKNAGIEIRPYDSILQEIDSLAARGAQLLMDPSSLNVAIISTYKSACERYTRN  373

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
                ++R        ++G    P  +Y  SP+S AKA+KN AEL+GM+N HLRDAAALAHF
Sbjct  374   SESEERANLKFTDSSSGYIANPSGIYMQSPISWAKAIKNDAELQGMKNSHLRDAAALAHF  433

Query  1386  WAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             WAWLEEE+ K+  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SC
Sbjct  434   WAWLEEEVHKNANLTEVDVADRLLEFRSLQDGFMDTSFDTISGSGANGAIIHYKPEPESC  493

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE T
Sbjct  494   SRVDPKKLFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGT  553

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNE  1925
             PGFVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GNMTP+  GM+VSNE
Sbjct  554   PGFVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISYRYGNMTPLQNGMIVSNE  613

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYEDH+FGIRIENLL+V++ +TPNRFGG+ YLGFEKLTF PIQ K+VD+S+LS  E+ 
Sbjct  614   PGYYEDHAFGIRIENLLHVRDAETPNRFGGVTYLGFEKLTFFPIQTKMVDVSLLSDTEID  673

Query  2106  WLNSYHLQVWEKVSGLVDGRA-REWLWNNTRPI  2201
             WLNSYH +VWEKVS L++G + ++WLWNNTRP+
Sbjct  674   WLNSYHEEVWEKVSPLLEGSSTQQWLWNNTRPL  706



>ref|XP_006299176.1| hypothetical protein CARUB_v10015320mg [Capsella rubella]
 gb|EOA32074.1| hypothetical protein CARUB_v10015320mg [Capsella rubella]
Length=708

 Score =   967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/691 (69%), Positives = 572/691 (83%), Gaps = 10/691 (1%)
 Frame = +3

Query  147   TRHSRFPLI----SLPIP-RKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRG  311
             +R+S  P +    SLP+  RKL Y    P     C V    +SS+  AK S E +K    
Sbjct  19    SRYSHSPFLRNFKSLPLSHRKLPY---IPPFGVRCHVS-SSSSSSFTAKSSKEIRKAQTK  74

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +  +++L ++R++FS P + IDAYI+PSQDAHQSEFIA+CY RRAYISGFTGSAGTAVVT
Sbjct  75    VVVDEKLSSIRRVFSDPGVGIDAYIVPSQDAHQSEFIAECYARRAYISGFTGSAGTAVVT  134

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             KDKAALWTDGRYFLQAEKQL+SSWILMR+GN GVP+ SEW+  VL+PG R+GIDPFLFS+
Sbjct  135   KDKAALWTDGRYFLQAEKQLNSSWILMRAGNPGVPSASEWVADVLAPGGRVGIDPFLFSA  194

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             DAAEELKE I+K NHELV+L N+NLVDEIWK+SRP+PP K IR+HDLK+AG DV+SKL S
Sbjct  195   DAAEELKEVIAKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRIHDLKHAGIDVASKLLS  254

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE+D A+LF+++SK+T 
Sbjct  255   LRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDQAQLFVNNSKVTA  314

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV D+LK+ G+E+R Y+SIL EI+SLA +GA L +D ST+N AI + YK+AC+RYSR   
Sbjct  315   EVKDHLKNAGIEVRPYDSILQEIDSLAGRGAQLLMDPSTLNVAIISTYKSACERYSRKSE  374

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
              + + K      ++G       +Y  SP+S AKA+KN AEL+GM+N HLRDAAALAHFWA
Sbjct  375   SEGKPKTKFTDSSSGDIPNSSGIYMQSPISWAKAIKNDAELQGMKNSHLRDAAALAHFWA  434

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLE+E+  +  LTEV+VA++LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SCS 
Sbjct  435   WLEKEVHTNANLTEVDVADRLLEFRSLQDGFMDTSFDTISGSGANGAIIHYKPEPESCSR  494

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE TPG
Sbjct  495   VDPQKLFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPG  554

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPG
Sbjct  555   FVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPG  614

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYEDH+FGIRIENLL+VK+ +TPNRFGG  YLGFEKLTF PIQ K+VD+S+LS  E+ WL
Sbjct  615   YYEDHAFGIRIENLLHVKDAETPNRFGGATYLGFEKLTFFPIQLKMVDVSLLSDTEIEWL  674

Query  2112  NSYHLQVWEKVSGLVDGR-AREWLWNNTRPI  2201
             NSYH +VWEKVS L++G   ++WLWNNTRP+
Sbjct  675   NSYHTEVWEKVSPLLEGSTTQQWLWNNTRPL  705



>ref|XP_010426180.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Camelina 
sativa]
Length=708

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/694 (69%), Positives = 570/694 (82%), Gaps = 10/694 (1%)
 Frame = +3

Query  147   TRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRG  311
             +R+S  P +    SLP I RKL Y    P     C      +SS  A   S E +K    
Sbjct  19    SRYSHTPFLRNFNSLPLINRKLPYK---PPFGVRCHASSSSSSSFTAKS-SKEIRKAQTK  74

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +  +++L ++R+LFS P + IDAYIIPSQDAHQSEFIA+CY RRAY+SGFTGSAGTA+VT
Sbjct  75    VVVDEKLTSIRRLFSDPGVGIDAYIIPSQDAHQSEFIAECYARRAYLSGFTGSAGTAIVT  134

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             KDKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+PG R+GIDPFLFS+
Sbjct  135   KDKAALWTDGRYFLQAEKQLNSSWSLMRAGNPGVPTASEWVADVLAPGGRVGIDPFLFSA  194

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             DAAEELK+ ISK NHELV+L N+NLVDEIWK+SRP+PP K IR+HDLKYAG DV+SKL +
Sbjct  195   DAAEELKKVISKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRIHDLKYAGVDVASKLLT  254

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVEID A LFID+SK+T 
Sbjct  255   LRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEIDQAHLFIDNSKVTA  314

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV D+LK+ G+ELR Y+SIL EI+SLA +GA L +D S++N AI + YK+AC+RYSR+  
Sbjct  315   EVKDHLKNAGIELRPYDSILQEIDSLAARGAQLLMDPSSLNVAIISTYKSACERYSRNSE  374

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
              ++R K      ++G    P  +Y  SP+S AKA+KN AEL+GM+N HLRDAAALAHFWA
Sbjct  375   SEERAKPKFTDSSSGYIANPSGIYMQSPISWAKAIKNDAELQGMKNSHLRDAAALAHFWA  434

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLEEE+ K+  LTEV+VA++LLEFRS Q GF+DTSFDTISGSG NGAIIHYKPE  SCS 
Sbjct  435   WLEEEVHKNANLTEVDVADRLLEFRSLQDGFMDTSFDTISGSGGNGAIIHYKPELKSCSR  494

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE TPG
Sbjct  495   VDPKKLFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPG  554

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPG
Sbjct  555   FVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPG  614

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYEDH+FGIRIENLL+V++ +TPNRFGG+ YLGFEKLTF PIQ K+VD+S+LS  E+ WL
Sbjct  615   YYEDHAFGIRIENLLHVRDAETPNRFGGVTYLGFEKLTFFPIQTKMVDVSLLSDTEIDWL  674

Query  2112  NSYHLQVWEKVSGLVDGR-AREWLWNNTRPIDSS  2210
             NSYH +VWEKVS L++G   ++WLWNNTRP+  S
Sbjct  675   NSYHAEVWEKVSPLLEGSTTQQWLWNNTRPLAKS  708



>ref|XP_002319540.2| hypothetical protein POPTR_0013s02230g [Populus trichocarpa]
 gb|EEE95463.2| hypothetical protein POPTR_0013s02230g [Populus trichocarpa]
Length=673

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/625 (76%), Positives = 548/625 (88%), Gaps = 9/625 (1%)
 Frame = +3

Query  243   LIVRNSSN--IAAKPSSEFQ-KKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQS  413
             +I RN ++  ++AKPSS+ +  + +  + +++L+ALR+LFS+P I IDAYIIPSQDAHQS
Sbjct  52    IITRNCTSPPVSAKPSSQIRWSRAKKSEPDEKLQALRELFSKPGIGIDAYIIPSQDAHQS  111

Query  414   EFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGV  593
             EFIA+CYMRR YISGFTGSAGTAVVTK+KAALWTDGRYFLQAEKQL+S+WILMR+GN GV
Sbjct  112   EFIAECYMRRTYISGFTGSAGTAVVTKEKAALWTDGRYFLQAEKQLNSNWILMRAGNPGV  171

Query  594   PTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESR  773
             PT SEWLN VL+PG+++G+DPFLFS DAAEELKE I+K NH+LV+L N NLVDEIWK SR
Sbjct  172   PTTSEWLNDVLAPGAKVGVDPFLFSFDAAEELKEAIAKKNHKLVYLYNPNLVDEIWKGSR  231

Query  774   PQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRH  953
             P PP KPIR+H+LKYAG DV+SKL  LRS+LI+  SSAI++SMLDEIAWLLNLRG DV H
Sbjct  232   PMPPNKPIRIHELKYAGVDVASKLSFLRSELIDTCSSAIIVSMLDEIAWLLNLRGGDVPH  291

Query  954   SPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLW  1133
             SPVMYAYLIVE+DGAKLF+D+SK+TPEV+++LK+ GVEL+ Y++ILSEIESLA KGA LW
Sbjct  292   SPVMYAYLIVEVDGAKLFVDNSKVTPEVLNHLKNAGVELKPYDTILSEIESLAAKGAELW  351

Query  1134  LDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNL--DTNGLSGQPHALYRSSPVSMA  1307
              D S+VNAAI N YK+ACDR+     I   ++K  NL   +N  S  P  +YR+SP+S+A
Sbjct  352   FDTSSVNAAIVNTYKSACDRHFE---IHASDRKG-NLHNGSNNQSWGPSGVYRASPISLA  407

Query  1308  KAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFL  1487
             KAVKN AELEGM N HLRDAAALA FW WLE EI KDV LTEV+VA+KLLEFRSKQ GF+
Sbjct  408   KAVKNPAELEGMHNSHLRDAAALAEFWVWLEGEIDKDVKLTEVDVADKLLEFRSKQAGFI  467

Query  1488  DTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPS  1667
             DTSFDTISGSGANGAIIHYKPEP+SCS+V+  +LFLLDSGAQYVDGTTDITRTVHFGEP+
Sbjct  468   DTSFDTISGSGANGAIIHYKPEPESCSVVDPKKLFLLDSGAQYVDGTTDITRTVHFGEPT  527

Query  1668  SREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNV  1847
             +REKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNV
Sbjct  528   AREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNV  587

Query  1848  HEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYL  2027
             HEGPQ ISFRFGNMTP+  GM+VSNEPGYYEDH+FGIRIENLL VK++DTPNR+GGI YL
Sbjct  588   HEGPQSISFRFGNMTPLQKGMIVSNEPGYYEDHAFGIRIENLLCVKQVDTPNRYGGIEYL  647

Query  2028  GFEKLTFVPIQAKLVDLSILSAAEV  2102
             GFEKLT+VPIQ KLVDLS+LS AEV
Sbjct  648   GFEKLTYVPIQTKLVDLSLLSVAEV  672



>ref|XP_010025188.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Eucalyptus 
grandis]
Length=598

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/598 (76%), Positives = 529/598 (88%), Gaps = 7/598 (1%)
 Frame = +3

Query  408   QSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNW  587
             +SEFIA+CY RRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAE QL+SSWILMR+GN 
Sbjct  5     RSEFIAECYTRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAENQLNSSWILMRAGNL  64

Query  588   GVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKE  767
             GVPT SEWLN VL+PG RIGIDPFLFSSDAAEELKE I+K NHELV L N+NLVDE+WKE
Sbjct  65    GVPTTSEWLNDVLAPGCRIGIDPFLFSSDAAEELKEAIAKKNHELVLLYNINLVDEVWKE  124

Query  768   SRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDV  947
              RP+PP KP+R+HDLK+AG DV+SKL  LR++ ++AG+SAI+ISMLDE+AWLLNLRG+DV
Sbjct  125   -RPKPPNKPVRIHDLKFAGLDVASKLSFLRAEFVDAGASAIIISMLDEVAWLLNLRGNDV  183

Query  948   RHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGAN  1127
              +SPV+YAYL+V+ + A+LF+D SKITPEVMD+LK+ GVELR Y+ ILSEIE+LA++G N
Sbjct  184   PNSPVVYAYLLVKTETAELFVDSSKITPEVMDHLKNAGVELRPYDKILSEIENLAKQGRN  243

Query  1128  LWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMA  1307
             LWLD S+VNAAI N YK+ACD+Y     + K++K   + D NG S  P  +YR+SP+S+A
Sbjct  244   LWLDTSSVNAAIVNTYKSACDKY-----LNKKSKARVH-DYNGRSAMPSGVYRASPISLA  297

Query  1308  KAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFL  1487
             KAVKN AEL+GM+N HLRDAAALAHFW WLEEEI +   LTEVEVA+KLLEFRSKQ GF+
Sbjct  298   KAVKNDAELQGMRNSHLRDAAALAHFWVWLEEEINRGAKLTEVEVADKLLEFRSKQDGFI  357

Query  1488  DTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPS  1667
             DTSFDTIS SGANGA+IHYKPEP SCS+++  +LFLLDSGAQYVDGTTDITRTVHFGEP+
Sbjct  358   DTSFDTISASGANGAVIHYKPEPGSCSVLDVEKLFLLDSGAQYVDGTTDITRTVHFGEPT  417

Query  1668  SREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNV  1847
              R+KECFTRVLQGH+ALDQAVFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNV
Sbjct  418   PRQKECFTRVLQGHMALDQAVFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNV  477

Query  1848  HEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYL  2027
             HEGPQ ISFR+GN+T +  GMVVSNEPGYYEDH+FGIRIENLL V EM+TPNRFGG+GYL
Sbjct  478   HEGPQSISFRYGNLTSLQKGMVVSNEPGYYEDHAFGIRIENLLSVVEMNTPNRFGGVGYL  537

Query  2028  GFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             GFEKLTFVPIQ K+VD ++LS+AE+ WLN YH QVWEKVS L+DG AR+WLW+NTRP+
Sbjct  538   GFEKLTFVPIQTKMVDSALLSSAEIDWLNDYHAQVWEKVSPLLDGSARQWLWDNTRPL  595



>ref|XP_006838262.1| hypothetical protein AMTR_s00103p00064920 [Amborella trichopoda]
 gb|ERN00831.1| hypothetical protein AMTR_s00103p00064920 [Amborella trichopoda]
Length=743

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/671 (69%), Positives = 552/671 (82%), Gaps = 19/671 (3%)
 Frame = +3

Query  240   VLIVRNSSN------IAAKPSSEFQKK-PRGLDQEDRLRALRQLFSRPDINIDAYIIPSQ  398
             +++ +NS N      I A+PS E +KK    L  + +L ALR+ F +P + +DAYI+PSQ
Sbjct  72    LMVAKNSMNGVSSGVIKARPSYELRKKHSDSLVPDKKLSALREQFCKPGVGVDAYIVPSQ  131

Query  399   DAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRS  578
             D HQSEFIA+C+MRRAYISGFTGSAGTAVVTK+KAALWTDGRYFLQAEKQLSS WILMR+
Sbjct  132   DPHQSEFIAECFMRRAYISGFTGSAGTAVVTKEKAALWTDGRYFLQAEKQLSSDWILMRA  191

Query  579   GNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEI  758
             G  GVP+  EWLN VL PGS+IGIDPFLFSSDAAEELKE +SK ++ELV+LSN NLVDEI
Sbjct  192   GTPGVPSYGEWLNDVLKPGSKIGIDPFLFSSDAAEELKETLSKKSNELVYLSNFNLVDEI  251

Query  759   WKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRG  938
             WKESRP+PP  P RVHD+KYAG D SSKL SLRS+L+ AG++ IVISMLDEIAWLLNLRG
Sbjct  252   WKESRPKPPMNPTRVHDIKYAGVDASSKLSSLRSELVEAGANVIVISMLDEIAWLLNLRG  311

Query  939   SDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEK  1118
              DV HSPV YAYLIVE+DGAKLF++ SK+  EVM +LK  GV L+ Y++++SEIE LAE+
Sbjct  312   DDVPHSPVAYAYLIVEVDGAKLFMEKSKVPNEVMFHLKKSGVTLQPYDALISEIERLAEQ  371

Query  1119  GANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKK------STNLDTNGLSGQ----  1268
              A LWLD S++NAA+ NA+  AC+RY  S G  K+NK+      S  L T   S      
Sbjct  372   DAKLWLDTSSINAAVVNAFSAACNRYYESFG--KKNKRRVAREISVGLQTKEGSTSHIDG  429

Query  1269  PHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAE  1448
             P  +YR+SPV+ AK++KN AELEGM+  HLRDAAAL  FWAWLE+ I K   LTEVE+A+
Sbjct  430   PSVIYRASPVTFAKSIKNHAELEGMRQSHLRDAAALVEFWAWLEDSISKKERLTEVEIAD  489

Query  1449  KLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGT  1628
             +LL FR+KQ GFLD+SFDTISG GANGAIIHYKPEP+SCS+V+  +LFLLDSG QYVDGT
Sbjct  490   RLLAFRAKQDGFLDSSFDTISGYGANGAIIHYKPEPESCSVVDDKQLFLLDSGGQYVDGT  549

Query  1629  TDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYR  1808
             TD+TRTVHFGEP+ ++K+CFTRVLQGHIALDQA+FP+NTPGFVLD FARS LWK+GLDYR
Sbjct  550   TDVTRTVHFGEPTLQQKDCFTRVLQGHIALDQAIFPDNTPGFVLDVFARSFLWKIGLDYR  609

Query  1809  HGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKE  1988
             HGTGHGVGAALNVHEGPQ IS+R+GN+T +  GM+VSNEPGYYEDHSFGIRIENLL V+E
Sbjct  610   HGTGHGVGAALNVHEGPQSISYRYGNLTGLQKGMIVSNEPGYYEDHSFGIRIENLLCVRE  669

Query  1989  MDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRA  2168
             +DTPN FGG+GYLGFE+LT+VPIQAKL+D+S LS  E+ WLN YH QVWEKVS LV+G A
Sbjct  670   VDTPNCFGGMGYLGFERLTYVPIQAKLIDISSLSILEINWLNDYHSQVWEKVSPLVNGAA  729

Query  2169  REWLWNNTRPI  2201
             R+WLW+NT+PI
Sbjct  730   RQWLWDNTQPI  740



>gb|EPS67046.1| hypothetical protein M569_07730, partial [Genlisea aurea]
Length=640

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/631 (74%), Positives = 531/631 (84%), Gaps = 23/631 (4%)
 Frame = +3

Query  258   SSNIAAKPSSEFQKKPRGLDQ-EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCY  434
             S++I AKPSSE +KK     + +D+L ALR+LF R DIN+DAYIIPSQDAHQSEFIA+CY
Sbjct  32    SASIKAKPSSEVRKKKHSSSESDDKLAALRELFLRSDINVDAYIIPSQDAHQSEFIAECY  91

Query  435   MRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWL  614
              RRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQL+SSWILMRSG  GVPT SEWL
Sbjct  92    SRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLTSSWILMRSGTLGVPTTSEWL  151

Query  615   NSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKP  794
             N+VL PGSRIGIDPFLFSSD+AEELKE IS  NHELV+L +LNLVDEIWKESRP+PP   
Sbjct  152   NNVLVPGSRIGIDPFLFSSDSAEELKEAISVKNHELVYLYDLNLVDEIWKESRPKPPSNL  211

Query  795   IRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAY  974
              R+HD+KYAG DV SKL SLRS+L  AGSSAIVIS+LDEIAWLLNLRGSDV HSPV+YAY
Sbjct  212   ARIHDIKYAGVDVPSKLASLRSELKTAGSSAIVISVLDEIAWLLNLRGSDVPHSPVVYAY  271

Query  975   LIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVN  1154
             L+V ++GAKLFIDD KI PEV  +LK+ GVE+RAYE ILSEI SLA +G +LW D S+V+
Sbjct  272   LVVGLEGAKLFIDDIKIGPEVRQHLKNAGVEIRAYEDILSEISSLARRGDSLWFDSSSVS  331

Query  1155  AAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAEL  1334
             AAI N YK+AC                      G++     +Y+SSPVS+ KAVKN AEL
Sbjct  332   AAIVNTYKSAC----------------------GMNSGLTPVYKSSPVSITKAVKNEAEL  369

Query  1335  EGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
             EGM+N HLRDAAALA FWAWLEE+I   + LTEV+VA KL++FRS+Q GFL +SFDTIS 
Sbjct  370   EGMRNAHLRDAAALAQFWAWLEEQISNGIVLTEVDVAAKLVQFRSRQDGFLGSSFDTISA  429

Query  1515  SGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTR  1694
             SGANGAIIHYKPEPDSCSIV   ELFLLDSGAQYVDGTTD+TRTVHFG+P+S +KECFTR
Sbjct  430   SGANGAIIHYKPEPDSCSIVEADELFLLDSGAQYVDGTTDVTRTVHFGQPASWQKECFTR  489

Query  1695  VLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISF  1874
             VL+GHIALD+AVFPEN+PGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISF
Sbjct  490   VLKGHIALDEAVFPENSPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISF  549

Query  1875  RFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVP  2054
             R+GN+TP++ GMVVSNEPGYYEDH+FGIRIENL+YVKE+ T  RFGG  YLGFEKLTFVP
Sbjct  550   RYGNVTPLLKGMVVSNEPGYYEDHAFGIRIENLVYVKEVKTEYRFGGAEYLGFEKLTFVP  609

Query  2055  IQAKLVDLSILSAAEVAWLNSYHLQVWEKVS  2147
             IQ KLVD+S+LS  E+ WLN YH QVW+KV+
Sbjct  610   IQTKLVDVSLLSPMEIDWLNDYHYQVWDKVT  640



>gb|KEH24524.1| Xaa-pro aminopeptidase P [Medicago truncatula]
Length=676

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/642 (72%), Positives = 542/642 (84%), Gaps = 11/642 (2%)
 Frame = +3

Query  153   HSRFPLISL-PIPRKLHYPLKFPSSSANCRVLI-VRN---SSNIAAKPSSEFQK-KPRGL  314
             HS FP ++L PI     +  KF S+  N      +RN   S++I+AKPSS+ +K +    
Sbjct  25    HSSFPTLNLNPI-----FFYKFKSNKHNKPPFFSIRNCTTSNSISAKPSSQLRKNRSSNS  79

Query  315   DQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTK  494
             D + +L ALR+LFS+PD++IDAYIIPSQDAHQSEFIA  Y RR YIS FTGS GTAVVT 
Sbjct  80    DSDPKLTALRRLFSKPDVSIDAYIIPSQDAHQSEFIAQSYARRKYISAFTGSNGTAVVTN  139

Query  495   DKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSD  674
             DKAALWTDGRYFLQAEKQL+S+WILMR+GN GVPT SEWLN VL+PG+R+GIDPFLF+SD
Sbjct  140   DKAALWTDGRYFLQAEKQLNSNWILMRAGNPGVPTTSEWLNEVLAPGARVGIDPFLFTSD  199

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
             AAEELK  ISK NHELV+L N NLVDEIWKE+RP+PP KP+RVH LKYAG DV+SKL SL
Sbjct  200   AAEELKHVISKKNHELVYLYNSNLVDEIWKEARPEPPNKPVRVHGLKYAGLDVASKLSSL  259

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             RS+L+ AGSSAI+++ LDEIAWLLNLRGSD+ HSPV+YAYLIVEIDGAKLFID+SK+T E
Sbjct  260   RSELVQAGSSAIIVTALDEIAWLLNLRGSDIPHSPVVYAYLIVEIDGAKLFIDNSKVTEE  319

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V D+LK   +E+R Y SI+SEIE+LA +G++LWLD S+VNAAI NAYK ACDRY ++   
Sbjct  320   VDDHLKKANIEIRPYNSIVSEIENLAARGSSLWLDTSSVNAAIVNAYKAACDRYYQNYES  379

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
             K + +      +   S  P A+++SSPVS+AKA+KN  EL+GMQ CHLRDAAALA FW W
Sbjct  380   KHKTRSKGFDGSIANSDVPIAVHKSSPVSLAKAIKNETELKGMQECHLRDAAALAQFWDW  439

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+EI  D  LTEVEV++KLLEFRSKQ GFLDTSFDTISGSG NGAIIHYKPEP SCS V
Sbjct  440   LEKEITNDRILTEVEVSDKLLEFRSKQAGFLDTSFDTISGSGPNGAIIHYKPEPGSCSTV  499

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             + ++LFLLDSGAQYVDGTTDITRTVHFG+P++REKECFTRVLQGHIALDQAVFPE+TPGF
Sbjct  500   DANKLFLLDSGAQYVDGTTDITRTVHFGKPTTREKECFTRVLQGHIALDQAVFPEDTPGF  559

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             VLDAFARS LWKVGLDYRHGTGHGVGAALNVHEGPQGIS+R+GN+TP+V GM+VSNEPGY
Sbjct  560   VLDAFARSFLWKVGLDYRHGTGHGVGAALNVHEGPQGISYRYGNLTPLVNGMIVSNEPGY  619

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQ  2060
             YEDH+FGIRIENLLYV+ ++TPNRFGGI YLGFEKLT+VPIQ
Sbjct  620   YEDHAFGIRIENLLYVRNVETPNRFGGIQYLGFEKLTYVPIQ  661



>gb|ACN39937.1| unknown [Picea sitchensis]
 gb|ACN40060.1| unknown [Picea sitchensis]
Length=738

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/679 (68%), Positives = 548/679 (81%), Gaps = 13/679 (2%)
 Frame = +3

Query  207   LKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYI  386
             L+F + S N       +   + A+PSS   +  +    + +L ALRQLF +  + IDAYI
Sbjct  63    LRFTARSMNAG----SSEGAVLARPSSPGGRNKQKESVDGKLSALRQLFDKARVKIDAYI  118

Query  387   IPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWI  566
             IPSQD HQSEFIA+C+MRR +ISGFTGSAGTAVVT+DKAALWTDGRYFLQAE QL   WI
Sbjct  119   IPSQDPHQSEFIAECFMRRVFISGFTGSAGTAVVTEDKAALWTDGRYFLQAENQLGPDWI  178

Query  567   LMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNL  746
             LMR+G  GVPT SEWL  VLS GS +GIDPFLFSSDAAEELK+ +S+ +H+LV++ + NL
Sbjct  179   LMRAGTAGVPTISEWLTDVLSSGSNVGIDPFLFSSDAAEELKQTLSRKDHKLVYIYDGNL  238

Query  747   VDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLL  926
             VDEIWK+ RP+ P  P+RVHD+KYAG+DVSSKL SLRS+LI AG++AIVISMLDE+AWLL
Sbjct  239   VDEIWKDERPKSPTAPVRVHDMKYAGSDVSSKLSSLRSNLIEAGANAIVISMLDEVAWLL  298

Query  927   NLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseies  1106
             NLRG+DV HSPV YAYLIVE+D A LFID+ KITP VM +L S  V ++ YE++LS+I  
Sbjct  299   NLRGNDVPHSPVAYAYLIVELDLATLFIDNLKITPGVMAHLTSSNVVVKPYETLLSQITR  358

Query  1107  lAEKGANLWLDKSTVNAAITNAYKTAC-DRYSR-SPGIKKRNKKSTNL---DTNGLSGQ-  1268
             LAE GA L LD S+++ AI NA+ +A  D Y R +   K+++ K +N+   + N L  + 
Sbjct  359   LAENGAKLLLDTSSISVAIVNAFNSASNDYYERLTKQSKRKSTKDSNMKLQEGNSLDIEM  418

Query  1269  --PHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKD-VGLTEVE  1439
               P A++RSSPV+ AKA+KN AEL+GM+  HLRDAAALA FW+WLE ++  + V LTEVE
Sbjct  419   EGPVAIHRSSPVAHAKAIKNEAELDGMRQAHLRDAAALAEFWSWLETKVVHEKVLLTEVE  478

Query  1440  VAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYV  1619
             VAEKLLE R+KQ GFLDTSFDTISGSGANGAIIHY+ EPD+C+IV+   LFLLDSG QYV
Sbjct  479   VAEKLLEIRAKQAGFLDTSFDTISGSGANGAIIHYRAEPDTCNIVDDKNLFLLDSGGQYV  538

Query  1620  DGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGL  1799
             DGTTDITRTVHFGEP+SR++ECFTRVLQGHIALDQA FPENTPGFVLD  ARSSLWK+GL
Sbjct  539   DGTTDITRTVHFGEPTSRQRECFTRVLQGHIALDQARFPENTPGFVLDVLARSSLWKIGL  598

Query  1800  DYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLY  1979
             DYRHGTGHGVGAALNVHEGPQGIS+R+ N T +  GM+VSNEPGYYED SFGIRIENLL 
Sbjct  599   DYRHGTGHGVGAALNVHEGPQGISYRYENTTGLQGGMIVSNEPGYYEDRSFGIRIENLLV  658

Query  1980  VKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVD  2159
             V+E++TPNRFGGI YLGFEKLTFVPIQ+KL+DLS++SAAE+ WLN YHL+VWEKVS LVD
Sbjct  659   VREVETPNRFGGITYLGFEKLTFVPIQSKLLDLSLVSAAEIEWLNDYHLEVWEKVSPLVD  718

Query  2160  GRAREWLWNNTRPIDSSPT  2216
             G AREWLW NTRP+    T
Sbjct  719   GDAREWLWKNTRPVSKHCT  737



>ref|XP_003557401.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Brachypodium 
distachyon]
Length=704

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/652 (68%), Positives = 530/652 (81%), Gaps = 9/652 (1%)
 Frame = +3

Query  273   AKPSSEFQKK---PRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRR  443
             A PSSE +K+        ++ +L A+R+LF RPDI IDAYI+PSQDAHQSEFIA+C+MRR
Sbjct  53    ALPSSELRKRRSSASATGEDSKLGAIRRLFVRPDIAIDAYIVPSQDAHQSEFIAECFMRR  112

Query  444   AYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSV  623
              Y++GFTGSAGTAVVTK+ AA WTDGRYFLQAEK+LS  W LMRSGN GVPT  EWLN V
Sbjct  113   TYLTGFTGSAGTAVVTKNNAAFWTDGRYFLQAEKELSHEWTLMRSGNHGVPTTIEWLNDV  172

Query  624   LSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRV  803
             L  G RIGIDPFLFS DAAEELK+ I+  NHEL+ +S+ NLVDEIW ESRP+PPK+P+RV
Sbjct  173   LPSGCRIGIDPFLFSFDAAEELKDAIANKNHELIMISDFNLVDEIWGESRPEPPKEPVRV  232

Query  804   HDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIV  983
             HD+KYAG DV SKL  +RS+L   G  ++VISMLDEIAWLLN+RGSDV HSPV Y+YLIV
Sbjct  233   HDIKYAGIDVPSKLSYVRSELAENGCESVVISMLDEIAWLLNMRGSDVPHSPVFYSYLIV  292

Query  984   EIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAI  1163
             E+  A LF+D +K++ +V+++L+  GV L+ Y +ILS +E LAEKGA LWLD S+VNAAI
Sbjct  293   EMSTATLFVDRNKVSEDVLEHLEKAGVTLKPYNAILSSVERLAEKGAKLWLDSSSVNAAI  352

Query  1164  TNAYKTACDRYSRSPGIKKRN-KKSTNLD-----TNGLSGQPHALYRSSPVSMAKAVKNS  1325
              + ++++CDRY +  G   R   K T+ D     ++  +G  + LY+ SPV++AK++KN+
Sbjct  353   ASVFRSSCDRYRKKTGKTGRQIGKDTSSDELTSKSHVQNGALNGLYKVSPVTLAKSIKNN  412

Query  1326  AELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDT  1505
             AE+ GM+N HLRDAAALA FW WLEEE+ K V LTEV+VAEKLLEFR KQ GF++TSFDT
Sbjct  413   AEIRGMKNSHLRDAAALAEFWCWLEEEVRKTVALTEVQVAEKLLEFRQKQDGFIETSFDT  472

Query  1506  ISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKEC  1685
             ISG GANGAIIHY+P PDSCS V    LFLLDSGAQY+DGTTDITRTVHFGEPS R+KEC
Sbjct  473   ISGYGANGAIIHYRPTPDSCSSVGSDNLFLLDSGAQYIDGTTDITRTVHFGEPSQRQKEC  532

Query  1686  FTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQG  1865
             FTRVLQGHIALDQAVFPE TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ 
Sbjct  533   FTRVLQGHIALDQAVFPERTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQS  592

Query  1866  ISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLT  2045
             IS+R+GN+T +  GM+VSNEPGYYED+SFGIRIENL+ VKE++  N FGGI YLGFEKLT
Sbjct  593   ISYRYGNLTALQKGMIVSNEPGYYEDNSFGIRIENLVLVKEVNLANSFGGISYLGFEKLT  652

Query  2046  FVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             FVPIQ+ L+DLS+LS +E+ W+N YH QVWEKVS ++ G  R+WLW NTRP+
Sbjct  653   FVPIQSNLIDLSLLSPSEINWVNEYHEQVWEKVSPMLSGDPRDWLWKNTRPL  704



>ref|NP_001168142.1| uncharacterized protein LOC100381889 [Zea mays]
 gb|ACN27220.1| unknown [Zea mays]
Length=714

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/704 (65%), Positives = 550/704 (78%), Gaps = 34/704 (5%)
 Frame = +3

Query  156   SRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSN----IAAKPSSEFQKKPRGLDQE  323
             SR PL   P   +  +PL         RVL   NSS     + A  SSE +K+ RGL   
Sbjct  20    SRPPLALRPFSLRRRFPL--------LRVLA--NSSGGDGRVVALSSSELRKR-RGLSSS  68

Query  324   -----------DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGS  470
                        ++LR+LR+LF+RPD+ IDAYI+PSQDAHQSEFIA+C+ RRAY++GFTGS
Sbjct  69    SGAADSASDGDEKLRSLRRLFARPDVAIDAYIVPSQDAHQSEFIAECFTRRAYLTGFTGS  128

Query  471   AGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGI  650
             AGTAVVTK+KAALWTDGRYFLQAEK+LS  W LMRSGN GVPT SEWLN VL  G R+GI
Sbjct  129   AGTAVVTKNKAALWTDGRYFLQAEKELSHHWTLMRSGNHGVPTTSEWLNDVLPSGCRVGI  188

Query  651   DPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGAD  830
             DPFLFS DAAEELK+ I+  NHELV +  +NLVDEIW ++RP PPK+P RVHD+KYAG D
Sbjct  189   DPFLFSFDAAEELKDSIANKNHELVLVQGMNLVDEIWGDARPNPPKEPTRVHDIKYAGID  248

Query  831   VSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFI  1010
             V SKL  +RS L   G  A+VISMLDE+AWLLN+RGSDV HSPV Y+YLIVE+  A LF+
Sbjct  249   VPSKLSFIRSQLAENGCDAVVISMLDEVAWLLNMRGSDVPHSPVFYSYLIVEVSTATLFV  308

Query  1011  DDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACD  1190
             D+SK++ +V+++L+  GV+L+ YE+I+SE+E LAEKGA LWLD S+VNAAI  A+K++CD
Sbjct  309   DNSKVSKDVLEHLEQAGVKLKPYEAIISEVERLAEKGAKLWLDSSSVNAAIITAFKSSCD  368

Query  1191  RYSRSPGIKKRNKKSTNLDTNGLSGQPH-------ALYRSSPVSMAKAVKNSAELEGMQN  1349
                +    ++  +K  +   + ++G P        A+Y  SPV++AK+VKN AE+EGM+N
Sbjct  369   MKKKGKAGEEVGEKEAS-SNDRITGDPSVHNGVISAVYNVSPVALAKSVKNDAEIEGMKN  427

Query  1350  CHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANG  1529
              HLRDAAALA FW WLEEEICK V LTEV++AEKLLEFR KQ GF++TSFDTISG GANG
Sbjct  428   SHLRDAAALAEFWCWLEEEICKSVPLTEVQIAEKLLEFRQKQDGFIETSFDTISGYGANG  487

Query  1530  AIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGH  1709
             AIIHY+P P+SCS V    LFLLDSGAQY+DGTTDITRTVHFGE S R+KECFTRVLQGH
Sbjct  488   AIIHYRPTPESCSSVGSDNLFLLDSGAQYIDGTTDITRTVHFGEASPRQKECFTRVLQGH  547

Query  1710  IALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM  1889
             IALDQAVFPE TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GN+
Sbjct  548   IALDQAVFPERTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISYRYGNL  607

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
             T +  GM+VSNEPGYYED+SFGIRIENLL VKE++  N FGGI YLGFEKLTFVPIQ+KL
Sbjct  608   TALQKGMIVSNEPGYYEDNSFGIRIENLLLVKELNLANSFGGISYLGFEKLTFVPIQSKL  667

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             ++ S++S +E+ W+N YH +VWEKVS L+ G +R+WLW NTRP+
Sbjct  668   IESSLMSPSEINWVNDYHEEVWEKVSPLLSGHSRDWLWKNTRPL  711



>tpg|DAA59962.1| TPA: hypothetical protein ZEAMMB73_367051 [Zea mays]
Length=741

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/704 (64%), Positives = 550/704 (78%), Gaps = 34/704 (5%)
 Frame = +3

Query  156   SRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSN----IAAKPSSEFQKKPRGLDQE  323
             SR PL   P   +  +PL          + ++ NSS     + A  SSE +K+ RGL   
Sbjct  47    SRPPLALRPFSLRRRFPL----------LRVLANSSGGDGRVVALSSSELRKR-RGLSSS  95

Query  324   -----------DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGS  470
                        ++LR+LR+LF+RPD+ IDAYI+PSQDAHQSEFIA+C+ RRAY++GFTGS
Sbjct  96    SGAADSASDGDEKLRSLRRLFARPDVAIDAYIVPSQDAHQSEFIAECFTRRAYLTGFTGS  155

Query  471   AGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGI  650
             AGTAVVTK+KAALWTDGRYFLQAEK+LS  W LMRSGN GVPT SEWLN VL  G R+GI
Sbjct  156   AGTAVVTKNKAALWTDGRYFLQAEKELSHHWTLMRSGNHGVPTTSEWLNDVLPSGCRVGI  215

Query  651   DPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGAD  830
             DPFLFS DAAEELK+ I+  NHELV +  +NLVDEIW ++RP PPK+P RVHD+KYAG D
Sbjct  216   DPFLFSFDAAEELKDSIANKNHELVLVQGMNLVDEIWGDARPNPPKEPTRVHDIKYAGID  275

Query  831   VSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFI  1010
             V SKL  +RS L   G  A+VISMLDE+AWLLN+RGSDV HSPV Y+YLIVE+  A LF+
Sbjct  276   VPSKLSFIRSQLAENGCDAVVISMLDEVAWLLNMRGSDVPHSPVFYSYLIVEVSTATLFV  335

Query  1011  DDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACD  1190
             D+SK++ +V+++L+  GV+L+ YE+I+SE+E LAEKGA LWLD S+VNAAI  A+K++CD
Sbjct  336   DNSKVSKDVLEHLEQAGVKLKPYEAIISEVERLAEKGAKLWLDSSSVNAAIITAFKSSCD  395

Query  1191  RYSRSPGIKKRNKKSTNLDTNGLSGQPH-------ALYRSSPVSMAKAVKNSAELEGMQN  1349
                +    ++  +K  +   + ++G P        A+Y  SPV++AK+VKN AE+EGM+N
Sbjct  396   MKKKGKAGEEVGEKEAS-SNDRITGDPSVHNGVISAVYNVSPVALAKSVKNDAEIEGMKN  454

Query  1350  CHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANG  1529
              HLRDAAALA FW WLEEEICK V LTEV++AEKLLEFR KQ GF++TSFDTISG GANG
Sbjct  455   SHLRDAAALAEFWCWLEEEICKSVPLTEVQIAEKLLEFRQKQDGFIETSFDTISGYGANG  514

Query  1530  AIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGH  1709
             AIIHY+P P+SCS V    LFLLDSGAQY+DGTTDITRTVHFGE S R+KECFTRVLQGH
Sbjct  515   AIIHYRPTPESCSSVGSDNLFLLDSGAQYIDGTTDITRTVHFGEASPRQKECFTRVLQGH  574

Query  1710  IALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM  1889
             IALDQAVFPE TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GN+
Sbjct  575   IALDQAVFPERTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISYRYGNL  634

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
             T +  GM+VSNEPGYYED+SFGIRIENLL VKE++  N FGGI YLGFEKLTFVPIQ+KL
Sbjct  635   TALQKGMIVSNEPGYYEDNSFGIRIENLLLVKELNLANSFGGISYLGFEKLTFVPIQSKL  694

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             ++ S++S +E+ W+N YH +VWEKVS L+ G +R+WLW NTRP+
Sbjct  695   IESSLMSPSEINWVNDYHEEVWEKVSPLLSGHSRDWLWKNTRPL  738



>ref|XP_002461663.1| hypothetical protein SORBIDRAFT_02g006140 [Sorghum bicolor]
 gb|EER98184.1| hypothetical protein SORBIDRAFT_02g006140 [Sorghum bicolor]
Length=719

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/666 (66%), Positives = 534/666 (80%), Gaps = 22/666 (3%)
 Frame = +3

Query  267   IAAKPSSEFQKKPRGLDQE-------------DRLRALRQLFSRPDINIDAYIIPSQDAH  407
             + A  SSE +K+ RGL                ++LR+LR+LF+RPD+ IDAYI+PSQDAH
Sbjct  52    VVALSSSELRKR-RGLSSSSSGAAADSASDGDEKLRSLRRLFARPDVAIDAYIVPSQDAH  110

Query  408   QSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNW  587
             QSEFIA+C+ RRAY++GFTGSAGTAVVTK+KAALWTDGRYFLQAEK+L+  W LMRSGN 
Sbjct  111   QSEFIAECFTRRAYLTGFTGSAGTAVVTKNKAALWTDGRYFLQAEKELNHHWTLMRSGNH  170

Query  588   GVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKE  767
             GVPT SEWLN VL  G R+GIDPFLFS DAAEELK+ I+  NHELV + ++NLVDEIW +
Sbjct  171   GVPTTSEWLNDVLPSGCRVGIDPFLFSFDAAEELKDSIANKNHELVLVQDMNLVDEIWGD  230

Query  768   SRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDV  947
             +RP PPK+P RVHD+KYAG DV SKL  +RS L   G  A+VISMLDE+AWLLN+RGSDV
Sbjct  231   ARPNPPKEPTRVHDIKYAGIDVPSKLSFIRSQLAENGCDAVVISMLDEVAWLLNMRGSDV  290

Query  948   RHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGAN  1127
              HSPV Y+YLIVE++ A LF+D SK++  V+++L+  GV+L+ YE+I+SE+  LAEKGA 
Sbjct  291   PHSPVFYSYLIVEVNTATLFVDSSKVSKGVLEHLEQAGVKLKPYEAIISEVGRLAEKGAK  350

Query  1128  LWLDKSTVNAAITNAYKTACDR-----YSRSPGIKKRNKKSTNL---DTNGLSGQPHALY  1283
             LWLD S+VNAAI  A+K++CDR           ++++   S +    D    +G   A+Y
Sbjct  351   LWLDSSSVNAAIITAFKSSCDRCMKKKGKTGKKVEEKEASSDDPIIGDPGVQNGVISAVY  410

Query  1284  RSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEF  1463
               SPV++AK+VKN AE+EGM++ HLRDAAALA FW WLEEEICK+V LTEV++AEKLLEF
Sbjct  411   NVSPVALAKSVKNDAEIEGMKSSHLRDAAALAEFWCWLEEEICKNVPLTEVQIAEKLLEF  470

Query  1464  RSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITR  1643
             R KQ GF++TSFDTISG GANGAIIHY+P P+SCS V    LFLLDSGAQY+DGTTDITR
Sbjct  471   RQKQAGFIETSFDTISGYGANGAIIHYRPTPESCSSVGTDNLFLLDSGAQYIDGTTDITR  530

Query  1644  TVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGH  1823
             TVHFGEPS R+KECFTRVLQGHIALDQAVFPE TPGFVLD  ARSSLWK+GLDYRHGTGH
Sbjct  531   TVHFGEPSRRQKECFTRVLQGHIALDQAVFPERTPGFVLDVLARSSLWKIGLDYRHGTGH  590

Query  1824  GVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPN  2003
             GVGAALNVHEGPQ IS+R+GN+T +  GM+VSNEPGYYED+SFGIRIENLL VKE++  N
Sbjct  591   GVGAALNVHEGPQSISYRYGNLTSLQKGMIVSNEPGYYEDNSFGIRIENLLLVKELNLAN  650

Query  2004  RFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLW  2183
              FGGI YLGFEKLTF PIQ+KL++ S+LS +E+ W+N YH +VWEKVS L+ G +R+WLW
Sbjct  651   SFGGISYLGFEKLTFAPIQSKLIESSLLSPSEINWVNDYHEEVWEKVSPLLSGHSRDWLW  710

Query  2184  NNTRPI  2201
              NTRP+
Sbjct  711   KNTRPL  716



>ref|XP_010464060.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Camelina 
sativa]
Length=679

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/693 (66%), Positives = 546/693 (79%), Gaps = 39/693 (6%)
 Frame = +3

Query  141   YHTRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKP  305
             + +R+S  P +    SLP I RKL  P   P     C      +SS  A   S E +K  
Sbjct  17    FTSRYSHTPFLRNFNSLPLINRKL--PYNKPPFGVRCHASSSSSSSFTAKS-SKEIRKTQ  73

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
               +  +++L ++R+LFS P + IDAYIIPSQDAHQSEFIA+CY RRAYISGFTGSAGTA+
Sbjct  74    TKVVVDEKLTSIRRLFSNPGVGIDAYIIPSQDAHQSEFIAECYARRAYISGFTGSAGTAI  133

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VTKDKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+PG R+GIDPFLF
Sbjct  134   VTKDKAALWTDGRYFLQAEKQLNSSWSLMRAGNPGVPTASEWIADVLAPGGRVGIDPFLF  193

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S+DAAEELKE I+K NHELV+L N+NLVDEIWK+SRP+PP K IR+HDLKYAG DV+SKL
Sbjct  194   SADAAEELKEVIAKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRIHDLKYAGVDVASKL  253

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
              +LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVE+D A LF+D+SK+
Sbjct  254   LTLRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDQAHLFVDNSKV  313

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
             T EV D+LK+ G+E+R Y+SIL EI+SLA +GA L +D S++N AI + YK+AC+RY+R+
Sbjct  314   TEEVKDHLKNAGIEIRPYDSILQEIDSLAARGAQLLMDPSSLNVAIISTYKSACERYTRN  373

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
                ++R        ++G    P  +Y  SP+S AKA+KN AEL+GM+N HLR        
Sbjct  374   SESEERANLKFTDSSSGYIANPSGIYMQSPISWAKAIKNDAELQGMKNSHLR--------  425

Query  1386  WAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
                                   LLEFRS Q GF+DTSFDTISGSGANGAIIHYKPEP+SC
Sbjct  426   ----------------------LLEFRSLQDGFMDTSFDTISGSGANGAIIHYKPEPESC  463

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE T
Sbjct  464   SRVDPKKLFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGT  523

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNE  1925
             PGFVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GNMTP+  GM+VSNE
Sbjct  524   PGFVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISYRYGNMTPLQNGMIVSNE  583

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYEDH+FGIRIENLL+V++ +TPNRFGG+ YLGFEKLTF PIQ K+VD+S+LS  E+ 
Sbjct  584   PGYYEDHAFGIRIENLLHVRDAETPNRFGGVTYLGFEKLTFFPIQTKMVDVSLLSDTEID  643

Query  2106  WLNSYHLQVWEKVSGLVDGRA-REWLWNNTRPI  2201
             WLNSYH +VWEKVS L++G + ++WLWNNTRP+
Sbjct  644   WLNSYHEEVWEKVSPLLEGSSTQQWLWNNTRPL  676



>ref|XP_010426246.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Camelina 
sativa]
Length=678

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/694 (66%), Positives = 543/694 (78%), Gaps = 40/694 (6%)
 Frame = +3

Query  147   TRHSRFPLI----SLP-IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRG  311
             +R+S  P +    SLP I RKL Y    P     C      +SS  A   S E +K    
Sbjct  19    SRYSHTPFLRNFNSLPLINRKLPYK---PPFGVRCHASSSSSSSFTAKS-SKEIRKAQTK  74

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +  +++L ++R+LFS P + IDAYIIPSQDAHQSEFIA+CY RRAY+SGFTGSAGTA+VT
Sbjct  75    VVVDEKLTSIRRLFSDPGVGIDAYIIPSQDAHQSEFIAECYARRAYLSGFTGSAGTAIVT  134

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             KDKAALWTDGRYFLQAEKQL+SSW LMR+GN GVPT SEW+  VL+PG R+GIDPFLFS+
Sbjct  135   KDKAALWTDGRYFLQAEKQLNSSWSLMRAGNPGVPTASEWVADVLAPGGRVGIDPFLFSA  194

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             DAAEELK+ ISK NHELV+L N+NLVDEIWK+SRP+PP K IR+HDLKYAG DV+SKL +
Sbjct  195   DAAEELKKVISKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRIHDLKYAGVDVASKLLT  254

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR+ +++AG+SAIVISMLDEIAW+LNLRGSDV HSPVMYAYLIVEID A LFID+SK+T 
Sbjct  255   LRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEIDQAHLFIDNSKVTA  314

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV D+LK+ G+ELR Y+SIL EI+SLA +GA L +D S++N AI + YK+AC+RYSR+  
Sbjct  315   EVKDHLKNAGIELRPYDSILQEIDSLAARGAQLLMDPSSLNVAIISTYKSACERYSRNSE  374

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
              ++R K      ++G    P  +Y  SP+S AKA+KN AEL+GM+N HLR          
Sbjct  375   SEERAKPKFTDSSSGYIANPSGIYMQSPISWAKAIKNDAELQGMKNSHLR----------  424

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
                                 LLEFRS Q GF+DTSFDTISGSG NGAIIHYKPE  SCS 
Sbjct  425   --------------------LLEFRSLQDGFMDTSFDTISGSGGNGAIIHYKPELKSCSR  464

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             V+  +LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE TPG
Sbjct  465   VDPKKLFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPG  524

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLD FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPG
Sbjct  525   FVLDGFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPG  584

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYEDH+FGIRIENLL+V++ +TPNRFGG+ YLGFEKLTF PIQ K+VD+S+LS  E+ WL
Sbjct  585   YYEDHAFGIRIENLLHVRDAETPNRFGGVTYLGFEKLTFFPIQTKMVDVSLLSDTEIDWL  644

Query  2112  NSYHLQVWEKVSGLVDGR-AREWLWNNTRPIDSS  2210
             NSYH +VWEKVS L++G   ++WLWNNTRP+  S
Sbjct  645   NSYHAEVWEKVSPLLEGSTTQQWLWNNTRPLAKS  678



>ref|XP_008651630.1| PREDICTED: uncharacterized protein LOC100381889 isoform X1 [Zea 
mays]
Length=769

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/732 (61%), Positives = 546/732 (75%), Gaps = 62/732 (8%)
 Frame = +3

Query  156   SRFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNSSN----IAAKPSSEFQKKPRGLDQE  323
             SR PL   P   +  +PL          + ++ NSS     + A  SSE +K+ RGL   
Sbjct  47    SRPPLALRPFSLRRRFPL----------LRVLANSSGGDGRVVALSSSELRKR-RGLSSS  95

Query  324   -----------DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGS  470
                        ++LR+LR+LF+RPD+ IDAYI+PSQDAHQSEFIA+C+ RRAY++GFTGS
Sbjct  96    SGAADSASDGDEKLRSLRRLFARPDVAIDAYIVPSQDAHQSEFIAECFTRRAYLTGFTGS  155

Query  471   AGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGI  650
             AGTAVVTK+KAALWTDGRYFLQAEK+LS  W LMRSGN GVPT SEWLN VL  G R+GI
Sbjct  156   AGTAVVTKNKAALWTDGRYFLQAEKELSHHWTLMRSGNHGVPTTSEWLNDVLPSGCRVGI  215

Query  651   DPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGAD  830
             DPFLFS DAAEELK+ I+  NHELV +  +NLVDEIW ++RP PPK+P RVHD+KYAG D
Sbjct  216   DPFLFSFDAAEELKDSIANKNHELVLVQGMNLVDEIWGDARPNPPKEPTRVHDIKYAGID  275

Query  831   VSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFI  1010
             V SKL  +RS L   G  A+VISMLDE+AWLLN+RGSDV HSPV Y+YLIVE+  A LF+
Sbjct  276   VPSKLSFIRSQLAENGCDAVVISMLDEVAWLLNMRGSDVPHSPVFYSYLIVEVSTATLFV  335

Query  1011  DDSKITPEVMDYLKSVGVELRAYes----------------------------ilseies  1106
             D+SK++ +V+++L+  GV+L+ YE+                             L  +  
Sbjct  336   DNSKVSKDVLEHLEQAGVKLKPYEAIISEVERKKILRQFNRENIIFAMLLLIKTLIALSR  395

Query  1107  lAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPH----  1274
             LAEKGA LWLD S+VNAAI  A+K++CD   +    ++  +K  +   + ++G P     
Sbjct  396   LAEKGAKLWLDSSSVNAAIITAFKSSCDMKKKGKAGEEVGEKEAS-SNDRITGDPSVHNG  454

Query  1275  ---ALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVA  1445
                A+Y  SPV++AK+VKN AE+EGM+N HLRDAAALA FW WLEEEICK V LTEV++A
Sbjct  455   VISAVYNVSPVALAKSVKNDAEIEGMKNSHLRDAAALAEFWCWLEEEICKSVPLTEVQIA  514

Query  1446  EKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDG  1625
             EKLLEFR KQ GF++TSFDTISG GANGAIIHY+P P+SCS V    LFLLDSGAQY+DG
Sbjct  515   EKLLEFRQKQDGFIETSFDTISGYGANGAIIHYRPTPESCSSVGSDNLFLLDSGAQYIDG  574

Query  1626  TTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDY  1805
             TTDITRTVHFGE S R+KECFTRVLQGHIALDQAVFPE TPGFVLD  ARSSLWK+GLDY
Sbjct  575   TTDITRTVHFGEASPRQKECFTRVLQGHIALDQAVFPERTPGFVLDVLARSSLWKIGLDY  634

Query  1806  RHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVK  1985
             RHGTGHGVGAALNVHEGPQ IS+R+GN+T +  GM+VSNEPGYYED+SFGIRIENLL VK
Sbjct  635   RHGTGHGVGAALNVHEGPQSISYRYGNLTALQKGMIVSNEPGYYEDNSFGIRIENLLLVK  694

Query  1986  EMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGR  2165
             E++  N FGGI YLGFEKLTFVPIQ+KL++ S++S +E+ W+N YH +VWEKVS L+ G 
Sbjct  695   ELNLANSFGGISYLGFEKLTFVPIQSKLIESSLMSPSEINWVNDYHEEVWEKVSPLLSGH  754

Query  2166  AREWLWNNTRPI  2201
             +R+WLW NTRP+
Sbjct  755   SRDWLWKNTRPL  766



>gb|EYU37529.1| hypothetical protein MIMGU_mgv1a019508mg, partial [Erythranthe 
guttata]
Length=560

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/574 (75%), Positives = 493/574 (86%), Gaps = 18/574 (3%)
 Frame = +3

Query  483   VVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFL  662
             VVTKDKAALWTDGRYFLQAE+QL+S W LMR+GN GVP+ SEWLN V++PGSRIGIDPFL
Sbjct  1     VVTKDKAALWTDGRYFLQAEQQLTSGWSLMRAGNLGVPSRSEWLNGVMAPGSRIGIDPFL  60

Query  663   FSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSK  842
             FSSDAAEELKE IS+ NHELV+L ++NLVDEIWKESRP+PP K +RVH++KYAG DVSSK
Sbjct  61    FSSDAAEELKEAISQKNHELVYLYDINLVDEIWKESRPKPPNKHVRVHEMKYAGVDVSSK  120

Query  843   LFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSK  1022
             L SLRS+L NAGSSAIVISMLDEIAWLLNLRGSD+ HSPVMYAYLIVEIDGAKLFID++K
Sbjct  121   LSSLRSELTNAGSSAIVISMLDEIAWLLNLRGSDIPHSPVMYAYLIVEIDGAKLFIDEAK  180

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             +  +VM YLK+ G+ELR YES                +     +AAI N YK ACD+Y  
Sbjct  181   VNSDVMHYLKNAGIELRPYES----------------ILSEIESAAIVNTYKCACDKYFG  224

Query  1203  SPG-IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALA  1379
             + G + ++N ++ N  T+G S  P  +YRSSP+S+AKAVKN AELEGM+N HLRDAAALA
Sbjct  225   TAGTVNEKNTEALN-GTDGTSCGPSYVYRSSPISLAKAVKNEAELEGMRNSHLRDAAALA  283

Query  1380  HFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
              FW WLEEEI   V LTEV+VA+KLLEFRSKQ GF+DTSFDTIS SGANGAIIHYKPEP+
Sbjct  284   QFWTWLEEEISNGVILTEVDVADKLLEFRSKQNGFVDTSFDTISASGANGAIIHYKPEPN  343

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             SCS+V+  +LFLLDSGAQ++DGTTDITRTVHFGEPSS +KECFTRVLQGHIALDQA+FPE
Sbjct  344   SCSVVDAEKLFLLDSGAQFIDGTTDITRTVHFGEPSSWQKECFTRVLQGHIALDQAIFPE  403

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVS  1919
             N PGFVLDAFAR+SLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFRFGNMTP++ GMVVS
Sbjct  404   NYPGFVLDAFARASLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRFGNMTPLLKGMVVS  463

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             NEPGYYEDH+FGIRIENLLYVKE+ TPNRFGG+ YLGFEKLT+VPIQ KL+DLSI+SAAE
Sbjct  464   NEPGYYEDHAFGIRIENLLYVKEVSTPNRFGGLDYLGFEKLTYVPIQTKLIDLSIVSAAE  523

Query  2100  VAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             + WLN YH QVWEKVS L+DG A+EWLWNNTRP+
Sbjct  524   IDWLNDYHKQVWEKVSPLLDGPAQEWLWNNTRPL  557



>ref|NP_001059149.1| Os07g0205700 [Oryza sativa Japonica Group]
 dbj|BAC83229.1| putative X-prolyl aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAF21063.1| Os07g0205700 [Oryza sativa Japonica Group]
 gb|EAZ39068.1| hypothetical protein OsJ_23499 [Oryza sativa Japonica Group]
 dbj|BAH00068.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/678 (65%), Positives = 536/678 (79%), Gaps = 27/678 (4%)
 Frame = +3

Query  234   CRVLIVRNSSNIAAKPSSEFQKK----------PRGLDQEDRLRALRQLFSRPDINIDAY  383
             C +          A PSSE +K+            G  ++++LR+LR+L +RPD+ IDAY
Sbjct  46    CFLAAAGGDGRAVALPSSELRKRRGGASSSSSAAPGGGEDEKLRSLRRLLARPDVAIDAY  105

Query  384   IIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSW  563
             I+PSQDAHQSEFIA+C+MRRAY++GFTGSAGTAVVTKDKAALWTDGRYFLQAEK+LS  W
Sbjct  106   IVPSQDAHQSEFIAECFMRRAYLTGFTGSAGTAVVTKDKAALWTDGRYFLQAEKELSHDW  165

Query  564   ILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLN  743
              LMRSGN GVPT SEWLN VL  G R+GIDPFLFS DAAEELK+ IS+ NHELV + +LN
Sbjct  166   TLMRSGNQGVPTTSEWLNEVLPSGCRVGIDPFLFSFDAAEELKDAISEKNHELVLIKDLN  225

Query  744   LVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWL  923
             LVDEIW ESRP+PPK+  RVH +KYAG DV SKL  +RS L   G +A+VIS+LDE+AWL
Sbjct  226   LVDEIWGESRPEPPKEQTRVHGIKYAGVDVPSKLSFVRSQLAENGCNAVVISLLDEVAWL  285

Query  924   LNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseie  1103
             LN+RGSDV +SPV Y+YLIVE   A LF+D++K++ +V+++L+  GV+L+ YE+ILS++E
Sbjct  286   LNMRGSDVPNSPVFYSYLIVEDTAATLFVDNNKVSEDVLEHLEKAGVKLKPYEAILSDVE  345

Query  1104  slAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQP----  1271
              LAE GA LWLD S++NAAI N ++++C+RY     +KKR K    +      G P    
Sbjct  346   RLAENGAKLWLDSSSINAAIVNVFRSSCERY-----VKKRGKAGRQIGKESSQGDPATGS  400

Query  1272  --------HALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGL  1427
                     +ALY+ SP ++AKAVKN AE+EGM++ HLRDAAALA FW WLE ++ + V L
Sbjct  401   SGVQNGTVNALYKVSPATLAKAVKNEAEVEGMKSSHLRDAAALAEFWCWLEGQVRESVPL  460

Query  1428  TEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSG  1607
             TEV+VAEKLLEFR KQ GF+DTSFDTISG GANGAIIHY+P P+SCS V    LFLLDSG
Sbjct  461   TEVQVAEKLLEFRQKQDGFIDTSFDTISGYGANGAIIHYRPTPESCSSVGSDNLFLLDSG  520

Query  1608  AQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLW  1787
             AQY+DGTTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVFPE TPGFVLD  ARSSLW
Sbjct  521   AQYIDGTTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVFPERTPGFVLDVLARSSLW  580

Query  1788  KVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIE  1967
             K+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GN+T +  GM+VSNEPGYYED+SFGIRIE
Sbjct  581   KIGLDYRHGTGHGVGAALNVHEGPQSISYRYGNLTALQKGMIVSNEPGYYEDNSFGIRIE  640

Query  1968  NLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVS  2147
             NLL VKE++ PN FGG+ YLGFEKLTFVPIQ+KLVDLS+LS +E+ W+N YH +VWEKVS
Sbjct  641   NLLLVKEVNLPNSFGGVSYLGFEKLTFVPIQSKLVDLSLLSPSEINWINEYHDEVWEKVS  700

Query  2148  GLVDGRAREWLWNNTRPI  2201
              L+ G + +WL  NTRP+
Sbjct  701   PLLSGHSLDWLRKNTRPL  718



>emb|CAN82623.1| hypothetical protein VITISV_002314 [Vitis vinifera]
Length=547

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/544 (78%), Positives = 484/544 (89%), Gaps = 0/544 (0%)
 Frame = +3

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MR+GN+GVPT SEWLN VL+PG RIGIDPFLFSSDAAEELKE I+K NHELV+L +LNLV
Sbjct  1     MRAGNYGVPTTSEWLNDVLAPGCRIGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLV  60

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIWKESRP+PP+KPIRVH+L YAG DVSSKL SLRS+LI+AG SAIV+SMLDE++WLLN
Sbjct  61    DEIWKESRPEPPRKPIRVHELTYAGLDVSSKLSSLRSELIDAGCSAIVVSMLDEVSWLLN  120

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             LRG+DV +SPVMYAYLIVEIDGAKLFIDDSK++PEVMD+LK+ G+ELR YESIL+EI++L
Sbjct  121   LRGNDVPNSPVMYAYLIVEIDGAKLFIDDSKVSPEVMDHLKNAGIELRPYESILAEIKNL  180

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRS  1289
             A KGA+LWLD S+VNAAI N Y+ ACD+YS S   K++NK       NG SG P  +Y+ 
Sbjct  181   AAKGAHLWLDTSSVNAAIVNTYEAACDQYSGSLDNKRKNKSEAYGVANGQSGVPTGVYKI  240

Query  1290  SPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRS  1469
             SP+ +AKAVKN AELEGM+N HLRDAAALA FW+WLEEEI K V LTEV+VA+KLL+FRS
Sbjct  241   SPILLAKAVKNQAELEGMRNSHLRDAAALAQFWSWLEEEILKGVLLTEVDVADKLLQFRS  300

Query  1470  KQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTV  1649
              Q GFLDTSFDTIS SGANGAIIHYKP PDSCSIV+  ++FLLDSGAQY+DGTTDITRTV
Sbjct  301   MQAGFLDTSFDTISASGANGAIIHYKPNPDSCSIVDVKKMFLLDSGAQYIDGTTDITRTV  360

Query  1650  HFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGV  1829
             HFGEP+ R+KECFTRVLQGHIALDQAVFPENTPGFVLDAFARS LWK+GLDYRHGTGHGV
Sbjct  361   HFGEPTPRQKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSFLWKIGLDYRHGTGHGV  420

Query  1830  GAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRF  2009
             GAALNVHEGPQ ISFRFGNMTP+  GM+VSNEPGYYEDH+FGIRIENLL VKEMDTPNRF
Sbjct  421   GAALNVHEGPQSISFRFGNMTPLQKGMIVSNEPGYYEDHAFGIRIENLLCVKEMDTPNRF  480

Query  2010  GGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNN  2189
             GGIGYLGFE+LTFVPIQ +LV+LS+LS AE+ WLN YH +VWEKVS L+DG AR+WLW+N
Sbjct  481   GGIGYLGFERLTFVPIQNELVELSLLSNAEIDWLNDYHSEVWEKVSPLLDGSARQWLWDN  540

Query  2190  TRPI  2201
             TRP+
Sbjct  541   TRPL  544



>gb|KEH24523.1| Xaa-pro aminopeptidase P [Medicago truncatula]
Length=677

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/611 (72%), Positives = 513/611 (84%), Gaps = 11/611 (2%)
 Frame = +3

Query  153   HSRFPLISL-PIPRKLHYPLKFPSSSANCRVLI-VRN---SSNIAAKPSSEFQK-KPRGL  314
             HS FP ++L PI     +  KF S+  N      +RN   S++I+AKPSS+ +K +    
Sbjct  25    HSSFPTLNLNPI-----FFYKFKSNKHNKPPFFSIRNCTTSNSISAKPSSQLRKNRSSNS  79

Query  315   DQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTK  494
             D + +L ALR+LFS+PD++IDAYIIPSQDAHQSEFIA  Y RR YIS FTGS GTAVVT 
Sbjct  80    DSDPKLTALRRLFSKPDVSIDAYIIPSQDAHQSEFIAQSYARRKYISAFTGSNGTAVVTN  139

Query  495   DKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSD  674
             DKAALWTDGRYFLQAEKQL+S+WILMR+GN GVPT SEWLN VL+PG+R+GIDPFLF+SD
Sbjct  140   DKAALWTDGRYFLQAEKQLNSNWILMRAGNPGVPTTSEWLNEVLAPGARVGIDPFLFTSD  199

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
             AAEELK  ISK NHELV+L N NLVDEIWKE+RP+PP KP+RVH LKYAG DV+SKL SL
Sbjct  200   AAEELKHVISKKNHELVYLYNSNLVDEIWKEARPEPPNKPVRVHGLKYAGLDVASKLSSL  259

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             RS+L+ AGSSAI+++ LDEIAWLLNLRGSD+ HSPV+YAYLIVEIDGAKLFID+SK+T E
Sbjct  260   RSELVQAGSSAIIVTALDEIAWLLNLRGSDIPHSPVVYAYLIVEIDGAKLFIDNSKVTEE  319

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V D+LK   +E+R Y SI+SEIE+LA +G++LWLD S+VNAAI NAYK ACDRY ++   
Sbjct  320   VDDHLKKANIEIRPYNSIVSEIENLAARGSSLWLDTSSVNAAIVNAYKAACDRYYQNYES  379

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
             K + +      +   S  P A+++SSPVS+AKA+KN  EL+GMQ CHLRDAAALA FW W
Sbjct  380   KHKTRSKGFDGSIANSDVPIAVHKSSPVSLAKAIKNETELKGMQECHLRDAAALAQFWDW  439

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+EI  D  LTEVEV++KLLEFRSKQ GFLDTSFDTISGSG NGAIIHYKPEP SCS V
Sbjct  440   LEKEITNDRILTEVEVSDKLLEFRSKQAGFLDTSFDTISGSGPNGAIIHYKPEPGSCSTV  499

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             + ++LFLLDSGAQYVDGTTDITRTVHFG+P++REKECFTRVLQGHIALDQAVFPE+TPGF
Sbjct  500   DANKLFLLDSGAQYVDGTTDITRTVHFGKPTTREKECFTRVLQGHIALDQAVFPEDTPGF  559

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             VLDAFARS LWKVGLDYRHGTGHGVGAALNVHEGPQGIS+R+GN+TP+V GM+VSNEPGY
Sbjct  560   VLDAFARSFLWKVGLDYRHGTGHGVGAALNVHEGPQGISYRYGNLTPLVNGMIVSNEPGY  619

Query  1935  YEDHSFGIRIE  1967
             YEDH+FGIRIE
Sbjct  620   YEDHAFGIRIE  630



>gb|EYU34859.1| hypothetical protein MIMGU_mgv1a004042mg [Erythranthe guttata]
Length=547

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/545 (79%), Positives = 484/545 (89%), Gaps = 2/545 (0%)
 Frame = +3

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MR+GN GVPT SEWLN V++PGSRIGIDPFLFSSDAAEELKE IS+ NHELV+L ++NLV
Sbjct  1     MRAGNLGVPTRSEWLNGVMAPGSRIGIDPFLFSSDAAEELKEAISQKNHELVYLYDINLV  60

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIWKESRP+PP K +RVHD+KYAG DVSSKL SLRS+L NAGSSAIVISMLDEIAWLLN
Sbjct  61    DEIWKESRPKPPNKHVRVHDMKYAGVDVSSKLSSLRSELTNAGSSAIVISMLDEIAWLLN  120

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             LRGSD+ HSPVMYAYLIVEIDGAKLFID++KI  +VM YLK+ G+ELR YESILSEIESL
Sbjct  121   LRGSDIPHSPVMYAYLIVEIDGAKLFIDEAKINSDVMHYLKNAGIELRPYESILSEIESL  180

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG-IKKRNKKSTNLDTNGLSGQPHALYR  1286
             AEKGA LWLD S+V+AAI N YK ACD+Y  + G + K+N ++ N  T+G S  P  +YR
Sbjct  181   AEKGACLWLDTSSVSAAIVNTYKCACDKYFGTAGTVNKKNTEALN-GTDGTSCGPSYVYR  239

Query  1287  SSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFR  1466
             SSP+S+AKAVKN AELEGM+N HLRDAAALA FW WLEEEI   V LTEV+VA+KLLEFR
Sbjct  240   SSPISLAKAVKNEAELEGMRNSHLRDAAALAQFWTWLEEEISNGVILTEVDVADKLLEFR  299

Query  1467  SKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRT  1646
             SKQ GF+DTSFDTIS SGANGAIIHYKPEP+SCSIV+  +LFLLDSGAQ++DGTTDITRT
Sbjct  300   SKQNGFVDTSFDTISASGANGAIIHYKPEPNSCSIVDAEKLFLLDSGAQFIDGTTDITRT  359

Query  1647  VHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHG  1826
             VHFGEPSS +KECFTRVLQGHIALDQA+FPEN PGFVLDAFARSSLWK+GLDYRHGTGHG
Sbjct  360   VHFGEPSSWQKECFTRVLQGHIALDQAIFPENYPGFVLDAFARSSLWKIGLDYRHGTGHG  419

Query  1827  VGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNR  2006
             VGAALNVHEGPQ ISFRFGNMTP++ GMVVSNEPGYYEDH+FGIRIENLLYVKE+ TPNR
Sbjct  420   VGAALNVHEGPQSISFRFGNMTPLLKGMVVSNEPGYYEDHAFGIRIENLLYVKEVSTPNR  479

Query  2007  FGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWN  2186
             FGG+ YLGFEKLT+VPIQ KL+DLSI+SA E+ WLN YH QVWEKVS L+DG A++WLWN
Sbjct  480   FGGLDYLGFEKLTYVPIQTKLIDLSIVSATEIDWLNDYHKQVWEKVSPLLDGPAQQWLWN  539

Query  2187  NTRPI  2201
             NTRP+
Sbjct  540   NTRPL  544



>gb|EEC81711.1| hypothetical protein OsI_25321 [Oryza sativa Indica Group]
Length=614

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/612 (68%), Positives = 497/612 (81%), Gaps = 17/612 (3%)
 Frame = +3

Query  402   AHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSG  581
             A  SEFIA+C+MRRAY++GFTGSAGTAVVTKDKAALWTDGRYFLQAEK+LS  W LMRSG
Sbjct  8     AEMSEFIAECFMRRAYLTGFTGSAGTAVVTKDKAALWTDGRYFLQAEKELSHDWTLMRSG  67

Query  582   NWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIW  761
             N GVPT SEWLN VL  G R+GIDPFLFS DAAEELK+ IS+ NHELV + +LNLVDEIW
Sbjct  68    NQGVPTTSEWLNEVLPSGCRVGIDPFLFSFDAAEELKDAISEKNHELVLIKDLNLVDEIW  127

Query  762   KESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGS  941
              ESRP+PPK+  RVH +KYAG DV SKL  +RS L   G +A+VIS+LDE+AWLLN+RGS
Sbjct  128   GESRPEPPKEQTRVHGIKYAGVDVPSKLSFVRSQLAENGCNAVVISLLDEVAWLLNMRGS  187

Query  942   DVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKG  1121
             DV +SPV Y+YLIVE   A LF+D++K++ +V+++L+  GV+L+ YE+ILS++E LAE G
Sbjct  188   DVPNSPVFYSYLIVEDTAATLFVDNNKVSEDVLEHLEKAGVKLKPYEAILSDVERLAENG  247

Query  1122  ANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQP----------  1271
             A LWLD S++NAAI N ++++C+RY     +KKR K    +      G P          
Sbjct  248   AKLWLDSSSINAAIVNVFRSSCERY-----VKKRGKAGRQIGKESSQGDPATGSSGVQNG  302

Query  1272  --HALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVA  1445
               +ALY+ SP ++AKAVKN AE+EGM++ HLRDAAALA FW WLE ++ + V LTEV+VA
Sbjct  303   TVNALYKVSPATLAKAVKNEAEVEGMKSSHLRDAAALAEFWCWLEGQVRESVPLTEVQVA  362

Query  1446  EKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDG  1625
             EKLLEFR KQ GF+DTSFDTISG GANGAIIHY+P P+SCS V    LFLLDSGAQY+DG
Sbjct  363   EKLLEFRQKQDGFIDTSFDTISGYGANGAIIHYRPTPESCSSVGSDNLFLLDSGAQYIDG  422

Query  1626  TTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDY  1805
             TTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVFPE TPGFVLD  ARSSLWK+GLDY
Sbjct  423   TTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVFPERTPGFVLDVLARSSLWKIGLDY  482

Query  1806  RHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVK  1985
             RHGTGHGVGAALNVHEGPQ IS+R+GN+T +  GM+VSNEPGYYED+SFGIRIENLL VK
Sbjct  483   RHGTGHGVGAALNVHEGPQSISYRYGNLTALQKGMIVSNEPGYYEDNSFGIRIENLLLVK  542

Query  1986  EMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGR  2165
             E++ PN FGG+ YLGFEKLTFVPIQ+KLVDLS+LS +E+ W+N YH +VWEKVS L+ G 
Sbjct  543   EVNLPNSFGGVSYLGFEKLTFVPIQSKLVDLSLLSPSEINWINEYHDEVWEKVSPLLSGH  602

Query  2166  AREWLWNNTRPI  2201
             + +WL  NTRP+
Sbjct  603   SLDWLRKNTRPL  614



>gb|KEH24522.1| Xaa-pro aminopeptidase P [Medicago truncatula]
Length=549

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/544 (75%), Positives = 474/544 (87%), Gaps = 0/544 (0%)
 Frame = +3

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MR+GN GVPT SEWLN VL+PG+R+GIDPFLF+SDAAEELK  ISK NHELV+L N NLV
Sbjct  1     MRAGNPGVPTTSEWLNEVLAPGARVGIDPFLFTSDAAEELKHVISKKNHELVYLYNSNLV  60

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIWKE+RP+PP KP+RVH LKYAG DV+SKL SLRS+L+ AGSSAI+++ LDEIAWLLN
Sbjct  61    DEIWKEARPEPPNKPVRVHGLKYAGLDVASKLSSLRSELVQAGSSAIIVTALDEIAWLLN  120

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             LRGSD+ HSPV+YAYLIVEIDGAKLFID+SK+T EV D+LK   +E+R Y SI+SEIE+L
Sbjct  121   LRGSDIPHSPVVYAYLIVEIDGAKLFIDNSKVTEEVDDHLKKANIEIRPYNSIVSEIENL  180

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRS  1289
             A +G++LWLD S+VNAAI NAYK ACDRY ++   K + +      +   S  P A+++S
Sbjct  181   AARGSSLWLDTSSVNAAIVNAYKAACDRYYQNYESKHKTRSKGFDGSIANSDVPIAVHKS  240

Query  1290  SPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRS  1469
             SPVS+AKA+KN  EL+GMQ CHLRDAAALA FW WLE+EI  D  LTEVEV++KLLEFRS
Sbjct  241   SPVSLAKAIKNETELKGMQECHLRDAAALAQFWDWLEKEITNDRILTEVEVSDKLLEFRS  300

Query  1470  KQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTV  1649
             KQ GFLDTSFDTISGSG NGAIIHYKPEP SCS V+ ++LFLLDSGAQYVDGTTDITRTV
Sbjct  301   KQAGFLDTSFDTISGSGPNGAIIHYKPEPGSCSTVDANKLFLLDSGAQYVDGTTDITRTV  360

Query  1650  HFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGV  1829
             HFG+P++REKECFTRVLQGHIALDQAVFPE+TPGFVLDAFARS LWKVGLDYRHGTGHGV
Sbjct  361   HFGKPTTREKECFTRVLQGHIALDQAVFPEDTPGFVLDAFARSFLWKVGLDYRHGTGHGV  420

Query  1830  GAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRF  2009
             GAALNVHEGPQGIS+R+GN+TP+V GM+VSNEPGYYEDH+FGIRIENLLYV+ ++TPNRF
Sbjct  421   GAALNVHEGPQGISYRYGNLTPLVNGMIVSNEPGYYEDHAFGIRIENLLYVRNVETPNRF  480

Query  2010  GGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNN  2189
             GGI YLGFEKLT+VPIQ KLVD+S+LS  E+ WLN+YH  VWEKVS L+DG AR+WLWNN
Sbjct  481   GGIQYLGFEKLTYVPIQIKLVDVSLLSTTEIDWLNNYHSVVWEKVSPLLDGSARQWLWNN  540

Query  2190  TRPI  2201
             T+PI
Sbjct  541   TQPI  544



>ref|XP_008246462.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Prunus 
mume]
Length=534

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/518 (78%), Positives = 457/518 (88%), Gaps = 0/518 (0%)
 Frame = +3

Query  648   IDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGA  827
             ++ FLFSSDAAEELK+ I+K NHELVFL + NLVDE+W +SRP+PP KPIRVHDLKYAG 
Sbjct  14    LEQFLFSSDAAEELKQGIAKKNHELVFLYDKNLVDEVWNKSRPKPPNKPIRVHDLKYAGV  73

Query  828   DVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLF  1007
             DV+SKL SLRS+L ++GSSAIVISMLDEIAWLLNLRGSDV HSPVMYAYLIVE D AKLF
Sbjct  74    DVASKLLSLRSELADSGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVETDKAKLF  133

Query  1008  IDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTAC  1187
             ID SK++ EVMD+LK+ G+ELR Y+SILSE+E LA +GAN+WLD S+VNAAI   + +AC
Sbjct  134   IDTSKVSAEVMDHLKNAGIELRPYDSILSEVEGLAAQGANVWLDISSVNAAIVKTFNSAC  193

Query  1188  DRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDA  1367
             +RY +S   K ++K     D+NG SG P  +YR SP+S+AKAVKN +ELEGM++CHLRDA
Sbjct  194   ERYYQSLESKTKSKTKMYDDSNGWSGGPTGIYRVSPISLAKAVKNDSELEGMRSCHLRDA  253

Query  1368  AALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYK  1547
             AAL  FW W+EE+I K++ LTEVEVA+KLLEFRS Q GFLDTSFDTISGSGANGAIIHY+
Sbjct  254   AALVQFWVWMEEQIKKNMKLTEVEVADKLLEFRSAQPGFLDTSFDTISGSGANGAIIHYR  313

Query  1548  PEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQA  1727
              EPDSCS+V+  +LFLLDSG QYVDGTTDITRTVHFGEP SR+KECFTRVLQGHIALDQA
Sbjct  314   AEPDSCSVVDDKKLFLLDSGGQYVDGTTDITRTVHFGEPPSRQKECFTRVLQGHIALDQA  373

Query  1728  VFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPG  1907
             VFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTP+  G
Sbjct  374   VFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPLQKG  433

Query  1908  MVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSIL  2087
             M+VSNEPGYYEDH+FGIRIENLL VKE+DTPNRFGGIGYLGFEKLTFVPIQAKL+DLS+L
Sbjct  434   MIVSNEPGYYEDHAFGIRIENLLVVKEVDTPNRFGGIGYLGFEKLTFVPIQAKLIDLSLL  493

Query  2088  SAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             SAAE  WLN YH QVWEKVS LVDG AREWLWNNTRP+
Sbjct  494   SAAEFDWLNDYHSQVWEKVSPLVDGYAREWLWNNTRPL  531



>gb|KDO56312.1| hypothetical protein CISIN_1g005183mg [Citrus sinensis]
 gb|KDO56313.1| hypothetical protein CISIN_1g005183mg [Citrus sinensis]
Length=533

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/515 (79%), Positives = 456/515 (89%), Gaps = 1/515 (0%)
 Frame = +3

Query  657   FLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVS  836
             FLFSSDAAEELKE I+K NHELV+L +LNLVD IWKESRP+PP KPIRVH LKYAG DV+
Sbjct  17    FLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVA  76

Query  837   SKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDD  1016
             SKL SLRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPVMYAYLIVE+D AKLF+DD
Sbjct  77    SKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDD  136

Query  1017  SKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRY  1196
             SK+TP+VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD S+VNAAI N Y+ A ++Y
Sbjct  137   SKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKY  196

Query  1197  SRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAAL  1376
               S    K++K   + DT G SG P  ++R+SP++ +KAVKNSAELEGM N HLRDAAAL
Sbjct  197   LTSNN-NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAAL  255

Query  1377  AHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEP  1556
             A FW WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFDTISGSGANGAIIHYKPEP
Sbjct  256   AQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEP  315

Query  1557  DSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFP  1736
               CS+V+  +LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTRVLQGHIALDQA+FP
Sbjct  316   GKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFP  375

Query  1737  ENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVV  1916
             ++TPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+V GM+V
Sbjct  376   QSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIV  435

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYEDH+FGIRIENLLYVKE+ TPNRFGG+ YLGFEKLTFVPIQ KLVDLS+LSAA
Sbjct  436   SNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAA  495

Query  2097  EVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             E+ WLN+YH QVWEKVS L+DG AR+WLWNNTRP+
Sbjct  496   EIDWLNNYHSQVWEKVSPLLDGFARQWLWNNTRPV  530



>ref|XP_006657547.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Oryza brachyantha]
Length=596

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/596 (67%), Positives = 480/596 (81%), Gaps = 7/596 (1%)
 Frame = +3

Query  435   MRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWL  614
             MRRAY++GFTGSAGTAVVTKDKAALWTDGRYFLQAEK+LS  W LMRSGN GVPT SEWL
Sbjct  1     MRRAYLTGFTGSAGTAVVTKDKAALWTDGRYFLQAEKELSHDWTLMRSGNHGVPTTSEWL  60

Query  615   NSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKP  794
               VL  G R+GIDPFLFS DAAEELK+ I + NHELV +  LNLVDEIW E+RP+PPK+ 
Sbjct  61    KEVLPSGCRVGIDPFLFSFDAAEELKDAIFEKNHELVLIRELNLVDEIWGEARPEPPKQK  120

Query  795   IRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAY  974
              RVH +KYAG DV SKL S+RS L + G  A+VIS+LDE+AWLLN+RGSDV +SPV Y+Y
Sbjct  121   TRVHGIKYAGIDVPSKLSSVRSQLADDGCDAVVISLLDEVAWLLNMRGSDVPNSPVFYSY  180

Query  975   LIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVN  1154
             LIVE   A LF+D++K++ +V+++L+  GV+L+ YE+ILS++E LA+ G  LWLD S++N
Sbjct  181   LIVEDKTATLFVDNNKVSEDVLEHLEKAGVKLKPYEAILSDVERLAQSGKKLWLDSSSIN  240

Query  1155  AAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGL-------SGQPHALYRSSPVSMAKA  1313
             AAI N ++ +CDR+    G   R     +             +G   ALY+ SPV++AKA
Sbjct  241   AAIVNVFRASCDRHVNKRGKAGRQSGKESPSGEPGSGSSGVQNGNLQALYKVSPVTLAKA  300

Query  1314  VKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDT  1493
             VKN AE+EGM++ H+RDAAALA FW WLE E+ + V  TEV+V+EKLLEFR KQ GF+DT
Sbjct  301   VKNEAEIEGMKSSHIRDAAALAEFWCWLEGEVRESVLHTEVQVSEKLLEFRQKQDGFIDT  360

Query  1494  SFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSR  1673
             SFDTISG GANGAIIHY+P P+SCS V    LFLLDSGAQY+DGTTDITRTVHFGEPS R
Sbjct  361   SFDTISGYGANGAIIHYRPTPESCSSVGSDNLFLLDSGAQYIDGTTDITRTVHFGEPSPR  420

Query  1674  EKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHE  1853
             +KECFT+VLQGHIALDQAVFPE TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHE
Sbjct  421   QKECFTKVLQGHIALDQAVFPERTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHE  480

Query  1854  GPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGF  2033
             GPQ IS+R+GN+T +  GM+VSNEPGYYED+SFGIRIENLL VKE++ PN FGG+ YLGF
Sbjct  481   GPQSISYRYGNLTALQKGMIVSNEPGYYEDNSFGIRIENLLLVKEVNLPNSFGGVSYLGF  540

Query  2034  EKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             EKLTFVPIQ+KL+DLS+LS +E+ W+N YH +VWEKVS L+ G + +WL  NTRP+
Sbjct  541   EKLTFVPIQSKLIDLSLLSPSEINWINEYHEEVWEKVSPLLSGDSLDWLRKNTRPL  596



>ref|XP_001784361.1| predicted protein [Physcomitrella patens]
 gb|EDQ50830.1| predicted protein [Physcomitrella patens]
Length=758

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/669 (61%), Positives = 512/669 (77%), Gaps = 9/669 (1%)
 Frame = +3

Query  216   PSSSANCRVLIVRNSSN-IAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPD--INIDAYI  386
             PS   N ++  +R +    + +PSS      +    + +L  LR+ F +      +DAYI
Sbjct  75    PSKHVNGKITTIRAAGGYFSVQPSSRRNVSKKEFPLDKKLADLRKEFEKNADYKGLDAYI  134

Query  387   IPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWI  566
             +PS+D HQSEFIADCYMRRAYISGFTGSAGTAV+TK+KAALWTDGRYFLQAE +L   W 
Sbjct  135   VPSEDPHQSEFIADCYMRRAYISGFTGSAGTAVITKEKAALWTDGRYFLQAENELGHEWT  194

Query  567   LMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNL  746
             LMR+G    P+ SEWL   L  G+R+GIDPFLFS+DA EEL+  +++ + ELV +   NL
Sbjct  195   LMRAGQPYTPSTSEWLKETLPEGARVGIDPFLFSADAGEELRRVLAEKDQELVLVYEDNL  254

Query  747   VDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLL  926
             VD++W ++RP PP +P+RVH+L+YAG DV++KL +LR +L+NAG+SAI+I+MLDE+AWLL
Sbjct  255   VDKVWGDARPAPPSEPLRVHELRYAGVDVATKLTNLRKELVNAGASAIIITMLDEVAWLL  314

Query  927   NLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseies  1106
             N+RG+DV HSPV YAY++V ++ A LF+D+SK+TPEV+ +L   GV ++ Y S++SEI+ 
Sbjct  315   NVRGNDVPHSPVAYAYVVVGLETASLFVDESKVTPEVLAHLNEAGVTVKPYASLVSEIKG  374

Query  1107  lAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI---KKRNKKSTNLDTNGLSGQPHA  1277
             LA KG+ LWLD S V+ AI NA+  AC +Y     I   K+ +K  T  D   L+G P A
Sbjct  375   LASKGSKLWLDSSRVSVAIKNAFDDACAQYYEDLEIARSKRSSKGKTAFDEE-LNG-PAA  432

Query  1278  LYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKD-VGLTEVEVAEKL  1454
             L+R SPV +AKA+KN AELEGM+  HLRDAAAL  FWAWLE +I  +   ++EVEVA+ L
Sbjct  433   LHRPSPVGIAKAIKNDAELEGMRQAHLRDAAALCEFWAWLESKIVDEKQQISEVEVADHL  492

Query  1455  LEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTD  1634
              +FR+KQ GFLDTSF+TISGSG NGAI+HY+ E  +C  V+  +L+LLDSGAQ+VDGTTD
Sbjct  493   EKFRAKQAGFLDTSFETISGSGPNGAIVHYRAEAATCRYVDDKQLYLLDSGAQFVDGTTD  552

Query  1635  ITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHG  1814
             ITRTVHFG PS+R+KECFTRVLQGHI +D AVFPE+TPGFVLDAFARSSLWK+GLDYRHG
Sbjct  553   ITRTVHFGTPSARQKECFTRVLQGHIGVDTAVFPEHTPGFVLDAFARSSLWKIGLDYRHG  612

Query  1815  TGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMD  1994
             TGHGVGAALNVHEGPQ +S RFGNMT +  GM+VSNEPGYYED +FGIRIENLL V+E  
Sbjct  613   TGHGVGAALNVHEGPQSVSARFGNMTGLEQGMIVSNEPGYYEDRAFGIRIENLLIVREQM  672

Query  1995  TPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRARE  2174
             T N +GG+ +LGFE+LTFVPIQ KL+DL I+S  E+ WLN YH +V+ KVS LV G AR 
Sbjct  673   TANNYGGVTFLGFERLTFVPIQTKLLDLEIMSDQEIKWLNDYHAEVFRKVSPLVKGNARR  732

Query  2175  WLWNNTRPI  2201
             WL  NTRPI
Sbjct  733   WLEENTRPI  741



>ref|XP_002884508.1| aminopeptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60767.1| aminopeptidase [Arabidopsis lyrata subsp. lyrata]
Length=545

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/545 (72%), Positives = 467/545 (86%), Gaps = 4/545 (1%)
 Frame = +3

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MR+GN GVPT SEW+  VL+PG R+GIDPFLFS+DAAEELKE I+K NHELV+L N+N+V
Sbjct  1     MRAGNLGVPTASEWVADVLAPGGRVGIDPFLFSADAAEELKEVIAKKNHELVYLYNVNIV  60

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIWK+SRP+PP K I +HDLKYAG DV+SKL SLR+ +++AG+SAIVISMLDEIAW+LN
Sbjct  61    DEIWKDSRPKPPSKQIGIHDLKYAGVDVASKLLSLRNQIMDAGASAIVISMLDEIAWVLN  120

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             LRGSDV HSPVMYAYLIVE+D A+LF+D+SK+T EV D+LK+ G+ELR Y+SIL  I+SL
Sbjct  121   LRGSDVPHSPVMYAYLIVEVDQAQLFVDNSKVTAEVKDHLKNAGIELRPYDSILQGIDSL  180

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRS  1289
             AE+GA L +D ST+N AI + YK+AC+RYS S   + + K      +NG +  P  +Y  
Sbjct  181   AERGAQLLMDPSTLNVAIISTYKSACERYSES---EDKAKTKFTDSSNGHTANPSGIYMQ  237

Query  1290  SPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRS  1469
             SP+S AKA+KN AEL+GM+N HLRDAAALAHFWAWLE+E+ K+  LTEV+VA++LLEFRS
Sbjct  238   SPISWAKAIKNDAELQGMKNSHLRDAAALAHFWAWLEDEVHKNANLTEVDVADRLLEFRS  297

Query  1470  KQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTV  1649
              Q GF+DTSFDTISGSGANGAIIHYKPEP+SCS V+  +LFLLDSGAQYVDGTTDITRTV
Sbjct  298   MQDGFMDTSFDTISGSGANGAIIHYKPEPESCSRVDPQKLFLLDSGAQYVDGTTDITRTV  357

Query  1650  HFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGV  1829
             HF EPS+REKECFTRVLQGHIALD+AVFPE TPGFVLD FARSSLWK+GLDYRHGTGHGV
Sbjct  358   HFSEPSAREKECFTRVLQGHIALDEAVFPEGTPGFVLDGFARSSLWKIGLDYRHGTGHGV  417

Query  1830  GAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRF  2009
             GAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPGYYEDH+FGIRIENLL+V++ +TPNRF
Sbjct  418   GAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPGYYEDHAFGIRIENLLHVRDAETPNRF  477

Query  2010  GGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGR-AREWLWN  2186
             GG  YLGFEKLTF PIQ K+VD+S+LS  E+ WLN YH +VWEKVS L++G   ++WLWN
Sbjct  478   GGATYLGFEKLTFFPIQTKMVDVSLLSDTEIDWLNRYHAEVWEKVSPLLEGSTTQQWLWN  537

Query  2187  NTRPI  2201
             NTRP+
Sbjct  538   NTRPL  542



>ref|XP_008802678.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X4 [Phoenix 
dactylifera]
Length=556

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/553 (73%), Positives = 464/553 (84%), Gaps = 9/553 (2%)
 Frame = +3

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MRSGN GVPT  EWLN VL+PG R+GIDPFLFSSDAAEELKE ISK NHELVF+   NLV
Sbjct  1     MRSGNLGVPTTPEWLNDVLAPGCRVGIDPFLFSSDAAEELKEAISKKNHELVFIYGYNLV  60

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIW +SRP+PP KP RVHD+KYAG DVS+KL SLRS+LI  G +AIVISMLDE+AWLLN
Sbjct  61    DEIWGKSRPKPPMKPTRVHDIKYAGVDVSTKLSSLRSELIETGCTAIVISMLDEVAWLLN  120

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             +RG+DV HSPV Y+YLIVEIDGAKLFID++K+T EVMD+LKS GVEL+ YESILSEIESL
Sbjct  121   MRGNDVPHSPVFYSYLIVEIDGAKLFIDEAKVTKEVMDHLKSAGVELKPYESILSEIESL  180

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKK---------STNLDTNGLS  1262
             A +GA LWLD S+VNAAI + +K+AC+++      + R+KK         +TN   +   
Sbjct  181   AARGAKLWLDTSSVNAAIVSRFKSACNKHFAKFEKQARDKKVDGETSPDMATNKHQDTRI  240

Query  1263  GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEV  1442
               P  LY+ SPV++AKAVKN +E++GM++CHLRDAAAL  FWAW+EEEI K+  LTEVEV
Sbjct  241   EGPTGLYKLSPVTLAKAVKNKSEIDGMRSCHLRDAAALVEFWAWMEEEIHKNAVLTEVEV  300

Query  1443  AEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVD  1622
             A+KLLEFR KQ GF+DTSFDTISG GANGA+IHY PEPDSCS+V+   LFLLDSG QYVD
Sbjct  301   ADKLLEFRKKQAGFMDTSFDTISGYGANGAVIHYSPEPDSCSVVDDKNLFLLDSGGQYVD  360

Query  1623  GTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLD  1802
             GTTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVFPE+TPGFVLD  ARSSLWK+GLD
Sbjct  361   GTTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVFPEHTPGFVLDVLARSSLWKIGLD  420

Query  1803  YRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYV  1982
             YRHGTGHGVGAALNVHEGPQ ISFR+GNMT +  GMVVSNEPGYYED+SFGIRIENLL V
Sbjct  421   YRHGTGHGVGAALNVHEGPQSISFRYGNMTALQKGMVVSNEPGYYEDNSFGIRIENLLLV  480

Query  1983  KEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDG  2162
             + +  PN FGGIGYLGFEKLTFVPIQ+KLVD+S+LS  E+ WLN YH QVW+K+S L+ G
Sbjct  481   EVVKLPNCFGGIGYLGFEKLTFVPIQSKLVDVSLLSPMEINWLNDYHSQVWDKISPLLYG  540

Query  2163  RAREWLWNNTRPI  2201
              AREWLWNNTRP+
Sbjct  541   SAREWLWNNTRPL  553



>gb|AAF27041.1|AC009177_31 putative aminopeptidase [Arabidopsis thaliana]
Length=569

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/566 (70%), Positives = 469/566 (83%), Gaps = 22/566 (4%)
 Frame = +3

Query  570   MRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLV  749
             MR+GN GVPT SEW+  VL+PG R+GIDPFLFS+DAAEELKE I+K NHELV+L N+NLV
Sbjct  1     MRAGNPGVPTASEWIADVLAPGGRVGIDPFLFSADAAEELKEVIAKKNHELVYLYNVNLV  60

Query  750   DEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLN  929
             DEIWK+SRP+PP + IR+HDLKYAG DV+SKL SLR+ +++AG+SAIVISMLDEIAW+LN
Sbjct  61    DEIWKDSRPKPPSRQIRIHDLKYAGLDVASKLLSLRNQIMDAGTSAIVISMLDEIAWVLN  120

Query  930   LRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseiesl  1109
             LRGSDV HSPVMYAYLIVE+D A+LF+D+SK+T EV D+LK+ G+ELR Y+SIL  I+SL
Sbjct  121   LRGSDVPHSPVMYAYLIVEVDQAQLFVDNSKVTVEVKDHLKNAGIELRPYDSILQGIDSL  180

Query  1110  AEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRS  1289
             A +GA L +D ST+N AI + YK+AC+RYSR+   + + K      ++G +  P  +Y  
Sbjct  181   AARGAQLLMDPSTLNVAIISTYKSACERYSRNFESEAKVKTKFTDSSSGYTANPSGIYMQ  240

Query  1290  SPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRS  1469
             SP+S AKA+KN AEL+GM+N HLRDAAALAHFWAWLEEE+ K+  LTEV+VA++LLEFRS
Sbjct  241   SPISWAKAIKNDAELKGMKNSHLRDAAALAHFWAWLEEEVHKNANLTEVDVADRLLEFRS  300

Query  1470  KQYGFLDTSFDTISG---------------------SGANGAIIHYKPEPDSCSIVNRHE  1586
              Q GF+DTSFDTISG                     SGANGAIIHYKPEP+SCS V+  +
Sbjct  301   MQDGFMDTSFDTISGMVIVTLVGGTCFLTHSQYTASSGANGAIIHYKPEPESCSRVDPQK  360

Query  1587  LFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDA  1766
             LFLLDSGAQYVDGTTDITRTVHF EPS+REKECFTRVLQGHIALDQAVFPE TPGFVLD 
Sbjct  361   LFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPGFVLDG  420

Query  1767  FARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDH  1946
             FARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMTP+  GM+VSNEPGYYEDH
Sbjct  421   FARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPGYYEDH  480

Query  1947  SFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHL  2126
             +FGIRIENLL+V++ +TPNRFGG  YLGFEKLTF PIQ K+VD+S+LS  EV WLNSYH 
Sbjct  481   AFGIRIENLLHVRDAETPNRFGGATYLGFEKLTFFPIQTKMVDVSLLSDTEVDWLNSYHA  540

Query  2127  QVWEKVSGLVDGR-AREWLWNNTRPI  2201
             +VWEKVS L++G   ++WLWNNTRP+
Sbjct  541   EVWEKVSPLLEGSTTQQWLWNNTRPL  566



>gb|KCW61788.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
 gb|KCW61789.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
 gb|KCW61790.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
 gb|KCW61791.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
 gb|KCW61792.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
 gb|KCW61793.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
Length=527

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/522 (74%), Positives = 456/522 (87%), Gaps = 7/522 (1%)
 Frame = +3

Query  636   SRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLK  815
             S + ++ FLFSSDAAEELKE I+K NHELV L N+NLVDE+WKE RP+PP KP+R+HDLK
Sbjct  10    SALILEQFLFSSDAAEELKEAIAKKNHELVLLYNINLVDEVWKE-RPKPPNKPVRIHDLK  68

Query  816   YAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDG  995
             +AG DV+SKL  LR++ ++AG+SAI+ISMLDE+AWLLNLRG+DV +SPV+YAYL+V+ + 
Sbjct  69    FAGLDVASKLSFLRAEFVDAGASAIIISMLDEVAWLLNLRGNDVPNSPVVYAYLLVKTET  128

Query  996   AKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAY  1175
             A+LF+D SKITPEVMD+LK+ GVELR Y+ ILSEIE+LA++G NLWLD S+VNAAI N Y
Sbjct  129   AELFVDSSKITPEVMDHLKNAGVELRPYDKILSEIENLAKQGRNLWLDTSSVNAAIVNTY  188

Query  1176  KTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCH  1355
             K+ACD+Y     + K++K   + D NG S  P  +YR+SP+S+AKAVKN AEL+GM+N H
Sbjct  189   KSACDKY-----LNKKSKARVH-DYNGRSAMPSGVYRASPISLAKAVKNDAELQGMRNSH  242

Query  1356  LRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             LRDAAALAHFW WLEEEI +   LTEVEVA+KLLEFRSKQ GF+DTSFDTIS SGANGA+
Sbjct  243   LRDAAALAHFWVWLEEEINRGAKLTEVEVADKLLEFRSKQDGFIDTSFDTISASGANGAV  302

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIA  1715
             IHYKPEP SCS+++  +LFLLDSGAQYVDGTTDITRTVHFGEP+ R+KECFTRVLQGH+A
Sbjct  303   IHYKPEPGSCSVLDVEKLFLLDSGAQYVDGTTDITRTVHFGEPTPRQKECFTRVLQGHMA  362

Query  1716  LDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTP  1895
             LDQAVFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GN+T 
Sbjct  363   LDQAVFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNLTS  422

Query  1896  MVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVD  2075
             +  GMVVSNEPGYYEDH+FGIRIENLL V EM+TPNRFGG+GYLGFEKLTFVPIQ K+VD
Sbjct  423   LQKGMVVSNEPGYYEDHAFGIRIENLLSVVEMNTPNRFGGVGYLGFEKLTFVPIQTKMVD  482

Query  2076  LSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
              ++LS+AE+ WLN YH QVWEKVS L+DG AR+WLW+NTRP+
Sbjct  483   SALLSSAEIDWLNDYHAQVWEKVSPLLDGSARQWLWDNTRPL  524



>ref|XP_002984553.1| hypothetical protein SELMODRAFT_445942 [Selaginella moellendorffii]
 gb|EFJ14603.1| hypothetical protein SELMODRAFT_445942 [Selaginella moellendorffii]
Length=662

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/671 (59%), Positives = 493/671 (73%), Gaps = 20/671 (3%)
 Frame = +3

Query  213   FPSSSANCRVLIVRNSS---NIAAKPSSEFQKKPRGLDQE----DRLRALRQLFSRPDIN  371
              PS   N   L   + +    I A+PSS    +    D+E     +L  LR+L S  +  
Sbjct  1     MPSPRGNLTALCSGSKNPGPGITAEPSSVRNARKNVKDKEFVPDKKLADLRKLMS--ESG  58

Query  372   IDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQL  551
             + AYI+PS+DAHQSEFIA+C+ RRAY+SGFTGSAGTAV+T +KAALWTDGRY+LQAE QL
Sbjct  59    VQAYIVPSEDAHQSEFIAECFTRRAYVSGFTGSAGTAVITLEKAALWTDGRYYLQAENQL  118

Query  552   SSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFL  731
                W LMR G+ GVP+ SEWL   LS GS +GIDPFL + + AEEL+  +S    +L F+
Sbjct  119   GPEWTLMRGGSVGVPSYSEWLRDNLSAGSAVGIDPFLVTHEGAEELRRTLSAKEIQLTFV  178

Query  732   SNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDE  911
              + NL+D+IW + RP PPK P+RVHDL YAG DV++KL   R  L  AG++ IVI+MLDE
Sbjct  179   -DRNLIDKIWLDGRPCPPKSPLRVHDLIYAGVDVAAKLSDARKKLSAAGATGIVITMLDE  237

Query  912   IAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesil  1091
             +AWL NLRG DV HSPV YAY +VE+D A LF D SK+TP+V  +L++  V ++ Y ++L
Sbjct  238   VAWLFNLRGGDVPHSPVAYAYALVEMDKATLFTDLSKVTPDVEMHLENSSVTVKEYSALL  297

Query  1092  seieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQP  1271
             S I+ LAE G+ LWLD +  N AI NA+   C  +     +  +N         G S  P
Sbjct  298   STIQRLAESGSKLWLDPTKTNMAIVNAFSDGCTGFYAKADVDGKN---------GTSDGP  348

Query  1272  HALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKD-VGLTEVEVAE  1448
              AL+R SP+S+ KA+KN+AE+ GM+  HLRDAAAL  FWAWLE +I  +   LTEVEV +
Sbjct  349   AALHRPSPLSVPKAIKNAAEMSGMKQAHLRDAAALVEFWAWLEVQIVTEKAKLTEVEVGD  408

Query  1449  KLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGT  1628
             +LL FRSKQ GFL+TSFDTI GSGANGAI+HY+ E D+C++V+   + LLDSGAQY DGT
Sbjct  409   ELLRFRSKQEGFLETSFDTICGSGANGAIVHYRAESDTCALVDDEHMLLLDSGAQYTDGT  468

Query  1629  TDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYR  1808
             TDITRTVHFG P+  +KECFTRVLQGHI++DQAVFPENTPGFVLD  ARSSLW++GLDYR
Sbjct  469   TDITRTVHFGVPTDYQKECFTRVLQGHISIDQAVFPENTPGFVLDVLARSSLWRIGLDYR  528

Query  1809  HGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKE  1988
             HGTGHGVGAALNVHEGPQ ISFRFGNMT + PGM++SNEPGYYEDH FGIRIENLL+V E
Sbjct  529   HGTGHGVGAALNVHEGPQSISFRFGNMTALQPGMIISNEPGYYEDHKFGIRIENLLHVCE  588

Query  1989  MDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRA  2168
             ++TPNRFGG+ YLGFE L+FVPIQ KL+ L +LS  +++W+N YH  VW+KVS LV+  A
Sbjct  589   VETPNRFGGVSYLGFECLSFVPIQTKLIALHLLSDEDISWVNKYHAAVWDKVSPLVNESA  648

Query  2169  REWLWNNTRPI  2201
             REWL  NT PI
Sbjct  649   REWLKRNTLPI  659



>gb|KEH24525.1| Xaa-pro aminopeptidase P [Medicago truncatula]
Length=536

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/515 (75%), Positives = 448/515 (87%), Gaps = 0/515 (0%)
 Frame = +3

Query  657   FLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVS  836
             FLF+SDAAEELK  ISK NHELV+L N NLVDEIWKE+RP+PP KP+RVH LKYAG DV+
Sbjct  17    FLFTSDAAEELKHVISKKNHELVYLYNSNLVDEIWKEARPEPPNKPVRVHGLKYAGLDVA  76

Query  837   SKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDD  1016
             SKL SLRS+L+ AGSSAI+++ LDEIAWLLNLRGSD+ HSPV+YAYLIVEIDGAKLFID+
Sbjct  77    SKLSSLRSELVQAGSSAIIVTALDEIAWLLNLRGSDIPHSPVVYAYLIVEIDGAKLFIDN  136

Query  1017  SKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRY  1196
             SK+T EV D+LK   +E+R Y SI+SEIE+LA +G++LWLD S+VNAAI NAYK ACDRY
Sbjct  137   SKVTEEVDDHLKKANIEIRPYNSIVSEIENLAARGSSLWLDTSSVNAAIVNAYKAACDRY  196

Query  1197  SRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAAL  1376
              ++   K + +      +   S  P A+++SSPVS+AKA+KN  EL+GMQ CHLRDAAAL
Sbjct  197   YQNYESKHKTRSKGFDGSIANSDVPIAVHKSSPVSLAKAIKNETELKGMQECHLRDAAAL  256

Query  1377  AHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEP  1556
             A FW WLE+EI  D  LTEVEV++KLLEFRSKQ GFLDTSFDTISGSG NGAIIHYKPEP
Sbjct  257   AQFWDWLEKEITNDRILTEVEVSDKLLEFRSKQAGFLDTSFDTISGSGPNGAIIHYKPEP  316

Query  1557  DSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFP  1736
              SCS V+ ++LFLLDSGAQYVDGTTDITRTVHFG+P++REKECFTRVLQGHIALDQAVFP
Sbjct  317   GSCSTVDANKLFLLDSGAQYVDGTTDITRTVHFGKPTTREKECFTRVLQGHIALDQAVFP  376

Query  1737  ENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVV  1916
             E+TPGFVLDAFARS LWKVGLDYRHGTGHGVGAALNVHEGPQGIS+R+GN+TP+V GM+V
Sbjct  377   EDTPGFVLDAFARSFLWKVGLDYRHGTGHGVGAALNVHEGPQGISYRYGNLTPLVNGMIV  436

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYEDH+FGIRIENLLYV+ ++TPNRFGGI YLGFEKLT+VPIQ KLVD+S+LS  
Sbjct  437   SNEPGYYEDHAFGIRIENLLYVRNVETPNRFGGIQYLGFEKLTYVPIQIKLVDVSLLSTT  496

Query  2097  EVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             E+ WLN+YH  VWEKVS L+DG AR+WLWNNT+PI
Sbjct  497   EIDWLNNYHSVVWEKVSPLLDGSARQWLWNNTQPI  531



>ref|XP_002965439.1| hypothetical protein SELMODRAFT_266905 [Selaginella moellendorffii]
 gb|EFJ32859.1| hypothetical protein SELMODRAFT_266905 [Selaginella moellendorffii]
Length=616

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/619 (61%), Positives = 466/619 (75%), Gaps = 18/619 (3%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
              + AYI+PS+DAHQSEFIA+C+ RRAYISGFTGSAGTAV+T +KAALWTDGRY+LQAE Q
Sbjct  5     GVQAYIVPSEDAHQSEFIAECFTRRAYISGFTGSAGTAVITLEKAALWTDGRYYLQAENQ  64

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVF  728
             L   W LMR G+ GVP+ SEWL   LS GS +GIDPFL + + AEEL+  +S    +L F
Sbjct  65    LGPEWTLMRGGSVGVPSYSEWLRDNLSAGSAVGIDPFLVTHEGAEELRRTLSAKEIQLTF  124

Query  729   LSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLD  908
             +   NL+D+IW + RP PPK P+RVHDL YAG DV+ KL   R  L  AG++ IVI+MLD
Sbjct  125   VDR-NLIDKIWLDGRPCPPKSPLRVHDLIYAGVDVAGKLSDARKKLSAAGATGIVITMLD  183

Query  909   EIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesi  1088
             E+AWL NLRG DV HSPV YAY +V++D A LF D SK+TP+V  +L++  V ++ Y ++
Sbjct  184   EVAWLFNLRGGDVPHSPVAYAYALVDMDKATLFTDLSKVTPDVEMHLENSSVTVKEYSAL  243

Query  1089  lseieslA-------EKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLD  1247
             LS I+  A       E G+ LWLD +  N AI NA+   C  +     +  +N       
Sbjct  244   LSTIQRCAIILMLGTESGSKLWLDPTKTNMAIVNAFSEGCTSFYAKADVDGKN-------  296

Query  1248  TNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKD-VG  1424
               G+S  P AL+R SP+S+ KA+KN+AE+ GM+  HLRDAAAL  FWAWLE +I  +   
Sbjct  297   --GISDGPAALHRPSPLSVPKAIKNAAEMSGMKQAHLRDAAALVEFWAWLEVQIVTEKAK  354

Query  1425  LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDS  1604
             LTEVEV ++L  FRSKQ GFL+TSFDTI GSGANGAI+HY+ E D+C++V+   + LLDS
Sbjct  355   LTEVEVGDELFRFRSKQEGFLETSFDTICGSGANGAIVHYRAESDTCALVDDEHMLLLDS  414

Query  1605  GAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSL  1784
             GAQY DGTTDITRTVHFG P+  +KECFTRVLQGHI++DQAVFPENTPGFVLD  ARSSL
Sbjct  415   GAQYTDGTTDITRTVHFGVPTDYQKECFTRVLQGHISIDQAVFPENTPGFVLDVLARSSL  474

Query  1785  WKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRI  1964
             W++GLDYRHGTGHGVGAALNVHEGPQ ISFRFGNMT + PGM++SNEPGYYEDH FGIRI
Sbjct  475   WRIGLDYRHGTGHGVGAALNVHEGPQSISFRFGNMTALQPGMIISNEPGYYEDHKFGIRI  534

Query  1965  ENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKV  2144
             ENLL+V E++TPNRFGG+ YLGFE L+FVPIQ KL+ L +LS  +++W+N YH  VW+KV
Sbjct  535   ENLLHVCEVETPNRFGGVSYLGFECLSFVPIQTKLMALHLLSDEDISWVNKYHAAVWDKV  594

Query  2145  SGLVDGRAREWLWNNTRPI  2201
             S LV+  AREWL  NT PI
Sbjct  595   SPLVNESAREWLKRNTLPI  613



>ref|XP_008802677.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X3 [Phoenix 
dactylifera]
Length=543

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/527 (72%), Positives = 442/527 (84%), Gaps = 9/527 (2%)
 Frame = +3

Query  648   IDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGA  827
             ++ FLFSSDAAEELKE ISK NHELVF+   NLVDEIW +SRP+PP KP RVHD+KYAG 
Sbjct  14    LEQFLFSSDAAEELKEAISKKNHELVFIYGYNLVDEIWGKSRPKPPMKPTRVHDIKYAGV  73

Query  828   DVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLF  1007
             DVS+KL SLRS+LI  G +AIVISMLDE+AWLLN+RG+DV HSPV Y+YLIVEIDGAKLF
Sbjct  74    DVSTKLSSLRSELIETGCTAIVISMLDEVAWLLNMRGNDVPHSPVFYSYLIVEIDGAKLF  133

Query  1008  IDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTAC  1187
             ID++K+T EVMD+LKS GVEL+ YESILSEIESLA +GA LWLD S+VNAAI + +K+AC
Sbjct  134   IDEAKVTKEVMDHLKSAGVELKPYESILSEIESLAARGAKLWLDTSSVNAAIVSRFKSAC  193

Query  1188  DRYSRSPGIKKRNKK---------STNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEG  1340
             +++      + R+KK         +TN   +     P  LY+ SPV++AKAVKN +E++G
Sbjct  194   NKHFAKFEKQARDKKVDGETSPDMATNKHQDTRIEGPTGLYKLSPVTLAKAVKNKSEIDG  253

Query  1341  MQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSG  1520
             M++CHLRDAAAL  FWAW+EEEI K+  LTEVEVA+KLLEFR KQ GF+DTSFDTISG G
Sbjct  254   MRSCHLRDAAALVEFWAWMEEEIHKNAVLTEVEVADKLLEFRKKQAGFMDTSFDTISGYG  313

Query  1521  ANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVL  1700
             ANGA+IHY PEPDSCS+V+   LFLLDSG QYVDGTTDITRTVHFGEP+ R+KECFTRVL
Sbjct  314   ANGAVIHYSPEPDSCSVVDDKNLFLLDSGGQYVDGTTDITRTVHFGEPTPRQKECFTRVL  373

Query  1701  QGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRF  1880
             QGHIALDQAVFPE+TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+
Sbjct  374   QGHIALDQAVFPEHTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRY  433

Query  1881  GNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQ  2060
             GNMT +  GMVVSNEPGYYED+SFGIRIENLL V+ +  PN FGGIGYLGFEKLTFVPIQ
Sbjct  434   GNMTALQKGMVVSNEPGYYEDNSFGIRIENLLLVEVVKLPNCFGGIGYLGFEKLTFVPIQ  493

Query  2061  AKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +KLVD+S+LS  E+ WLN YH QVW+K+S L+ G AREWLWNNTRP+
Sbjct  494   SKLVDVSLLSPMEINWLNDYHSQVWDKISPLLYGSAREWLWNNTRPL  540



>ref|XP_007030824.1| Metallopeptidase M24 family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY11326.1| Metallopeptidase M24 family protein isoform 2, partial [Theobroma 
cacao]
Length=497

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/525 (72%), Positives = 433/525 (82%), Gaps = 31/525 (6%)
 Frame = +3

Query  627   SPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVH  806
             +PG  +GIDPFLFS DAAEELKE ISK N ELV+L +LNLVDEIWKESRP+PP KPIRVH
Sbjct  1     APGGTVGIDPFLFSYDAAEELKEAISKKNLELVYLYDLNLVDEIWKESRPKPPNKPIRVH  60

Query  807   DLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVE  986
             DLKYAG DV SKL SL+++L+  GSSAIVISMLDE AWLLNLRGSDV HS VMYAYLIVE
Sbjct  61    DLKYAGLDVVSKLSSLKAELVGTGSSAIVISMLDEAAWLLNLRGSDVPHSSVMYAYLIVE  120

Query  987   IDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAIT  1166
             +D AKLF+D+SK+TPEVMD+LK+ GVELR Y+SILSEI  LA +GANLWLD S+VNAAI 
Sbjct  121   VDAAKLFVDNSKVTPEVMDHLKNAGVELRPYDSILSEIRRLAAQGANLWLDTSSVNAAIV  180

Query  1167  NAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQ  1346
               YK+ACD+Y  + G + + K     ++NGLS  P  +Y  SP+S+AKA+KN  ELEGMQ
Sbjct  181   ETYKSACDKYLMNHGSRGKIKNKRYGESNGLSIGPSGVYMPSPISLAKALKNPTELEGMQ  240

Query  1347  NCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGAN  1526
             N HLRDAAALA FW+WLEEEI K+V LTEV+VA+KLLEFRSKQ GFLDTSFDTISGSGAN
Sbjct  241   NSHLRDAAALAQFWSWLEEEIHKNVKLTEVDVADKLLEFRSKQDGFLDTSFDTISGSGAN  300

Query  1527  GAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQG  1706
             GAIIHYKPEP+SCS+V+ ++LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTRVL+G
Sbjct  301   GAIIHYKPEPESCSVVDPNKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLKG  360

Query  1707  HIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGN  1886
             HIALDQAVFPENTPGFVLDAFARS+LWK+GLDYRHGTGHGVGAALNVHEGPQ IS+R+GN
Sbjct  361   HIALDQAVFPENTPGFVLDAFARSALWKIGLDYRHGTGHGVGAALNVHEGPQSISYRYGN  420

Query  1887  MTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAK  2066
             MTP+  GM+VSNEPGYYEDH+FGIRIE                                K
Sbjct  421   MTPLQKGMIVSNEPGYYEDHAFGIRIE-------------------------------TK  449

Query  2067  LVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             LVDLS+LS  E+ WLN+YH QVWEKVS L++G AR+WLW+NTRP+
Sbjct  450   LVDLSLLSVEEIGWLNNYHSQVWEKVSPLLEGSARQWLWDNTRPV  494



>ref|XP_006375757.1| hypothetical protein POPTR_0013s02230g [Populus trichocarpa]
 gb|ERP53554.1| hypothetical protein POPTR_0013s02230g [Populus trichocarpa]
Length=497

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/496 (76%), Positives = 430/496 (87%), Gaps = 6/496 (1%)
 Frame = +3

Query  621   VLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIR  800
             +L P   + ++ FLFS DAAEELKE I+K NH+LV+L N NLVDEIWK SRP PP KPIR
Sbjct  5     LLGPKLVLILEQFLFSFDAAEELKEAIAKKNHKLVYLYNPNLVDEIWKGSRPMPPNKPIR  64

Query  801   VHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLI  980
             +H+LKYAG DV+SKL  LRS+LI+  SSAI++SMLDEIAWLLNLRG DV HSPVMYAYLI
Sbjct  65    IHELKYAGVDVASKLSFLRSELIDTCSSAIIVSMLDEIAWLLNLRGGDVPHSPVMYAYLI  124

Query  981   VEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAA  1160
             VE+DGAKLF+D+SK+TPEV+++LK+ GVEL+ Y++ILSEIESLA KGA LW D S+VNAA
Sbjct  125   VEVDGAKLFVDNSKVTPEVLNHLKNAGVELKPYDTILSEIESLAAKGAELWFDTSSVNAA  184

Query  1161  ITNAYKTACDRYSRSPGIKKRNKKSTNL--DTNGLSGQPHALYRSSPVSMAKAVKNSAEL  1334
             I N YK+ACDR+     I   ++K  NL   +N  S  P  +YR+SP+S+AKAVKN AEL
Sbjct  185   IVNTYKSACDRHFE---IHASDRKG-NLHNGSNNQSWGPSGVYRASPISLAKAVKNPAEL  240

Query  1335  EGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
             EGM N HLRDAAALA FW WLE EI KDV LTEV+VA+KLLEFRSKQ GF+DTSFDTISG
Sbjct  241   EGMHNSHLRDAAALAEFWVWLEGEIDKDVKLTEVDVADKLLEFRSKQAGFIDTSFDTISG  300

Query  1515  SGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTR  1694
             SGANGAIIHYKPEP+SCS+V+  +LFLLDSGAQYVDGTTDITRTVHFGEP++REKECFTR
Sbjct  301   SGANGAIIHYKPEPESCSVVDPKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTR  360

Query  1695  VLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISF  1874
             VLQGHIALDQAVFPENTPGFVLDAFARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISF
Sbjct  361   VLQGHIALDQAVFPENTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISF  420

Query  1875  RFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVP  2054
             RFGNMTP+  GM+VSNEPGYYEDH+FGIRIENLL VK++DTPNR+GGI YLGFEKLT+VP
Sbjct  421   RFGNMTPLQKGMIVSNEPGYYEDHAFGIRIENLLCVKQVDTPNRYGGIEYLGFEKLTYVP  480

Query  2055  IQAKLVDLSILSAAEV  2102
             IQ KLVDLS+LS AEV
Sbjct  481   IQTKLVDLSLLSVAEV  496



>ref|XP_007030825.1| Metallopeptidase M24 family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY11327.1| Metallopeptidase M24 family protein isoform 3, partial [Theobroma 
cacao]
Length=483

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/477 (77%), Positives = 417/477 (87%), Gaps = 0/477 (0%)
 Frame = +3

Query  546   QLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELV  725
             QLSSSW LMR+GN GVPT S+WLN +L+PG  +GIDPFLFS DAAEELKE ISK N ELV
Sbjct  1     QLSSSWTLMRAGNLGVPTTSQWLNDILAPGGTVGIDPFLFSYDAAEELKEAISKKNLELV  60

Query  726   FLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISML  905
             +L +LNLVDEIWKESRP+PP KPIRVHDLKYAG DV SKL SL+++L+  GSSAIVISML
Sbjct  61    YLYDLNLVDEIWKESRPKPPNKPIRVHDLKYAGLDVVSKLSSLKAELVGTGSSAIVISML  120

Query  906   DEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYes  1085
             DE AWLLNLRGSDV HS VMYAYLIVE+D AKLF+D+SK+TPEVMD+LK+ GVELR Y+S
Sbjct  121   DEAAWLLNLRGSDVPHSSVMYAYLIVEVDAAKLFVDNSKVTPEVMDHLKNAGVELRPYDS  180

Query  1086  ilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSG  1265
             ILSEI  LA +GANLWLD S+VNAAI   YK+ACD+Y  + G + + K     ++NGLS 
Sbjct  181   ILSEIRRLAAQGANLWLDTSSVNAAIVETYKSACDKYLMNHGSRGKIKNKRYGESNGLSI  240

Query  1266  QPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVA  1445
              P  +Y  SP+S+AKA+KN  ELEGMQN HLRDAAALA FW+WLEEEI K+V LTEV+VA
Sbjct  241   GPSGVYMPSPISLAKALKNPTELEGMQNSHLRDAAALAQFWSWLEEEIHKNVKLTEVDVA  300

Query  1446  EKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDG  1625
             +KLLEFRSKQ GFLDTSFDTISGSGANGAIIHYKPEP+SCS+V+ ++LFLLDSGAQYVDG
Sbjct  301   DKLLEFRSKQDGFLDTSFDTISGSGANGAIIHYKPEPESCSVVDPNKLFLLDSGAQYVDG  360

Query  1626  TTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDY  1805
             TTDITRTVHFGEP++REKECFTRVL+GHIALDQAVFPENTPGFVLDAFARS+LWK+GLDY
Sbjct  361   TTDITRTVHFGEPTAREKECFTRVLKGHIALDQAVFPENTPGFVLDAFARSALWKIGLDY  420

Query  1806  RHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLL  1976
             RHGTGHGVGAALNVHEGPQ IS+R+GNMTP+  GM+VSNEPGYYEDH+FGIRIE  L
Sbjct  421   RHGTGHGVGAALNVHEGPQSISYRYGNMTPLQKGMIVSNEPGYYEDHAFGIRIETKL  477



>ref|XP_008802676.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Phoenix 
dactylifera]
Length=632

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/696 (55%), Positives = 457/696 (66%), Gaps = 109/696 (16%)
 Frame = +3

Query  159   RFPLISLPIPRKLHYPLKFPSSSANCRVLIVRNS--SNIAAKPSSEFQKKPRG--LDQED  326
             RF  +S+P   +LH            R+ +   S    I A+PSSE +KK     L ++D
Sbjct  28    RFLALSVPFLGELHTRRCVALRPRYLRLSVAARSFGDGIIARPSSELRKKQSSGSLTEDD  87

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +LRALR+LFSRP I ID YIIPSQDAHQSEFIA+C+MRRAYI+GFTGSAGTAVVTK+KAA
Sbjct  88    KLRALRELFSRPGIGIDVYIIPSQDAHQSEFIAECFMRRAYITGFTGSAGTAVVTKEKAA  147

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             LWTDGRYFLQAEKQLS  W LMRSGN GVPT  EWLN VL+PG R+GIDP          
Sbjct  148   LWTDGRYFLQAEKQLSCDWKLMRSGNLGVPTTPEWLNDVLAPGCRVGIDP----------  197

Query  687   LKEDISKGN---HELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLR  857
                   +GN   H  VF S   L+ EI                          +KLF   
Sbjct  198   ------RGNDVPHSPVFYS--YLIVEI------------------------DGAKLF---  222

Query  858   SDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEID-----GAKLFIDDSK  1022
                     + +   ++D      +L+ + V   P  Y  ++ EI+     GAKL++D S 
Sbjct  223   -----IDEAKVTKEVMD------HLKSAGVELKP--YESILSEIESLAARGAKLWLDTSS  269

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRY--  1196
             +   ++   K                              S  N       K A D+   
Sbjct  270   VNAAIVSRFK------------------------------SACNKHFAKFEKQARDKKVD  299

Query  1197  -SRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAA  1373
                SP +     + T ++       P  LY+ SPV++AKAVKN +E++GM++CHLRDAAA
Sbjct  300   GETSPDMATNKHQDTRIEG------PTGLYKLSPVTLAKAVKNKSEIDGMRSCHLRDAAA  353

Query  1374  LAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPE  1553
             L  FWAW+EEEI K+  LTEVEVA+KLLEFR KQ GF+DTSFDTISG GANGA+IHY PE
Sbjct  354   LVEFWAWMEEEIHKNAVLTEVEVADKLLEFRKKQAGFMDTSFDTISGYGANGAVIHYSPE  413

Query  1554  PDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVF  1733
             PDSCS+V+   LFLLDSG QYVDGTTDITRTVHFGEP+ R+KECFTRVLQGHIALDQAVF
Sbjct  414   PDSCSVVDDKNLFLLDSGGQYVDGTTDITRTVHFGEPTPRQKECFTRVLQGHIALDQAVF  473

Query  1734  PENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMV  1913
             PE+TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ ISFR+GNMT +  GMV
Sbjct  474   PEHTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTALQKGMV  533

Query  1914  VSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSA  2093
             VSNEPGYYED+SFGIRIENLL V+ +  PN FGGIGYLGFEKLTFVPIQ+KLVD+S+LS 
Sbjct  534   VSNEPGYYEDNSFGIRIENLLLVEVVKLPNCFGGIGYLGFEKLTFVPIQSKLVDVSLLSP  593

Query  2094  AEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
              E+ WLN YH QVW+K+S L+ G AREWLWNNTRP+
Sbjct  594   MEINWLNDYHSQVWDKISPLLYGSAREWLWNNTRPL  629



>ref|XP_009626586.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nicotiana tomentosiformis]
Length=507

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/478 (73%), Positives = 403/478 (84%), Gaps = 7/478 (1%)
 Frame = +3

Query  138   HYHTRHSRFPLISLPIPRKLHYPLKFPSSSAN-CRVLIVRNSSN--IAAKPSSEFQKKPR  308
             H+  R  RF  +SLPI  K     KF S   N   +LIVR+SS+  I AKPS EFQKK  
Sbjct  24    HHPPRRFRFLSLSLPIFHKFKTCHKFSSKFPNHLNLLIVRSSSSSSITAKPSPEFQKKG-  82

Query  309   GLD---QEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGT  479
             G D   ++++LRALR+LF++P +N+DAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGT
Sbjct  83    GSDRKEEDNKLRALRELFTKPGVNVDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGT  142

Query  480   AVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPF  659
             AVVTKDKAALWTDGRYFL+AEKQL+SSW+LMR+GN GVPTPSEWLN+VL+PG RIGIDPF
Sbjct  143   AVVTKDKAALWTDGRYFLRAEKQLNSSWVLMRAGNLGVPTPSEWLNTVLAPGCRIGIDPF  202

Query  660   LFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSS  839
             LFSSDAA+E KEDISKGNHELV L + NLVDEIWKESRP PPK+PIR+HDLKYAG DVSS
Sbjct  203   LFSSDAAKEFKEDISKGNHELVLLYDFNLVDEIWKESRPTPPKEPIRLHDLKYAGVDVSS  262

Query  840   KLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDS  1019
             KL SLRS+L +AG+SAIVISMLDEIAWLLNLRG+DV HSPVMYAYL+VEIDGAKLF+DD+
Sbjct  263   KLSSLRSELRHAGASAIVISMLDEIAWLLNLRGNDVSHSPVMYAYLVVEIDGAKLFVDDT  322

Query  1020  KITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYS  1199
             K+TPEVM++L++ G+ELRAYESILSEIESLA KGANLWLD S+VNAAI NAY++AC +Y 
Sbjct  323   KVTPEVMEHLRNAGIELRAYESILSEIESLAAKGANLWLDTSSVNAAILNAYESACYKYP  382

Query  1200  RSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALA  1379
                  K R KK+ NLD++G SG P A+YRSSPVS+ KAVKN AELEGM+NCHLRDAAALA
Sbjct  383   WKSATKSRRKKTVNLDSDGQSGGPCAVYRSSPVSLRKAVKNDAELEGMRNCHLRDAAALA  442

Query  1380  HFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPE  1553
              FWAWLE+EI +DV LTEVEVA+KLLEFRS Q GFLDTSFDTISG   +  +I    E
Sbjct  443   QFWAWLEDEIQRDVILTEVEVADKLLEFRSHQDGFLDTSFDTISGILVSIIVIELNSE  500



>ref|XP_009763066.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nicotiana sylvestris]
Length=501

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/464 (75%), Positives = 396/464 (85%), Gaps = 5/464 (1%)
 Frame = +3

Query  138   HYHTRHSRFPLISLPIPRKLHYPLKFPSSSAN-CRVLIVRNSSN--IAAKPSSEFQKKP-  305
             H+  R  R   +SLPI  K     KF S S N   +LIVR+SS+  I AKPSSEFQKK  
Sbjct  24    HHPPRRFRVLSLSLPIFHKFKTCPKFSSKSPNHLNLLIVRSSSSSSITAKPSSEFQKKGG  83

Query  306   RGLDQED-RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTA  482
             R   +ED +LRALR+LF++P +N+DAYIIPSQDAHQSEFIA+CYMRRAYIS FTGSAGTA
Sbjct  84    RDRKEEDNKLRALRELFTKPGVNVDAYIIPSQDAHQSEFIAECYMRRAYISRFTGSAGTA  143

Query  483   VVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFL  662
             VVTKDKAALWTDGRYFLQAEKQL+SSW+LMR+GN GVPTPSEWLN+VL+PG RIGIDPFL
Sbjct  144   VVTKDKAALWTDGRYFLQAEKQLNSSWVLMRAGNLGVPTPSEWLNTVLAPGCRIGIDPFL  203

Query  663   FSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSK  842
             FSSDAA+E KEDISKGNHELV L + NLVDEIWKESRP PPK+PIR+H  KYAG DVSSK
Sbjct  204   FSSDAAKEFKEDISKGNHELVLLYDFNLVDEIWKESRPTPPKEPIRLHGPKYAGVDVSSK  263

Query  843   LFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSK  1022
             L SLRS+L +AG+SAIVISMLDEIAWLLNLRG+DV HSPVMYAYL+VEIDGAKLF+DD+K
Sbjct  264   LLSLRSELRHAGASAIVISMLDEIAWLLNLRGNDVPHSPVMYAYLVVEIDGAKLFVDDTK  323

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             +TPEVM++L + G+ELRAYESILSEIESLA KGANLWLD S+VNAAI NAY++AC +Y  
Sbjct  324   VTPEVMEHLTNAGIELRAYESILSEIESLAAKGANLWLDTSSVNAAIVNAYESACYKYPW  383

Query  1203  SPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             +   K R KK+ NLD+NG SG P A+YRSSPVS+ KAVKN AELEGM+NCHLRDAAALA 
Sbjct  384   NSATKSRRKKTANLDSNGQSGGPCAVYRSSPVSLRKAVKNDAELEGMRNCHLRDAAALAQ  443

Query  1383  FWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
             FWAWLE+EI +DV LTEVEVA+KLLEFRS Q GFLDTSFDTISG
Sbjct  444   FWAWLEDEIQRDVILTEVEVADKLLEFRSHQDGFLDTSFDTISG  487



>gb|KHG06386.1| putative Xaa-Pro aminopeptidase P [Gossypium arboreum]
Length=578

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/423 (74%), Positives = 367/423 (87%), Gaps = 0/423 (0%)
 Frame = +3

Query  933   RGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslA  1112
             RGSDV HSPVMYAYLIVE+DGAKLF+D+SK+T EVMD+LK+  VELR Y+SILSEI+ LA
Sbjct  153   RGSDVPHSPVMYAYLIVEVDGAKLFVDNSKVTKEVMDHLKNASVELRPYDSILSEIKRLA  212

Query  1113  EKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSS  1292
              +GA LWLD S+VNAAI   YK+A D+Y  + G K + K     ++NGLS  P  +Y  S
Sbjct  213   AQGAQLWLDTSSVNAAIVETYKSALDKYCSNHGSKGKIKNKRYDESNGLSEGPSGVYMRS  272

Query  1293  PVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSK  1472
             P+S+AKA+KN AELEGMQNCHLRDAAALA FW WLEEEI  +V L EV+VA+KLLEFR+K
Sbjct  273   PISLAKALKNPAELEGMQNCHLRDAAALAQFWCWLEEEIHNNVELIEVDVADKLLEFRAK  332

Query  1473  QYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVH  1652
             + GFLDTSFDTISGSGANGAIIHY+ E  SCS+V+ ++LFLLDSGAQY+DGTTDITRTVH
Sbjct  333   KEGFLDTSFDTISGSGANGAIIHYRAERGSCSVVDPNKLFLLDSGAQYIDGTTDITRTVH  392

Query  1653  FGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVG  1832
             FGEP++REKECFTRVL+GHIALDQAVFPENTPGFVLD FARSSLWK+GLDYRHGTGHGVG
Sbjct  393   FGEPTAREKECFTRVLKGHIALDQAVFPENTPGFVLDGFARSSLWKIGLDYRHGTGHGVG  452

Query  1833  AALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFG  2012
             AALNVHEGPQ IS+R+GN TP+  GM+VSNEPGYYEDH+FGIRIENLL+V+E++TPNR+G
Sbjct  453   AALNVHEGPQSISYRYGNTTPLQKGMIVSNEPGYYEDHAFGIRIENLLHVQEINTPNRYG  512

Query  2013  GIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNT  2192
             GI YLGFEKLTF PIQAKLVD+S++S  E+ WLN+YH QVWEKVS LV+G AR+WLWNNT
Sbjct  513   GIEYLGFEKLTFFPIQAKLVDISLISDDEIEWLNNYHSQVWEKVSPLVEGSARQWLWNNT  572

Query  2193  RPI  2201
             R I
Sbjct  573   RVI  575


 Score =   146 bits (368),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 5/132 (4%)
 Frame = +3

Query  156  SRFPLIS--LPIPRKLHY-PLKFPSSSANCRVLIVR--NSSNIAAKPSSEFQKKPRGLDQ  320
            SR P  S  LPI  K    P  +  S      L +R  +S ++ AK SSE ++     + 
Sbjct  21   SRLPFFSFSLPIFHKFKINPSIYNKSQKVPLFLTLRCCSSGSVTAKHSSELRRNRDVQEP  80

Query  321  EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
            ++++ ALR+LFS+P I IDAYIIPSQDAHQSEFIA+CYMRRAYISGFTGSAGTAVVTKDK
Sbjct  81   DEKVVALRRLFSKPGIGIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDK  140

Query  501  AALWTDGRYFLQ  536
            AALWTDGRYFLQ
Sbjct  141  AALWTDGRYFLQ  152



>ref|XP_006433333.1| hypothetical protein CICLE_v100005701mg, partial [Citrus clementina]
 gb|ESR46573.1| hypothetical protein CICLE_v100005701mg, partial [Citrus clementina]
Length=500

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/434 (74%), Positives = 365/434 (84%), Gaps = 1/434 (0%)
 Frame = +3

Query  243   LIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFI  422
             L +RN ++I AKPSSEF +       +++LRALR+LFSRP +NIDAYIIPSQDAHQSEFI
Sbjct  56    LFIRNCTSITAKPSSEFNRNRTQDAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFI  115

Query  423   ADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTP  602
             A+CYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT 
Sbjct  116   AECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTT  175

Query  603   SEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQP  782
              EWLN VL+PG R+GIDPFLFSSDAAEELKE I+K NHELV+L +LNLVD IWKESRP+P
Sbjct  176   FEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKP  235

Query  783   PKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPV  962
             P KPIRVH LKYAG DV+SKL SLRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPV
Sbjct  236   PNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPV  295

Query  963   MYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDK  1142
             MYAYLIVE+D AKLF+DDSK+TP+VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD 
Sbjct  296   MYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDP  355

Query  1143  STVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKN  1322
             S+VNAAI N Y+ A ++Y  S    K++K   + DT G SG P  ++R+SP++ +KAVKN
Sbjct  356   SSVNAAIMNTYEIAIEKYLTSNN-NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKN  414

Query  1323  SAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFD  1502
             SAELEGM N HLRDAAALA FW WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFD
Sbjct  415   SAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFD  474

Query  1503  TISGSGANGAIIHY  1544
             TISG   +  +I Y
Sbjct  475   TISGISTSEILITY  488



>ref|XP_006433332.1| hypothetical protein CICLE_v100005701mg [Citrus clementina]
 gb|ESR46572.1| hypothetical protein CICLE_v100005701mg [Citrus clementina]
Length=529

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/447 (73%), Positives = 369/447 (83%), Gaps = 7/447 (2%)
 Frame = +3

Query  243   LIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFI  422
             L +RN ++I AKPSSEF +       +++LRALR+LFSRP +NIDAYIIPSQDAHQSEFI
Sbjct  56    LFIRNCTSITAKPSSEFNRNRTQDAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFI  115

Query  423   ADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTP  602
             A+CYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT 
Sbjct  116   AECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTT  175

Query  603   SEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQP  782
              EWLN VL+PG R+GIDPFLFSSDAAEELKE I+K NHELV+L +LNLVD IWKESRP+P
Sbjct  176   FEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKP  235

Query  783   PKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPV  962
             P KPIRVH LKYAG DV+SKL SLRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPV
Sbjct  236   PNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPV  295

Query  963   MYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDK  1142
             MYAYLIVE+D AKLF+DDSK+TP+VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD 
Sbjct  296   MYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDP  355

Query  1143  STVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKN  1322
             S+VNAAI N Y+ A ++Y  S    K++K   + DT G SG P  ++R+SP++ +KAVKN
Sbjct  356   SSVNAAIMNTYEIAIEKYLTSNN-NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKN  414

Query  1323  SAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFD  1502
             SAELEGM N HLRDAAALA FW WLEEEI     LTEV+VA+KLLEFRSKQ GFLDTSFD
Sbjct  415   SAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFD  474

Query  1503  TISGSGANGAIIHY------KPEPDSC  1565
             TISG   +  +I Y        EPD C
Sbjct  475   TISGISTSEILITYLLAYLFPFEPDLC  501



>ref|XP_002958447.1| hypothetical protein VOLCADRAFT_77935 [Volvox carteri f. nagariensis]
 gb|EFJ40447.1| hypothetical protein VOLCADRAFT_77935 [Volvox carteri f. nagariensis]
Length=630

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/614 (50%), Positives = 406/614 (66%), Gaps = 3/614 (0%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
              + AY++P++D H SE+  +    R YISGFTG+AGT VVT D A LWTDGRYFLQA  +
Sbjct  9     GVSAYVVPTEDPHMSEYPPEHLKFRQYISGFTGTAGTVVVTTDAALLWTDGRYFLQAAAE  68

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELV-  725
             L   W LM++G  G P   +WL + L  G+R+GIDP++ + ++   L+  +      LV 
Sbjct  69    LGPEWTLMKAGTAGCPDLEDWLATNLPQGARVGIDPWVHTVNSVRNLQRKLEDAGKVLVP  128

Query  726   FLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISML  905
              LS+ NLV  IW E RP  P  P+RVHD+++AG DV +KL  +R  + NAG++A++   L
Sbjct  129   LLSDGNLVGNIWGEGRPPAPSTPLRVHDMQWAGEDVPAKLGRMREQMRNAGATALLAPSL  188

Query  906   DEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYes  1085
             DE+AWL N RG DV H+PV  +Y ++  D A L++D +K+   V  +L   GV+++AYE+
Sbjct  189   DEVAWLYNTRGGDVDHNPVALSYALITADSAVLYVDTAKVVNPVAQHLAEAGVQVKAYET  248

Query  1086  ilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSG  1265
             +L ++ ++A  G  LWLD + V+ A    + +A      +      N   +     G+  
Sbjct  249   LLDDVAAVAATGGRLWLDPARVSYAGAPTHGSAGGAREANGDHHVSNNGGSAAAGGGVKA  308

Query  1266  QPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVA  1445
                 +   SPV+ AKA+KN +EL GM+  HLRDA A+  F  WLE+++     ++EVEV 
Sbjct  309   PFRPVELPSPVTAAKAIKNPSELAGMREAHLRDAVAVCQFMKWLEDKVGSGATVSEVEVD  368

Query  1446  EKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDG  1625
             E L  FR +Q GF++TSF TI+G+G NGAIIHY+ +P SC  V+ + L LLDSG QY  G
Sbjct  369   EVLTGFRRQQQGFVETSFATIAGAGPNGAIIHYRAQPGSCRHVDDNTLLLLDSGGQYDCG  428

Query  1626  TTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDY  1805
             TTDITRTVH G PS  ++ CFTRVLQGHIALD A++PE TPG  LD  AR  LW+ GL+Y
Sbjct  429   TTDITRTVHTGTPSDHQRRCFTRVLQGHIALDSAIWPEGTPGAALDPLARLPLWREGLNY  488

Query  1806  RHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVK  1985
             RHGTGHGVGAALNVHEGPQ IS R+   TP+ P MV SNEPGYYED SFG+RIENL+ V 
Sbjct  489   RHGTGHGVGAALNVHEGPQAISMRYHITTPLAPAMVCSNEPGYYEDGSFGVRIENLVVVV  548

Query  1986  EMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGR  2165
             E +TP R+ G  YLGFE+LT VP+QAKLVD ++LS  E AWL+ YH +VWE+VS  +  +
Sbjct  549   EKETPFRYAGQQYLGFERLTLVPMQAKLVDTALLSPQEAAWLDGYHREVWERVSPRMQDQ  608

Query  2166  AR--EWLWNNTRPI  2201
                 EWL  NTRP+
Sbjct  609   PELLEWLRTNTRPL  622



>ref|XP_005647728.1| Creatinase/aminopeptidase [Coccomyxa subellipsoidea C-169]
 gb|EIE23184.1| Creatinase/aminopeptidase [Coccomyxa subellipsoidea C-169]
Length=606

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/620 (51%), Positives = 399/620 (64%), Gaps = 27/620 (4%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
             N+ AYIIP++D H SE+      RR +IS FTGSA TAVVT D A LWTDGRYFLQA +Q
Sbjct  5     NVQAYIIPTEDPHMSEYSTSDAERRHFISRFTGSAATAVVTTDAAMLWTDGRYFLQASQQ  64

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVF  728
             L  +W LMRSG  G P   EWL   +  G  +GIDPFL + D A +LKE +      L  
Sbjct  65    LGPAWTLMRSGTPGCPEIPEWLAENVQDGDAVGIDPFLHTVDNARKLKEQLEAAGKGLRP  124

Query  729   LSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLD  908
             +   NLVD +W   RP  P  P+RVH L++AG  VS KL ++R+ +  A ++ ++++ LD
Sbjct  125   IYG-NLVDRVWGSDRPAAPSAPLRVHALEHAGQSVSDKLTAVRAKMKGAKANVLLLTALD  183

Query  909   EIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesi  1088
             EIAWL NLRGSDV ++PV  +Y  V  D AKLF+D  K+TPEV  +L   GVEL AYE +
Sbjct  184   EIAWLFNLRGSDVSYNPVFLSYATVTEDAAKLFVDAGKVTPEVKSHLSEAGVELGAYEGM  243

Query  1089  lseieslAEKGANLWLDKSTVNAAITNAYKTAC---DRYSRSPGIKKRNKKSTNLDTNGL  1259
             L E+ SLA      W D + V+  +T     A    D Y++   ++K             
Sbjct  244   LDEVRSLAAARQIFWADPTKVHHVMTRWCDVAAGKADDYAKKMFVEK-------------  290

Query  1260  SGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVE  1439
                       SPV+  KAVKN AEL GM+  HLRDA ALA     LE+EI     LTEV+
Sbjct  291   ---------PSPVAGVKAVKNPAELAGMREAHLRDAVALAETLYHLEQEIAAGRTLTEVD  341

Query  1440  VAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYV  1619
             V + L   R+ Q GF++ SF TI+GSG NGAIIHY+ +PD+C+ V+  +L L+DSG QY 
Sbjct  342   VDDFLTGRRAAQGGFIEPSFPTIAGSGPNGAIIHYRAQPDTCNTVSGSQLLLVDSGGQYD  401

Query  1620  DGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGL  1799
              GTTD+TRT H GEP+  +K CFTRVLQGHIALD AVFP  TPG  LD  AR+ LW +GL
Sbjct  402   CGTTDVTRTFHLGEPTKHQKVCFTRVLQGHIALDSAVFPTGTPGLALDTLARAPLWSMGL  461

Query  1800  DYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLY  1979
             +YRHGTGHGVGAALNVHEGPQ IS R+    P+  GMVVSNEPGYYE+  FGIRIENLL 
Sbjct  462   NYRHGTGHGVGAALNVHEGPQSISTRYTITYPLEAGMVVSNEPGYYEEGEFGIRIENLLV  521

Query  1980  VKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVD  2159
             VKE DTP RFG   YL FE+LT  P+Q K++DL ++S++E+ W+N YH +VW+K S  + 
Sbjct  522   VKEADTPFRFGEQPYLSFERLTMCPLQRKMIDLDVMSSSEIEWVNQYHEEVWDKASPRLS  581

Query  2160  GRAREWLWNNTRPIDSSPTP  2219
             G   EWL  NT  +  +P P
Sbjct  582   GDVLEWLRANTASL-QAPIP  600



>emb|CEG00173.1| Creatinase [Ostreococcus tauri]
Length=627

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/629 (49%), Positives = 407/629 (65%), Gaps = 12/629 (2%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +L ALR +    +++IDA I+PSQD H SE++A  + RR Y+S FTGSAGT VVT  KA 
Sbjct  5     QLTALRAVMK--EVSIDAVIVPSQDPHFSEYVAAAFERRRYVSDFTGSAGTCVVTATKAL  62

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNS----VLSPGSRIGIDPFLFSSD  674
             LWTDGRYF QAE +L+ +W LMRSG  G P   +WL      +   G R+GIDP + S  
Sbjct  63    LWTDGRYFKQAEDELAEAWTLMRSGTKGTPDVRKWLAGDEAGLAGNGGRVGIDPNVHSVS  122

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
              A  L+E +     ELV L   NLVD+IW + RP   K P+RVH L+YAG  V  KL  +
Sbjct  123   EARALREVLKAVGCELVSLEE-NLVDKIWSD-RPAAAKTPLRVHPLEYAGKSVEEKLEDM  180

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             R+ +       +V+S LD++ WLLN+RG D   +PV  +Y +V    A  ++D  K+T  
Sbjct  181   RAKMRENEVDKLVVSSLDDVMWLLNVRGGDAPCNPVTLSYALVGESDATFYVDLDKVTAP  240

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V  +L++  V ++ Y+ +  ++   A +G  LW+D   V+ A+    ++A D  S     
Sbjct  241   VKAHLEAANVTIKPYDDMSRDVHDAASRGEKLWMDIDKVSIAM---LESAEDGNSVRKAT  297

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
             K     + N D +  S        + P+ +AKAVKN AE+ GM   HL D AA++ FW W
Sbjct  298   KATKSDAQN-DASSSSVVVAVKEGTCPIPIAKAVKNEAEMAGMVEAHLMDGAAMSEFWCW  356

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             +E+EI     + E E  EK+LEFRSKQ GF++ SF TI+G G +GAI+HY+   +S   +
Sbjct  357   IEKEISSGRTIDEYEAGEKVLEFRSKQKGFVEESFPTIAGEGPHGAIVHYRASKESARTI  416

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             ++  L L DSG Q+  GTTD+TRTVHFG PS+ +KEC+TRVLQGHIALDQ VFP  T GF
Sbjct  417   SKDSLLLCDSGGQFACGTTDVTRTVHFGTPSAHQKECYTRVLQGHIALDQMVFPTGTKGF  476

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             VLDAFARS LW  GLDYRHGTGHGVGAALNVHEGPQGIS RFGNMT +VPGM++SNEPGY
Sbjct  477   VLDAFARSHLWANGLDYRHGTGHGVGAALNVHEGPQGISPRFGNMTELVPGMILSNEPGY  536

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIE LL VK+ +T + FG  G+L F+ LT +PIQ KL+DL I+S  E+AW+N
Sbjct  537   YEDGAFGIRIETLLQVKKAETKHNFGDTGFLCFDVLTLIPIQTKLMDLGIMSDKEIAWVN  596

Query  2115  SYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +YH +VW+ +   V G   +WL     PI
Sbjct  597   AYHQKVWDNIHPRVAGETLQWLERACAPI  625



>ref|XP_003082710.1| putative X-prolyl aminopeptidase (ISS) [Ostreococcus tauri]
Length=688

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/629 (49%), Positives = 407/629 (65%), Gaps = 12/629 (2%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +L ALR +    +++IDA I+PSQD H SE++A  + RR Y+S FTGSAGT VVT  KA 
Sbjct  66    QLTALRAVMK--EVSIDAVIVPSQDPHFSEYVAAAFERRRYVSDFTGSAGTCVVTATKAL  123

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNS----VLSPGSRIGIDPFLFSSD  674
             LWTDGRYF QAE +L+ +W LMRSG  G P   +WL      +   G R+GIDP + S  
Sbjct  124   LWTDGRYFKQAEDELAEAWTLMRSGTKGTPDVRKWLAGDEAGLAGNGGRVGIDPNVHSVS  183

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
              A  L+E +     ELV L   NLVD+IW + RP   K P+RVH L+YAG  V  KL  +
Sbjct  184   EARALREVLKAVGCELVSLEE-NLVDKIWSD-RPAAAKTPLRVHPLEYAGKSVEEKLEDM  241

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             R+ +       +V+S LD++ WLLN+RG D   +PV  +Y +V    A  ++D  K+T  
Sbjct  242   RAKMRENEVDKLVVSSLDDVMWLLNVRGGDAPCNPVTLSYALVGESDATFYVDLDKVTAP  301

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V  +L++  V ++ Y+ +  ++   A +G  LW+D   V+ A+    ++A D  S     
Sbjct  302   VKAHLEAANVTIKPYDDMSRDVHDAASRGEKLWMDIDKVSIAM---LESAEDGNSVRKAT  358

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
             K     + N D +  S        + P+ +AKAVKN AE+ GM   HL D AA++ FW W
Sbjct  359   KATKSDAQN-DASSSSVVVAVKEGTCPIPIAKAVKNEAEMAGMVEAHLMDGAAMSEFWCW  417

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             +E+EI     + E E  EK+LEFRSKQ GF++ SF TI+G G +GAI+HY+   +S   +
Sbjct  418   IEKEISSGRTIDEYEAGEKVLEFRSKQKGFVEESFPTIAGEGPHGAIVHYRASKESARTI  477

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             ++  L L DSG Q+  GTTD+TRTVHFG PS+ +KEC+TRVLQGHIALDQ VFP  T GF
Sbjct  478   SKDSLLLCDSGGQFACGTTDVTRTVHFGTPSAHQKECYTRVLQGHIALDQMVFPTGTKGF  537

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             VLDAFARS LW  GLDYRHGTGHGVGAALNVHEGPQGIS RFGNMT +VPGM++SNEPGY
Sbjct  538   VLDAFARSHLWANGLDYRHGTGHGVGAALNVHEGPQGISPRFGNMTELVPGMILSNEPGY  597

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIE LL VK+ +T + FG  G+L F+ LT +PIQ KL+DL I+S  E+AW+N
Sbjct  598   YEDGAFGIRIETLLQVKKAETKHNFGDTGFLCFDVLTLIPIQTKLMDLGIMSDKEIAWVN  657

Query  2115  SYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +YH +VW+ +   V G   +WL     PI
Sbjct  658   AYHQKVWDNIHPRVAGETLQWLERACAPI  686



>ref|XP_005847344.1| hypothetical protein CHLNCDRAFT_23797 [Chlorella variabilis]
 gb|EFN55242.1| hypothetical protein CHLNCDRAFT_23797 [Chlorella variabilis]
Length=658

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/643 (48%), Positives = 408/643 (63%), Gaps = 21/643 (3%)
 Frame = +3

Query  321   EDRLRALRQLFSRPD--INIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTK  494
             + +L  +R   +R D    I A+I+PS+D H +  + +C  RR +ISGF GSAGTAVV  
Sbjct  21    DPKLVRIRAAMARADGGRGIQAFIVPSEDPHMASCVGECDARREFISGFDGSAGTAVVCL  80

Query  495   DKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSD  674
             D AALWTDGRYFLQAE QL   W LMR G    P   EWL   L  GSR+GIDP + + D
Sbjct  81    DTAALWTDGRYFLQAEAQLGPDWTLMRHGTPNCPEVHEWLAEHLPEGSRVGIDPAVHTVD  140

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
             AAE+LK  +     +LV L + N VDE W E RP PP+ P+RVH L++AG  V+ KL  L
Sbjct  141   AAEKLKAKLRAAGKQLVALGS-NPVDEAW-EGRPAPPEAPLRVHPLEWAGQSVAQKLDGL  198

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             R  L  AG+ A++++MLDE+AWL NLRG DV ++PV  +Y +V  DGA L++D  K+TPE
Sbjct  199   RRQLAEAGAGALLVTMLDEVAWLFNLRGGDVAYNPVFLSYGVVTADGATLYVDPRKVTPE  258

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAA--ITNAYKTACDRYSRSP  1208
             V  +L   GV ++ Y +++ ++  +A  G  +WLD S V AA  I       C   +   
Sbjct  259   VAAHLGEAGVVVKEYGALMGDVRGMAAAGTKIWLDPSRVRAAAGIAEMCPGGCSVLTIHT  318

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              I+     S +     L+   H       V++AK+VKN AEL G++  HLRD  AL  F 
Sbjct  319   RIRPTPLPSAHTPHPRLAAGCHP---PPAVTLAKSVKNDAELAGLREAHLRDGVALTQFL  375

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
              W+E+E+     LTEVE+ E+L   R+ Q GF++ SF TI+G+G NGA+IHY+ +P +C 
Sbjct  376   CWVEKEVAGGRVLTEVEIDEELTARRAAQPGFVEPSFPTIAGAGPNGAVIHYRAQPGTCR  435

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              V+   L LLDSGAQ+  GTTDITRT+HFG P+  +K CFT VLQGH+ALD AV+PE TP
Sbjct  436   AVDASTLLLLDSGAQFDCGTTDITRTMHFGSPTPHQKACFTAVLQGHVALDSAVWPEGTP  495

Query  1749  GFVLDAFARSSLWKVGLDYR----------HGTGHGVGAALNVHEGPQGISFRFGNMTPM  1898
             G  +D  AR+ LW +GL+YR          HGTGHGVGAALNVHEGPQ IS RF N  P+
Sbjct  496   GCAIDVLARTPLWALGLNYRQACCRAAAAWHGTGHGVGAALNVHEGPQSISSRFWNTQPL  555

Query  1899  VPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDL  2078
             +  MV SNEPGYYED +FGIRIENL  V E  TP RF G  Y   E+LT  P+Q K++ +
Sbjct  556   LERMVCSNEPGYYEDGAFGIRIENLFVVVEAATPFRFAGQPYYTCERLTVCPLQKKMIAV  615

Query  2079  SILSAAEVAWLNSYHLQVWEKVSGLVDGRAR--EWLWNNTRPI  2201
               LS  EVAW+++YH QVWE ++  ++G+A   EWL   T P+
Sbjct  616   EQLSQKEVAWVDAYHRQVWEALAPRLEGQAEELEWLRQATSPL  658



>emb|CDS07624.1| hypothetical protein LRAMOSA01573 [Absidia idahoensis var. thermophila]
Length=607

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/629 (50%), Positives = 409/629 (65%), Gaps = 31/629 (5%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             DRL ALR L    + N+DA++IPS+D+HQSE+IADC  RR +ISGFTGSAG A+V+  +A
Sbjct  7     DRLSALRALMKSQEYNVDAFLIPSEDSHQSEYIADCDKRRHWISGFTGSAGFAIVSTHEA  66

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             AL+TDGRYFLQA +QL S+W LM+ G  GVPT  E+L   L  GSRIG+DP L ++  A 
Sbjct  67    ALFTDGRYFLQASEQLDSNWTLMKQGLPGVPTWQEYLVKNLPAGSRIGVDPKLITASDAR  126

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             +L   +S     LV +   NLVD+ W   RP  PK  + V  +K+AG   + KL  LR  
Sbjct  127   QLSSSLSTVGSSLVVIHE-NLVDKAWGAERPLAPKDHVIVQPIKFAGKSHADKLEDLRKY  185

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             ++  G+  +V+S LDE+AWL NLRGSDV  +PV Y+Y I+    A L++D +K+   V +
Sbjct  186   IVEKGAYGVVVSALDEVAWLFNLRGSDVECNPVFYSYAIISKADAVLYVDPAKVPDAVKE  245

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +L S  V L+ Y+                         AI +  +   D  + S G K  
Sbjct  246   HLGS-HVTLKPYD-------------------------AIFDDLRKLSDTLASS-GEKLI  278

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
                 T+L     +G+ +     S ++ AKA+KN AEL+GM++CHLRDAAAL H++AWLE+
Sbjct  279   ANSKTSLAVEVAAGKDNVQEERSFINDAKAIKNDAELKGMRDCHLRDAAALVHYFAWLEK  338

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             ++     L EV+ A+KL  FR++Q  ++  SFDTIS +G NGAIIHYKPE D+C +++  
Sbjct  339   QLKAGTKLDEVDGADKLEGFRAQQGDYVGLSFDTISSTGENGAIIHYKPEKDTCKVIDIK  398

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             +++L DSG QY DGTTD+TRT HFGEP++ EK CFTRVLQGHIA+D AVFP+ T GF+LD
Sbjct  399   QIYLCDSGGQYKDGTTDVTRTYHFGEPTAYEKRCFTRVLQGHIAIDSAVFPQGTTGFLLD  458

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYE  1940
              FAR +LWK GLD+RHGTGHGVG+ LNVHEGPQGI  R   N TP+  GM V+NEPGYYE
Sbjct  459   PFARHALWKDGLDFRHGTGHGVGSFLNVHEGPQGIGVRIAYNDTPLAVGMTVTNEPGYYE  518

Query  1941  DHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSY  2120
             D  FGIRIEN+L V++ DTP+ FG  GYLGFE +T VPI   L+D  +LS  E  W+N Y
Sbjct  519   DGKFGIRIENVLIVRKADTPHNFGDRGYLGFEHVTLVPIGLNLIDKELLSPEEKKWVNDY  578

Query  2121  HLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             H +   K+  LV  D  A  WL   T PI
Sbjct  579   HAECLAKIGPLVASDPDAVAWLKRETTPI  607



>ref|XP_001421129.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99422.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=626

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/623 (48%), Positives = 406/623 (65%), Gaps = 21/623 (3%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +L A+R+  ++  +   A ++PSQD H   ++A C+ RR ++S FTGSAGT VVT   A 
Sbjct  11    KLAAVREAMAKRGVR--AVVVPSQDPHFRRYVAACFERRRWLSDFTGSAGTVVVTDAAAL  68

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNS----VLSPGSRIGIDPFLFSSD  674
             LWTDGRYF+QAE +LS  W LMRSG   VP   +WL +    +   G+++GIDP + S  
Sbjct  69    LWTDGRYFVQAEDELSEDWTLMRSGVKDVPDVKKWLCAEEAGLAFTGAKVGIDPNVHSVS  128

Query  675   AAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSL  854
              A  L+E +S    EL+ +   NLVD +W + RP  PK P+RVH ++YAG  V+ KL +L
Sbjct  129   EARGLREALSACGIELMSVEE-NLVDLVWSD-RPPFPKTPLRVHPMEYAGKSVAEKLENL  186

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             R  +    +  +V+S LD++ WL N+RG D   +PV  +Y++V  + A  ++D  K TPE
Sbjct  187   REKMKENDAQKLVVSSLDDVMWLCNVRGGDAPCNPVTLSYVLVGENDASFYVDTDKATPE  246

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V+ +L    V ++ YE +  ++ + A++G  LW+D   V+ A+    +      + +P  
Sbjct  247   VVAHLAEANVTIKPYEDMAKDVYAAAQRGERLWMDVDKVSIAMLEQAEAG---AAEAPKD  303

Query  1215  KKRNKKSTNLDTNGLSGQPHALYR-SSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
              K+ K  +          P A+   + PV +AKAVKN AE+ GM   HL D AA+A FW 
Sbjct  304   AKKVKTES---------APSAIKEGTCPVPIAKAVKNEAEMAGMVEAHLMDGAAMAEFWC  354

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
              +E ++ +   + E E  E++L  R+KQ GF + SF TI+G G +GA++HY+    S   
Sbjct  355   AIERDVAEGRAIDEYEAGERVLACRAKQNGFFEESFPTIAGEGPHGAVVHYRASKKSARA  414

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             + +  L L DSG QY  GTTD+TRTVHFG P++ +KEC+TRVLQGHIALDQ VFP  T G
Sbjct  415   IGKDSLLLCDSGGQYACGTTDVTRTVHFGTPTAHQKECYTRVLQGHIALDQMVFPVGTKG  474

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPG  1931
             FVLDAFARS LW  GLDYRHGTGHGVGAALNVHEGPQGIS RFGNMTP++PGM++SNEPG
Sbjct  475   FVLDAFARSHLWANGLDYRHGTGHGVGAALNVHEGPQGISPRFGNMTPLMPGMILSNEPG  534

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYED +FGIRIE LL VKE  T + FG  G+L F+ LT +PIQ KL+DLSI+S  E+AW+
Sbjct  535   YYEDGAFGIRIETLLQVKEAKTAHNFGDTGFLCFDVLTLIPIQTKLMDLSIMSEKEIAWV  594

Query  2112  NSYHLQVWEKVSGLVDGRAREWL  2180
             N+YH +VW+++S  V G  + WL
Sbjct  595   NAYHEKVWQQISPRVSGETKTWL  617



>ref|XP_002503206.1| peptidase [Micromonas sp. RCC299]
 gb|ACO64464.1| peptidase [Micromonas sp. RCC299]
Length=627

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/613 (49%), Positives = 394/613 (64%), Gaps = 13/613 (2%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
              +DA+I+PSQD H SE++  C+ RR +ISGFTGSAGTA+VT D+A LWTDGRYFLQAE++
Sbjct  18    GVDAFIVPSQDPHFSEYVPTCFERRMFISGFTGSAGTALVTHDEALLWTDGRYFLQAEQE  77

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVF  728
             L   W LMR G  GVP PS+WL   ++ GS++G+DP + S   A  L+  +      LV 
Sbjct  78    LGPEWTLMRGGQPGVPEPSKWLADKMAKGSKVGVDPAVHSLSEARALRSALEAAGSALVT  137

Query  729   LSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLD  908
             L ++N VD +W   RP  P  P+RVH  +++G  V+ K+  +R+ L    S  +V+S LD
Sbjct  138   L-DVNPVDTVWDADRPAFPTAPLRVHKAEFSGKSVADKVDFIRAKLDENKSDVLVVSPLD  196

Query  909   EIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesi  1088
             E+AWL N+RG D+ ++PV   Y +V  D A L++D  K+T EV  +L   GV ++ Y+  
Sbjct  197   EVAWLFNVRGGDLDYNPVTLGYGLVSKDEACLYVDLGKVTNEVRAHLDEAGVVVKPYDDC  256

Query  1089  lseieslAEKGANLWLDKSTVNAA-ITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSG  1265
               ++ + A  G  LW+D   V+ A +  A + A          K  N  +      G+S 
Sbjct  257   AGDMRAAAAAGKTLWIDADKVSVALVEAAEEAAAAAGPAEKKAKTENDDAKKTIKEGVS-  315

Query  1266  QPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVA  1445
                      P+ +AKAVKN AEL GM   HLRD  A+A FW WL+E+  +     E E+ 
Sbjct  316   ---------PIPLAKAVKNEAELAGMLEAHLRDGVAMASFWCWLDEQAAQGKEWDEYEIG  366

Query  1446  EKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDG  1625
             E + +FR++Q GF + SF TI+G G +GAIIHY+   +S   V ++ L L DSG QY  G
Sbjct  367   EWVSKFRAEQPGFSEESFATIAGEGPHGAIIHYRASVESARKVGQNSLLLCDSGGQYDCG  426

Query  1626  TTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDY  1805
             TTD+TRT H G P+  +K  +TRVLQGHI L  AVFP++T GFVLDAFAR  LW+ GLDY
Sbjct  427   TTDVTRTHHLGTPTDHQKNAYTRVLQGHIGLTTAVFPQDTSGFVLDAFARRHLWEAGLDY  486

Query  1806  RHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVK  1985
             RHGTGHGVGAALNVHEGPQ IS RFGNMT +VPGM++SNEPGYYED  FGIRIENLL V+
Sbjct  487   RHGTGHGVGAALNVHEGPQSISPRFGNMTGLVPGMILSNEPGYYEDGGFGIRIENLLVVR  546

Query  1986  EMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLV-DG  2162
             E  T + FG   YL F+ LT +PIQ KL+D S++S AEVAWLN YH  VWEKVS  V D 
Sbjct  547   EAKTSHNFGDKKYLTFDYLTHIPIQKKLIDFSLMSGAEVAWLNQYHAVVWEKVSPRVTDE  606

Query  2163  RAREWLWNNTRPI  2201
             + + WL     P+
Sbjct  607   KVKAWLKEACAPV  619



>ref|XP_001422825.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01184.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=608

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/609 (48%), Positives = 398/609 (65%), Gaps = 19/609 (3%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
              + A ++PSQD H   ++A C+ RR ++S FTGSAGT VVT   A LWTDGRYF+QAE +
Sbjct  5     GVRAVVVPSQDPHFRRYVAACFERRRWLSDFTGSAGTVVVTDAAALLWTDGRYFVQAEDE  64

Query  549   LSSSWILMRSGNWGVPTPSEWLNS----VLSPGSRIGIDPFLFSSDAAEELKEDISKGNH  716
             LS  W LMRSG   VP   +WL +    +   G+++GIDP + S   A  L+E +S    
Sbjct  65    LSEDWTLMRSGVKDVPDVKKWLCAEEAGLAFTGAKVGIDPNVHSVSEARGLREALSACGI  124

Query  717   ELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVI  896
             EL+ +   NLVD +W + RP  PK P+RVH ++YAG  V+ KL +LR  +    +  +V+
Sbjct  125   ELMSVEE-NLVDLVWSD-RPPFPKTPLRVHPMEYAGKSVAEKLENLREKMKENDAQKLVV  182

Query  897   SMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRA  1076
             S LD++ WL N+RG D   +PV  +Y++V  + A  ++D  K TPEV+ +L    V ++ 
Sbjct  183   SSLDDVMWLCNVRGGDAPCNPVTLSYVLVGENDASFYVDTDKATPEVVAHLAEANVTIKP  242

Query  1077  YesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNG  1256
             YE +  ++ + A++G  LW+D   V+ A+    +      + +P   K+ K  +      
Sbjct  243   YEDMAKDVYAAAQRGERLWMDVDKVSIAMLEQAEAG---AAEAPKDAKKVKTES------  293

Query  1257  LSGQPHALYR-SSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTE  1433
                 P A+   + PV +AKAVKN AE+ GM   HL D AA+A FW  +E ++ +   + E
Sbjct  294   ---APSAIKEGTCPVPIAKAVKNEAEMAGMVEAHLMDGAAMAEFWCAIERDVAEGRAIDE  350

Query  1434  VEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQ  1613
              E  E++L  R+KQ GF + SF TI+G G +GA++HY+    S   + +  L L DSG Q
Sbjct  351   YEAGERVLACRAKQNGFFEESFPTIAGEGPHGAVVHYRASKKSARAIGKDSLLLCDSGGQ  410

Query  1614  YVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKV  1793
             Y  GTTD+TRTVHFG P++ +KEC+TRVLQGHIALDQ VFP  T GFVLDAFARS LW  
Sbjct  411   YACGTTDVTRTVHFGTPTAHQKECYTRVLQGHIALDQMVFPVGTKGFVLDAFARSHLWAN  470

Query  1794  GLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENL  1973
             GLDYRHGTGHGVGAALNVHEGPQGIS RFGNMTP++PGM++SNEPGYYED +FGIRIE L
Sbjct  471   GLDYRHGTGHGVGAALNVHEGPQGISPRFGNMTPLMPGMILSNEPGYYEDGAFGIRIETL  530

Query  1974  LYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGL  2153
             L VKE  T + FG  G+L F+ LT +PIQ KL+DLSI+S  E+AW+N+YH +VW+++S  
Sbjct  531   LQVKEAKTAHNFGDTGFLCFDVLTLIPIQTKLMDLSIMSEKEIAWVNAYHEKVWQQISPR  590

Query  2154  VDGRAREWL  2180
             V G  + WL
Sbjct  591   VSGETKTWL  599



>ref|XP_003347197.1| hypothetical protein SMAC_08089 [Sordaria macrospora k-hell]
 sp|D1ZKF3.1|AMPP1_SORMK RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Sordaria macrospora k-hell]
 emb|CCC13968.1| unnamed protein product [Sordaria macrospora k-hell]
Length=614

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/635 (48%), Positives = 408/635 (64%), Gaps = 28/635 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  DRL ALR L     ++I  Y++PS+D+H SE+I DC  RR +ISGF+GSAGTAVVT
Sbjct  3     VNTTDRLAALRSLMKERSVDI--YVVPSEDSHASEYITDCDARRTFISGFSGSAGTAVVT  60

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL  +W L+++G   VPT  EW     + G  +GIDP L S 
Sbjct  61    LDKAALATDGRYFNQASKQLDENWHLLKTGLQDVPTWQEWTADESAGGKTVGIDPTLISP  120

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               AE+L  DI K     +     NLVD +W ESRP  P +P+ +   KYAG   + KL  
Sbjct  121   AVAEKLNGDIKKHGGSGLKAVTENLVDLVWGESRPPRPSEPVFLLGAKYAGKGAAEKLTD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++A V+SMLDEIAWL NLRG+D+ ++PV ++Y IV  D A L++D+SK+T 
Sbjct  181   LRKELEKKKAAAFVVSMLDEIAWLFNLRGNDITYNPVFFSYAIVTKDSATLYVDESKLTD  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTV-NAAITNAYKTACDRYSRSP  1208
             EV  YL   G E++ Y               +L+ D   + NAA + +      +Y  S 
Sbjct  241   EVKQYLAENGTEIKPY--------------TDLFKDTEVLANAAKSTSESEKPTKYLVS-  285

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G+ H     SP+  AKA+KN  ELEGM+ CH+RD AAL  ++
Sbjct  286   -----NKASWALKL-ALGGEKHVDEVRSPIGDAKAIKNETELEGMRKCHIRDGAALIKYF  339

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EVE A++L +FRS+Q  F+  SFDTIS +G NGAIIHYKPE  +C
Sbjct  340   AWLEDQLVNKKAKLNEVEAADQLEKFRSEQSDFVGLSFDTISSTGPNGAIIHYKPERGAC  399

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S+++ + ++L DSGAQ+ DGTTD+TRT+HFG+P++ EK+ +T VL+G+IALD AVFP+ T
Sbjct  400   SVIDPNAIYLCDSGAQFYDGTTDVTRTLHFGQPTAAEKKSYTLVLKGNIALDTAVFPKGT  459

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LDA AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+ PG V+S 
Sbjct  460   SGFALDALARQFLWKYGLDYRHGTGHGVGSFLNVHEGPIGIGTRKAYIDVPLAPGNVLSI  519

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED ++GIRIENL  V+E+ T ++FG   YLGFE +T VP   KL+D S+L+  E 
Sbjct  520   EPGYYEDGNYGIRIENLAIVREVKTEHQFGDKPYLGFEHITMVPYCRKLIDESLLTQEEK  579

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPI  2201
              WLN  + ++ + ++G  DG     +WL   T P 
Sbjct  580   DWLNKSNEEIRKNMAGYFDGDQLTTDWLLRETSPF  614



>ref|XP_009850898.1| hypothetical protein NEUTE1DRAFT_122163 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO57808.1| hypothetical protein NEUTE1DRAFT_122163 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ71920.1| Creatinase/aminopeptidase [Neurospora tetrasperma FGSC 2509]
Length=614

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/635 (48%), Positives = 410/635 (65%), Gaps = 28/635 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  DRL ALR L    + N+D Y++PS+D+H SE+IA+C  RRA+ISGFTGSAGTAVVT
Sbjct  3     VNTTDRLAALRSLMK--ERNVDIYVVPSEDSHASEYIAECDARRAFISGFTGSAGTAVVT  60

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL  +W L+++G   VPT  EW     + G  +GIDP L S 
Sbjct  61    LDKAALATDGRYFNQASKQLDENWHLLKTGLQDVPTWQEWTADESAGGKSVGIDPTLISP  120

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A++L  DI K     +   N NLVD +W +SRP  P +P+ +   KY+G   + KL +
Sbjct  121   AVADKLDGDIKKHGGAGLKAINENLVDLVWGDSRPPRPSEPVFLLGAKYSGKGTAEKLTN  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++A V+SMLDEIAWL NLRG+D+ ++PV ++Y IV  D A L++D+SK+  
Sbjct  181   LRKELEKKKAAAFVVSMLDEIAWLFNLRGNDITYNPVFFSYAIVTKDSATLYVDESKLND  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTV-NAAITNAYKTACDRYSRSP  1208
             EV  YL   G  ++ Y               +L+ D   + NAA + +      +Y  S 
Sbjct  241   EVKQYLAENGTGIKPYN--------------DLFKDTEILANAAKSTSEPDKPTKYLVS-  285

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G+ H     SP+  AKA+KN  ELEGM+ CH+RD AAL  ++
Sbjct  286   -----NKASWALKL-ALGGEKHVDEVRSPIGDAKAIKNETELEGMRRCHIRDGAALIKYF  339

Query  1389  AWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE++ I K   L EVE A++L +FRS+Q  F+  SFDTIS +G NGAIIHYKPE  +C
Sbjct  340   AWLEDQLINKKAKLDEVEAADQLEQFRSEQADFVGLSFDTISSTGPNGAIIHYKPERGAC  399

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S+++ + ++L DSGAQ+ DGTTD+TRT+HFG+P+  E++ +T VL+G+IALD AVFP+ T
Sbjct  400   SVIDPNAIYLCDSGAQFYDGTTDVTRTLHFGQPTDAERKSYTLVLKGNIALDTAVFPKGT  459

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LDA AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+ PG V+S 
Sbjct  460   SGFALDALARQFLWKYGLDYRHGTGHGVGSFLNVHEGPIGIGTRKAYIDVPLAPGNVLSI  519

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED ++GIRIENL  V+E+ T ++FG   YLGFE +T VP   KL+D S+L+  E 
Sbjct  520   EPGYYEDGNYGIRIENLAIVREVKTEHQFGDKPYLGFEHVTMVPYCRKLIDESLLTQEEK  579

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPI  2201
              WLN  + ++ + ++G  DG     EWL   T P 
Sbjct  580   DWLNKSNEEIRKNMAGYFDGDQLTTEWLLRETSPF  614



>ref|XP_957236.1| hypothetical protein NCU00112 [Neurospora crassa OR74A]
Length=614

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/635 (48%), Positives = 409/635 (64%), Gaps = 28/635 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  DRL ALR L    + N+D Y++PS+D+H SE+IA+C  RRA+ISGFTGSAGTAVVT
Sbjct  3     VNTTDRLAALRSLMK--ERNVDIYVVPSEDSHASEYIAECDARRAFISGFTGSAGTAVVT  60

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL  +W L+++G   VPT  EW     + G  +GIDP L S 
Sbjct  61    LDKAALATDGRYFNQASKQLDENWHLLKTGLQDVPTWQEWTADESAGGKSVGIDPTLISP  120

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A++L  DI K     +   N NLVD +W +SRP  P +P+ +   KY+G   + KL +
Sbjct  121   AVADKLDGDIKKHGGAGLKAINENLVDLVWGDSRPPRPSEPVFLLGAKYSGKGTAEKLTN  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++A V+SMLDE+AWL NLRG+D+ ++PV ++Y IV  D A L++D+SK+  
Sbjct  181   LRKELEKKKAAAFVVSMLDEVAWLFNLRGNDITYNPVFFSYAIVTKDSATLYVDESKLND  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTV-NAAITNAYKTACDRYSRSP  1208
             EV  YL   G  ++ Y               +L+ D   + NAA + +      +Y  S 
Sbjct  241   EVKQYLAENGTGIKPYN--------------DLFKDTEILANAAKSTSESDKPTKYLVS-  285

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G+ H     SP+  AKA+KN  ELEGM+ CH+RD AAL  ++
Sbjct  286   -----NKASWALKL-ALGGEKHVDEVRSPIGDAKAIKNETELEGMRRCHIRDGAALIKYF  339

Query  1389  AWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE++ I K   L EVE A++L +FRS+Q  F+  SFDTIS +G NGAIIHYKPE  +C
Sbjct  340   AWLEDQLINKKAKLDEVEAADQLEQFRSEQADFVGLSFDTISSTGPNGAIIHYKPERGAC  399

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S+++   ++L DSGAQ+ DGTTD+TRT+HFG+P+  E++ +T VL+G+IALD AVFP+ T
Sbjct  400   SVIDPDAIYLCDSGAQFCDGTTDVTRTLHFGQPTDAERKSYTLVLKGNIALDTAVFPKGT  459

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LDA AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+ PG V+S 
Sbjct  460   SGFALDALARQFLWKYGLDYRHGTGHGVGSFLNVHEGPIGIGTRKAYIDVPLAPGNVLSI  519

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED ++GIRIENL  V+E+ T ++FG   YLGFE +T VP   KL+D S+L+  E 
Sbjct  520   EPGYYEDGNYGIRIENLAIVREVKTEHQFGDKPYLGFEHVTMVPYCRKLIDESLLTQEEK  579

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPI  2201
              WLN  + ++ + ++G  DG     EWL   T P 
Sbjct  580   DWLNKSNEEIRKNMAGYFDGDQLTTEWLLRETSPF  614



>sp|Q5AVF0.2|AMPP1_EMENI RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Aspergillus nidulans FGSC 
A4]
 tpe|CBF79990.1| TPA: aminopeptidase P, putative (AFU_orthologue; AFUA_5G08050) 
[Aspergillus nidulans FGSC A4]
Length=654

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/682 (46%), Positives = 418/682 (61%), Gaps = 35/682 (5%)
 Frame = +3

Query  168   LISLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQ  347
             L S P P +L + L F  S       + R S    +   S F      +D   RL +LRQ
Sbjct  2     LFSRP-PARLSWILAFQPSQK-----LPRYSPRFFSISVSRFAIDMEAVDTTKRLSSLRQ  55

Query  348   LFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRY  527
             L    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+++ ++AAL TDGRY
Sbjct  56    LMR--EHKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIISLNEAALSTDGRY  113

Query  528   FLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISK  707
             F QA KQL ++W L++ G  GVPT  EW+      G  +G+DP L +  AA  L + + K
Sbjct  114   FNQAAKQLDNNWTLLKRGVEGVPTSQEWITQQAEGGKVVGVDPALITGAAARSLSDALQK  173

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
                 L+ +S  NLVD +W   RP PP++ +RVH  KYAG     K+  LR +L N  ++ 
Sbjct  174   SGASLIGVSQ-NLVDLVWGNDRPAPPREKVRVHPEKYAGKSFQEKVSDLRKELENKKAAG  232

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
              VISMLDEIAWLLNLRGSD+ ++PV  +Y IV     +L+IDD K+TPEV  +L    V 
Sbjct  233   FVISMLDEIAWLLNLRGSDIPYNPVFISYCIVTPTKVELYIDDEKLTPEVKAHLGD-DVI  291

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLD  1247
             ++ Y+              +++ D      A+  A K   D  S    +  R   + NL 
Sbjct  292   IKPYD--------------SIFADAK----ALFEAKKKDPDAPSSKFLLSNRASWALNL-  332

Query  1248  TNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEIC-KDVG  1424
                L G+ H     SP+  AKAVKN  EL GM+ CH+RD AAL  ++AWLE E+  K   
Sbjct  333   --SLGGEDHVEEIRSPIGDAKAVKNEVELAGMRACHIRDGAALIEYFAWLENELVNKKST  390

Query  1425  LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDS  1604
             L EV+ A+KL + RSKQ  F   SFDTIS +G NGA+IHYKPE  SCS+++ + ++L DS
Sbjct  391   LDEVDAADKLEQLRSKQELFAGLSFDTISSTGPNGAVIHYKPEKGSCSVIDPNAIYLCDS  450

Query  1605  GAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSL  1784
             G QY+DGTTD+TRT HFG+P+  EK+ FT VL+G I LD AVFP+ T GF LD  AR  L
Sbjct  451   GGQYLDGTTDVTRTFHFGQPTELEKKAFTLVLKGCIGLDSAVFPKGTSGFALDVLARQHL  510

Query  1785  WKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSFGIR  1961
             WK GLD+ HGTGHG+G+ LNVHEGP GI  R      P+ PG V+S+EPG+YED  FGIR
Sbjct  511   WKEGLDFLHGTGHGIGSYLNVHEGPVGIGTRVQYTEVPLAPGNVISDEPGFYEDGKFGIR  570

Query  1962  IENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEK  2141
             IEN++ V+E+ T ++FG   +LGFE +T  PI   L++ S+LS +E+ WLN YH +VWEK
Sbjct  571   IENVIMVREVQTTHKFGERPWLGFEHVTMCPIGQNLIEPSLLSDSEIKWLNDYHAEVWEK  630

Query  2142  VSGLV--DGRAREWLWNNTRPI  2201
                    D   R+WL   TRPI
Sbjct  631   THKYFENDEVTRKWLERETRPI  652



>sp|Q7RYL6.2|AMPP1_NEUCR RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Neurospora crassa OR74A]
 gb|EAA28000.2| aminopeptidase P [Neurospora crassa OR74A]
 gb|KHE89492.1| hypothetical protein GE21DRAFT_4394 [Neurospora crassa]
Length=684

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/678 (46%), Positives = 424/678 (63%), Gaps = 33/678 (5%)
 Frame = +3

Query  183   IPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRP  362
             +PR L     FP  S   R   +  +S +     +   ++   ++  DRL ALR L    
Sbjct  35    LPRAL---TAFPQPSRTTRAFSL--TSRLFQHLRAASDEETMTVNTTDRLAALRSLMK--  87

Query  363   DINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAE  542
             + N+D Y++PS+D+H SE+IA+C  RRA+ISGFTGSAGTAVVT DKAAL TDGRYF QA 
Sbjct  88    ERNVDIYVVPSEDSHASEYIAECDARRAFISGFTGSAGTAVVTLDKAALATDGRYFNQAS  147

Query  543   KQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHEL  722
             KQL  +W L+++G   VPT  EW     + G  +GIDP L S   A++L  DI K     
Sbjct  148   KQLDENWHLLKTGLQDVPTWQEWTADESAGGKSVGIDPTLISPAVADKLDGDIKKHGGAG  207

Query  723   VFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISM  902
             +   N NLVD +W +SRP  P +P+ +   KY+G   + KL +LR +L    ++A V+SM
Sbjct  208   LKAINENLVDLVWGDSRPPRPSEPVFLLGAKYSGKGTAEKLTNLRKELEKKKAAAFVVSM  267

Query  903   LDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYe  1082
             LDE+AWL NLRG+D+ ++PV ++Y IV  D A L++D+SK+  EV  YL   G  ++ Y 
Sbjct  268   LDEVAWLFNLRGNDITYNPVFFSYAIVTKDSATLYVDESKLNDEVKQYLAENGTGIKPYN  327

Query  1083  silseieslAEKGANLWLDKSTV-NAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGL  1259
                           +L+ D   + NAA + +      +Y  S      NK S  L    L
Sbjct  328   --------------DLFKDTEILANAAKSTSESDKPTKYLVS------NKASWALKL-AL  366

Query  1260  SGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICKDVGLTEV  1436
              G+ H     SP+  AKA+KN  ELEGM+ CH+RD AAL  ++AWLE++ I K   L EV
Sbjct  367   GGEKHVDEVRSPIGDAKAIKNETELEGMRRCHIRDGAALIKYFAWLEDQLINKKAKLDEV  426

Query  1437  EVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQY  1616
             E A++L +FRS+Q  F+  SFDTIS +G NGAIIHYKPE  +CS+++   ++L DSGAQ+
Sbjct  427   EAADQLEQFRSEQADFVGLSFDTISSTGPNGAIIHYKPERGACSVIDPDAIYLCDSGAQF  486

Query  1617  VDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVG  1796
              DGTTD+TRT+HFG+P+  E++ +T VL+G+IALD AVFP+ T GF LDA AR  LWK G
Sbjct  487   CDGTTDVTRTLHFGQPTDAERKSYTLVLKGNIALDTAVFPKGTSGFALDALARQFLWKYG  546

Query  1797  LDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSNEPGYYEDHSFGIRIENL  1973
             LDYRHGTGHGVG+ LNVHEGP GI  R   +  P+ PG V+S EPGYYED ++GIRIENL
Sbjct  547   LDYRHGTGHGVGSFLNVHEGPIGIGTRKAYIDVPLAPGNVLSIEPGYYEDGNYGIRIENL  606

Query  1974  LYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGL  2153
               V+E+ T ++FG   YLGFE +T VP   KL+D S+L+  E  WLN  + ++ + ++G 
Sbjct  607   AIVREVKTEHQFGDKPYLGFEHVTMVPYCRKLIDESLLTQEEKDWLNKSNEEIRKNMAGY  666

Query  2154  VDGR--AREWLWNNTRPI  2201
              DG     EWL   T P 
Sbjct  667   FDGDQLTTEWLLRETSPF  684



>ref|XP_007727599.1| xaa-Pro aminopeptidase [Capronia coronata CBS 617.96]
 gb|EXJ80405.1| xaa-Pro aminopeptidase [Capronia coronata CBS 617.96]
Length=618

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/634 (47%), Positives = 407/634 (64%), Gaps = 23/634 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR L  +    +D YI+PS+D+HQSE+IA C  RRAYISGFTGSAGTAV+T
Sbjct  4     IDTSKRLAQLRDLMRQH--KLDVYIVPSEDSHQSEYIAPCDARRAYISGFTGSAGTAVIT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL S+W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  62    LEKAALATDGRYFNQASKQLDSNWHLLKQGMEDVPTWQEWTTEQAEGGKTVGVDPTVITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +LKE + K +   +   + NLVDEIW +  P+P +K I + ++ YAG     KL  
Sbjct  122   SDARKLKETLKKKSQATLVGISENLVDEIWTDRPPRPAEKVIVLSEV-YAGKPYKDKLDD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++ +V+SMLDE+AWL NLRGSD+ ++PV ++Y  V    A L++D SK+ P
Sbjct  181   LRKELKKKKAAGMVVSMLDEVAWLFNLRGSDIPYNPVFFSYAAVTPKSAILYVDSSKVGP  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV ++L  V VE++ Y++              L+ D + +     N  +T     S +P 
Sbjct  241   EVKEHLNGV-VEIKPYDA--------------LFSDLTDIAQTAVNELQTDEITKSHTPK  285

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
             +   NK S  L   GL G+       SPV+ AKA+KN+ ELEGM+ CH+RD AAL  ++A
Sbjct  286   LLLSNKSSWALSL-GLGGEEKVEESRSPVADAKAIKNATELEGMRQCHIRDGAALIEYFA  344

Query  1392  WLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE+E+  +   L EV+ A+KL E RSK   F+  SFDTIS +G N A+IHY PE  +C+
Sbjct  345   WLEDELVNNHAWLDEVQAADKLEEIRSKGEHFVGLSFDTISATGPNAAVIHYSPERGNCA  404

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++   ++L DSGAQY+DGTTD TRT+HFGEP+  EK+ +T VL+G I LD+AVFP+ T 
Sbjct  405   VIDSKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMEKKAYTLVLKGVIGLDRAVFPKGTT  464

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+E
Sbjct  465   GFAIDAFARQHLWRQGLDYRHGTGHGVGSFLNVHEGPIGIGTRAAYSEVSLSIGNVISDE  524

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED SFGIRIEN++  +E  T ++FG   ++GFE +T VP+  KL+D S+L   E  
Sbjct  525   PGYYEDGSFGIRIENVIMAREAKTNHKFGDKPWIGFEHVTMVPMCRKLIDPSLLDPEEKV  584

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             WLN YH +VW+K SG    D +  +WL   T PI
Sbjct  585   WLNEYHKEVWDKTSGFFTNDEKTTKWLKRETAPI  618



>ref|XP_001216942.1| hypothetical protein ATEG_08321 [Aspergillus terreus NIH2624]
 sp|Q0CDB3.1|AMPP1_ASPTN RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Aspergillus terreus NIH2624]
 gb|EAU31494.1| hypothetical protein ATEG_08321 [Aspergillus terreus NIH2624]
Length=654

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/634 (47%), Positives = 400/634 (63%), Gaps = 29/634 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  +RL  LRQL    D  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+V+
Sbjct  44    VDTTERLSRLRQLMK--DHQVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIVS  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W+L++ G  GV T  EW       G  +G+DP L ++
Sbjct  102   LTKAALSTDGRYFNQASKQLDSNWVLLKRGVEGVQTWQEWTTEQAEGGKVVGVDPALITA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E + K    L  +   NLVD +W   RP PP++ + VH  K+AG     K+  
Sbjct  162   SGARSLSETLQKNGSSLKGIRP-NLVDLVWGNDRPSPPREKVTVHPEKFAGKSFQDKISE  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++  VISMLDEIAWL NLRG+D+ ++PV ++Y I+    A+L++DD K+TP
Sbjct  221   LRKELEKKKTAGFVISMLDEIAWLFNLRGTDIPYNPVFFSYAIITPTTAELYVDDDKLTP  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ Y+              +++ D   ++AA       A  ++  S  
Sbjct  281   EVKAHLGQ-DVVVKPYD--------------SIYADAEALSAARKQDAGDAAPKFLLS--  323

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+       SP++ AKAVKN  EL GM+ CH+RD AAL  ++A
Sbjct  324   ----NKASWALSLS-LGGEEQTEEVRSPIADAKAVKNDVELSGMRACHIRDGAALIEYFA  378

Query  1392  WLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E+  K   L EV+ A+KL + RSK   F   SFDTIS +G NGA+IHYKPE  SCS
Sbjct  379   WLENELVNKKTTLDEVDAADKLEQIRSKHELFAGLSFDTISSTGPNGAVIHYKPEKGSCS  438

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++ + ++L DSGAQ++DGTTD+TRT HFG+P+  EK+ FT VL+G IALD AVFP+ T 
Sbjct  439   IIDPNAIYLCDSGAQFLDGTTDVTRTFHFGKPTELEKKAFTLVLKGMIALDSAVFPKGTS  498

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LD  AR  LW+ GLDY HGTGHG+G+ LNVHEGP GI  R      P+ PG V+SNE
Sbjct  499   GFALDVLARQYLWQEGLDYLHGTGHGIGSYLNVHEGPMGIGTRVQYTEVPIAPGNVISNE  558

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED  FGIRIEN++  +E+ TP++FG   +LGFE +T  PI   L++ S+LS +E+ 
Sbjct  559   PGFYEDGKFGIRIENVIMAREVQTPHKFGDRPWLGFEHVTMAPIGLNLIEPSLLSDSEIK  618

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             W+N YH +VWEK       D R R WL   T+PI
Sbjct  619   WVNDYHAEVWEKTHHFFQNDERTRSWLQRETQPI  652



>ref|XP_001274245.1| Exocyst complex component Sec8, putative [Aspergillus clavatus 
NRRL 1]
 sp|A1CAQ1.1|AMPP1_ASPCL RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Aspergillus clavatus NRRL 
1]
 gb|EAW12819.1| Exocyst complex component Sec8, putative [Aspergillus clavatus 
NRRL 1]
Length=658

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/638 (47%), Positives = 402/638 (63%), Gaps = 33/638 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  +RL  LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+V+
Sbjct  44    VNTSERLARLRQLMQ--EHKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIVS  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W+L++ G   VPT  EW       G  +G+DP L ++
Sbjct  102   MTKAALSTDGRYFNQASKQLDSNWLLLKRGVENVPTWQEWTTEQAEGGKVVGVDPSLITA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E + K    LV +   NLVD +W E RP PP++ +RVH  K+AG     K+  
Sbjct  162   PGARSLAETLRKNGSSLVGVQQ-NLVDLVWGEDRPAPPREKVRVHPDKFAGKSFQEKITD  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L N  ++  VISMLDEIAWL NLRGSD+ ++PV +AY I+    A L+ID+ K+TP
Sbjct  221   LRKELENKKTAGFVISMLDEIAWLFNLRGSDIPYNPVFFAYAIITPTTADLYIDEEKLTP  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ Y+              +++ D + ++ A       A  ++  S  
Sbjct  281   EVTSHLGQ-DVVIKPYD--------------SIFADATALSEARKQDAGEAAAKFLLS--  323

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+ H     SP++ AKAVKN AEL GM+ CH+RD AAL  ++A
Sbjct  324   ----NKASWALSLS-LGGEEHVEETRSPIADAKAVKNEAELAGMRACHIRDGAALIEYFA  378

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E + K   L EV+ A+KL + RSK   F   SFDTIS +G NGA+IHYKPE  SC+
Sbjct  379   WLENELVSKKTSLDEVDAADKLEQIRSKHDLFAGLSFDTISSTGPNGAVIHYKPEKGSCA  438

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSGAQY+DGTTD+TRT HFG+P+  EK+ FT VL+G IA+D AVFP+ T 
Sbjct  439   IIDPEAIYLCDSGAQYLDGTTDVTRTFHFGQPTELEKKAFTLVLKGMIAIDSAVFPKGTS  498

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LD  AR  LWK GLDY HGTGHG+G+ LNVHEGP GI  R      P+ PG V+S+E
Sbjct  499   GFALDVLARQFLWKEGLDYLHGTGHGIGSYLNVHEGPIGIGTRVQYTEVPIAPGNVISDE  558

Query  1926  PGYYEDHSFGIRIE----NLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSA  2093
             PG+YED  FGIRIE    +++  +E+ T ++FG   +LGFE +T  PI   L++ S+LS 
Sbjct  559   PGFYEDGKFGIRIEICLADVIMAREVQTTHKFGDKPWLGFEHVTMAPIGRNLIEPSLLSE  618

Query  2094  AEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             +E+ W+N YH ++WEK       D   R WL   T+PI
Sbjct  619   SELKWVNDYHAEIWEKTHHFFENDEFTRSWLQRETQPI  656



>ref|XP_753831.1| aminopeptidase P [Aspergillus fumigatus Af293]
 sp|Q4WUD3.1|AMPP1_ASPFU RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Aspergillus fumigatus Af293]
 sp|B0Y3V7.1|AMPP1_ASPFC RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Aspergillus fumigatus A1163]
 gb|EAL91793.1| aminopeptidase P, putative [Aspergillus fumigatus Af293]
 gb|EDP51548.1| aminopeptidase P, putative [Aspergillus fumigatus A1163]
Length=654

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/629 (47%), Positives = 396/629 (63%), Gaps = 29/629 (5%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LRQL    +  ID YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+V+  KAA
Sbjct  49    RLARLRQLMQ--EHKIDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIVSMTKAA  106

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA KQL S+W L++ G   VPT  EW       G  +G+DP L ++  A  
Sbjct  107   LSTDGRYFNQASKQLDSNWELLKRGVENVPTWQEWTTEQAQGGKVVGVDPALITASGARS  166

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L+E + +    LV +S  NLVD +W + RP PP++ +RVH  K++G     K+  LR +L
Sbjct  167   LEETLKRNGSSLVGISQ-NLVDLVWGKDRPAPPREKVRVHPDKFSGKTFQEKIADLRKEL  225

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
                 ++  VISMLDEIAWL NLRGSD+ ++PV +AY I+    A+L+IDD KITPEV+ +
Sbjct  226   EKKKTAGFVISMLDEIAWLFNLRGSDIPYNPVFFAYAIITPTKAELYIDDDKITPEVVAH  285

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             L    V ++ Y               +++ D   ++ A          ++  S      N
Sbjct  286   LGQ-DVVIKPYN--------------SIFADAKALSEARRKEAGETASKFLLS------N  324

Query  1227  KKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE  1406
             K S  L  + L G+ H     SP++ AKA+KN  EL GM+ CH+RD AAL  ++AWLE E
Sbjct  325   KASWALSLS-LGGEEHVEETRSPIADAKAIKNEVELAGMRACHIRDGAALIEYFAWLENE  383

Query  1407  IC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             +  K   L EV+ A+KL + R+K   F   SFDTIS +G NGA+IHYKPE  +CSI++  
Sbjct  384   LVNKKTVLDEVDAADKLEQIRTKHDLFAGLSFDTISSTGPNGAVIHYKPEKGTCSIIDPD  443

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
              ++L DSGAQY+DGTTD+TRT HFG+P+  EK+ FT VL+G IA+D AVFP+ T GF LD
Sbjct  444   AIYLCDSGAQYLDGTTDVTRTFHFGKPTELEKKAFTLVLKGLIAIDTAVFPKGTSGFALD  503

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYE  1940
             A AR  LWK GLDY HGTGHGVG+ LNVHEGP GI  R      P+ PG V+S+EPG+YE
Sbjct  504   ALARQYLWKEGLDYLHGTGHGVGSYLNVHEGPIGIGTRVQYTEVPIAPGNVISDEPGFYE  563

Query  1941  DHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSY  2120
             D  FGIRIEN++  +E+ T ++FG   +LGFE +T  PI   L++ S+LS  E+ W+N Y
Sbjct  564   DGKFGIRIENVIMAREVQTTHKFGDKPWLGFEHVTMAPIGRNLIEPSLLSDLELKWVNDY  623

Query  2121  HLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             H +VW+K       D   R WL   T PI
Sbjct  624   HAEVWDKTHHFFENDEFTRSWLQRETAPI  652



>ref|XP_007792825.1| putative xaa-pro aminopeptidase protein [Eutypa lata UCREL1]
 gb|EMR68082.1| putative xaa-pro aminopeptidase protein [Eutypa lata UCREL1]
Length=673

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/655 (46%), Positives = 404/655 (62%), Gaps = 28/655 (4%)
 Frame = +3

Query  246   IVRNSSNIAAKPSSEFQKKPRG-----LDQEDRLRALRQLFSRPDIN-IDAYIIPSQDAH  407
             +V  + NI    ++    + R      +D+ D    L QL    D N +D YI+PS+D+H
Sbjct  30    LVTGTGNIRLTATTNLNIRLRSTAVIRMDKVDTTAQLSQLRQLMDANKVDVYIVPSEDSH  89

Query  408   QSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNW  587
              SE+IADC  RRA+ISGF+GSAG AVVT DKAAL TDGRYF QA KQL  +W+L++ G  
Sbjct  90    SSEYIADCDARRAFISGFSGSAGCAVVTLDKAALATDGRYFNQASKQLDGNWLLLKQGIQ  149

Query  588   GVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISK-GNHELVFLSNLNLVDEIWK  764
              VPT  EW     + G  + +DP L +S+ A++L E I K G  +LV L+  NLVD++W 
Sbjct  150   DVPTWQEWTAEQSAGGKIVAVDPTLLTSNVAKKLLEKIKKSGGKDLVPLAG-NLVDQVWG  208

Query  765   ESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSD  944
             + R   P +P+ V   +++G DV++KL  LR +L    S   V+SMLDE+AWL NLRG+D
Sbjct  209   DERSARPSEPVIVLGQQFSGKDVTTKLTELRKELDKNKSLGFVVSMLDEVAWLFNLRGND  268

Query  945   VRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGA  1124
             + ++PV ++Y I+  D A L++D SK+ P    YL   GV ++ Y +I        E   
Sbjct  269   IPYNPVFFSYAIITPDEATLYVDSSKLDPGCQSYLDKNGVSVKPYHAIF-------EDAT  321

Query  1125  NLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSM  1304
              L     + NA  +   K        S  +K+            L G        SP+S 
Sbjct  322   ALSQSARSANAEDSGEQKKFIISNRASWALKR-----------ALGGDAMVTELRSPISD  370

Query  1305  AKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYG  1481
             AKA+KN  ELEGM++CH+RD AAL  ++AWLE++ I K   + EVE A+KL   R+KQ  
Sbjct  371   AKAIKNDTELEGMRSCHVRDGAALIEYFAWLEDQLIQKKAQIDEVEGADKLESLRAKQKD  430

Query  1482  FLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGE  1661
             ++  SFDTIS +GAN A+IHYKP+P  C+ ++ + ++L DSGAQY+DGTTD+TRT+HFG 
Sbjct  431   YVGLSFDTISSTGANAAVIHYKPQPGKCATIDSNAVYLCDSGAQYLDGTTDVTRTLHFGN  490

Query  1662  PSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAAL  1841
             P+  E E +T VLQG+IALD AVFP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ L
Sbjct  491   PTDAEIEAYTLVLQGNIALDMAVFPKGTTGFALDCLARQHLWRQGLDYRHGTGHGVGSYL  550

Query  1842  NVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGI  2018
             NVHEGP GI  R   +  P+ PG V+SNEPG+Y D SFGIRIEN++  +E+ T + FG  
Sbjct  551   NVHEGPIGIGTRIQFSEVPLSPGNVISNEPGFYVDGSFGIRIENIIMAREVKTKHSFGDR  610

Query  2019  GYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLW  2183
              YLGFE +T VP   KL+D S+L+  E  WLN Y+  +W K  G  +G      W
Sbjct  611   PYLGFEHVTMVPYCRKLIDPSLLTNVERQWLNEYNADIWNKTKGYFEGDQLTLAW  665



>ref|XP_001838946.1| aminopeptidase P [Coprinopsis cinerea okayama7#130]
 sp|A8P5H7.1|AMPP1_COPC7 RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Coprinopsis cinerea okayama7#130]
 gb|EAU82877.1| aminopeptidase P [Coprinopsis cinerea okayama7#130]
Length=622

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/633 (47%), Positives = 403/633 (64%), Gaps = 22/633 (3%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   +L ALR+L  +   N+D +++PS+D H SE++A C  RRA+ISGF GSAG AV+T
Sbjct  9     VDTSKQLAALRELMKKE--NVDVWVVPSEDQHYSEYLAHCDERRAFISGFNGSAGCAVIT  66

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKA L+TDGRYFLQAEKQL S+W LM+ G   VPT  ++L+  L    +IGID  + + 
Sbjct  67    LDKAYLFTDGRYFLQAEKQLDSNWTLMKQGLPDVPTWQDFLHKTLDGSLKIGIDATIITE  126

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             + A  L+++++    ELV  S  NLVD +W   RP  P+ P+   D KY+G     K+  
Sbjct  127   EDAAGLRKNLAPKKSELV-PSKKNLVDIVWGSERPARPQNPVFHLDEKYSGQSFKEKVKK  185

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             +R ++      A V++MLDE+AWL NLRGSD+ ++PV +AY +V  D   LFI++ ++  
Sbjct  186   VREEIAKEKGKAFVVTMLDEVAWLFNLRGSDIDYNPVFFAYAVVTPDEVVLFINEKQLDD  245

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
                DYL    V++R Y+ +   ++ L  K  +L  DK      +T+    A       P 
Sbjct  246   AARDYLGQ-DVKIRGYDELYDYLKELP-KSLSLTGDKDGEKILVTSRTSLAITETITPPS  303

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 + +ST           H + RS PV   KA+KN+ E+EG + CH+RD AALA ++A
Sbjct  304   ----SPESTTF---------HKVVRS-PVGDLKAIKNAVEIEGFRQCHIRDGAALARYFA  349

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLEE + +   ++E   AE L ++RS+   F   SF TIS +G NGAIIHY P+P  C+I
Sbjct  350   WLEEALNEGKEVSEYAGAEVLEKYRSELDLFRGLSFTTISSTGPNGAIIHYSPDPQDCAI  409

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             + + +++L DSGAQ+ DGTTD+TRT HFG P   E   FTRVLQGHIA+D AVFP  T G
Sbjct  410   IKKDQVYLCDSGAQFSDGTTDVTRTWHFGTPRPEEVRAFTRVLQGHIAIDTAVFPNGTTG  469

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEP  1928
             +++D++AR SLW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +  GM VSNEP
Sbjct  470   YLIDSWARRSLWQDGLDYRHGTGHGVGHFLNVHEGPQGIGVRIAYNNTALKAGMTVSNEP  529

Query  1929  GYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAW  2108
             GYYED  +GIRIEN++ VKE+  PN FG  GYLGFE +T  PIQ KL+D S+L+  E  W
Sbjct  530   GYYEDGQYGIRIENIVIVKEVKLPNNFGDKGYLGFEHVTMCPIQTKLIDASLLTEPEKKW  589

Query  2109  LNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             +N YH +VW+KVS L+  D RA EWL   T PI
Sbjct  590   VNDYHQEVWQKVSPLLQNDKRALEWLKRETTPI  622



>gb|KIN06180.1| hypothetical protein OIDMADRAFT_141796 [Oidiodendron maius Zn]
Length=619

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/637 (46%), Positives = 401/637 (63%), Gaps = 28/637 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  +RL  LRQL       +D YIIPS+D+H SE+IA C  RR +ISGF+GSAG AVVT
Sbjct  4     VNSTERLTHLRQLMRI--YKVDIYIIPSEDSHASEYIAPCDARREFISGFSGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL ++W+L++ G   VPT  EW       G  +G+DP + S+
Sbjct  62    HEKAALATDGRYFNQASKQLDTNWLLLKQGLQDVPTWQEWSAEQSEGGKIVGVDPTVISA  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L E I K G  +LV +   NLVD++W  SRP  P +P+++    +AG DV +KL 
Sbjct  122   PEARKLAEKIKKRGGGDLVAIEE-NLVDQVWGASRPLMPSEPVKILAQHFAGKDVKTKLD  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    SS  ++S+LDEIAWL NLRG+D+ ++PV ++Y  +  D A L++  SK+ 
Sbjct  181   ELRKELEKKKSSGFIVSLLDEIAWLFNLRGNDIPYNPVFFSYATITPDAATLYVSSSKLN  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              E   YL   GV +R YE              +++ D      A+  +   A D      
Sbjct  241   SECTTYLTDNGVYIRPYE--------------SIFDDAE----ALGQSLGAASDESQPES  282

Query  1209  GIKK--RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
              IKK   + K++      L G+       SP+  AKA+KN  ELEGM+ CH+RD AAL  
Sbjct  283   KIKKFLVSTKTSWALKRALGGEAKVEETRSPIGDAKAIKNETELEGMRQCHIRDGAALIE  342

Query  1383  FWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE + + +   + EV  A++L   R++Q  F+  SFDTIS +GAN A+IHYKPEP 
Sbjct  343   YFAWLENQLVAEKAQIDEVAAADRLQAIRTRQKHFVGLSFDTISSTGANAAVIHYKPEPG  402

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +CSI++  E++L DSGAQY DGTTD TRT+HFGEP+  E++ +T VL+GHIA+D ++FP+
Sbjct  403   NCSIIDPKEIYLCDSGAQYFDGTTDTTRTLHFGEPTEMERKAYTLVLKGHIAIDVSIFPK  462

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVV  1916
              T GF LD+ AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+ PG V+
Sbjct  463   GTSGFALDSLARQFLWEHGLDYRHGTGHGVGSYLNVHEGPIGIGTRIQYSEVPLAPGNVI  522

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYED SFGIRIEN++ V+E++T ++FG   YLGFE +T VP   KL+D ++L+A 
Sbjct  523   SNEPGYYEDGSFGIRIENIVMVREVETKHQFGDKPYLGFEHVTMVPYCRKLIDETLLTAR  582

Query  2097  EVAWLNSYHLQVWEKVSGLVDG--RAREWLWNNTRPI  2201
             E  WLN YH  V  K          A +WL   T PI
Sbjct  583   EKNWLNEYHADVHAKTKDFFQAGSLALKWLERETTPI  619



>ref|XP_001259881.1| xaa-pro aminopeptidase [Neosartorya fischeri NRRL 181]
 sp|A1DF27.1|AMPP1_NEOFI RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Neosartorya fischeri NRRL 
181]
 gb|EAW17984.1| xaa-pro aminopeptidase [Neosartorya fischeri NRRL 181]
Length=654

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/634 (47%), Positives = 397/634 (63%), Gaps = 29/634 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  +RL  LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+V+
Sbjct  44    VNTTERLARLRQLMQ--EHKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIVS  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W L++ G   VPT  EW       G  +G+DP L ++
Sbjct  102   MTKAALSTDGRYFNQASKQLDSNWELLKRGVENVPTWQEWTTEQAEGGKVVGVDPSLITA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L+E + +    LV +S  NLVD +W + RP PP++ +RVH  K+AG     K+  
Sbjct  162   SGARSLEETLKRNGSSLVGISQ-NLVDLVWGKDRPAPPREKVRVHPDKFAGKTFQEKIAD  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++  VISMLDEIAWL NLRGSD+ ++PV +AY I+    A+L+IDD KITP
Sbjct  221   LRKELEKKKTAGFVISMLDEIAWLFNLRGSDIPYNPVFFAYAIITPTKAELYIDDDKITP  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV+ +L    V ++ Y               +++ D   ++ A          ++  S  
Sbjct  281   EVVAHLGQ-DVVIKPYN--------------SIFADAKALSEARKQEAGETASKFLLS--  323

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+ H     SP++ AKA+KN  EL GM+ CH+RD AAL  ++A
Sbjct  324   ----NKASWALSLS-LGGEEHVEETRSPIADAKAIKNEVELAGMRACHIRDGAALIEYFA  378

Query  1392  WLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E+  K   L EV+ A+KL   R+K   F   SFDTIS +G NGA+IHYKPE  +CS
Sbjct  379   WLENELVNKKTVLDEVDAADKLERIRTKHDLFAGLSFDTISSTGPNGAVIHYKPEKGTCS  438

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSGAQY+DGTTD+TRT HFG+P+  EK+ FT VL+G IA+D AVFP+ T 
Sbjct  439   IIDPDAIYLCDSGAQYLDGTTDVTRTFHFGKPTELEKKAFTLVLKGLIAIDTAVFPKGTS  498

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LDA AR  LWK GLDY HGTGHG+G+ LNVHEGP GI  R      P+ PG V+S+E
Sbjct  499   GFALDALARQYLWKEGLDYLHGTGHGIGSYLNVHEGPIGIGTRVQYTEVPIAPGNVISDE  558

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED  FGIRIEN++  +E+ T ++FG   +LGFE +T  PI   L+  S+LS  E+ 
Sbjct  559   PGFYEDGKFGIRIENVIMAREVQTTHKFGDKPWLGFEHVTMAPIGRNLIQPSLLSDLELK  618

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             W+N YH +VW+K       D   R WL   T PI
Sbjct  619   WVNDYHAEVWDKTHHFFENDEFTRSWLQRETAPI  652



>ref|XP_007513735.1| unnamed protein product [Bathycoccus prasinos]
 emb|CCO16260.1| unnamed protein product [Bathycoccus prasinos]
Length=731

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/645 (46%), Positives = 400/645 (62%), Gaps = 27/645 (4%)
 Frame = +3

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             L ALR   ++   NI A +IPSQD H SE+++ C+ RR YIS FTGSAGT +VTK  A L
Sbjct  90    LAALRLEMNKR--NISAVLIPSQDPHFSEYVSKCFERRKYISNFTGSAGTCLVTKTSAML  147

Query  510   WTDGRYFLQAEKQLSS-SWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             WTDGRYFLQAE++L S +W LM+ G   VP+  +WL   +  G+ + +D  + S   A +
Sbjct  148   WTDGRYFLQAEQELDSPAWQLMKQGEKDVPSVQKWLRENMESGAALAVDANVHSVAEARQ  207

Query  687   LKEDISKGN---------HELVFLSNLNLVDEIWK-----ESRPQPPKKPIRVHDLKYAG  824
             L+E + K N          +LV +   NLVD +W+     E RP  PK  +RVH +KYAG
Sbjct  208   LEELMRKKNAGGRGEGGDGKLVKVEK-NLVDLVWENEEGEEKRPGMPKAMLRVHAMKYAG  266

Query  825   ADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKL  1004
                  KL  +R ++       +V+S LD+I WL+N+RG D   +PV  ++++V    A +
Sbjct  267   KSAKDKLTDIRKEMAKEKQECLVVSALDDIMWLVNVRGGDAECNPVCLSHVLVTEKEAFM  326

Query  1005  FIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTA  1184
             F+D  K+  EV  +LK  GVE++ YE +   +  +AEKG  +W+D+  V+    N Y  A
Sbjct  327   FVDRDKVNEEVAQHLKESGVEVKPYEDVGKCLREMAEKGTKIWIDEDKVS---VNTYDEA  383

Query  1185  CD--RYSRSPGIKKRNKKSTNLDTNGLSGQPHALYR--SSPVSMAKAVKNSAELEGMQNC  1352
                 + + +   + R  K    D +G     +   +   SP+ MAKA+KN AELEGM+  
Sbjct  384   MKGIKAAENNIDESRPAKVAKSDNSGGGNDSNQQIKLGVSPIPMAKAIKNEAELEGMREA  443

Query  1353  HLRDAAALAHFWAWLEEEICK-DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANG  1529
             HL D  A++  W WLE++  + +  L E  V EK+   R++Q G+++ SF +I G G +G
Sbjct  444   HLMDGVAMSELWWWLEKQAGEGNKDLNEFNVGEKVSSLRAEQNGYVEESFPSIVGEGPHG  503

Query  1530  AIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGH  1709
             A++HY+   +S   + +  + LLDSG Q++ GTTD+TRT H G PS+ E  C+TRVL+GH
Sbjct  504   AVVHYRATEESARKITKDSMVLLDSGGQFLCGTTDVTRTHHLGTPSAYETMCYTRVLKGH  563

Query  1710  IALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM  1889
             IALD A FP  TPG  LD FAR  LW  GLDYRHGTGHGVGAALNVHEGPQ IS R+GN 
Sbjct  564   IALDSATFPVGTPGMALDTFARQHLWSAGLDYRHGTGHGVGAALNVHEGPQSISPRWGNT  623

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
             TP+  GM+VSNEPGYYED  FGIRIENLL  +E  T + F G GYL FE LTF+PIQ KL
Sbjct  624   TPIKDGMIVSNEPGYYEDGQFGIRIENLLICREAKTEHNFQGKGYLSFECLTFIPIQTKL  683

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKVSGLVDG-RAREWLWNNTRPI  2201
             +DL I+S  E+AW+N YH QVWEK+S  V     +EWL   T  I
Sbjct  684   MDLKIMSDDEIAWVNRYHEQVWEKISPRVQKEEVKEWLQKATAKI  728



>gb|KFZ06986.1| hypothetical protein V501_06890 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=671

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/688 (46%), Positives = 417/688 (61%), Gaps = 36/688 (5%)
 Frame = +3

Query  180   PIPRKLHYPL---KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL  350
             P+ R LH       F  S+    + I  +SS  +A  +S        +D   RL  LRQL
Sbjct  6     PLNRVLHATRPRNTFDYSAQRIHISIRLSSSCASADMAS--------IDTSQRLSKLRQL  57

Query  351   FSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYF  530
                   N+D YIIPS+D+H SE+IA C  RR +I GF+GSAG AVVT+DKAAL TDGRYF
Sbjct  58    MKEK--NVDVYIIPSEDSHASEYIASCDGRREFICGFSGSAGCAVVTQDKAALATDGRYF  115

Query  531   LQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDI-SK  707
              QA KQL  SW L++ G   VPT  EW          +G+DP + S+  A +L + I + 
Sbjct  116   NQASKQLDDSWTLLKQGLLDVPTWQEWTAEQAEGSKTVGVDPTVISAPDARKLADKIKAA  175

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
             G  +L+ + + NL+D++W   RP  P +P++    +++G  V++KL  LR +L    SS 
Sbjct  176   GGADLIAVED-NLIDKVWGADRPAKPTQPVKPLGEEFSGKSVTAKLEDLRKELDKKKSSG  234

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
             +V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++ E  D+L    + 
Sbjct  235   LVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLSKEAQDHLAQNCIS  294

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDR---YSRSPGIKK---RNK  1229
             +R+Y++I        E  A L     ++ A  T    +  D     ++   +KK    NK
Sbjct  295   IRSYDAIF-------EDAAVL---GRSIQATTTKEASSGDDSSKPAAQDTKVKKFMVSNK  344

Query  1230  KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-  1406
              S  L    L G+ +     SP+  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE E 
Sbjct  345   ASWAL-KRALGGESNVDEVRSPIGDAKAVKNETELEGMRACHIRDGAALTEFFAWLENEL  403

Query  1407  ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHE  1586
             I K   + EVE  +KL E RSK   F+  SFDTIS +GAN AIIHYKPEP +CSI++ +E
Sbjct  404   IEKKATVNEVEALDKLEEMRSKHKHFVGLSFDTISSTGANAAIIHYKPEPGNCSIIDPNE  463

Query  1587  LFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDA  1766
             ++L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD AVFP+ T GF LD 
Sbjct  464   VYLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAVFPKGTSGFSLDT  523

Query  1767  FARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYED  1943
              AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V+SNEPGYYED
Sbjct  524   LARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNVISNEPGYYED  583

Query  1944  HSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYH  2123
              SFGIRIEN++ V+E  T + FG   YLGFE +T VP   KL+D S+L+  E  WLN YH
Sbjct  584   GSFGIRIENIIMVREAKTKHTFGEKPYLGFEHVTMVPYCRKLIDESLLTPKEKRWLNEYH  643

Query  2124  LQVWEKVSGLVD--GRAREWLWNNTRPI  2201
               +  K  G  +      +WL    +P 
Sbjct  644   ADILAKTKGYFEPGSLTIKWLEREAQPF  671



>ref|XP_005705542.1| X-Pro dipeptidase isoform 2 [Galdieria sulphuraria]
 gb|EME29022.1| X-Pro dipeptidase isoform 2 [Galdieria sulphuraria]
Length=796

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/628 (46%), Positives = 392/628 (62%), Gaps = 35/628 (6%)
 Frame = +3

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             L  LR+L    ++ + A ++ + D H SE+    + RR ++SGFTGSAGTA+VT+  A L
Sbjct  83    LPQLRKLLK--ELGLQALVVANTDPHLSEYPPAHFNRREFVSGFTGSAGTALVTEKSAIL  140

Query  510   WTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEEL  689
             WTDGRYFL AEK+L  +W LM+ G  G PT  E+L+  L   S +GIDP+  S    E L
Sbjct  141   WTDGRYFLLAEKELDENWKLMKVGIAGFPTLEEFLSENLPKQSVVGIDPYSHSVSFVENL  200

Query  690   KEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLI  869
              + +S  +  +  L + N VD +W   RP  P   IR+H L+ AG     KL  +R  + 
Sbjct  201   SKKLSIKDIYIRLL-DTNPVDLLWNVGRPSLPTDSIRIHPLENAGQSCFEKLEDIRVRMQ  259

Query  870   NAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYL  1049
                   +++S+LDEIAW+LNLRGSD+ H PV  AY +V  +   L+++  KI   V  YL
Sbjct  260   ELNVDMLLVSLLDEIAWVLNLRGSDIPHCPVFLAYFLVGFNQNVLYVNREKIPSSVESYL  319

Query  1050  KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNK  1229
                 ++++ YE+IL +++  ++    +W D  + NAA+                      
Sbjct  320   YECNIDIKPYEAILPDLKKFSQDNRKIWYDPLSTNAAL----------------------  357

Query  1230  KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEI  1409
                     G + QP    +S+P+S+ KAVKN AE+ GM+  H+RD  AL HF  WLE E 
Sbjct  358   --------GFACQPGGFPQSTPISLMKAVKNDAEIRGMREAHIRDGVALVHFLNWLETEG  409

Query  1410  CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHEL  1589
               + G++E E AEKLLEFRS+   F+  SF TI GSG NGAIIHY+P P     ++  EL
Sbjct  410   ISN-GVSEFEAAEKLLEFRSRHAEFVTESFPTICGSGPNGAIIHYRPMPSDARPLSTKEL  468

Query  1590  FLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAF  1769
              LLDSG QY+DGTTD+TRT HFG PS +++ECFTRVLQGHI+LD A+FP+ T G +LD++
Sbjct  469   ILLDSGGQYMDGTTDVTRTFHFGTPSEKQRECFTRVLQGHISLDTAIFPKGTLGCLLDSY  528

Query  1770  ARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHS  1949
             AR  LW+ GLDYRHGTGHG+GAALNVHEGP  IS R GN   + PGM VSNEPG+YED  
Sbjct  529   ARRKLWEYGLDYRHGTGHGIGAALNVHEGPHSISPRMGNNVYLRPGMFVSNEPGFYEDGE  588

Query  1950  FGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQ  2129
             FGIRIEN+L V E DTP RFG I + GFE  T VPIQ K++ + +L   E+ W++ YH +
Sbjct  589   FGIRIENILLVVEKDTPFRFGDIPFYGFEAFTIVPIQQKMIKIELLEKHEIDWIDRYHSR  648

Query  2130  VWEKVSGLV-DGRAREWLWNNTRPIDSS  2210
             VW+ ++  V D   +EWLW +TRPI S+
Sbjct  649   VWKILNPRVEDANVKEWLWKSTRPILST  676



>gb|KFY72923.1| hypothetical protein V499_06965 [Pseudogymnoascus pannorum VKM 
F-103]
Length=671

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/685 (46%), Positives = 419/685 (61%), Gaps = 30/685 (4%)
 Frame = +3

Query  180   PIPRKLHYPL---KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL  350
             P+ R LH       F  S+    + I  +SS  +A  +S        +D   RL  LRQL
Sbjct  6     PLNRVLHATRPRNTFDYSAQRIHISIRLSSSCASADMAS--------IDTSQRLSKLRQL  57

Query  351   FSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYF  530
                   N+D YIIPS+D+H SE+IA C  RR +I GF+GSAG AVVT+DKAAL TDGRYF
Sbjct  58    MKEK--NVDIYIIPSEDSHASEYIASCDGRREFICGFSGSAGCAVVTQDKAALATDGRYF  115

Query  531   LQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDI-SK  707
              QA KQL  SW L++ G   VPT  EW          +G+DP + S+  A +L + I + 
Sbjct  116   NQASKQLDDSWTLLKQGLLDVPTWQEWTAEQSEGSKTVGVDPTVISAPDARKLADKIKAA  175

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
             G  +L+ + + NL+D++W   RP  P +P++    +++G  V++KL  LR +L    SS 
Sbjct  176   GGADLIAVED-NLIDKVWGADRPAKPTQPVKPLGEEFSGKSVTAKLEDLRKELDKKKSSG  234

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
             +V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++ E  D+L    + 
Sbjct  235   LVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLSKEAQDHLAQNCIS  294

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK---RNKKST  1238
             +R+Y    +  E  A  G ++    +   ++  N++K A    ++   +KK    NK S 
Sbjct  295   IRSY---DAIFEDAAVLGRSIQATTTKEASSGDNSFKPA----AQDTKVKKFMVSNKASW  347

Query  1239  NLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICK  1415
              L    L G+ +     SP+  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE E I K
Sbjct  348   AL-KRALGGESNVDEVRSPIGDAKAVKNETELEGMRACHIRDGAALTEFFAWLENELIEK  406

Query  1416  DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFL  1595
                + EVE  +KL E RSK   F+  SFDTIS +GAN AIIHYKPE  +CSI++ +E++L
Sbjct  407   KATVNEVEALDKLEEMRSKHKHFVGLSFDTISSTGANAAIIHYKPERGNCSIIDPNEVYL  466

Query  1596  LDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFAR  1775
              DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD AVFP+ T GF LD  AR
Sbjct  467   CDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAVFPKGTSGFSLDTLAR  526

Query  1776  SSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSF  1952
               LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V+SNEPGYYED SF
Sbjct  527   QFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNVISNEPGYYEDGSF  586

Query  1953  GIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQV  2132
             GIRIEN++ V+E  T + FG   YLGFE +T VP   KL+D S+L+  E  WLN YH  +
Sbjct  587   GIRIENIIMVREAKTKHTFGEKPYLGFEHVTMVPYCRKLIDESLLTPKEKRWLNEYHADI  646

Query  2133  WEKVSGLVD--GRAREWLWNNTRPI  2201
             + K  G  +      +WL    +P 
Sbjct  647   FAKTKGYFEPGSLTMKWLEREVQPF  671



>gb|EPS34624.1| hypothetical protein PDE_09588 [Penicillium oxalicum 114-2]
Length=614

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/634 (47%), Positives = 399/634 (63%), Gaps = 29/634 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  +RL  LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+++
Sbjct  4     VNTTERLTQLRQLMK--EHQVDLYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIIS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W L++ G  GVPT  EW       G  +G+DP L ++
Sbjct  62    LTKAALSTDGRYFNQAAKQLDSNWHLLKQGTEGVPTWQEWTTEEAQGGKAVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L E + K    LV + + NLVD +W + RP  P++ +RVH ++YAG     K+  
Sbjct  122   SGARKLAETLEKNGSSLVGIQS-NLVDLVWGKDRPSRPQEKVRVHPVEYAGKPFQEKIAE  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L     +  V+SMLDEIAWL NLRGSD+ ++PV ++Y I+    A+L+++  K+TP
Sbjct  181   LRKELETKKKAGFVVSMLDEIAWLFNLRGSDIPYNPVFFSYAIITPTTAELYVEADKLTP  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ YE               ++ D   ++ A + + + A +++  S  
Sbjct  241   EVTAHLGQ-DVIVKPYE--------------TIFADAKALSTARSQSAEKAPNKFLLS--  283

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  N L G+       SP++ AKAVKN AELEGM+ CH+RD AAL  ++A
Sbjct  284   ----NKASWALSLN-LGGEGQVEEARSPIADAKAVKNKAELEGMRACHIRDGAALTEYFA  338

Query  1392  WLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E+  K   L EV+ A+KL + R+K   F   SFDTIS +G NGA+IHYKPE  SCS
Sbjct  339   WLENELVNKKTVLDEVDGADKLEQIRTKHDRFAGLSFDTISSTGPNGAVIHYKPEKGSCS  398

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSG QY+DGTTD TRT HFG+P+  EK+ FT VL+G I +D AVFP+ T 
Sbjct  399   IIDPAAIYLCDSGCQYLDGTTDTTRTFHFGQPTEFEKKAFTLVLKGMIGIDTAVFPKGTS  458

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +D  AR  LWK GLDY HGTGHGVG+ LNVHEGP GI  R      P+  G V+SNE
Sbjct  459   GFAIDVLARQYLWKEGLDYLHGTGHGVGSFLNVHEGPMGIGTRVQYTEVPIAVGHVLSNE  518

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  FGIRIEN++  +E  T ++FG   +LGFE +T  PI   L++ S+LS  E+ 
Sbjct  519   PGYYEDGKFGIRIENIIMAREAKTNHKFGDKQWLGFEHVTMTPIGRNLIEPSLLSDDEIK  578

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             WLN YH +VWEK +     D    +WL   T+PI
Sbjct  579   WLNDYHAEVWEKTNHFFKDDELTLKWLQRETQPI  612



>gb|KFZ15919.1| hypothetical protein V502_05345 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=671

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/685 (46%), Positives = 414/685 (60%), Gaps = 30/685 (4%)
 Frame = +3

Query  180   PIPRKLHYPL---KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL  350
             P+ R LH       F  S+    + I  +SS  +A  +S        +D   RL  LRQL
Sbjct  6     PLNRVLHTTRPRSTFDYSAQRIHISIRLSSSCASADMAS--------IDTSQRLSKLRQL  57

Query  351   FSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYF  530
                   N+D YIIPS+D+H SE+IA C  RR +I GF+GSAG AVVT+DKAAL TDGRYF
Sbjct  58    MKEK--NVDVYIIPSEDSHASEYIASCDGRREFICGFSGSAGCAVVTQDKAALATDGRYF  115

Query  531   LQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDI-SK  707
              QA+KQL  SW L++ G   VPT  EW          +G+DP + S+  A +L + I + 
Sbjct  116   NQAQKQLDDSWTLLKQGLLDVPTWQEWTAEQAEGNKTVGVDPTVISAPDARKLADKIKTA  175

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
             G  +L+ + + NLVD++W   RP  P + ++  + +++G  V++KL  LR +L    SS 
Sbjct  176   GGADLIAVED-NLVDKVWGVDRPAKPTQAVKPLNEEFSGKSVTAKLEDLRKELDKKKSSG  234

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
             +V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++ E  D+L    + 
Sbjct  235   LVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLSKEAQDHLAQNCIS  294

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK---RNKKST  1238
             +R+Y +I        E  A L        A  T++   +    ++   +KK    NK S 
Sbjct  295   IRSYNAIF-------EDAAVLGRSIQASTAKETSSGDASSKPSNQDVKVKKFMVSNKASW  347

Query  1239  NLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICK  1415
              L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE E I K
Sbjct  348   AL-KRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIRDGAALTEFFAWLENELIEK  406

Query  1416  DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFL  1595
                + EVE  +KL E RSK   F+  SFDTIS +GAN AIIHYKPEP +CSI++ +E++L
Sbjct  407   KATVNEVEALDKLEEMRSKHKHFVGLSFDTISSTGANAAIIHYKPEPGNCSIIDPNEVYL  466

Query  1596  LDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFAR  1775
              DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD AVFP+ T GF LD  AR
Sbjct  467   CDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAVFPKGTSGFSLDTLAR  526

Query  1776  SSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSF  1952
               LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V+SNEPGYYED SF
Sbjct  527   QFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNVISNEPGYYEDGSF  586

Query  1953  GIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQV  2132
             GIRIEN++ V E  T + FG   YLGFE +T VP    L+D S+L+  E  WLN YH  +
Sbjct  587   GIRIENIIMVNEAKTKHTFGEKPYLGFEHVTMVPYCRNLIDESLLTRKEKRWLNEYHADI  646

Query  2133  WEKVSGLVD--GRAREWLWNNTRPI  2201
               K  G  +      +WL   T+P 
Sbjct  647   LAKTKGYFEPGSVTMKWLERETQPF  671



>gb|KFY81379.1| hypothetical protein V500_11470 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=671

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/685 (46%), Positives = 414/685 (60%), Gaps = 30/685 (4%)
 Frame = +3

Query  180   PIPRKLHYPL---KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL  350
             P+ R LH       F  S+    + I  +SS  +A  +S        +D   RL  LRQL
Sbjct  6     PLNRVLHTTRPRSTFDYSAQRIHISIRLSSSCASADMAS--------IDTSQRLSKLRQL  57

Query  351   FSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYF  530
                   N+D YIIPS+D+H SE+IA C  RR +I GF+GSAG AVVT+DKAAL TDGRYF
Sbjct  58    MKEK--NVDVYIIPSEDSHASEYIASCDGRREFICGFSGSAGCAVVTQDKAALATDGRYF  115

Query  531   LQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDI-SK  707
              QA+KQL  SW L++ G   VPT  EW          +G+DP + S+  A +L + I + 
Sbjct  116   NQAQKQLDDSWTLLKQGLLDVPTWQEWTAEQAEGNKTVGVDPTVISAPDARKLADKIKTA  175

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
             G  +L+ + + NLVD++W   RP  P + ++  + +++G  V++KL  LR +L    SS 
Sbjct  176   GGADLIAVED-NLVDKVWGVDRPAKPTQAVKPLNEEFSGKSVTAKLEDLRKELDKKKSSG  234

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
             +V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++ E  D+L    + 
Sbjct  235   LVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLSKEAQDHLAQNCIS  294

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK---RNKKST  1238
             +R+Y +I        E  A L        A  T++   +    ++   +KK    NK S 
Sbjct  295   IRSYNAIF-------EDAAVLGRSIQASTAKETSSGDASSKPSNQDVKVKKFMVSNKASW  347

Query  1239  NLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICK  1415
              L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE E I K
Sbjct  348   AL-KRALGGDANVDEVRSPIGDAKAVKNGTELEGMRACHIRDGAALTEFFAWLENELIEK  406

Query  1416  DVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFL  1595
                + EVE  +KL E RSK   F+  SFDTIS +GAN AIIHYKPEP +CSI++ +E++L
Sbjct  407   KATVNEVEALDKLEEMRSKHKHFVGLSFDTISSTGANAAIIHYKPEPGNCSIIDPNEVYL  466

Query  1596  LDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFAR  1775
              DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD AVFP+ T GF LD  AR
Sbjct  467   CDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAVFPKGTSGFSLDTLAR  526

Query  1776  SSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSF  1952
               LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V+SNEPGYYED SF
Sbjct  527   QFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNVISNEPGYYEDGSF  586

Query  1953  GIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQV  2132
             GIRIEN++ V E  T + FG   YLGFE +T VP    L+D S+L+  E  WLN YH  +
Sbjct  587   GIRIENIIMVNEAKTKHTFGEKPYLGFEHVTMVPYCRNLIDESLLTRKEKRWLNEYHADI  646

Query  2133  WEKVSGLVD--GRAREWLWNNTRPI  2201
               K  G  +      +WL   T+P 
Sbjct  647   LAKTKGYFEPGSVTMKWLERETQPF  671



>ref|XP_006433331.1| hypothetical protein CICLE_v100005701mg [Citrus clementina]
 gb|ESR46571.1| hypothetical protein CICLE_v100005701mg [Citrus clementina]
Length=428

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/373 (75%), Positives = 318/373 (85%), Gaps = 1/373 (0%)
 Frame = +3

Query  243   LIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFI  422
             L +RN ++I AKPSSEF +       +++LRALR+LFSRP +NIDAYIIPSQDAHQSEFI
Sbjct  56    LFIRNCTSITAKPSSEFNRNRTQDAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFI  115

Query  423   ADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTP  602
             A+CYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGN GVPT 
Sbjct  116   AECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTT  175

Query  603   SEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQP  782
              EWLN VL+PG R+GIDPFLFSSDAAEELKE I+K NHELV+L +LNLVD IWKESRP+P
Sbjct  176   FEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKP  235

Query  783   PKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPV  962
             P KPIRVH LKYAG DV+SKL SLRSDL++AGSSAIVISMLDEIAWLLNLRGSDV HSPV
Sbjct  236   PNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPV  295

Query  963   MYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDK  1142
             MYAYLIVE+D AKLF+DDSK+TP+VMD+LK+ GVELR Y SILSEI+SLA +GA LWLD 
Sbjct  296   MYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDP  355

Query  1143  STVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKN  1322
             S+VNAAI N Y+ A ++Y  S    K++K   + DT G SG P  ++R+SP++ +KAVKN
Sbjct  356   SSVNAAIMNTYEIAIEKYLTSNN-NKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKN  414

Query  1323  SAELEGMQNCHLR  1361
             SAELEGM N HLR
Sbjct  415   SAELEGMLNSHLR  427



>sp|A2QGR5.1|AMPP1_ASPNC RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Aspergillus niger CBS 513.88]
 emb|CAK47862.1| unnamed protein product [Aspergillus niger]
Length=614

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/634 (46%), Positives = 397/634 (63%), Gaps = 29/634 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  +RL  LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+++
Sbjct  4     VDTSERLTRLRQLMQ--ERKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIIS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W L++ G  G PT  EW       G  +G+DP L + 
Sbjct  62    MTKAALSTDGRYFNQASKQLDSNWALLKRGVEGFPTWQEWTTEQAEGGKVVGVDPALVTP  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E + K    LV +   NLVD +W + RP PP++ +RVH  +YAG     K+  
Sbjct  122   AGARSLSETLKKNGSSLVGVEQ-NLVDLVWGKDRPAPPREAVRVHPAQYAGKSFQEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L N  ++ IVISMLDEIAWL NLRG+D+ ++PV ++Y ++      L++D+ K+TP
Sbjct  181   LRKELENKKAAGIVISMLDEIAWLFNLRGTDIPYNPVFFSYALITPTTVDLYVDEDKLTP  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ Y+              +++ D      A++ A K   D    +P 
Sbjct  241   EVKAHLGQ-DVVIKPYD--------------SIFADAK----ALSEARKQ--DATGAAPK  279

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+       SP++ AKA+KN  EL GM++CH+RD AAL  ++A
Sbjct  280   FLLSNKASWALSLS-LGGEEQVEEVRSPIADAKAIKNDVELAGMRSCHVRDGAALIEYFA  338

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E I K   L EV+ A+KL + RSK   +   SFDTIS +G NGA+IHYKPE  SCS
Sbjct  339   WLENELINKKTTLDEVDAADKLEQIRSKHDLYAGLSFDTISSTGPNGAVIHYKPEKGSCS  398

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSGAQY+DGTTD+TRT HFG P+  EK+ FT VL+G I++D AVFP+ T 
Sbjct  399   IIDPTAIYLCDSGAQYLDGTTDVTRTFHFGNPTDLEKKAFTLVLKGLISIDTAVFPKGTS  458

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LDA AR  LWK GLDY HGTGHG+G+ LNVHEGP GI  R      P+  G V+S+E
Sbjct  459   GFALDALARQFLWKEGLDYLHGTGHGIGSYLNVHEGPMGIGTRVQYTEVPIAAGNVISDE  518

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED  FGIRIEN++  +E+ T ++FG   +LGFE +T  P+   L++ ++LS  E+ 
Sbjct  519   PGFYEDGKFGIRIENVIMAREVQTTHKFGEKPWLGFEHVTTAPLGRNLINATLLSEDELK  578

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             W+N YH +VWEK       D   R WL   T+PI
Sbjct  579   WVNEYHAEVWEKTHRFFENDDYTRSWLQRETQPI  612



>ref|XP_005705543.1| X-Pro dipeptidase isoform 1 [Galdieria sulphuraria]
 gb|EME29023.1| X-Pro dipeptidase isoform 1 [Galdieria sulphuraria]
Length=910

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/628 (46%), Positives = 392/628 (62%), Gaps = 35/628 (6%)
 Frame = +3

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             L  LR+L    ++ + A ++ + D H SE+    + RR ++SGFTGSAGTA+VT+  A L
Sbjct  83    LPQLRKLLK--ELGLQALVVANTDPHLSEYPPAHFNRREFVSGFTGSAGTALVTEKSAIL  140

Query  510   WTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEEL  689
             WTDGRYFL AEK+L  +W LM+ G  G PT  E+L+  L   S +GIDP+  S    E L
Sbjct  141   WTDGRYFLLAEKELDENWKLMKVGIAGFPTLEEFLSENLPKQSVVGIDPYSHSVSFVENL  200

Query  690   KEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLI  869
              + +S  +  +  L + N VD +W   RP  P   IR+H L+ AG     KL  +R  + 
Sbjct  201   SKKLSIKDIYIRLL-DTNPVDLLWNVGRPSLPTDSIRIHPLENAGQSCFEKLEDIRVRMQ  259

Query  870   NAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYL  1049
                   +++S+LDEIAW+LNLRGSD+ H PV  AY +V  +   L+++  KI   V  YL
Sbjct  260   ELNVDMLLVSLLDEIAWVLNLRGSDIPHCPVFLAYFLVGFNQNVLYVNREKIPSSVESYL  319

Query  1050  KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNK  1229
                 ++++ YE+IL +++  ++    +W D  + NAA+                      
Sbjct  320   YECNIDIKPYEAILPDLKKFSQDNRKIWYDPLSTNAAL----------------------  357

Query  1230  KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEI  1409
                     G + QP    +S+P+S+ KAVKN AE+ GM+  H+RD  AL HF  WLE E 
Sbjct  358   --------GFACQPGGFPQSTPISLMKAVKNDAEIRGMREAHIRDGVALVHFLNWLETEG  409

Query  1410  CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHEL  1589
               + G++E E AEKLLEFRS+   F+  SF TI GSG NGAIIHY+P P     ++  EL
Sbjct  410   ISN-GVSEFEAAEKLLEFRSRHAEFVTESFPTICGSGPNGAIIHYRPMPSDARPLSTKEL  468

Query  1590  FLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAF  1769
              LLDSG QY+DGTTD+TRT HFG PS +++ECFTRVLQGHI+LD A+FP+ T G +LD++
Sbjct  469   ILLDSGGQYMDGTTDVTRTFHFGTPSEKQRECFTRVLQGHISLDTAIFPKGTLGCLLDSY  528

Query  1770  ARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHS  1949
             AR  LW+ GLDYRHGTGHG+GAALNVHEGP  IS R GN   + PGM VSNEPG+YED  
Sbjct  529   ARRKLWEYGLDYRHGTGHGIGAALNVHEGPHSISPRMGNNVYLRPGMFVSNEPGFYEDGE  588

Query  1950  FGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQ  2129
             FGIRIEN+L V E DTP RFG I + GFE  T VPIQ K++ + +L   E+ W++ YH +
Sbjct  589   FGIRIENILLVVEKDTPFRFGDIPFYGFEAFTIVPIQQKMIKIELLEKHEIDWIDRYHSR  648

Query  2130  VWEKVSGLV-DGRAREWLWNNTRPIDSS  2210
             VW+ ++  V D   +EWLW +TRPI S+
Sbjct  649   VWKILNPRVEDANVKEWLWKSTRPILST  676



>ref|XP_009157123.1| X-Pro aminopeptidase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY56662.1| X-Pro aminopeptidase [Exophiala dermatitidis NIH/UT8656]
Length=659

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/634 (47%), Positives = 406/634 (64%), Gaps = 23/634 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR L  +    +D YI+PS+D+HQSE+IA C  RRAYISGFTGSAGTAV+T
Sbjct  45    VDTSKRLAQLRDLMRQH--KLDVYIVPSEDSHQSEYIAPCDARRAYISGFTGSAGTAVIT  102

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL S+W+L++ G   VPT  EW       G  +G+DP + ++
Sbjct  103   LEKAALATDGRYFNQASKQLDSNWLLLKQGMEDVPTWQEWTTEQAEGGKTVGVDPTVITA  162

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +LKE + K +   +   + NLVD+IW +  P+P +K I + + KYAG     KL  
Sbjct  163   SDARKLKETLKKKSRATLVGVSENLVDKIWADRPPRPAEKVIVLSE-KYAGKSFKDKLED  221

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR DL    ++ +V+SMLDE+AWL NLRGSD+ ++PV ++Y  V    A L++D SKI  
Sbjct  222   LRKDLKKKKAAGMVVSMLDEVAWLFNLRGSDIPYNPVFFSYASVTPKSATLYVDSSKIGQ  281

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV DYL  + V+++ Y+              +L+ D + +     + Y+T     S +P 
Sbjct  282   EVKDYLHGL-VDIKPYD--------------SLFSDLTQIAETAASEYETDGTSKSHAPK  326

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
             +   NK S  L   GL G+       SP++ AKA+KN+ ELEGM+ CH+RD AAL  ++A
Sbjct  327   LLLSNKSSWALSL-GLGGEDKVEESRSPIADAKAIKNATELEGMRQCHIRDGAALIEYFA  385

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E I  +  + EVE A+KL E RSK   F+  SFDTIS +G N A+IHY PE  +C+
Sbjct  386   WLENELINNNAWIDEVEAADKLEEIRSKGEHFVGLSFDTISATGPNAAVIHYSPERGNCA  445

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++   ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G I LD+AVFP+ T 
Sbjct  446   VIDSKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMERKAYTLVLKGVIGLDRAVFPKGTT  505

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G VVS+E
Sbjct  506   GFAIDAFARQHLWREGLDYRHGTGHGVGSFLNVHEGPIGIGTRAAYSEVSLSIGNVVSDE  565

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED +FGIRIEN++  +E  T ++FG   ++GFE +T VP+  KL+D S+L   E  
Sbjct  566   PGYYEDGNFGIRIENVIMAREAQTNHKFGDKPWIGFEHVTMVPMCRKLIDPSLLDPEEKD  625

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             WLN YH +VW+K SG    D R  +WL   T  I
Sbjct  626   WLNDYHKEVWDKTSGFFTNDERTIKWLKRETASI  659



>gb|KDQ10491.1| hypothetical protein BOTBODRAFT_36195 [Botryobasidium botryosum 
FD-172 SS1]
Length=614

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/627 (47%), Positives = 392/627 (63%), Gaps = 40/627 (6%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             +R+ ALR+L  RP+ N+ AY++ ++D H SE++ADC  RRA+ISGF GSAG A+VT  +A
Sbjct  13    ERVNALRELMKRPEHNVHAYVVVTEDQHASEYLADCDARRAFISGFNGSAGCAIVTLQEA  72

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              ++ DGRY+LQAEKQ+  +W LM+ G   VPT  E+L+  L   SRIGIDP L S+  A+
Sbjct  73    FIFVDGRYYLQAEKQIDQNWTLMKQGLPNVPTWQEYLSKHLEKDSRIGIDPTLISALDAK  132

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             +L+E +     ELV +   NLVD++W   RP  P+  I   D+KYAG     KL  LR+ 
Sbjct  133   DLRESLKGRKSELVPIDE-NLVDQVWGSDRPARPQNKIFPLDVKYAGKTSKEKLTELRAK  191

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L+   + A++++MLDE+AWL NLRGSD+  +PV +AY +V    A L+++D++I  +V  
Sbjct  192   LVKEEAGAMIVNMLDEVAWLFNLRGSDIAFNPVFFAYALVTHSKAVLYVNDAQIGDDVRA  251

Query  1044  YLKSVGVELRAYesi---lseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             +L    VE+  Y  +   L    +  +KG  + + K T + A+ NA              
Sbjct  252   HLGE-DVEIHPYNEVFNHLKSFYAEEDKGKKVLVGKQT-SLALANAI-------------  296

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                             G  + + + SP++  KA KN  E EG +  H+RD  AL  ++AW
Sbjct  297   ----------------GLDNLIIKGSPIAELKAQKNDTETEGFRQAHIRDGVALVRYFAW  340

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LEE +     L E + A+KL EFRS+   F+  SF TIS +G NGAIIHY P P  C+I+
Sbjct  341   LEERLNTGPELNESQGADKLEEFRSQGDLFMGLSFTTISSAGPNGAIIHYSPNPKDCAII  400

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
              + +++L DSGAQY DGTTD+TRT HFG P++ E   FTRVLQGHIA+D A+FP+ T G+
Sbjct  401   KKDQMYLCDSGAQYWDGTTDVTRTWHFGTPTAEEIRAFTRVLQGHIAIDTAIFPQGTSGY  460

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPG  1931
             +LDAFAR  LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N TP+  GM +SNEPG
Sbjct  461   LLDAFARRPLWQEGLDYRHGTGHGVGHFLNVHEGPQGIGTRLAYNSTPLKKGMTLSNEPG  520

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YY D  FGIRIE++  V E  TPN FG  GYLGFE  T  PI  KLVD+S+L+  E +WL
Sbjct  521   YYADGRFGIRIESVCIVTEASTPNNFGDRGYLGFENFTMCPIHTKLVDVSLLTPDERSWL  580

Query  2112  NSYHLQVWEKVSGLV----DGRAREWL  2180
             NSYH  V  K+  L+    D +A  WL
Sbjct  581   NSYHETVLAKLKPLLEKTGDQKAVSWL  607



>ref|XP_001390304.2| hypothetical protein ANI_1_500034 [Aspergillus niger CBS 513.88]
Length=654

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/634 (46%), Positives = 397/634 (63%), Gaps = 29/634 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  +RL  LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+++
Sbjct  44    VDTSERLTRLRQLMQ--ERKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIIS  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W L++ G  G PT  EW       G  +G+DP L + 
Sbjct  102   MTKAALSTDGRYFNQASKQLDSNWALLKRGVEGFPTWQEWTTEQAEGGKVVGVDPALVTP  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E + K    LV +   NLVD +W + RP PP++ +RVH  +YAG     K+  
Sbjct  162   AGARSLSETLKKNGSSLVGVEQ-NLVDLVWGKDRPAPPREAVRVHPAQYAGKSFQEKISD  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L N  ++ IVISMLDEIAWL NLRG+D+ ++PV ++Y ++      L++D+ K+TP
Sbjct  221   LRKELENKKAAGIVISMLDEIAWLFNLRGTDIPYNPVFFSYALITPTTVDLYVDEDKLTP  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ Y+              +++ D      A++ A K   D    +P 
Sbjct  281   EVKAHLGQ-DVVIKPYD--------------SIFADAK----ALSEARKQ--DATGAAPK  319

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+       SP++ AKA+KN  EL GM++CH+RD AAL  ++A
Sbjct  320   FLLSNKASWALSLS-LGGEEQVEEVRSPIADAKAIKNDVELAGMRSCHVRDGAALIEYFA  378

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E I K   L EV+ A+KL + RSK   +   SFDTIS +G NGA+IHYKPE  SCS
Sbjct  379   WLENELINKKTTLDEVDAADKLEQIRSKHDLYAGLSFDTISSTGPNGAVIHYKPEKGSCS  438

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSGAQY+DGTTD+TRT HFG P+  EK+ FT VL+G I++D AVFP+ T 
Sbjct  439   IIDPTAIYLCDSGAQYLDGTTDVTRTFHFGNPTDLEKKAFTLVLKGLISIDTAVFPKGTS  498

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LDA AR  LWK GLDY HGTGHG+G+ LNVHEGP GI  R      P+  G V+S+E
Sbjct  499   GFALDALARQFLWKEGLDYLHGTGHGIGSYLNVHEGPMGIGTRVQYTEVPIAAGNVISDE  558

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED  FGIRIEN++  +E+ T ++FG   +LGFE +T  P+   L++ ++LS  E+ 
Sbjct  559   PGFYEDGKFGIRIENVIMAREVQTTHKFGEKPWLGFEHVTTAPLGRNLINATLLSEDELK  618

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             W+N YH +VWEK       D   R WL   T+PI
Sbjct  619   WVNEYHAEVWEKTHRFFENDDYTRSWLQRETQPI  652



>ref|XP_008727308.1| hypothetical protein G647_04748 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI22953.1| hypothetical protein G647_04748 [Cladophialophora carrionii CBS 
160.54]
Length=663

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/686 (45%), Positives = 431/686 (63%), Gaps = 29/686 (4%)
 Frame = +3

Query  159   RFPLISLPIPRKLHYPLKFPSSSANCRVL-IVRNSSNIAAKPSSEFQKKPRGLDQEDRLR  335
             R+  + LP  R+  YP +     +NC  L  VR+ S   +  +++ +K    +D   RL 
Sbjct  2     RWSFLRLPFSRR-RYPARNRELISNCSPLQSVRSFSFSGSLQAADMEK----VDTTKRLA  56

Query  336   ALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWT  515
              LR+L    +  +D YI+PS+D+HQSE+IA C  RRAY+SGFTGSAGTAVVT +KAAL T
Sbjct  57    QLRELMR--EHKLDVYIVPSEDSHQSEYIAPCDARRAYLSGFTGSAGTAVVTLEKAALAT  114

Query  516   DGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKE  695
             DGRYF QA KQL  +W L++ G   VPT  EW       G  +G+DP + ++  A +L E
Sbjct  115   DGRYFNQASKQLDDNWHLLKQGMEDVPTWQEWTTEQAEGGKTVGVDPTVITASDARKLSE  174

Query  696   DISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINA  875
              + K +H  +   + NLVD+IW + RPQ P + + V   KY+G     KL  LR DL   
Sbjct  175   TLKKKSHATLVGISENLVDKIWTD-RPQRPTEKVIVLAEKYSGKSYREKLDDLRKDLKKK  233

Query  876   GSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKS  1055
              ++ +V+SMLDE+AWL NLRGSD+ ++PV ++Y  +  D A ++ID SK+ PEV ++L+ 
Sbjct  234   KAAGMVVSMLDEVAWLFNLRGSDIPYNPVFFSYAAITPDSATIYIDSSKLGPEVKEHLEG  293

Query  1056  VGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK-TACDRYSRSPGIKKRNKK  1232
               V ++ Y++              L+ D +++  A  +  +     +   SP +   NK 
Sbjct  294   T-VTIKPYDA--------------LFSDLTSIAEAAASESQANGASKKPHSPKLLLSNKS  338

Query  1233  STNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEIC  1412
             S  L   GL G+       SP++ AKA+KN+ ELEGM+ CH+RD AAL+ ++AWLE E+ 
Sbjct  339   SWALYL-GLGGEDKVEESRSPIADAKAIKNATELEGMRQCHIRDGAALSEYFAWLESELQ  397

Query  1413  KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELF  1592
                 + EV+ A+KL E RSK   F+  SFDTIS +G N A+IHY PE  +C+ ++ ++++
Sbjct  398   GGAWMDEVQAADKLEEIRSKGQHFVGLSFDTISSTGPNAAVIHYSPERGNCATIDVNQIY  457

Query  1593  LLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFA  1772
             L DSGAQY+DGTTD TRT+HFG PS  E + +T VL+G IALD+AVFP+ T GF +DAFA
Sbjct  458   LCDSGAQYLDGTTDTTRTLHFGTPSEMEIKAYTLVLKGVIALDRAVFPKGTTGFAIDAFA  517

Query  1773  RSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHS  1949
             R  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+EPGYYED +
Sbjct  518   RQHLWREGLDYRHGTGHGVGSYLNVHEGPIGIGTRAAYSEVSLSIGNVISDEPGYYEDGN  577

Query  1950  FGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQ  2129
             FGIRIEN++  +E  T ++FG   ++GFE +T VP+  KL+D  +L   E  WLN+YH +
Sbjct  578   FGIRIENMIMAREAKTNHKFGDKPWIGFEHVTMVPMCRKLIDPKLLDPEEREWLNNYHAE  637

Query  2130  VWEKVSGLVDG--RAREWLWNNTRPI  2201
             VWEK SG  +G  R  +WL   T PI
Sbjct  638   VWEKTSGYFEGDERTTKWLKRETAPI  663



>ref|XP_002837289.1| hypothetical protein [Tuber melanosporum Mel28]
 sp|D5GAC6.1|AMPP1_TUBMM RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Tuber melanosporum Mel28]
 emb|CAZ81480.1| unnamed protein product [Tuber melanosporum]
Length=619

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/636 (46%), Positives = 396/636 (62%), Gaps = 26/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L  R    +D Y++PS+DAH SE+I     RRA+ISGFTGSAG A+VT
Sbjct  4     VDTTSRLAKLRELMKRE--RVDVYVVPSEDAHSSEYICAADARRAFISGFTGSAGCAIVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             ++KAAL TDGRYF QA +QL  +W L++ G   VPT  EW+      G  +G+D  + ++
Sbjct  62    QEKAALSTDGRYFNQAARQLDENWELLKQGLPDVPTWQEWVAQQAEGGKNVGVDATVITA  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L+  I K G   L+ + N NL+DE+W   RP  P  P+ V D KY+G +   K+ 
Sbjct  122   QQAKSLETRIKKKGGTSLLGIPN-NLIDEVWGADRPNRPNNPVMVLDEKYSGKEFPLKIE  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
             ++R +L N  S   V+SMLDEIAWL NLRG+D+ ++PV ++Y  +  +   L+ID SK+ 
Sbjct  181   AVRKELENKKSPGFVVSMLDEIAWLFNLRGTDIPYNPVFFSYAFISPESTTLYIDSSKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +V+ +L S  V++R Y  I                D+  + A      +   D  +   
Sbjct  241   EKVIAHLGSA-VKIRPYHEI---------------FDEIDLLAQKLKVGQPETDSKASED  284

Query  1209  GIK--KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             G K    NK S  L +  L G        SPV   KAVKN  E EGM+ CH+RD AAL  
Sbjct  285   GGKWLVSNKTSWAL-SKALGGDDAIEVIRSPVEEEKAVKNDTEKEGMKRCHIRDGAALTE  343

Query  1383  FWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDS  1562
             ++AWLE+E+ K   + EV+ A+KL + RS+   F+  SFDTIS +G N A+IHYKPE  +
Sbjct  344   YFAWLEDELLKGTKIDEVQAADKLEQIRSRGENFMGLSFDTISSTGPNAAVIHYKPEAGN  403

Query  1563  CSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPEN  1742
             CS+++   ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G IALD+A+FP+ 
Sbjct  404   CSVIDPKAIYLCDSGAQYLDGTTDTTRTLHFGEPTDMERKSYTLVLKGMIALDRAIFPKG  463

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVS  1919
             T GF LD  AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +   + PGM VS
Sbjct  464   TSGFALDILARQFLWSEGLDYRHGTGHGVGSFLNVHEGPFGIGTRIQYSEVALSPGMFVS  523

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             NEPGYYED SFGIRIEN++ VKE+ T + FG   Y GFE++T VP+  KL+D  +L+ AE
Sbjct  524   NEPGYYEDGSFGIRIENIIMVKEVKTSHSFGDRPYFGFERVTMVPMCRKLIDAGLLTPAE  583

Query  2100  VAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
               WLNSYH +V+EK  G    D  A +WL   T PI
Sbjct  584   TEWLNSYHAEVFEKTHGFFEKDSLASKWLKRETTPI  619



>ref|XP_003663373.1| hypothetical protein MYCTH_2305258 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO58128.1| hypothetical protein MYCTH_2305258 [Myceliophthora thermophila 
ATCC 42464]
Length=617

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/631 (47%), Positives = 393/631 (62%), Gaps = 28/631 (4%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LR L  +    +D Y++PS+D+H SE+IA C  RRA+ISGFTGSAGTAVVT DKAA
Sbjct  9     RLARLRSLMKQK--GVDVYVVPSEDSHASEYIAACDARRAFISGFTGSAGTAVVTLDKAA  66

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA KQL S+W L+++G   VPT  EW     + G  +G+DP L SS  AE+
Sbjct  67    LATDGRYFNQASKQLDSNWQLLKTGLQDVPTWQEWAAEESAGGKTVGVDPSLISSSVAEK  126

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L E + K     +   + NLVD +W + RP  P  P+ +   KYAG   ++KL  LR +L
Sbjct  127   LDESVKKSGGAGLKAVSENLVDAVWGDDRPARPNNPVVLLPEKYAGKAAATKLAELRKEL  186

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
                 ++A V+SMLDEIAWL NLRGSD+ ++PV ++Y IV  D A L++D+SK+  E   Y
Sbjct  187   DKKKAAAFVLSMLDEIAWLFNLRGSDIPYNPVFFSYAIVTGDSATLYVDESKLNDECRSY  246

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             L    V ++ Y             GA     K+  NAA          +Y  S      N
Sbjct  247   LDQNKVSVKPY-------------GALFEDVKALANAAKAQETSEPPRKYFVS------N  287

Query  1227  KKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE  1406
             K S  L    L G  +     SPV+ AKAVKN  ELEGM+ CH+RD AAL  F+AWLE++
Sbjct  288   KGSWALKL-ALGGDKYVEEVRSPVADAKAVKNETELEGMRQCHIRDGAALIEFFAWLEDQ  346

Query  1407  IC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             +  K   + EV  A++L  FR KQ  F+  SFDTIS +G N AIIHYKPEP +C+ ++  
Sbjct  347   LVNKKAVIDEVAAADQLEAFRKKQKDFVGLSFDTISSTGPNAAIIHYKPEPGTCATIDPD  406

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
              ++L DSGAQ++DGTTD+TRT+HFG PS  +++ +T VL+G+IALD AVFP+ T G+ +D
Sbjct  407   AIYLCDSGAQFLDGTTDVTRTLHFGTPSDEQRKAYTLVLKGNIALDTAVFPKGTTGYAID  466

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSNEPGYYE  1940
               AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       +  G V+S EPG+YE
Sbjct  467   CLARQFLWKQGLDYRHGTGHGVGSYLNVHEGPIGIGTRKQYADAALAAGNVLSIEPGFYE  526

Query  1941  DHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSY  2120
             D ++GIRIENL  V+E+ T + FG   +LGFE +T VP   KL+D ++L+A E AWLN  
Sbjct  527   DGAYGIRIENLALVREVKTEHSFGDKPFLGFEHVTMVPYCRKLIDETLLTAEEKAWLNRS  586

Query  2121  HLQVWEKVSGLVDGR----AREWLWNNTRPI  2201
             + ++ EK+ G  +G      R WL   T+P 
Sbjct  587   NEEIREKMKGRFEGEEHALTRAWLERETQPF  617



>ref|XP_007736361.1| xaa-Pro aminopeptidase [Capronia epimyces CBS 606.96]
 gb|EXJ79787.1| xaa-Pro aminopeptidase [Capronia epimyces CBS 606.96]
Length=618

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/634 (47%), Positives = 404/634 (64%), Gaps = 23/634 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   +L  LR+L  +    +D YI+PS+D+HQSE+IA C  RRAYISGFTGSAGTAV+T
Sbjct  4     VDTTTQLAQLRELMRQH--KLDVYIVPSEDSHQSEYIAPCDARRAYISGFTGSAGTAVIT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL S+W+L++ G   VPT  EW       G  +G+DP + ++
Sbjct  62    LEKAALATDGRYFNQASKQLDSNWLLLKQGLEDVPTWQEWTTEQAEGGKTVGVDPTVITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +LKE + K +   +     NLVDEIWKE RP  P + + V   KYAG     KL  
Sbjct  122   SDARKLKETLKKKSQAALVGVAENLVDEIWKE-RPARPAEKVIVLSTKYAGKSYKDKLAD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR DL    ++ +V+SMLDE+AWL NLRGSD+ ++PV ++Y  V  + A L++D SK+  
Sbjct  181   LRKDLKKKKAAGMVVSMLDEVAWLFNLRGSDIPYNPVFFSYASVTPNSATLYVDSSKVGQ  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +V D+L  V V+++ Y+              +L+ D + +        +T     S +P 
Sbjct  241   DVKDHLSGV-VDIKPYD--------------SLFSDLANIAETAAGEVQTDEATKSHTPK  285

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
             +   NK S  L   GL G+       SP++ AKA+KN+ ELEGM+ CH+RD AAL  ++A
Sbjct  286   LLLSNKSSWALSL-GLGGEEKVEESRSPIADAKAIKNATELEGMRQCHVRDGAALIEYFA  344

Query  1392  WLEEEICKDVG-LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE+E+  +   L EV+ A+KL E RSK   F+  SFDTIS +G N A+IHY PE  +CS
Sbjct  345   WLEDELVNNNAWLDEVQAADKLEEIRSKGEHFVGLSFDTISSTGPNAAVIHYSPERGNCS  404

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++ + ++L DSGAQY+DGTTD TRT+HFG+P+  E + +T VL+G I LD+AVFP+ T 
Sbjct  405   VIDPNAVYLCDSGAQYLDGTTDTTRTLHFGQPTEMEIKAYTLVLKGVIGLDRAVFPKGTT  464

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+E
Sbjct  465   GFAIDAFARQHLWREGLDYRHGTGHGVGSYLNVHEGPVGIGTRAAYSEVSLSIGNVLSDE  524

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  FGIRIEN++  +E  T ++FG   ++GFE +T VP+  KL+D S+L   E  
Sbjct  525   PGYYEDGRFGIRIENVIMAREAKTNHKFGEKPWIGFEHVTMVPMCQKLIDPSLLDPEERD  584

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             WLN YH +VW K SG    D R  +WL   T PI
Sbjct  585   WLNEYHKEVWAKTSGFFTNDERTTKWLKRETAPI  618



>ref|XP_002482106.1| aminopeptidase P, putative [Talaromyces stipitatus ATCC 10500]
 sp|B8M9W2.1|AMPP1_TALSN RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Talaromyces stipitatus ATCC 
10500]
 gb|EED18114.1| aminopeptidase P, putative [Talaromyces stipitatus ATCC 10500]
Length=657

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/662 (45%), Positives = 409/662 (62%), Gaps = 33/662 (5%)
 Frame = +3

Query  228   ANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAH  407
             A CR    R       + S E +     ++  +RL  LR+L  +   N+D YI+PS+D+H
Sbjct  24    APCRPSFSRTFVTTTVRFSVEMET----VNTSERLAQLRELMKQN--NLDVYIVPSEDSH  77

Query  408   QSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNW  587
             QSE+IA C  RR +ISGFTGSAGTAV++   AAL TDGRYF QA KQL S+W L++ G  
Sbjct  78    QSEYIAHCDARREFISGFTGSAGTAVISTTAAALSTDGRYFNQAAKQLDSNWKLLKRGLE  137

Query  588   GVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKE  767
             GV T  EW       G  +G+DP + ++ +A +L E + KG  +LV +   NLVD+IW  
Sbjct  138   GVLTWQEWTAEQAEGGKIVGVDPSVITAASARKLSETLEKGGSKLVGIEQ-NLVDQIWGT  196

Query  768   SRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDV  947
              RPQ P + +++H ++YAG     K+  LR +L     +  ++S+LDEIAWL NLRG+D+
Sbjct  197   HRPQRPSEKVKIHPIEYAGKPFQEKIADLRKELKTKKRAGFIVSVLDEIAWLFNLRGNDI  256

Query  948   RHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGAN  1127
              ++PV ++Y ++  D   L+IDD K++PEV  +L S  V ++ YE              +
Sbjct  257   PYNPVFFSYAVITPDTVDLYIDDEKLSPEVKVHLGS-DVVIKPYE--------------S  301

Query  1128  LWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMA  1307
             ++ D   ++A        A  +Y  S      NK S  L  +   G+       SP+S A
Sbjct  302   IFADAKALSAKAPLTESGAPMKYLTS------NKASWALSLS-FGGEKKLDEARSPISDA  354

Query  1308  KAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGF  1484
             KA+KN  EL+GM++CH+RD AAL  ++AWLE E I K   L EV+ A+KL + RSK   F
Sbjct  355   KAIKNEVELKGMRDCHIRDGAALTEYFAWLENELINKKSTLDEVDGADKLEQIRSKHDKF  414

Query  1485  LDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEP  1664
             +  SFDTIS +G N A+IHYKPE   CS+++ + ++L DSGAQY+DGTTD TRT HF  P
Sbjct  415   VGLSFDTISSTGPNAAVIHYKPEKGVCSVIDPNAIYLCDSGAQYLDGTTDTTRTFHFSTP  474

Query  1665  SSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALN  1844
             +  EK+ FT VL+G IALD AVFP+ T GF LDA AR  LW+ GLDY HGTGHGVGA LN
Sbjct  475   TEMEKKAFTLVLKGLIALDTAVFPKGTSGFALDALARQHLWRQGLDYLHGTGHGVGAYLN  534

Query  1845  VHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIG  2021
             VHEGP G+  R   +   + PG V+S+EPGYYED  FGIRIEN++  +E++TP +FG   
Sbjct  535   VHEGPIGVGTRIQYSEVSLSPGNVISDEPGYYEDGKFGIRIENIIMAREVETPYKFGDKP  594

Query  2022  YLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTR  2195
             +LGFE +T  PI   L++ S+LS  E  W+++YH +VWEK SG    D     WL   T+
Sbjct  595   WLGFEHVTMTPIGQNLIETSLLSKEERQWVDNYHAEVWEKTSGFFKQDELTLNWLKKETQ  654

Query  2196  PI  2201
             P+
Sbjct  655   PL  656



>gb|KFY64490.1| hypothetical protein V496_03218 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=662

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/644 (46%), Positives = 399/644 (62%), Gaps = 31/644 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LRQL      N+D Y+IPS+D+H SE+IA C  RR YI GF+GSAG AVVT
Sbjct  36    IDTSQRLSKLRQLMKEK--NVDVYVIPSEDSHASEYIASCDGRREYICGFSGSAGCAVVT  93

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             +DKAAL TDGRYF QA+KQL  SW L++ G   VPT  EW          +G+DP + S+
Sbjct  94    QDKAALATDGRYFNQAQKQLDDSWTLLKQGLLDVPTWQEWTAEQAEGSKTVGVDPTVISA  153

Query  672   DAAEELKEDI-SKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L + I + G  +L+ + + NLVD++W   RP  P + ++  + +++G  V++KL 
Sbjct  154   PDARKLADKIKAAGGADLIAVED-NLVDKVWGADRPAKPTQAVKPLNEEFSGKSVTAKLE  212

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    SS  V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++
Sbjct  213   DLRKELDKKKSSGFVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLS  272

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAI---TNAYKTACDRYS  1199
              E  D+L    + +R+Y +              ++ D + +  +I   T    ++ D  S
Sbjct  273   KEAQDHLAQNCISIRSYNA--------------IFEDAAVLGRSIQASTTKEASSGDASS  318

Query  1200  R--SPGIKKRNKKSTNLDT----NGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLR  1361
             +  S  +K +    +N  +      L G  +     SP+  AKAVKN  ELEGM+ CH+R
Sbjct  319   KPSSADVKVKKFMVSNRASWALKRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIR  378

Query  1362  DAAALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAII  1538
             D AAL  F+AWLE E I K   + EV+   KL E RSK   F+  SFDTIS +GAN AII
Sbjct  379   DGAALTEFFAWLENELIEKKATIDEVQALVKLEEMRSKHKHFVGLSFDTISSTGANAAII  438

Query  1539  HYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIAL  1718
             HYKPEP +CSI++ ++++L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IAL
Sbjct  439   HYKPEPGNCSIIDPNQVYLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIAL  498

Query  1719  DQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTP  1895
             D AVFP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P
Sbjct  499   DTAVFPKGTSGFSLDTLARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVP  558

Query  1896  MVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVD  2075
             +  G V+SNEPGYYED SFGIRIEN++ V E  T + FG   YLGFE +T VP   KL+D
Sbjct  559   LAIGNVISNEPGYYEDGSFGIRIENIIMVTEAKTKHTFGEKPYLGFEHVTMVPYCRKLID  618

Query  2076  LSILSAAEVAWLNSYHLQVWEKVSGLVD--GRAREWLWNNTRPI  2201
              S+L+  E  WLN YH  ++ K  G  +      +WL   T+P 
Sbjct  619   ESLLTPKEKRWLNEYHADIFAKTKGYFEPGSVTTKWLERETQPF  662



>gb|EWM30511.1| putative xaa-pro aminopeptidase p [Nannochloropsis gaditana]
Length=774

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/670 (45%), Positives = 405/670 (60%), Gaps = 41/670 (6%)
 Frame = +3

Query  279   PSSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISG  458
             P++  Q++   L Q      +R   S+    + A+I+PS D H SE+ AD + RRA+ISG
Sbjct  115   PATTLQQRSAALTQ------VRDELSK--RGLAAFIVPSGDPHLSEYPADHFCRRAFISG  166

Query  459   FTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGS  638
             F GSAGTAVVT  +A LWTDGRY LQAE+QL   W LMR G  GVP+ + +L   LS  +
Sbjct  167   FDGSAGTAVVTPTQALLWTDGRYHLQAEQQLGPDWTLMREGQKGVPSLTAYLQEELSAQA  226

Query  639   RIGIDPFLFSSDAAEELKEDIS--KGNHELVFLSNLNLVDEIWKES--RPQPPKKPIRVH  806
              +G+DP +      + L + +   K   + + ++  N +D  W+ +  RP  P+ P+R+H
Sbjct  227   VVGLDPTVHPVKLVQNLAQALGSKKVQVQPLNVAETNPIDLAWRTAGGRPPAPQAPVRIH  286

Query  807   DLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVE  986
              L +AG  VS K+  L  ++   G+  +V   LDE+AWLLN+RG DV + P+  AY ++E
Sbjct  287   PLAFAGEAVSDKVKRLSEEMAKEGADVLVAGTLDEVAWLLNIRGEDVPNCPLPVAYAVLE  346

Query  987   IDGA--------------KLFIDDSKITPEVMDYL-KSVGVELRAYesilseieslAEKG  1121
              +GA               +F++D+K+ P    +L K    E+R Y  I S +      G
Sbjct  347   REGAFDSGNGGKEKSARVIVFVEDAKLGPTARAHLEKDCRAEIRPYAEIFSYLSGAHASG  406

Query  1122  ANLWLDKSTVNAAITNAYKTACDRYSRS-PGIKKRNKKSTNLDTNGLSGQPHALYRSSPV  1298
               +WLD    N A+  A     ++   +   +           T  +  +P  L   +P+
Sbjct  407   RKIWLDPDKSNYALLRAASMPPEKGKVTDEKVSGSTGDGAVAATGKVPSEPSLLLHPTPI  466

Query  1299  SMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQY  1478
             ++ KAVKN AELEGM+  HLRD AA   F AWLE+EI +   ++EVE+ + L  FRS++ 
Sbjct  467   TLFKAVKNEAELEGMRAAHLRDGAAEVEFLAWLEKEI-QTRSVSEVEIDQVLTGFRSRRE  525

Query  1479  GFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFG  1658
              FL  SFDTI+GSG NGAIIHY+  P++C  + +  + LLDSG QY DGTTD+TRTVHFG
Sbjct  526   KFLGVSFDTIAGSGPNGAIIHYRAMPETCGEMTKETMLLLDSGGQYEDGTTDVTRTVHFG  585

Query  1659  EPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAA  1838
             EP+  EKE FTRVLQGHI +D AVFPE TPGFVLDA+AR SLW+ G DY HGTGHGVGAA
Sbjct  586   EPTEEEKEAFTRVLQGHIGVDTAVFPEGTPGFVLDAYARRSLWQAGSDYAHGTGHGVGAA  645

Query  1839  LNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGI  2018
             LNVHEGP GISF F N TP+  GM+VSNEPGYY    FGIRIENLL V E       GG+
Sbjct  646   LNVHEGPHGISFNFANRTPLQAGMIVSNEPGYYASGVFGIRIENLLIVVERAG---LGGV  702

Query  2019  G--------YLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLV-DGRAR  2171
             G        +LGFE+LT++PI  +L+   +LS  EV W++ YH +VWE++S L+    A 
Sbjct  703   GGQDPRQRKFLGFERLTYIPISKRLIKQDLLSPEEVKWVDRYHAEVWERISPLLTSSEAE  762

Query  2172  EWLWNNTRPI  2201
              WL   T P+
Sbjct  763   AWLREATAPM  772



>gb|KFY76172.1| hypothetical protein V498_09726 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=671

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/644 (46%), Positives = 399/644 (62%), Gaps = 31/644 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LRQL      N+D Y+IPS+D+H SE+IA C  RR YI GF+GSAG AVVT
Sbjct  45    IDTSQRLSKLRQLMKEK--NVDVYVIPSEDSHASEYIASCDGRREYICGFSGSAGCAVVT  102

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             +DKAAL TDGRYF QA+KQL  SW L++ G   VPT  EW          +G+DP + S+
Sbjct  103   QDKAALATDGRYFNQAQKQLDDSWTLLKQGLLDVPTWQEWTAEQAEGSKTVGVDPTVISA  162

Query  672   DAAEELKEDI-SKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L + I + G  +L+ + + NLVD++W   RP  P + ++  + +++G  V++KL 
Sbjct  163   PDARKLADKIKAAGGADLIAVED-NLVDKVWGADRPAKPTQAVKPLNEEFSGKSVTAKLE  221

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    SS  V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++
Sbjct  222   DLRKELDKKKSSGFVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLS  281

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAI---TNAYKTACDRYS  1199
              E  D+L    + +R+Y +              ++ D + +  +I   T    ++ D  S
Sbjct  282   KEAQDHLAQNCISIRSYNA--------------IFEDAAVLGRSIQASTTKEASSGDASS  327

Query  1200  R--SPGIKKRNKKSTNLDT----NGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLR  1361
             +  S  +K +    +N  +      L G  +     SP+  AKAVKN  ELEGM+ CH+R
Sbjct  328   KPSSADVKVKKFMVSNRASWALKRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIR  387

Query  1362  DAAALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAII  1538
             D AAL  F+AWLE E I K   + EV+   KL E RSK   F+  SFDTIS +GAN AII
Sbjct  388   DGAALTEFFAWLENELIEKKATIDEVQALVKLEEMRSKHKHFVGLSFDTISSTGANAAII  447

Query  1539  HYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIAL  1718
             HYKPEP +CSI++ ++++L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IAL
Sbjct  448   HYKPEPGNCSIIDPNQVYLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIAL  507

Query  1719  DQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTP  1895
             D AVFP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P
Sbjct  508   DTAVFPKGTSGFSLDTLARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVP  567

Query  1896  MVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVD  2075
             +  G V+SNEPGYYED SFGIRIEN++ V E  T + FG   YLGFE +T VP   KL+D
Sbjct  568   LAIGNVISNEPGYYEDGSFGIRIENIIMVTEAKTKHTFGEKPYLGFEHVTMVPYCRKLID  627

Query  2076  LSILSAAEVAWLNSYHLQVWEKVSGLVD--GRAREWLWNNTRPI  2201
              S+L+  E  WLN YH  ++ K  G  +      +WL   T+P 
Sbjct  628   ESLLTPKEKRWLNEYHADIFAKTKGYFEPGSVTTKWLERETQPF  671



>gb|KIL60909.1| hypothetical protein M378DRAFT_193546 [Amanita muscaria Koide 
BX008]
Length=652

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/686 (44%), Positives = 410/686 (60%), Gaps = 65/686 (9%)
 Frame = +3

Query  174   SLPIPRKLHYPLKFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQLF  353
             SLP+PR +  P +    S           S + AK + +     R  D  ++LR      
Sbjct  22    SLPLPRSVERPFQLKRFS----------KSTMGAKGTHKVDTTQRLADLREQLRQH----  67

Query  354   SRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFL  533
                  ++ A+++PS+D H SE+IA C  RRA+ISGF GSAG AVVT D A L+TDGRYFL
Sbjct  68    -----SVQAFVVPSEDQHSSEYIAHCDQRRAFISGFNGSAGCAVVTLDGAFLFTDGRYFL  122

Query  534   QAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGN  713
             QAEKQL  +W LM++G   VPT  E+L   L   ++IGID  L +S  AE LK++++  +
Sbjct  123   QAEKQLDKNWELMKTGLPDVPTWQEFLYKNLGNSTKIGIDATLIASSDAESLKKNLTPKD  182

Query  714   HELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIV  893
              +LV  S  NLVD++W + RP  PK P+   D+KY+G   + K+ ++R ++    + AIV
Sbjct  183   SQLV--SVPNLVDKVWHD-RPARPKNPVFHLDVKYSGQSHTDKIEAVRKEMKKKEAKAIV  239

Query  894   ISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELR  1073
             I+MLDE+AWL NLRGSDV  +PV ++Y +V  D A LF+D    T +    L        
Sbjct  240   ITMLDEVAWLFNLRGSDVDFNPVFFSYAVVTNDSAVLFVDKEPFTEDAHAALG-------  292

Query  1074  AYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNL--D  1247
                                       +  +  AY +  D     PG  + + KS  L  D
Sbjct  293   --------------------------DTVVIQAYDSFFDYLRNLPGTLELDDKSKILLGD  326

Query  1248  TNGLS-----GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEIC  1412
                L+     G+       SP++  KA+KN  ELEG + CH+RD AAL  ++AWLEE++ 
Sbjct  327   RASLAVAEAIGEGKYTTIRSPIADLKAIKNVTELEGFRQCHIRDGAALIRYFAWLEEQLD  386

Query  1413  KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELF  1592
               V L E + A +L +FRS+   F   SF+TIS +G N A+IHY P+P+ C+I+ + +++
Sbjct  387   NGVVLNEFQGAGQLKQFRSELDLFRGLSFETISSTGPNAAVIHYSPDPEDCAIIKKDQIY  446

Query  1593  LLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFA  1772
             L DSG QY DGTTD+TRT+HFG P+ +EK  FTRVLQGHIALD A+FP  T G+++D+FA
Sbjct  447   LCDSGGQYWDGTTDVTRTLHFGTPTDQEKRAFTRVLQGHIALDTAIFPTGTTGYIIDSFA  506

Query  1773  RSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHS  1949
             R  LW+ GLDYRHGTGHGVG  LNVHEGP GI  R   N  P+  GM V+NEPGYY D  
Sbjct  507   RRPLWQDGLDYRHGTGHGVGQYLNVHEGPHGIGVRIAYNSAPLKTGMTVTNEPGYYADGQ  566

Query  1950  FGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQ  2129
             FGIRIEN++ V+   TPN FG  GYLGFE +T  PI  KLV++S+LSA E  WLN YH +
Sbjct  567   FGIRIENIMLVQVSKTPNNFGDKGYLGFEHVTLCPIHKKLVEISLLSAEERKWLNDYHAE  626

Query  2130  VWEKVSGLV--DGRAREWLWNNTRPI  2201
             VWEK+S  +  D RA +WL N    I
Sbjct  627   VWEKISPHLKNDIRALKWLENECSSI  652



>ref|XP_003655342.1| hypothetical protein THITE_2118945 [Thielavia terrestris NRRL 
8126]
 gb|AEO69006.1| hypothetical protein THITE_2118945 [Thielavia terrestris NRRL 
8126]
Length=617

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/638 (47%), Positives = 401/638 (63%), Gaps = 32/638 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  +RL ALR L     ++I  Y++PS+D+H SE+IA C  RRA+ISGF+GSAGTAVVT
Sbjct  4     VNTTERLAALRSLMKEKGVDI--YVVPSEDSHASEYIAACDARRAFISGFSGSAGTAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL  +W L+++G   VPT  EW     + G  +G+DP L +S
Sbjct  62    LEKAALATDGRYFNQASKQLDENWQLLKTGMQDVPTWQEWTAEEATGGKTVGVDPALIAS  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               AE+L E + K     V   + NLVD +W   RP     P+ +   +Y+G D ++KL  
Sbjct  122   SVAEKLDESVKKSGGAGVKAVSENLVDLVWGSDRPPRSNNPVVLLPPEYSGKDTATKLAD  181

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++  V+SMLDEIAWL NLRGSD+ ++PV ++Y IV  D A L++D+SK+  
Sbjct  182   LRKELEKKKAAGFVLSMLDEIAWLFNLRGSDIAYNPVFFSYAIVTQDSATLYVDESKLND  241

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLD-KSTVNAAITNAYKTACDRYSRSP  1208
             E   YL+   V ++ Y++              L+ D KS  +AA TN       +Y  S 
Sbjct  242   ESRSYLEQNNVSVKPYDA--------------LFADAKSLASAAETNETSEPPKKYLVS-  286

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G  +     SPV  AKAVKN  ELEGM+ CH+RD AAL  F+
Sbjct  287   -----NKGSWALKL-ALGGDKYVDEVRSPVGDAKAVKNDTELEGMRQCHIRDGAALIEFF  340

Query  1389  AWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE++ I K   + EV+ A+KL E R KQ  F+  SFDTIS +G N A+IHYKP+   C
Sbjct  341   AWLEDQLINKKAVIDEVDAADKLEELRKKQKDFVGLSFDTISSTGPNAAVIHYKPQKGQC  400

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S+++   ++L DSGAQY+DGTTD TRT+HFG PS  E++ +T VL+G+IALD AVFP+ T
Sbjct  401   SVIDPQAIYLCDSGAQYLDGTTDTTRTLHFGTPSPEERKAYTLVLKGNIALDTAVFPKGT  460

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMVPGMVVS  1919
              GF +D  AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R  + ++  +  G V+S
Sbjct  461   TGFAIDCLARQFLWKAGLDYRHGTGHGVGSYLNVHEGPIGIGTRKQYADVA-LAAGNVLS  519

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
              EPGYYED ++GIRIENL  V+E+ T + FG   +LGFE +T VP   +L+D S+L+A E
Sbjct  520   IEPGYYEDGAYGIRIENLALVREVKTEHSFGDKPFLGFEHVTMVPYCRRLIDESLLTADE  579

Query  2100  VAWLNSYHLQVWEKVSGLVDGR----AREWLWNNTRPI  2201
              AWLN  + ++ E + G  +G     AR WL   T+P 
Sbjct  580   KAWLNESNRRIREVMQGRFEGDEGALARAWLERETQPF  617



>ref|XP_007738872.1| xaa-Pro aminopeptidase [Cladophialophora psammophila CBS 110553]
 gb|EXJ75555.1| xaa-Pro aminopeptidase [Cladophialophora psammophila CBS 110553]
Length=617

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/634 (46%), Positives = 403/634 (64%), Gaps = 21/634 (3%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSR-PDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVV  488
             +++ D  + L QL  R  +  +D YI+PS+D+HQSE+IA C  RRAYISGFTGSAGTAV+
Sbjct  1     MEKVDTTKRLSQLRDRMREHKLDVYIVPSEDSHQSEYIAPCDARRAYISGFTGSAGTAVI  60

Query  489   TKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
             T +KAAL TDGRYF QA KQL  +W+L++ G   VPT  EW       G  +G+DP + +
Sbjct  61    TLEKAALSTDGRYFNQASKQLDENWLLLKQGMEDVPTWQEWTTEQAEGGKTVGVDPTVIT  120

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +  A +L E + K +H  +   + NLVD IW +  P+P ++ I + + KYAG     KL 
Sbjct  121   ASDARKLSETLKKKSHATLVGVSENLVDNIWNDRPPRPAERVIVLSE-KYAGKPYQQKLD  179

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    +  +V+SMLDE+AWL NLRGSD+ ++PV ++Y  V  + A L+ID +KI 
Sbjct  180   DLRKELKKKKAVGMVVSMLDEVAWLFNLRGSDIPYNPVFFSYAAVTPNSATLYIDSAKIG  239

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              EV ++L+   VE+++Y+              +L+ D +++       ++T     S   
Sbjct  240   SEVREHLEGA-VEIKSYD--------------DLFSDLTSIAETAAIEFQTNGVTKSHPN  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +   NK S  L   GL G+       SP++ AKA+KN  ELEGM+ CH+RD AAL+ ++
Sbjct  285   RLLLSNKSSWALYL-GLGGEDKVEESRSPIADAKAIKNPTELEGMRQCHIRDGAALSEYF  343

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLE E+     + EV+ A+KL   RSK   F+  SFDTIS +G N A+IHY PE  +CS
Sbjct  344   AWLEGELHNGSWVDEVQAADKLEAIRSKGEHFVGLSFDTISATGPNAAVIHYSPERGNCS  403

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++   ++L DSGAQY+DGTTD TRT+HFG PS  E + +T VL+G IALD+AVFP+ T 
Sbjct  404   TIDVRAVYLCDSGAQYLDGTTDTTRTLHFGTPSDMEIKAYTLVLKGVIALDRAVFPKGTT  463

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+E
Sbjct  464   GFAIDAFARQHLWREGLDYRHGTGHGVGSYLNVHEGPIGIGTRAAYSEVSLSIGNVISDE  523

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED +FGIRIEN++   E  T ++FG   ++GFE +T VP+  KL+D S+L   E A
Sbjct  524   PGYYEDGNFGIRIENMIMACEAKTNHKFGDKPWIGFEHVTMVPMCRKLIDPSLLDPEERA  583

Query  2106  WLNSYHLQVWEKVSGLVDG--RAREWLWNNTRPI  2201
             WLN+YH +VWEK SG  D   R  +WL   T PI
Sbjct  584   WLNAYHEEVWEKTSGFFDKDERTTKWLRRETAPI  617



>ref|XP_006692714.1| putative cytoplasm protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS20418.1| putative cytoplasm protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=714

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/683 (45%), Positives = 417/683 (61%), Gaps = 31/683 (5%)
 Frame = +3

Query  174   SLPIPRKLHYPL--KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQ  347
             ++P+PR L +P   +F S   +   +   N ++   + +     +   +   +RLRALR 
Sbjct  56    AVPLPRNL-FPFLSRFSSQHLSSAAVSRPNRASYTTQTTGATSSEEMTVHTTERLRALRS  114

Query  348   LFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRY  527
             +     I+I  Y++PS+D+H SE+I  C  RRA+ISGFTGSAGTAVVT +KAAL TDGRY
Sbjct  115   VMKEKGIDI--YVVPSEDSHASEYIDACDARRAFISGFTGSAGTAVVTLEKAALATDGRY  172

Query  528   FLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISK  707
             F QA KQL  +W L+++G   VPT  EW +   + G  +G+DP L SS  AE+L E I +
Sbjct  173   FNQAGKQLDENWELLKTGMQDVPTWQEWTSQQAAGGKVVGVDPTLISSTVAEKLDESIKR  232

Query  708   GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSA  887
                  +     NLVD +W ++RP+    PI +  LKY+G D +SK+  LR +L    ++ 
Sbjct  233   AGGAGLKAVTENLVDIVWGDARPKRSNNPIFLLPLKYSGKDSASKIADLRKELEKKKAAG  292

Query  888   IVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVE  1067
             IV+S+LDEIAWL NLRGSD+ ++PV ++Y +V  D A L+ID+SK+  E   YL    V 
Sbjct  293   IVLSLLDEIAWLFNLRGSDIAYNPVFFSYALVTADSAILYIDESKLNDECKSYLAQNKVS  352

Query  1068  LRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLD  1247
             ++ Y ++  + + L +    LW ++S     I+                    K S  L 
Sbjct  353   IKPYNALFDDAKMLVKAAEALWTEQSPKKFLIS-------------------TKASWALK  393

Query  1248  TNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEIC-KDVG  1424
                L G        SPV  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE+++  K   
Sbjct  394   L-ALGGDKFVEEVRSPVGDAKAVKNETELEGMRQCHIRDGAALIQFFAWLEDQLVNKKAV  452

Query  1425  LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDS  1604
             + EV  A+KL EFR KQ  F+  SFDTIS +G N A+IHYKPE  SC++++   ++L DS
Sbjct  453   IDEVAAADKLEEFRKKQKDFVALSFDTISATGPNAAVIHYKPERGSCAVIDPDAIYLCDS  512

Query  1605  GAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSL  1784
             GAQY+DGTTD TRT+HF  P   E++ +T VL+G+IALD AVFP+ T G+ +DA AR  L
Sbjct  513   GAQYLDGTTDTTRTLHFTTPKPEERKAYTLVLKGNIALDTAVFPKGTTGYAIDALARQFL  572

Query  1785  WKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMVPGMVVSNEPGYYEDHSFGI  1958
             WK GLDYRHGTGHGVG+ LNVHEGP GI  R  + ++ P+  G V+S EPGYYED S+GI
Sbjct  573   WKQGLDYRHGTGHGVGSFLNVHEGPIGIGTRKQYADV-PLASGNVLSIEPGYYEDGSYGI  631

Query  1959  RIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWE  2138
             RIENL  V+E+ T + FG   +LGFE +T VP   KL+D S+L+A E AWLN  + Q+  
Sbjct  632   RIENLAIVREVKTEHSFGDKPFLGFEHVTMVPYCRKLIDESMLTAEEKAWLNKSNEQIRA  691

Query  2139  KVSGLV--DGRAREWLWNNTRPI  2201
              +      D   R WL   T+P 
Sbjct  692   AMEPYFKDDELTRAWLERETQPF  714



>gb|KFY15244.1| hypothetical protein V492_02131 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=667

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/642 (46%), Positives = 389/642 (61%), Gaps = 31/642 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LRQL      N+D Y++PS+D+H SE+IA C  RR YI GF+GSAG AV+T
Sbjct  45    IDTSQRLSKLRQLMKEK--NVDVYVVPSEDSHASEYIASCDGRREYICGFSGSAGCAVIT  102

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA+KQL  SW L++ G   VPT  EW          +G+DP + S+
Sbjct  103   HDKAALATDGRYFNQAQKQLDDSWTLLKQGLADVPTWQEWTAEQAEGSKTVGVDPTVISA  162

Query  672   DAAEELKEDI-SKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L + I + G  +LV +   NL+D +W   RP  P + +     +++G  V++KL 
Sbjct  163   PDARKLADKIKAAGGADLVAVEE-NLIDNVWGADRPAKPTQAVNPLAEEFSGKSVTAKLE  221

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    SS +V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK+T
Sbjct  222   DLRKELDKKKSSGLVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLT  281

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              E  D+L    + +R+Y               +   D S V      A  ++ D  S+  
Sbjct  282   KEAQDHLAQNSISIRSY---------------DAIFDDSAVLGRSIQASTSSGDGSSKPA  326

Query  1209  G----IKK---RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDA  1367
                  +KK    NK S  L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD 
Sbjct  327   SQDTKVKKFMVSNKASWAL-KRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIRDG  385

Query  1368  AALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHY  1544
             AAL  F+AWLE E I K   + EV+  +KL E RSK   F+  SFDTIS +GAN AIIHY
Sbjct  386   AALTEFFAWLENELIEKKATVDEVQALDKLEEIRSKHKHFVGLSFDTISSTGANAAIIHY  445

Query  1545  KPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQ  1724
             KP+P SC++++   ++L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD 
Sbjct  446   KPQPGSCAVIDPKAVYLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDT  505

Query  1725  AVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMV  1901
             A+FP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+ 
Sbjct  506   AIFPKGTSGFSLDTLARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLA  565

Query  1902  PGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLS  2081
              G V+SNEPGYYED SFGIRIEN++ V E  T + FG   YLGFE +T VP   KL+D +
Sbjct  566   VGNVISNEPGYYEDGSFGIRIENIILVTEAKTKHTFGEKPYLGFEHVTMVPYCRKLIDET  625

Query  2082  ILSAAEVAWLNSYHLQVWEKVSGLVD--GRAREWLWNNTRPI  2201
             +L+  E  WLN YH  ++ K  G  +      EWL    +P 
Sbjct  626   LLTPKEKKWLNDYHTDIFAKTKGYFEPGSVTMEWLEREVQPF  667



>sp|C0NDZ7.1|AMPP1_AJECG RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Histoplasma capsulatum G186AR]
 gb|EEH10445.1| xaa-pro aminopeptidase [Histoplasma capsulatum G186AR]
Length=617

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/637 (46%), Positives = 401/637 (63%), Gaps = 30/637 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D YI+PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  4     IDTSQRLARLRELMQ--ERKVDVYIVPSEDSHQSEYIAHCDGRREFISGFTGSAGCAIVS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL ++WIL++ G   +PT  EW       G  +G+DP L ++
Sbjct  62    MTKAALSTDGRYFNQAAKQLDNNWILLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L+ +   NLVD +W   RP  P + + +H +++AG     K+  
Sbjct  122   SDARNLSETIKKCGGSLLGVQE-NLVDLVWGTERPARPSEKVALHPIEFAGKSFEEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S+  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+ID+ K+  
Sbjct  181   LRKELQKKKSAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITQSTADLYIDEEKLPA  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV +YL    V L+ Y              ++++ D   +  +  N  K+  +  ++ P 
Sbjct  241   EVKNYLGD-KVSLKPY--------------SSIFEDAKVLGQSAQN--KSDGEASAKPPQ  283

Query  1212  ---IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
                I  R   S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL+ 
Sbjct  284   KFLISTRASWSLSL---ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALSE  340

Query  1383  FWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E +
Sbjct  341   YFAWLENELVNKKTVLNEVDASDKLEQIRSKHQHFVGLSFDTISSTGPNAAVIHYKAERN  400

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  EK+ +T VL+G I++D AVFP+
Sbjct  401   NCSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMEKKAYTLVLKGLISIDTAVFPK  460

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVV  1916
              T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R   +   + PG V+
Sbjct  461   GTTGFALDAFARQYLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYSEVAIAPGNVI  520

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             S+EPGYYED  FGIRIEN++  KE+ T ++FG   +LGFE +T  P+  KL++ S+LS A
Sbjct  521   SDEPGYYEDGVFGIRIENIIMAKEVKTTHKFGEKPWLGFEHVTMTPLCQKLINPSLLSDA  580

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  W+N YH ++WEK S     D   R WL   T+PI
Sbjct  581   EKKWVNDYHTEIWEKTSKYFENDELTRNWLKRETQPI  617



>gb|EYU44663.1| hypothetical protein MIMGU_mgv1a002786mg [Erythranthe guttata]
Length=637

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/651 (45%), Positives = 401/651 (62%), Gaps = 42/651 (6%)
 Frame = +3

Query  321   EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             E+ L +LR L +     +DA ++PS+D HQSE+++    RR ++SGF GSAG A++T ++
Sbjct  3     EETLASLRSLMASHCPPLDALVVPSEDYHQSEYVSARDKRREFVSGFNGSAGLALITANE  62

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             A LWTDGRYFLQAEKQLS+ W LMR G    PT   W+   L+  + IG+DP+  S D A
Sbjct  63    ALLWTDGRYFLQAEKQLSNEWKLMRVGE--DPTVDIWMADNLASNAAIGVDPWCISVDTA  120

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             ++ +   +K   +L+  +  NLVDE+W  SRP P   P+ V  L++AG  V  KL  LR 
Sbjct  121   QKWERAFAKKQQKLIQTAT-NLVDEVWT-SRPPPETNPVVVQPLEFAGRSVEDKLKDLRE  178

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVM  1040
             +L+   + AIV++ LDE+AWL N+RGSDV +SPV++AY IV    A  ++D  K++ EV 
Sbjct  179   ELMQEKARAIVLTALDEVAWLYNVRGSDVDYSPVVHAYAIVTSAAAFFYVDKRKVSSEVS  238

Query  1041  DYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAY---KTACDRYSRSPG  1211
              Y++  G+E+R Y  + S+   LA          S  NAA  NA+   +   D     PG
Sbjct  239   SYMEKNGIEVRDYGEVSSDAALLASNKL------SYSNAAKENAHDISQNPNDLIWVDPG  292

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                      NLD             SSP+++AKA+KN  E+EG++N H+RD AA+  +  
Sbjct  293   SCFALYSKLNLDK--------VFLHSSPLALAKALKNPVEIEGLKNAHIRDGAAVVQYLV  344

Query  1392  WLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFDTIS  1511
             WL++++ +  G                    LTEV V++KL EFR+ +  F   SF TIS
Sbjct  345   WLDKQMQEIYGASGYFVDSEVNKNDKLRTGKLTEVSVSDKLEEFRASKEHFRGLSFPTIS  404

Query  1512  GSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFT  1691
               G NGA+IHY PEP++C+ ++ + ++L DSGAQYVDGTTDITRTVHFG+P+S EK C+T
Sbjct  405   SVGPNGAVIHYSPEPETCAELDPNSMYLFDSGAQYVDGTTDITRTVHFGKPTSHEKACYT  464

Query  1692  RVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGIS  1871
              VL+GHI L  A FP  T G VLD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP  IS
Sbjct  465   AVLKGHIGLGNARFPNGTTGHVLDVLARIPLWKDGLDYRHGTGHGIGSYLNVHEGPHQIS  524

Query  1872  FR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTF  2048
             FR      P+ P M V++EPGYYED +FGIR+EN+L VKE +T   FG  GYL FE +T+
Sbjct  525   FRPAARNVPLQPSMTVTDEPGYYEDGNFGIRLENVLVVKEAETKFNFGNKGYLSFEHITW  584

Query  2049  VPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
              P Q KL+DLS+L   EV WLN YH +  E ++  +D    EWL   T P+
Sbjct  585   APYQTKLMDLSLLVPEEVEWLNKYHYRCREILAPFLDNSEMEWLKKATEPV  635



>gb|EIE83834.1| hypothetical protein RO3G_08539 [Rhizopus delemar RA 99-880]
Length=608

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/633 (45%), Positives = 386/633 (61%), Gaps = 51/633 (8%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
              +D +++PS+DAHQSE+IA+C  RR +ISGFTGSAG AVVT   AAL+TDGRYFLQA +Q
Sbjct  5     QVDVFLVPSEDAHQSEYIAECDQRRHWISGFTGSAGFAVVTMSTAALFTDGRYFLQASQQ  64

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVF  728
             L  +W LM+ G  GVPT  E+L   +S GSRIG+DP L     A ++   +      LV 
Sbjct  65    LDDNWTLMKQGLPGVPTWQEYLVKNISAGSRIGLDPKLICGADAHQISAQLKPIGSSLVP  124

Query  729   LSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGAD-------------------VSSKLFS  851
             +   NLVD  W E RP+ PK  I V  ++Y+G                     V  KL  
Sbjct  125   IQE-NLVDAAWGEERPKAPKDKIFVQPIQYSGKQKGQLFPFMERSIYSCLGKAVQDKLKE  183

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR  ++   +   V+S LDEIAWL N+RGSD+  +PV ++Y +V    A L+ID  K+T 
Sbjct  184   LRDHIVEKKAYGTVVSALDEIAWLYNVRGSDIECNPVFFSYSVVTESEAILYIDLDKVTD  243

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L +  V LR Y           E  + + L        + N              
Sbjct  244   EVKAHLDASQVTLRPYSEFF-------EALSEIKLKLGEKKLLVNN--------------  282

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                     T+L      G+ + +   S ++ AKA+K   EL+GM+ CH+RD AAL  ++A
Sbjct  283   -------KTSLAVEVAVGEDNVIEERSFITDAKAIKTKEELDGMRACHIRDGAALVQYFA  335

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLE+++  +  + EVE +++L +FR+ Q  ++  SF TIS +G NGAIIHYKPE ++C +
Sbjct  336   WLEQKLLANEKIDEVESSDRLEQFRAAQEHYVGLSFATISSTGPNGAIIHYKPEKETCKV  395

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             ++ + ++L DSG QY+DGTTD+TRT HFG P++ EK CFTRVLQGHIA+DQAVFP+ T G
Sbjct  396   IDPNAIYLCDSGGQYLDGTTDVTRTFHFGTPTAYEKRCFTRVLQGHIAIDQAVFPKGTTG  455

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEP  1928
             ++LD FAR  LWK GL++ HGTGHGVG+ LNVHEGP GI  R   N TP+  GM V++EP
Sbjct  456   YLLDPFARQYLWKDGLNFLHGTGHGVGSFLNVHEGPHGIGIRVSYNDTPLAAGMTVTDEP  515

Query  1929  GYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAW  2108
             GYYED  FGIRIEN++ VKE DTPN FGG GYLGFE +T  PI   L+D+ +LS +E  W
Sbjct  516   GYYEDGKFGIRIENVIIVKEADTPNNFGGRGYLGFEHVTIAPIGRNLIDVDLLSPSERKW  575

Query  2109  LNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             +N YH +   K+S L+  D  A  WL   T PI
Sbjct  576   VNDYHQECLAKLSPLIAHDELATAWLKKETLPI  608



>ref|XP_001542821.1| hypothetical protein HCAG_02992 [Histoplasma capsulatum NAm1]
 sp|A6R035.1|AMPP1_AJECN RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Histoplasma capsulatum NAm1]
 gb|EDN06389.1| hypothetical protein HCAG_02992 [Histoplasma capsulatum NAm1]
Length=617

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/637 (46%), Positives = 399/637 (63%), Gaps = 30/637 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D YI+PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  4     IDTSQRLARLRELMQ--ERKVDVYIVPSEDSHQSEYIAHCDGRREFISGFTGSAGCAIVS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+WIL++ G   +PT  EW       G  +G+DP L ++
Sbjct  62    MTKAALSTDGRYFNQAAKQLDSNWILLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L+ +   NLVD +W   RP  P + + +H +++AG     K+  
Sbjct  122   FDARNLSETIKKCGGSLLGVQE-NLVDLVWGTERPARPSEKVALHPIEFAGKSFEEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L     +  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+ID+ K+  
Sbjct  181   LRKELQKKKCAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITQSTADLYIDEEKLPA  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV +YL    V L+ Y               +++ D   +  +  N  K+  +  ++ P 
Sbjct  241   EVKNYLGD-KVSLKPY--------------GSIFEDAKVLGQSAQN--KSDGEASTKPPQ  283

Query  1212  ---IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
                I  R   S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL+ 
Sbjct  284   KFLISTRASWSLSL---ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALSE  340

Query  1383  FWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E +
Sbjct  341   YFAWLENELVNKKTVLNEVDASDKLEQIRSKHQHFVGLSFDTISSTGPNAAVIHYKAERN  400

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  EK+ +T VL+G I++D AVFP+
Sbjct  401   NCSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMEKKAYTLVLKGLISIDTAVFPK  460

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVV  1916
              T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R   +   + PG V+
Sbjct  461   GTTGFALDAFARQYLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYSEVAIAPGNVI  520

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             S+EPGYYED  FGIRIEN++  KE+ T ++FG   +LGFE +T  P+  KL++ S+LS A
Sbjct  521   SDEPGYYEDGVFGIRIENIIMAKEVKTTHKFGEKPWLGFEHVTMTPLCQKLINPSLLSDA  580

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  W+N YH ++WEK S     D   R WL   T+PI
Sbjct  581   EKKWVNDYHTEIWEKTSKYFENDELTRNWLKRETQPI  617



>ref|XP_007755842.1| xaa-Pro aminopeptidase [Cladophialophora yegresii CBS 114405]
 gb|EXJ63188.1| xaa-Pro aminopeptidase [Cladophialophora yegresii CBS 114405]
Length=618

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/634 (47%), Positives = 407/634 (64%), Gaps = 23/634 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D YI+PS+D+HQSE+IA C  RRAYISGFTGSAGTAVVT
Sbjct  4     VDTSKRLAQLRELMR--EHKVDVYIVPSEDSHQSEYIAPCDARRAYISGFTGSAGTAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL  +W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  62    LEKAALATDGRYFNQASKQLDDNWHLLKQGMEDVPTWQEWTTEQAEGGKTVGVDPTVITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L E + K +H  +   + NLVD+IW +  P+P ++ I + + KY+G     KL  
Sbjct  122   SDARKLSETLKKKSHATLVGISENLVDKIWADRPPRPTEQVIVLSE-KYSGKSYREKLDD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR DL    ++ +V+SMLDE+AWL NLRG+D+ ++PV ++Y  +  D A ++ID SK+ P
Sbjct  181   LRKDLKKKKAAGMVVSMLDEVAWLFNLRGNDIPYNPVFFSYAAITPDSATIYIDSSKLGP  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK-TACDRYSRSP  1208
             EV ++L+   V ++ Y++              L+ D +T+  A  +  +     +   SP
Sbjct  241   EVKEHLEGT-VTIKPYDA--------------LFCDLTTIAEAAASESQANGATKKPHSP  285

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +   NK S  L   GL G+       SP++ AKA+KN+ ELEGM+ CH+RD AAL+ ++
Sbjct  286   KLLLSNKSSWALYL-GLGGEDKVEESRSPIADAKAIKNATELEGMRQCHIRDGAALSEYF  344

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLE E+     + EV+ A+KL E RSK   F+  SFDTIS +G N A+IHY PE  +CS
Sbjct  345   AWLESELQSGSWIDEVQAADKLEEIRSKGQHFVGLSFDTISSTGPNAAVIHYSPERGNCS  404

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ + ++L DSGAQY+DGTTD TRT+HFG PS  E + +T VL+G IALD+AVFP+ T 
Sbjct  405   TIDANLIYLCDSGAQYLDGTTDTTRTLHFGTPSEMEIKAYTLVLKGVIALDRAVFPKGTT  464

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G VVS+E
Sbjct  465   GFAIDAFARQHLWREGLDYRHGTGHGVGSYLNVHEGPIGIGTRAAYSEVSLSIGNVVSDE  524

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED +FGIRIEN++  +E  T ++FG   ++GFE +T VP+  KL+D  +L   E  
Sbjct  525   PGYYEDGNFGIRIENMIMAREAKTNHKFGDKPWIGFEHVTMVPMCRKLIDPKLLDPEERE  584

Query  2106  WLNSYHLQVWEKVSGLVDG--RAREWLWNNTRPI  2201
             WLNSYH +VWEK SG  +G  R  +WL   T PI
Sbjct  585   WLNSYHAEVWEKTSGYFEGDERTTKWLKRETAPI  618



>ref|XP_007804168.1| Xaa-Pro aminopeptidase P [Endocarpon pusillum Z07020]
 gb|ERF70133.1| Xaa-Pro aminopeptidase P [Endocarpon pusillum Z07020]
Length=621

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/632 (46%), Positives = 405/632 (64%), Gaps = 26/632 (4%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LR L     ++I  YI+PS+D+HQSE+IA C  RR YISGF+GSAG AV+T DKAA
Sbjct  9     RLAHLRDLMKEHKLDI--YIVPSEDSHQSEYIAPCDGRREYISGFSGSAGCAVITLDKAA  66

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA KQL  +W L++ G   VPT  EW       G  +G+DP + ++  A +
Sbjct  67    LATDGRYFNQASKQLDDNWTLLKQGLEDVPTWQEWTTEQAEGGKIVGVDPTVITAPDARK  126

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L E++ K     +     NLVD +W   RP  PK+ + V   KY+G    SKL  +R +L
Sbjct  127   LSENLKKKAGSSLIGERENLVDHVWGADRPPRPKEKVMVQPEKYSGNKFQSKLEEVRKEL  186

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
                 ++ I+ISMLDE+AWL NLRGSD+ ++PV ++Y  V +  A++++D +K+T EV D+
Sbjct  187   DKKKAAGIIISMLDEVAWLFNLRGSDIPYNPVFFSYAAVTLTTARIYVDSNKLTDEVKDH  246

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             L    VE+R Y+S+L+++ +++E               + +A  TA      +P +KK+ 
Sbjct  247   L-GTDVEIRPYDSLLADLTAMSESA-----------PIVEDANATAS-----APILKKKY  289

Query  1227  KKSTNLD---TNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               ST      + GL G+       SPV  AKA+KN+ EL+GM++CH+RD AAL+ ++AWL
Sbjct  290   LISTRASWALSLGLGGEEQVDEIRSPVGDAKAIKNATELQGMRSCHIRDGAALSEYFAWL  349

Query  1398  EEEICKDV-GLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             EE + +    L EV+ A+KL   RSK+  F+  SFDTIS +G N A+IHYKPE  +CS +
Sbjct  350   EETLVQKAETLDEVQAADKLEAIRSKREHFVGLSFDTISSTGPNAAVIHYKPERGNCSTI  409

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +   ++L DSGAQY+DGTTD TRT+HFG P+  E + +T VL+G IALD+A+FP+ T GF
Sbjct  410   DPKAIYLCDSGAQYLDGTTDTTRTLHFGNPTGMEVKAYTLVLKGVIALDRAIFPKGTTGF  469

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPG  1931
              LD+FAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+EPG
Sbjct  470   ALDSFARQHLWREGLDYRHGTGHGVGSFLNVHEGPIGIGTRSQYSEVQLSAGNVLSDEPG  529

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YYED +FGIRIEN++  +E  T + FG   +L FE +T VP+  KL+D ++L++ E  WL
Sbjct  530   YYEDGNFGIRIENMIMARETSTKHNFGDKPWLSFEHVTMVPMCRKLIDPALLTSEEKTWL  589

Query  2112  NSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             N YH +VWEK+S     D R  +WL   T+ I
Sbjct  590   NDYHREVWEKISEFFKDDQRTTDWLQRETKEI  621



>gb|KFY39396.1| hypothetical protein V494_03998 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=667

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/641 (45%), Positives = 396/641 (62%), Gaps = 29/641 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LRQL      N+D Y++PS+D+H SE+IA C  RR YI GF+GSAG AV+T
Sbjct  45    IDTSQRLSKLRQLMKEK--NVDVYVVPSEDSHASEYIASCDGRREYICGFSGSAGCAVIT  102

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA+KQL  SW L++ G   VPT  EW          +G+DP + S+
Sbjct  103   HDKAALATDGRYFNQAQKQLDDSWTLLKQGLADVPTWQEWTAEQAEGSKTVGVDPTVISA  162

Query  672   DAAEELKEDI-SKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L + I + G  +LV +   NL+D +W   RP  P + +     +++G  V++KL 
Sbjct  163   PDARKLADKIKAAGGADLVAVEE-NLIDNVWGADRPAKPTQAVNPLAEEFSGKSVTAKLE  221

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    SS +V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L+ID SK++
Sbjct  222   DLRKELDKKKSSGLVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYIDSSKLS  281

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAI---TNAYKTACDRYS  1199
              E  D+L    + +R+Y++              ++ D + +  +I   T++   +    S
Sbjct  282   KEAQDHLAQNSISIRSYDA--------------IFEDSAVLGRSIQASTSSGDGSSKPAS  327

Query  1200  RSPGIKK---RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAA  1370
             +   +KK    NK S  L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD A
Sbjct  328   QDTKVKKFMVSNKASWAL-KRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIRDGA  386

Query  1371  ALAHFWAWLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYK  1547
             AL  F+AWLE E+ ++   + EV+  +KL E RSK   F+  SFDTIS +GAN AIIHYK
Sbjct  387   ALTEFFAWLENELIENKATVDEVQALDKLEEIRSKHKHFVGLSFDTISSTGANAAIIHYK  446

Query  1548  PEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQA  1727
             P+P SC++++   ++L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD A
Sbjct  447   PQPGSCAVIDPKAVYLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTA  506

Query  1728  VFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVP  1904
             +FP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  
Sbjct  507   IFPKGTSGFSLDTLARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAV  566

Query  1905  GMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSI  2084
             G V+SNEPGYYED SFGIRIEN++ V E  T + FG   YLGFE +T VP   KL+D ++
Sbjct  567   GNVISNEPGYYEDGSFGIRIENIILVTEAKTKHTFGEKPYLGFEHVTMVPYCRKLIDETL  626

Query  2085  LSAAEVAWLNSYHLQVWEKVSGLVDGRA--REWLWNNTRPI  2201
             L+  E  WLN YH  ++ K  G  +  +   +WL    +P 
Sbjct  627   LTPKEKKWLNDYHTDIFAKTKGYFEAGSVTMKWLEREVQPF  667



>gb|EGC44919.1| aminopeptidase [Histoplasma capsulatum H88]
Length=617

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/637 (46%), Positives = 399/637 (63%), Gaps = 30/637 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D Y++PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  4     IDTSQRLARLRELMQ--ERKVDVYVVPSEDSHQSEYIAHCDGRREFISGFTGSAGCAIVS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL ++WIL++ G   +PT  EW       G  +G+DP L ++
Sbjct  62    MTKAALSTDGRYFNQAAKQLDNNWILLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L+ +   NLVD +W   RP  P + + +H +++AG     K+  
Sbjct  122   SDARNLSETIKKCGGSLLGVQE-NLVDLVWGTERPARPSEKVALHPIEFAGKSFEEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L     +  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+ID+ K+  
Sbjct  181   LRKELQKKKCAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITQSTADLYIDEEKLPA  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV +YL    V L+ Y              ++++ D   +  +  N  K+  +  ++ P 
Sbjct  241   EVKNYLGD-KVSLKPY--------------SSIFEDAKVLGQSAQN--KSDGETSTKPPQ  283

Query  1212  ---IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
                I  R   S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL+ 
Sbjct  284   KFLISTRASWSLSL---ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALSE  340

Query  1383  FWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E +
Sbjct  341   YFAWLENELVNKKTVLNEVDASDKLEQIRSKHQHFVGLSFDTISSTGPNAAVIHYKAERN  400

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  EK+ +T VL+G I++D AVFP+
Sbjct  401   NCSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMEKKAYTLVLKGLISIDTAVFPK  460

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVV  1916
              T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R   +   + PG V+
Sbjct  461   GTTGFALDAFARQYLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYSEVAIAPGNVI  520

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             S+EPGYYED  FGIRIEN++  KE+ T ++FG   +LGFE +T  P+  KL++ S+LS  
Sbjct  521   SDEPGYYEDGVFGIRIENIIMAKEVKTTHKFGEKPWLGFEHVTMTPLCQKLINPSLLSDV  580

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  W+N YH ++WEK S     D   R WL   T+PI
Sbjct  581   EKKWVNDYHTEIWEKTSKYFENDELTRNWLKRETQPI  617



>gb|KEQ71118.1| putative Xaa-pro aminopeptidase P [Aureobasidium pullulans var. 
namibiae CBS 147.97]
Length=607

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/629 (46%), Positives = 387/629 (62%), Gaps = 34/629 (5%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             +RL  LR+L  R  ++I  YI+PS+D+HQSE+IA    RR YISGF+GSAGTAV+T DKA
Sbjct  8     ERLSQLRELMKRNKVDI--YIVPSEDSHQSEYIAPADARREYISGFSGSAGTAVITHDKA  65

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             AL TDGRYF QAEKQL  +W L++ G   VPT  EW       G  +G+DP   ++  A 
Sbjct  66    ALATDGRYFNQAEKQLDDNWTLLKQGLQDVPTWQEWSAEQAEGGKTVGVDPTTITAPDAR  125

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             +L E I K   + +     NLVD +W  +RP  P +   V  L +AG     K+  +R D
Sbjct  126   KLSEKIKKKGGKDLIAVKENLVDSVWGSARPARPNEKADVLTLDFAGKKFQDKIEDIRKD  185

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    S+  V+SMLDE+AWL NLRGSD+ ++PV ++Y +V    + L+IDDSK+T     
Sbjct  186   LDKKKSAGFVVSMLDEVAWLYNLRGSDIPYNPVFFSYAVVTPTTSTLYIDDSKLTAAAKT  245

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +L   GVE+R YE              +++ D    +++      T  ++Y  S      
Sbjct  246   HLS--GVEVRPYE--------------SIFTDMEAFSSS-----STGDNKYLVS------  278

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             NK S  L    L G+       S +  AKAVKN  E++GM+ CH+RD AAL+ F+AWLE+
Sbjct  279   NKASWAL-YQALGGEDKVELIRSLIGDAKAVKNETEMKGMRECHIRDGAALSEFFAWLED  337

Query  1404  EIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNR  1580
              +  ++  + EVE A+KL   RSK   F+  SFDTIS +GAN A+IHYKPE  +CS+++ 
Sbjct  338   RLVGENAKIDEVEAADKLESIRSKHKHFVGLSFDTISSTGANAAVIHYKPEVGACSVIDP  397

Query  1581  HELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVL  1760
               ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+GHIALD   FP+ T G+ +
Sbjct  398   KAVYLCDSGAQYLDGTTDTTRTMHFGEPTDMERKAYTLVLKGHIALDNVKFPKGTTGYAI  457

Query  1761  DAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYY  1937
             D  AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+  G V+SNEPGYY
Sbjct  458   DVLARQFLWAEGLDYRHGTGHGVGSFLNVHEGPIGIGTRVAYSEVPLAVGNVISNEPGYY  517

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN+  V E  T ++FG   YLGFE +T  P+  KL D S+LS+ E  WLN 
Sbjct  518   EDGAFGIRIENMFMVTEKKTTHQFGDKPYLGFEHVTMTPMCKKLTDASLLSSEEKQWLND  577

Query  2118  YHLQVWEKVSGLV--DGRAREWLWNNTRP  2198
             YH +V+EK  G    D R  +WL     P
Sbjct  578   YHSKVYEKTKGYFSQDQRTMKWLERECAP  606



>ref|XP_007848100.1| aminopeptidase p [Moniliophthora roreri MCA 2997]
 gb|ESK92563.1| aminopeptidase p [Moniliophthora roreri MCA 2997]
Length=644

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/646 (45%), Positives = 390/646 (60%), Gaps = 35/646 (5%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LR+L  + + NI AYI+PS+D H SE+IADC  RRA+ISGF GSAG A++T ++A 
Sbjct  11    RLTRLRELMQKQENNISAYIVPSEDQHGSEYIADCDERRAFISGFDGSAGCAIITLNEAF  70

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             ++TDGRYFLQAE+QL  +W LM+ G   VPT  E+L S L   SRIG+DP L +   +  
Sbjct  71    MFTDGRYFLQAEQQLDENWKLMKQGLPDVPTWQEFLTSHLKEDSRIGLDPTLITFADSTS  130

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             + + +   N  LV ++  NLVD++W   RP+ P  PI   DLKY+G   SSKL  + + +
Sbjct  131   ISKSLKPRNSSLVSIAE-NLVDQVWGSERPRRPANPIVHLDLKYSGESHSSKLNRVVAAI  189

Query  867   INAGSS------------------AIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEID  992
                 S+                   ++++ LDEIAWL NLRGSD+ ++PV ++Y +V +D
Sbjct  190   TEPASAKAPNTNTKPLDGASPTRKVLILTALDEIAWLFNLRGSDITYNPVFFSYAVVYLD  249

Query  993   GAKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNA  1172
             G K         P  + +L+  GVE  +    +   E   +    +W    T+   +   
Sbjct  250   GTK---------PRAVLFLQKEGVESMSGLGDILGQEVEIKAYDEIWSYLKTLGEKLRKE  300

Query  1173  YKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNC  1352
                  +   +   +  +     +L      G+   +   SPV+  KA+KNS ELEG +  
Sbjct  301   IDGQSNESKKVVLVSDK----ASLAVVETLGEDIVINAPSPVAALKAIKNSTELEGFRQS  356

Query  1353  HLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGA  1532
             H RD  ALA ++AWLEE +  D   TE E AEKL +FRS+   F   SFDTIS +G NGA
Sbjct  357   HTRDGVALAKYFAWLEESVAGDKPPTEWEGAEKLEKFRSELDLFKGLSFDTISSTGPNGA  416

Query  1533  IIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHI  1712
             IIHY P P  C ++ + +++L DSGAQ+ DGTTD+TRT HFG P+  EK   TRVLQGHI
Sbjct  417   IIHYSPNPKDCPVIEQDQIYLCDSGAQFWDGTTDVTRTWHFGNPTDEEKRAATRVLQGHI  476

Query  1713  ALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NM  1889
             A+D AVFP  T GF +D++AR +LWK GLDYRHGTGHGVG  LNVHEGP GI  R   N 
Sbjct  477   AIDTAVFPNGTTGFAIDSWARRALWKDGLDYRHGTGHGVGHFLNVHEGPHGIGVRIVYNS  536

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
             TP+  GM V+NEPGYY D  FG+RIEN++ V+E  TPN FG  GYL  E++T  PIQ KL
Sbjct  537   TPLKAGMTVTNEPGYYADGKFGVRIENVMLVQETKTPNNFGDKGYLALERVTMCPIQTKL  596

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             VD  +L+  E+ WLN YH +VW KVS  +  D +A EWL    RPI
Sbjct  597   VDTQLLNEEEIQWLNDYHKEVWTKVSPFLKNDEQAFEWLERECRPI  642



>gb|EPB91827.1| hypothetical protein HMPREF1544_01335 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=620

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/634 (47%), Positives = 401/634 (63%), Gaps = 44/634 (7%)
 Frame = +3

Query  315   DQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTK  494
             D   +L ALR        N+DA+++PS+DAHQSE+ A+C  RRA+ISGFTGSAG AVVTK
Sbjct  25    DAGRKLAALRTAMD----NLDAFVVPSEDAHQSEYTAECDNRRAWISGFTGSAGCAVVTK  80

Query  495   DKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             + AAL+TDGRYFLQA K+L    W LM+ G  GVPT  E+L   L P S IGIDP + + 
Sbjct  81    NDAALFTDGRYFLQASKELDEKHWKLMKQGIPGVPTWQEYLKD-LPPNSSIGIDPSVITM  139

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
             + A +L +++S    +LV+++  N VD+I    RP  P +PI+VH ++YAG  V SKL  
Sbjct  140   EEARQLDKELSLIGSKLVYVTE-NPVDQIRSTDRPSRPSEPIKVHPIQYAGKSVKSKLNE  198

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDS-KIT  1028
             LR    N   +++++S LDEIAWLLNLRGSD+  SPV ++Y+IV    A L++  S K++
Sbjct  199   LRKACEN---NSVIVSALDEIAWLLNLRGSDIHCSPVFFSYVIVTPQQATLYLQPSAKLS  255

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +V  +LK  GV+L  Y+ +LS+I +L +      +D S  N +I  A      R  + P
Sbjct  256   EQVKSHLKEAGVQLANYDQVLSDIRNLNQP---FLIDPSATNMSICQAIGETNIRSKQGP  312

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                                          +SMAKAVKN +EL GM+NCH RDA AL   +
Sbjct  313   SF---------------------------ISMAKAVKNESELNGMRNCHKRDAVALCKHF  345

Query  1389  AWLEEEI-CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             +WL E +  +   + E E A+ L   R     ++  SFDTI+ +G NGAIIHY+P+P + 
Sbjct  346   SWLSEALTAQKQTIRESEAADHLASMRQLDPTYIGLSFDTIAATGPNGAIIHYQPDPKNS  405

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHF-GEPSSREKECFTRVLQGHIALDQAVFPEN  1742
             +I+N   ++L DSGAQY+DGTTD+TRT  F GEP+  +K  FTRVLQ HIA+DQ+VFP+ 
Sbjct  406   AIINPRRIYLCDSGAQYIDGTTDVTRTYMFDGEPTEFQKRAFTRVLQCHIAVDQSVFPQG  465

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVS  1919
             T G+ LD+ AR  LWK GL++RHG GHGVGA LNVHEGPQGI  R   N  P+ PGMVV+
Sbjct  466   TTGYQLDSIARLPLWKDGLNFRHGVGHGVGAYLNVHEGPQGIGSRASYNTVPLQPGMVVT  525

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             NEPGYYED  FGIRIEN+L V+   TP RFG    LGFE +TFVPI  KL++  +L+ ++
Sbjct  526   NEPGYYEDGQFGIRIENVLTVRRASTPYRFGNTDSLGFEHVTFVPIGRKLLEDGLLTPSD  585

Query  2100  VAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
               W+N YH +  + +  L+D +A  WL   T P+
Sbjct  586   KLWINKYHQECRDVLEPLLDNKALSWLERETEPL  619



>emb|CEL58929.1| X-Pro aminopeptidase [Rhizoctonia solani AG-1 IB]
Length=642

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/641 (47%), Positives = 407/641 (63%), Gaps = 21/641 (3%)
 Frame = +3

Query  294   QKKP-----RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISG  458
             Q KP     R ++  +RL ALR L    +  +DAY++ S+D H SE++A C  RRA+ISG
Sbjct  4     QDKPGEPGARTVNTSERLNALRLLLK--ENQVDAYVVVSEDQHSSEYLAACDARRAFISG  61

Query  459   FTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGS  638
             F GSAG AV++   A L+TDGRYFLQAE+QL S+W LM+ G  GVPT  E+L   L  G+
Sbjct  62    FDGSAGCAVISASGAFLFTDGRYFLQAEQQLDSNWTLMKQGLPGVPTWQEFLAKKLPEGT  121

Query  639   RIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKY  818
             +IGIDP L S   A  LK+ ++  N  LV ++  NLVD++W  SRP  P  PI    LKY
Sbjct  122   KIGIDPTLISVSDATSLKKTLTPRNSSLVPIA-ANLVDKVWT-SRPPRPANPIHPLPLKY  179

Query  819   AGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGA  998
             +GA  + KL  LR+ L  AG++ +V+S+LDE+AWL+ +RGSD+ ++PV +AY +V  + A
Sbjct  180   SGASATEKLNMLRAKLARAGATGVVVSLLDEVAWLVGMRGSDIDYNPVFFAYAVVAPNTA  239

Query  999   KLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK  1178
              LF++ S++T E    L   G  +  YE+I+  +E L  K   +   K  V     +  +
Sbjct  240   TLFVNSSQLTSEAQANLNEAGWAVEKYENIIKHLEDLGSKAKEV---KEEVKVTDEDDGE  296

Query  1179  TACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHL  1358
              A  +      +   +K S  L      G+ H     S V+ AK++KN+ ELEG +N H+
Sbjct  297   EAQPKGDAQGKVLVDSKAS--LAVAHALGEDHYQIVRSSVADAKSIKNAVELEGFRNSHI  354

Query  1359  RDAAALAHFWAWLEEEIC--KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGA  1532
             RD  ALA ++A LEE +   +    +E + AE L  +RS+   F   SF TIS +G NGA
Sbjct  355   RDGVALARYFAHLEEHLSGSEQPKWSEYQAAEVLERYRSELDLFKGLSFTTISSTGPNGA  414

Query  1533  IIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHI  1712
             IIHY P  +  + + + +++L DSGAQ++DGTTD+TRT HFG P+  EK  FTRV+QGHI
Sbjct  415   IIHYSPSKEGSAEIKKDQIYLCDSGAQFLDGTTDVTRTWHFGTPTKEEKRAFTRVVQGHI  474

Query  1713  ALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NM  1889
             ++D AVFP  T G+VLDAFAR +LW  GLDYRHGTGHGVG  L VHEGPQGI  R   N 
Sbjct  475   SIDTAVFPTGTTGYVLDAFARRALWADGLDYRHGTGHGVGHYLCVHEGPQGIGTRIAYND  534

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
             T +  GMV+SNEPGYYED  FGIRIE+++ V++  TPN FG  GYLGFE +T  PIQ KL
Sbjct  535   TKLKEGMVLSNEPGYYEDGKFGIRIESIVLVRKTSTPNDFGARGYLGFEHVTMCPIQTKL  594

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKV----SGLVDGRAREWL  2180
             VD S+L+  E+ WLN+YH +V EKV    + + D RA+ WL
Sbjct  595   VDRSLLNVTEIEWLNNYHAEVLEKVGPELAKVGDARAQAWL  635



>ref|XP_006969727.1| X-Prolyl aminopeptidase [Trichoderma reesei QM6a]
 gb|EGR44374.1| X-Prolyl aminopeptidase [Trichoderma reesei QM6a]
 gb|ETR97049.1| xaa-pro aminopeptidase [Trichoderma reesei RUT C-30]
Length=620

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/631 (47%), Positives = 394/631 (62%), Gaps = 24/631 (4%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +L  LR L    + N+  Y++PS+D+H SE+IA C  RR +ISGFTGSAG AV+T+  AA
Sbjct  9     KLAKLRALMK--EHNVQVYVVPSEDSHSSEYIAACDARREFISGFTGSAGCAVITETAAA  66

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA +QL  +W L++ G   VPT  EW     + G  + +D  L ++  A++
Sbjct  67    LATDGRYFNQATQQLDDNWTLLKQGLQDVPTWQEWAAEQAAGGKTVAVDSTLVTASIAKK  126

Query  687   LKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             L E I K G  +LV L ++NLVD +W E RP  P++ I V   K+AG  V SKL  + S+
Sbjct  127   LAEKIRKSGGSDLVPL-DINLVDAVWAEDRPARPQQRITVLSDKFAGKSVQSKLSDVFSE  185

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    S  + ISMLDE+AWL NLRGSD+ ++PV ++Y ++   GA L++D+SK+  E  +
Sbjct  186   LEKKRSPGLFISMLDEVAWLFNLRGSDIPYNPVFFSYAVITPKGAALYVDESKLDEECRE  245

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +L    V ++ YE              + + D    +     + ++A +  S S      
Sbjct  246   HLNKCNVAIKPYE--------------SFFRDAELHHQQFVASAQSA-EGASPSGSFLMS  290

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             NK S  L    L G        SPV  AKA+KN  E+EGM+ CH+RD AAL  ++AWLE+
Sbjct  291   NKGSWALK-RALGGDGAVEEIRSPVGDAKAIKNETEMEGMRACHIRDGAALIEYFAWLED  349

Query  1404  E-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNR  1580
             + I K   L EV+ A+KL E RSK   F+  SF TIS +GAN A+IHY PE  +C++++ 
Sbjct  350   QLINKKTVLDEVQAADKLEELRSKHEHFVGLSFPTISSTGANAAVIHYGPERGNCAVIDP  409

Query  1581  HELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVL  1760
               ++L DSGAQY+DGTTD TRT+HFGEPS  E+E +T VL+G+IALD A+FP+ T GF L
Sbjct  410   EAIYLCDSGAQYLDGTTDTTRTLHFGEPSEAEREAYTLVLKGNIALDVAIFPKGTTGFAL  469

Query  1761  DAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYY  1937
             DA AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R      P+ PG V+SNEPGYY
Sbjct  470   DALARQHLWKTGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAPGNVISNEPGYY  529

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED  FGIRIEN++ VKE+ T   FG   +LGFE +T VP    L++ S+LS AE  WLN+
Sbjct  530   EDGRFGIRIENIVMVKEVKTKYAFGDKPFLGFEHVTMVPYCRNLINESMLSEAEKTWLNT  589

Query  2118  YHLQVWEKVSGLVDGRA--REWLWNNTRPID  2204
              + ++ EK  G  +G A    WL   TRPI+
Sbjct  590   SNAEILEKTKGFFEGDALTMAWLTRETRPIE  620



>gb|EFX00736.1| xaa-pro aminopeptidase [Grosmannia clavigera kw1407]
Length=712

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/634 (47%), Positives = 401/634 (63%), Gaps = 22/634 (3%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL ALR L +  + +ID YI+PS+DAH SE+IA C  RR +ISGF+GSAG A+VT
Sbjct  97    IDTSARLEALRTLMN--EHHIDIYIVPSEDAHSSEYIAPCDGRRQFISGFSGSAGCAIVT  154

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W+L++ G   VPT  EW  +  + G  +G+DP L S+
Sbjct  155   LSKAALATDGRYFNQASKQLDSNWLLLKQGILEVPTWQEWTVTEAAGGKVVGVDPTLISN  214

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
              AA++L + I K     +   + NLVD IW   +P  P +PI      YAG  +S+KL  
Sbjct  215   AAAKKLADKIKKSGGGGLKAISANLVDAIWGVDQPPRPAEPIVQLAGSYAGRSISAKLAD  274

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +     ++  V+SMLDE+AWL NLRG+D+ ++PV ++Y IV  D A L++D+SK+T 
Sbjct  275   LRKEFAKTSAAGFVVSMLDEVAWLFNLRGNDIPYNPVFFSYAIVTADNALLYVDESKLTA  334

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             E   YL    V ++ Y +I S+   LA   A       TV+        ++   ++    
Sbjct  335   ESRSYLAENKVTVKPYSAIFSDATELATAAATATEAAGTVSVRPKKFLLSSSASWA----  390

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                      NL    L G+       SP+  AKA+KN  ELEGM+ CH+RD +AL  ++A
Sbjct  391   --------LNL---ALGGEKSVEEVRSPIGDAKAIKNDTELEGMRQCHIRDGSALIAYFA  439

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WLEE++   V L EV  ++KL E RSKQ  F+  SF TIS +G N A+IHY+PE  SCSI
Sbjct  440   WLEEQLQSGVELDEVTASDKLEELRSKQERFVGLSFTTISSTGPNAAVIHYQPERGSCSI  499

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             ++   ++L DSGAQY+DGTTD TRT+HFG P++ EK+ +T VL+G+IALD A+FP+ T G
Sbjct  500   IDPKAIYLCDSGAQYLDGTTDTTRTLHFGTPTAAEKKAYTLVLKGNIALDVAIFPKGTTG  559

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMVPGMVVSNE  1925
             F LDA AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R  + ++  +  G V S E
Sbjct  560   FALDALARQFLWKEGLDYRHGTGHGVGSYLNVHEGPIGIGTRKQYADVA-LASGNVTSIE  618

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED S+GIRIEN++ VKE++T + FG   YLGFE +T VP    L+D ++L+  E  
Sbjct  619   PGFYEDGSYGIRIENMVIVKEVETTHSFGDKPYLGFEHVTMVPYARSLIDATLLTEQEKK  678

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             WLN +H ++ +K  GL+  D RA  WL   T+P+
Sbjct  679   WLNDHHAEIVKKTQGLLQDDERALAWLMKETQPL  712



>gb|ELR10443.1| hypothetical protein GMDG_00855 [Pseudogymnoascus destructans 
20631-21]
Length=671

 Score =   546 bits (1407),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 305/687 (44%), Positives = 406/687 (59%), Gaps = 34/687 (5%)
 Frame = +3

Query  180   PIPRKLHYPL---KFPSSSANCRVLIVRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL  350
             P+ R LH       F  S+    + I  +SS  +A  +         +D   RL  LRQL
Sbjct  6     PLNRVLHTARPRNTFDYSAQRIHISICLSSSCASADMAC--------IDTSQRLSKLRQL  57

Query  351   FSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYF  530
                   N+D YIIPS+D+H SE+IA C  RR +I GF+GSAG AVVT+DKAAL TDGRYF
Sbjct  58    MKEK--NVDVYIIPSEDSHASEYIASCDARREFICGFSGSAGCAVVTQDKAALATDGRYF  115

Query  531   LQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKG  710
              QA+KQL  SW L++ G   VPT  EW          +G+ P + S+  A +L + I   
Sbjct  116   NQAQKQLDDSWTLLKQGLVDVPTWQEWTAEQAEGSKTVGVHPTVISAPDARKLADKIKAA  175

Query  711   NHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAI  890
                 +     NL+D++W   RP  P + ++    +++G  V++KL  LR +L    SS +
Sbjct  176   GGAGLIAVEDNLIDKVWGADRPAKPAQAVKPLGEEFSGKSVTAKLEDLRKELDKKKSSGL  235

Query  891   VISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVEL  1070
             V+SMLDEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++ E  D L    + +
Sbjct  236   VVSMLDEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLSKEAQDRLTQNCISI  295

Query  1071  RAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDR---YSRSPGIKK---RNKK  1232
             R+Y++I        E  A L     ++ A  T    +  D     ++   +KK    NK 
Sbjct  296   RSYDAIF-------EDAAVL---GRSIQATTTKEASSGDDSSKPATQDAKVKKFMVSNKA  345

Query  1233  STNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-I  1409
             S  L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE E I
Sbjct  346   SWAL-KRALGGDANVDEVRSPIGDAKAVKNVTELEGMRACHIRDGAALTEFFAWLENELI  404

Query  1410  CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHEL  1589
              K   + EVE  +KL E RSK   F+  SFDTIS +GAN AIIHYKPEP +CSI++ +E+
Sbjct  405   EKKATVNEVEALDKLEEMRSKHKHFVGLSFDTISSTGANAAIIHYKPEPGNCSIIDPNEV  464

Query  1590  FLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAF  1769
             +L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD AVFP+ T GF LD  
Sbjct  465   YLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAVFPKGTSGFSLDTL  524

Query  1770  ARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDH  1946
             AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V+SNEPGYYE+ 
Sbjct  525   ARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNVISNEPGYYEEG  584

Query  1947  SFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHL  2126
             SFGIRIEN++ V++    + FG   YLGFE +T VP    L+D S+L+  E  WLN YH 
Sbjct  585   SFGIRIENIIMVRDAKMKHTFGEKPYLGFEHVTMVPYCRNLIDESLLTPKEKRWLNEYHA  644

Query  2127  QVWEKVSGLVD--GRAREWLWNNTRPI  2201
              ++ K  G  +      +WL    +P 
Sbjct  645   DIFAKTKGYFEPGSVTMKWLEREVQPF  671



>ref|XP_006088172.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X2 [Myotis lucifugus]
Length=655

 Score =   545 bits (1404),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  42    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  101

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LMR G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  102   AAMWTDGRYFLQAAKQMDSNWTLMRMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  161

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  162   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  219

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  220   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  279

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  280   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTNLSPKEKVW  321

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  322   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  380

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  381   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  439

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  440   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  499

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  500   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  559

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  560   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  619

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  620   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  651



>ref|XP_006088171.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Myotis lucifugus]
Length=657

 Score =   545 bits (1404),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  44    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  103

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LMR G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  104   AAMWTDGRYFLQAAKQMDSNWTLMRMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  163

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  164   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  221

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  222   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  281

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  282   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTNLSPKEKVW  323

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  324   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  382

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  383   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  441

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  442   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  501

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  502   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  561

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  562   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  621

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  622   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  653



>gb|KEQ89621.1| peptidase M24 [Aureobasidium pullulans EXF-150]
Length=607

 Score =   543 bits (1399),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 291/628 (46%), Positives = 392/628 (62%), Gaps = 36/628 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  +RL  LR+L  R  ++I  YI+PS+D+HQSE+IA    RR YI GF+GSAGTAVVT
Sbjct  4     VNTTERLAQLRELMKRNKVDI--YIVPSEDSHQSEYIAPADARREYICGFSGSAGTAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRI-GIDPFLFS  668
              DKAAL TDGRYF QAEKQL  +W L++ G   VPT  EW ++  S G++I G+DP   +
Sbjct  62    LDKAALATDGRYFNQAEKQLDDNWTLLKQGLQDVPTWQEW-SAEQSEGAKIVGVDPTTIT  120

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +  A +L E I K   + +     NLVD +W  +RP  P +   V  L +AG     K+ 
Sbjct  121   APDARKLSEKIKKKGGKDLIAVKENLVDSVWDSARPARPNEKADVLTLDFAGKKFQDKID  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR DL    S+  V+SMLDEIAWL NLRGSD+ ++PV ++Y +V    + L+IDDSK+T
Sbjct  181   DLRKDLDKKKSAGFVVSMLDEIAWLYNLRGSDIPYNPVFFSYAVVTPTTSTLYIDDSKLT  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
                  +L   GVE+R Y++              ++ D   ++++ T   K          
Sbjct  241   AAAKTHLS--GVEVRPYDA--------------VFTDMEALSSSSTGESKYLV-------  277

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G+       S +  AKAVKN  E++GM+ CH+RD AAL+ ++
Sbjct  278   ----SNKASWAL-YQALGGEDKVDLVRSLIGDAKAVKNETEMKGMRECHIRDGAALSEYF  332

Query  1389  AWLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  +   + EVE A+KL   RSK   F+  SFDTIS +GAN A+IHYKPEP +C
Sbjct  333   AWLEDQLINEKAKIDEVEGADKLESIRSKHKHFVGLSFDTISSTGANAAVIHYKPEPGAC  392

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S+++   ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+GHIALD   FP+ T
Sbjct  393   SVIDPKAVYLCDSGAQYLDGTTDTTRTMHFGEPTDMERKAYTLVLKGHIALDNVKFPKGT  452

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSN  1922
              G+ +D  AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+  G V+SN
Sbjct  453   TGYAIDVLARQFLWAEGLDYRHGTGHGVGSFLNVHEGPIGIGTRVAYSEVPLAVGNVISN  512

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED +FGIRIEN+  V E  T ++FG   YLGFE +T  P+  KL D+S+LS+ E 
Sbjct  513   EPGYYEDGAFGIRIENMFMVTEKKTTHQFGDKPYLGFEHVTMTPMCRKLTDVSLLSSEEK  572

Query  2103  AWLNSYHLQVWEKVSGLV--DGRAREWL  2180
              WLN YH +V+E+  G    D R  +WL
Sbjct  573   QWLNDYHSKVYERTKGYFTHDQRTMKWL  600



>ref|XP_005874614.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X3 [Myotis brandtii]
Length=657

 Score =   545 bits (1403),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  44    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  103

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LMR G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  104   AAMWTDGRYFLQAAKQMDSNWTLMRMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  163

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  164   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  221

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  222   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  281

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  282   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTSLSPKEKVW  323

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  324   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  382

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  383   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  441

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  442   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  501

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  502   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  561

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  562   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  621

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  622   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  653



>ref|XP_005874612.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Myotis brandtii]
Length=655

 Score =   545 bits (1403),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  42    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  101

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LMR G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  102   AAMWTDGRYFLQAAKQMDSNWTLMRMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  161

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  162   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  219

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  220   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  279

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  280   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTSLSPKEKVW  321

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  322   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  380

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  381   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  439

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  440   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  499

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  500   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  559

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  560   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  619

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  620   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  651



>ref|XP_003755440.1| PREDICTED: xaa-Pro aminopeptidase 1 [Sarcophilus harrisii]
Length=623

 Score =   543 bits (1399),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 292/635 (46%), Positives = 389/635 (61%), Gaps = 36/635 (6%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA+VT+  
Sbjct  10    LRQLRQAMKNTEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIVTEQH  69

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL +VL  GSR+G+DP +  SD  
Sbjct  70    AAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVNVLPEGSRVGVDPLIIPSDQW  129

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RPQ P KP+    L YAG     K+  LR 
Sbjct  130   KKMAKVLRGAGHYLVPVKE-NLVDKIWTD-RPQRPCKPLLTLGLDYAGVAWKDKVADLRV  187

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFID-DSKITPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y IV  D  +LFID D    P+V
Sbjct  188   KMAERKVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIVGTDTIRLFIDGDRTKAPDV  247

Query  1038  MDYL---KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              ++L    S+  E +                            +I    KT C   S   
Sbjct  248   REHLLFSSSLADEFKVQVLPY---------------------KSILTELKTICSGLSPKD  286

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +   +K S  + T  +  +       +P+ ++KAVKNS E EGM+  H++DA AL   +
Sbjct  287   KVWISDKASYAV-TEAIPKEHRCCMPYTPICISKAVKNSTESEGMRRAHIKDAVALCELF  345

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
              WLE+E+ K   +TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++  
Sbjct  346   NWLEKEVPKG-SVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYSPVPETNR  404

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ +E++L+DSGAQY DGTTD+TRT+HFG PS+ EKECFT VL+GHIA+  A+FP  T 
Sbjct  405   TLSLNEVYLIDSGAQYKDGTTDVTRTMHFGTPSAYEKECFTYVLKGHIAVSAAIFPTGTK  464

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEP  1928
             G +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EP
Sbjct  465   GHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEP  524

Query  1929  GYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAW  2108
             GYYED SFGIRIEN++ V    T   F   G L FE LT VPIQ K++D+++L+  E  W
Sbjct  525   GYYEDGSFGIRIENVVLVVSTKTKYNFNNRGSLTFEPLTLVPIQTKMIDVNLLTQKECDW  584

Query  2109  LNSYHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             LN+YH    E +   +  + R    EWL   T PI
Sbjct  585   LNNYHKTCREVIGKELQKQGRQEALEWLIKETNPI  619



>gb|EPQ12889.1| Xaa-Pro aminopeptidase 1, partial [Myotis brandtii]
Length=657

 Score =   544 bits (1402),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  44    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  103

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LMR G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  104   AAMWTDGRYFLQAAKQMDSNWTLMRMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  163

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  164   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  221

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  222   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  281

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  282   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTSLSPKEKVW  323

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  324   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  382

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  383   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  441

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  442   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  501

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  502   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  561

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  562   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  621

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  622   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  653



>ref|XP_005874613.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X2 [Myotis brandtii]
Length=659

 Score =   544 bits (1402),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 293/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  46    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  105

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LMR G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  106   AAMWTDGRYFLQAAKQMDSNWTLMRMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  165

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  166   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  223

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  224   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  283

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  284   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTSLSPKEKVW  325

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  326   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  384

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  385   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  443

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  444   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  503

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  504   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  563

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  564   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  623

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  624   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  655



>ref|XP_007592836.1| metallopeptidase family M24 [Colletotrichum fioriniae PJ7]
 gb|EXF83528.1| metallopeptidase family M24 [Colletotrichum fioriniae PJ7]
Length=617

 Score =   543 bits (1398),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 292/636 (46%), Positives = 393/636 (62%), Gaps = 28/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D Y+IPS+D+H SE+IA C  RR +ISGF+GSAG AVVT
Sbjct  4     IDTTSRLSRLRELMK--ERKVDVYVIPSEDSHASEYIAGCDARREFISGFSGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL  +W+L++ G   VPT  EW     + G  +G+D  L + 
Sbjct  62    LDKAALATDGRYFNQASKQLDQNWLLLKQGLQDVPTWQEWSAEQSTGGKVVGVDAKLITG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A++L E + + G  +L+ L + NLVD +W  +RP  PK P++V   ++ G DV SKL 
Sbjct  122   SVAKKLAEKVKRSGGSDLLPLDD-NLVDLVWAANRPARPKNPVKVLPERFNGKDVKSKLK  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    S A V+SMLDEIAWL NLRG D+ ++PV ++Y I+  D A L++DDSK+ 
Sbjct  181   DLRQELEKKNSPAFVVSMLDEIAWLFNLRGDDIPYNPVFFSYAIITPDSATLYVDDSKLG  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              E  DYL    V +R YE+I                   ++NA  +    T     + S 
Sbjct  241   KETRDYLAENDVAVRPYETIF-----------------DSINALRSEVKSTESATGTTSQ  283

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        SP+  +KAVKN  E+ GM+ CH+RD AAL  ++
Sbjct  284   RFMISNKASWAL-KRSLGGDGQVDEVRSPIGDSKAVKNKNEMAGMRACHIRDGAALIEYF  342

Query  1389  AWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE++ + K   L EVE  +KL + R+KQ  ++  SFDTIS +GAN A+IHYKPE  +C
Sbjct  343   AWLEDQLVAKKAKLDEVEAGDKLEQLRAKQKDYVGLSFDTISSTGANAAVIHYKPERGAC  402

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S ++ + ++L DSGAQY+DGTTD TRT+HFG+P+  EK  +T VL+G+IALD A+FP+ T
Sbjct  403   STIDPNAIYLCDSGAQYLDGTTDTTRTLHFGQPTEAEKLAYTLVLKGNIALDTAIFPKGT  462

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMVPGMVVS  1919
              GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R  F  +  + PG VVS
Sbjct  463   TGFALDCLARQHLWREGLDYRHGTGHGVGSYLNVHEGPIGIGTRVQFAEVA-LAPGNVVS  521

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
              EPG+YED S+GIRIEN+  V E+ T + FG   YLGFE +T VP    L++ S+L+  E
Sbjct  522   IEPGFYEDGSYGIRIENVAMVTEVKTKHSFGDKPYLGFEHVTMVPYCQNLIEPSLLTVEE  581

Query  2100  VAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
              AWLN ++ ++++K       D     WL   T+P 
Sbjct  582   KAWLNKHNAEIFQKTKDCFQNDPLTLAWLTRETQPF  617



>gb|KIJ15105.1| hypothetical protein PAXINDRAFT_169294 [Paxillus involutus ATCC 
200175]
Length=610

 Score =   542 bits (1397),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 289/632 (46%), Positives = 399/632 (63%), Gaps = 32/632 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  +RL +LR L    D N+  +++PS+D H SE+ +    RR +ISGF GSAG A++T
Sbjct  9     VDTSERLASLRALMREQDYNVGVFVVPSEDEHFSEYPSQADERRTFISGFNGSAGCAIIT  68

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
                A L+TDGRYFLQAE+QL  +W LM+ G   VPT  E+L+  +  G+RIG+DP L S+
Sbjct  69    LQNAFLFTDGRYFLQAEQQLDKNWNLMKQGLPDVPTWQEFLSKNIEQGTRIGVDPSLISA  128

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A+ LK   S G+ ELV L   N VD +W   RPQ PK  + V D++Y+G  +S+KL  
Sbjct  129   VDAQVLKR--SLGDSELVPLLK-NPVDVVWASDRPQRPKNKVFVLDVEYSGETLSTKLQR  185

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             +R  +    + A+ +++LDE+AWL NLRG+D+  +PV +AY +VE D A LF+D++++  
Sbjct  186   VREAMAKKNAVAMAVTLLDEVAWLFNLRGTDIDFNPVFFAYAVVEKDLAVLFVDEAQVDD  245

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
              V  +L    V ++ Y   L  + +LAEKG                          +   
Sbjct  246   VVKAHLGQ-EVLIKPYTEFLPYLGALAEKGL-----------------------VQKEQP  281

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
             +   +K  TNL    + G+ +     SPV+  KA+KNS E+ G + CH+RD AAL  ++A
Sbjct  282   VLLGDK--TNLAVVHVLGEENVAIVPSPVADMKAIKNSTEINGFRQCHIRDGAALVRYFA  339

Query  1392  WLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSI  1571
             WL++++   V L+E + A+KL EFRS+   F   SF TIS +G N  IIHY P+P  C+ 
Sbjct  340   WLDQQLKNGVVLSESQGADKLEEFRSEFDLFRGLSFPTISSAGPNAGIIHYSPDPKDCAT  399

Query  1572  VNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPG  1751
             + + +++L DSG QY+DGTTD+TRT HFG PS+ EK  FTRVLQGHIA+D A+FP  T G
Sbjct  400   ITKDQIYLCDSGGQYLDGTTDVTRTWHFGTPSAEEKRAFTRVLQGHIAIDTAIFPTGTTG  459

Query  1752  FVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEP  1928
             F++D++AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N TP+  GM VSNEP
Sbjct  460   FIIDSWARRALWQDGLDYRHGTGHGVGHFLNVHEGPQGIGTRIAYNSTPLKAGMTVSNEP  519

Query  1929  GYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAW  2108
             GYY D  +GIRIEN++ V E++TPN FG  GYLGFE++T  PIQ  L+D +IL+A E  W
Sbjct  520   GYYADGRWGIRIENVVIVCEVETPNNFGN-GYLGFERVTMCPIQTSLIDYAILTAEEKKW  578

Query  2109  LNSYHLQVWEKVSGLV-DGRAREWLWNNTRPI  2201
             LN YH +V  KV  L+ D  A  WL    + +
Sbjct  579   LNDYHAEVARKVGPLLQDECALAWLVKQCQAV  610



>ref|XP_003231471.1| aminopeptidase [Trichophyton rubrum CBS 118892]
Length=655

 Score =   544 bits (1401),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 291/637 (46%), Positives = 393/637 (62%), Gaps = 29/637 (5%)
 Frame = +3

Query  303   PRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTA  482
             P  +D   RL  LR+L ++    +D YI+PS+D+HQSE+IA C  RRA+IS FTGSAG A
Sbjct  44    PPPVDTTQRLAKLRELMAQN--KVDVYIVPSEDSHQSEYIAPCDGRRAFISSFTGSAGCA  101

Query  483   VVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFL  662
             +V+  KAAL TDGRYF QA KQL ++WIL++ G  GVPT  EW       G  +G+DP L
Sbjct  102   IVSMSKAALSTDGRYFSQAAKQLDANWILLKRGVEGVPTWEEWTAEQAENGKVVGVDPSL  161

Query  663   FSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSK  842
              ++  A +L + +      LV +   NL+D +W + RP  P   I V  ++ AG     K
Sbjct  162   ITAADARKLSQTLKTTGGSLVGIDQ-NLIDAVWGDERPARPANQITVQPVERAGKSFEEK  220

Query  843   LFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSK  1022
             +  LR +L     SA+VIS LDEIAWL NLRGSD+ ++PV ++Y IV    A+L++D+SK
Sbjct  221   VEDLRKELTAKKRSAMVISTLDEIAWLFNLRGSDIPYNPVFFSYAIVTPSVAELYVDESK  280

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             ++PE   +L+   V L+ Y                    +S   A+   A   A      
Sbjct  281   LSPEARKHLEG-KVVLKPY--------------------ESIFQASKVLAESKASASSGS  319

Query  1203  SPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             S      NK S +L    L G+ + +   SP++ AKA+KN  ELEG + CH+RD AAL  
Sbjct  320   SGKFLLSNKASWSLSL-ALGGEQNVVEVRSPITDAKAIKNEVELEGFRKCHIRDGAALIE  378

Query  1383  FWAWLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE  + K+   L EV+ A+KL E R K   F+  SFDTIS +GANGA IHYKPE  
Sbjct  379   YFAWLENALIKEGAKLDEVDGADKLFEIRKKYDLFVGNSFDTISSTGANGATIHYKPEKS  438

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +C+I++   ++L DSG QY+DGTTD TRT+HFGEP+  +K+ +  VL+GHI++D A+FP+
Sbjct  439   TCAIIDPKAMYLCDSGGQYLDGTTDTTRTLHFGEPTEFQKKAYALVLKGHISIDNAIFPK  498

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVV  1916
              T G+ +D+FAR  LWK GLDY HGTGHGVG+ LNVHEGP GI  R      P+    V+
Sbjct  499   GTTGYAIDSFARQHLWKEGLDYLHGTGHGVGSFLNVHEGPMGIGSRAQYAEVPLSASNVL  558

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYED +FGIR+ENL+  KE+ T ++FG   +LGFE +T VP   KL+D S+L+ A
Sbjct  559   SNEPGYYEDGNFGIRLENLVICKEVQTAHKFGDKPFLGFESITLVPFCQKLLDASLLTEA  618

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  W+N YH +VWEK S     D     WL   T+PI
Sbjct  619   ERKWVNDYHAKVWEKTSPFFEKDELTTAWLKRETQPI  655



>gb|KFY22564.1| hypothetical protein V491_02759 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=630

 Score =   543 bits (1398),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 292/638 (46%), Positives = 390/638 (61%), Gaps = 19/638 (3%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LRQL      N+D YI+PS+D+H SE+IA C  RR +I GF+GSAG AVVT
Sbjct  4     IDTSQRLSKLRQLMKEK--NVDVYIVPSEDSHASEYIASCDGRREFICGFSGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             +DKAAL TDGRYF QA+KQL  SW L++ G   VPT  EW          +G+DP + S+
Sbjct  62    QDKAALATDGRYFNQAQKQLDDSWTLLKQGLVDVPTWQEWTAEQAEGRKTVGVDPTVISA  121

Query  672   DAAEELKEDI-SKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L + I + G  +L+ +   NLVD++W   RP  P + ++    +++G  V++KL 
Sbjct  122   PDARKLADKIKAAGGADLIAVEE-NLVDKVWGVDRPAKPTQAVKPLGEEFSGKSVTAKLE  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    SS +V+SMLDEIAWL NLRG+D+ ++PV ++Y IV      L+ID SK++
Sbjct  181   DLRKELDKKKSSGLVVSMLDEIAWLFNLRGNDIPYNPVFFSYAIVTPTSTTLYIDSSKLS  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              E  D+L    + +R+Y +I        E  A L       N    ++   +    S+  
Sbjct  241   KEAQDHLAQNSISIRSYNAIF-------EDAAVLGRSIQASNKKEASSGDDSSKPTSQET  293

Query  1209  GIKK---RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALA  1379
              +KK    NK S  L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD AAL 
Sbjct  294   KVKKFMVSNKASWAL-KRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIRDGAALT  352

Query  1380  HFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEP  1556
              F+AWLE E+  K   + EV+  +KL E RSK   F+  SFDTIS +GAN A+IHYKP+P
Sbjct  353   EFFAWLENELLEKKATVDEVQALDKLEEIRSKHKHFVGLSFDTISSTGANAAVIHYKPQP  412

Query  1557  DSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFP  1736
              +C++++   ++L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD AVFP
Sbjct  413   GNCAVIDPKAVYLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAVFP  472

Query  1737  ENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMV  1913
             + T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V
Sbjct  473   KGTSGFSLDTLARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNV  532

Query  1914  VSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSA  2093
             +SNEPGYYED SFGIRIEN++ V E  T + FG   YL FE +T VP    L+D S+L+ 
Sbjct  533   ISNEPGYYEDGSFGIRIENIIMVTEAKTKHTFGEKPYLCFEHVTMVPYCRNLIDESLLTR  592

Query  2094  AEVAWLNSYHLQVWEKVSGLVD--GRAREWLWNNTRPI  2201
              E  WLN YH  ++ K     +    + +WL    +P 
Sbjct  593   KEKRWLNEYHADIFAKTKDYFEPGSVSMKWLEREVQPF  630



>ref|XP_005785544.1| hypothetical protein EMIHUDRAFT_63427 [Emiliania huxleyi CCMP1516]
 gb|EOD33115.1| hypothetical protein EMIHUDRAFT_63427 [Emiliania huxleyi CCMP1516]
Length=676

 Score =   544 bits (1401),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 307/637 (48%), Positives = 390/637 (61%), Gaps = 45/637 (7%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +LR+ R+  +  D  + A+++PS DAH SE+    Y RRA++SGFTGSAGTAVVT D A 
Sbjct  50    KLRSFRKAMA--DAGVAAFVVPSGDAHLSEYTHPAYDRRAFLSGFTGSAGTAVVTADAAL  107

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             LWTDGRYFLQAE++LS  W LMR+G  GVP+   WL S L   S +GID  + S D A  
Sbjct  108   LWTDGRYFLQAEQELSPEWTLMRAGQPGVPSLESWLASNLPDASAVGIDASVHSVDEANT  167

Query  687   LKE--DISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             L+   D ++    L  LS  NLVD IW   RP PP    R+  L  AGA    KL +   
Sbjct  168   LRSALDAAQSGLRLEPLSPPNLVDSIWT-GRPPPPLGKARLLPLSVAGASAEEKLAAAGE  226

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEID---GAKLFIDDSKITP  1031
             DL  A + A+V+  LDE+ WLLN+RG+DV H PV+ A+ +V       A LF++ SK+  
Sbjct  227   DLDKAKADALVLGSLDEVCWLLNVRGADVPHCPVLQAFALVHATHPTSATLFVERSKLDD  286

Query  1032  EVMDYLKSVGVELRAYesilseieslA-EKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
             EV   L + GV +  YE     +  LA E+G  L +D  +VN             Y    
Sbjct  287   EVSGALAAAGVAIAPYEEAEPAVRRLADEEGKTLLIDPKSVN-------------YGLRL  333

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                 R   +T                 SP+ + KA KN+AEL GM   HL DAAALAHF+
Sbjct  334   AAGGRAALAT-----------------SPLILRKARKNAAELAGMLEAHLTDAAALAHFF  376

Query  1389  AWLEEEICKDVG-LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE  +  +   LTEVE+A KL  FR+ Q GF+D SF TI+G+G+NGAIIHY       
Sbjct  377   AWLERVVVAEATPLTEVEIATKLASFRAAQPGFIDLSFPTIAGAGSNGAIIHYDCMVADA  436

Query  1566  SIVNR---HELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFP  1736
             + VN     ++ LLDSG QY  GTTD+TRT H G P+  ++ECFTRVL+G+I LD   FP
Sbjct  437   ARVNTLDGSQMMLLDSGGQYATGTTDVTRTFHLGTPTDWQRECFTRVLKGNIGLDTLTFP  496

Query  1737  ENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVV  1916
             E TPG  +DAFAR +LW+ GLDY HGTGHGVGAALNVHEGP  IS R+GN   +  GM+ 
Sbjct  497   EGTPGMAIDAFARQALWQAGLDYLHGTGHGVGAALNVHEGPHSISARWGNTCGLEEGMIC  556

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYE  +FGIRIENLL  +   TPN F G  YL F++LT VPIQA L++ S+L++A
Sbjct  557   SNEPGYYEAGAFGIRIENLLVARAAPTPNAFNGKAYLRFDQLTHVPIQASLLEPSLLTSA  616

Query  2097  EVAWLNSYHLQVWEKVSGLVDGRAR--EWLWNNTRPI  2201
             EV WL++YH +VWE+VS  VD  +    WL   TRP+
Sbjct  617   EVEWLDAYHARVWERVSPRVDADSEGARWLRRVTRPL  653



>ref|XP_004579920.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Ochotona princeps]
Length=666

 Score =   543 bits (1400),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 294/633 (46%), Positives = 394/633 (62%), Gaps = 32/633 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA+VT++ 
Sbjct  53    LRQLRQAMRNAEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFMSGFDGSAGTAIVTEEH  112

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  113   AAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDCW  172

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  173   KKMAKVLRSAGHHLVPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKEKVADLRL  230

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDE+AWL NLRGSDV H+PV ++Y I+ +D   LFID  +I  P V
Sbjct  231   KMAERNIVWFVVTALDEVAWLFNLRGSDVEHNPVFFSYAIIGLDTIMLFIDGDRIDAPSV  290

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
               +L   +G+E              AE    +   K     A+ +  KT C   S    +
Sbjct  291   KQHLLLDLGLE--------------AEYRIQVLPYK-----AVLSELKTLCAGLSPREKV  331

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  L +  +          +P+ +AKAVKNSAE EGM+  H++DA AL   + W
Sbjct  332   WVSDKASYAL-SEAIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNW  390

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  391   LEKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  449

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  AVFP  T G 
Sbjct  450   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGH  509

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GMVV++EPGY
Sbjct  510   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMVVTDEPGY  569

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN
Sbjct  570   YEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQIKMIDVDSLTDKECEWLN  629

Query  2115  SYHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             +YHL   + +   +  + R    EWL   T+P+
Sbjct  630   NYHLTCRDVIGKELQKQGRQEALEWLIRETQPV  662



>ref|XP_002621127.1| xaa-pro aminopeptidase [Blastomyces dermatitidis SLH14081]
 sp|C5K105.1|AMPP1_AJEDS RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ74285.1| xaa-pro aminopeptidase [Blastomyces dermatitidis SLH14081]
Length=617

 Score =   541 bits (1395),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 291/636 (46%), Positives = 395/636 (62%), Gaps = 28/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D YI+PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  4     VDTSQRLARLRELMQ--ERKVDVYIVPSEDSHQSEYIAPCDGRREFISGFTGSAGCAIVS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL ++W+L++ G   +PT  EW       G  +G+DP L ++
Sbjct  62    MSKAALSTDGRYFNQAAKQLDNNWMLLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L  +   NL+D +W + RP  P + + +H +++AG     K+  
Sbjct  122   SEARSLSETIEKSGGSLQGVQE-NLIDLVWGKKRPARPSEKVALHPIEFAGKSFEEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S+  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+IDD K+  
Sbjct  181   LRKELQKKKSAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITPTTADLYIDDEKLPA  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  YL    V ++ Y               +++ D   ++ +   A K +    S SP 
Sbjct  241   EVKKYLGDQ-VSVKPY--------------GSIFEDAKALSQS---AQKKSDGDASTSPS  282

Query  1212  IK--KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
              K     K S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL  +
Sbjct  283   EKFLISTKASWSLSL-ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALTEY  341

Query  1386  WAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDS  1562
             +AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E D+
Sbjct  342   FAWLENELVNKKTVLNEVDGSDKLEQIRSKHKHFVGLSFDTISSTGPNAAVIHYKAERDT  401

Query  1563  CSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPEN  1742
             CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G I++D AVFP+ 
Sbjct  402   CSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMERKAYTLVLKGLISIDTAVFPKG  461

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVS  1919
             T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R       + PG V+S
Sbjct  462   TTGFALDAFARQHLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYAEVAITPGNVIS  521

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             +EPG+YED  FGIRIEN++  KE+ T + FG   +LGFE +T  P+  KL++ S+L+  E
Sbjct  522   DEPGFYEDGVFGIRIENIIIAKEVKTTHGFGEKPWLGFEHVTMTPLCQKLINPSLLTDGE  581

Query  2100  VAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
               W+N YH +VWEK S     D   R WL   T+PI
Sbjct  582   KKWVNDYHSKVWEKTSSYFENDELTRNWLKRETQPI  617



>gb|KEF61408.1| xaa-Pro aminopeptidase [Exophiala aquamarina CBS 119918]
Length=618

 Score =   541 bits (1395),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 296/634 (47%), Positives = 405/634 (64%), Gaps = 23/634 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L  +  ++I  YI+PS+D+HQSE+IA C  RR +I GF+GSAGTAV+T
Sbjct  4     VDTTKRLAHLRELMQKHKVDI--YIVPSEDSHQSEYIAPCDARREHICGFSGSAGTAVIT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL ++W+L++ G   VPT  EW       G  +G+DP L +S
Sbjct  62    LDKAALATDGRYFNQASKQLDANWLLLKQGLEDVPTWQEWTTEQAEGGKTVGVDPTLITS  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L   + K +H  +   + NL+D IW + RP  P +P+ V   KYAG     KL  
Sbjct  122   IDARKLSATLKKQSHATLVGVSENLIDRIWTD-RPNRPAEPVIVLSDKYAGKSFQEKLED  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR DL    S+ +V+SMLDE+AWL NLRGSD+ ++PV ++Y  V  + A L++D +KI  
Sbjct  181   LRKDLKKKKSAGMVVSMLDEVAWLFNLRGSDIPYNPVFFSYAAVTPNSATLYVDAAKIGQ  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             E+ D+L    VE++ Y+++ S++ ++AE         + VN A  N+        S+   
Sbjct  241   EIRDFLGEF-VEIKPYDALFSDLTAIAE---------TAVNEADANSTTK-----SKPQK  285

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
             +   NK S  L   GL G+       SP++ AKA+KN+ ELEGM+ CH+RD AAL  ++A
Sbjct  286   LLLSNKSSWALSL-GLGGEDKVEEVRSPITDAKAIKNATELEGMRQCHIRDGAALIEYFA  344

Query  1392  WLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE+E+  K   L EV+ A+KL E RS+   F   SF TIS +G N A+IHY PE  +CS
Sbjct  345   WLEDELVNKGKTLDEVQAADKLEEIRSRGDHFKGLSFPTISSTGPNAAVIHYSPERGNCS  404

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             IV+   ++L DSGAQY+DGTTD TRT+HF +P++ E + +T VL+G I+LD+AVFP+ T 
Sbjct  405   IVDPKAIYLCDSGAQYLDGTTDTTRTLHFTKPTAMEIKAYTLVLKGVISLDRAVFPKGTT  464

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+E
Sbjct  465   GFAIDAFARQHLWREGLDYRHGTGHGVGSFLNVHEGPVGIGTRAAYSEVALSIGNVISDE  524

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED +FGIRIEN++  +E  T ++FG   ++ FE +T VP+  KL D  +L   E+ 
Sbjct  525   PGYYEDGNFGIRIENMIMAREATTNHKFGDKPWISFEHVTLVPMCRKLTDPKLLDPEEID  584

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             WLN YH +VWEK SG    D R  +WL   T PI
Sbjct  585   WLNDYHKEVWEKTSGFFKDDERTTKWLTRETAPI  618



>ref|XP_008142509.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Eptesicus fuscus]
Length=629

 Score =   542 bits (1396),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 290/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  16    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  75

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  76    AAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPADYW  135

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L YAG     K+  LR 
Sbjct  136   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYAGISWKDKVADLRL  193

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  194   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLEAIKLFIDGDRIDAPSV  253

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  254   KEHL-------------LLDLSLEAEYKIQVLPYKS-----ILNELKALCTSLSPKEKVW  295

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNS E +GM+  H++DA AL   + WL
Sbjct  296   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSTESDGMRRAHIKDAVALCELFNWL  354

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  355   EKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  413

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  414   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  473

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  474   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  533

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN+
Sbjct  534   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNN  593

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+PI
Sbjct  594   YHQTCRDVIGKELQKQGRQEALEWLIRETQPI  625



>ref|XP_006778761.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X2 [Myotis davidii]
Length=653

 Score =   543 bits (1398),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 291/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  40    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  99

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  100   AAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  159

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  160   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  217

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  218   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  277

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  278   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTSLSLKEKVW  319

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  320   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  378

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  379   EKEVPKG-GVTEIAAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  437

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  438   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  497

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  498   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  557

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  558   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  617

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+P+
Sbjct  618   YHQTCRDVIGKELQKQGRQEALEWLIRETQPV  649



>ref|XP_008717481.1| hypothetical protein HMPREF1541_04917 [Cyphellophora europaea 
CBS 101466]
 gb|ETN40638.1| hypothetical protein HMPREF1541_04917 [Cyphellophora europaea 
CBS 101466]
Length=620

 Score =   541 bits (1395),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 294/640 (46%), Positives = 397/640 (62%), Gaps = 33/640 (5%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR L  +    +D YI+PS+D+HQSE+IA C  RRA+I GF+GSAGTAV+T
Sbjct  4     VDTSKRLAHLRALMKKH--AVDVYIVPSEDSHQSEYIAPCDARRAFICGFSGSAGTAVIT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             +DKAAL TDGRYF QA KQL ++W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  62    QDKAALATDGRYFNQASKQLDANWQLLKQGLEDVPTWQEWTTEQAEGGKTVGVDPTVITA  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A +L E + K  N  LV +   NLVD IW E RP  P + + V   KYAG     KL 
Sbjct  122   IEARKLSETLKKKANASLVGVKE-NLVDHIWTE-RPARPTEKVIVLSEKYAGKSFKDKLA  179

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR ++    ++ +V+SMLDEIAWL NLRG+D+ ++PV ++Y  V    A L++D +K++
Sbjct  180   ELRKEIGKKKAAGMVVSMLDEIAWLFNLRGNDIPYNPVFFSYAAVTPKTATLYVDSTKMS  239

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              E +DYL    V ++ Y+++                  S +NA   NA   A +      
Sbjct  240   SEALDYLGD-AVAIKPYDALF-----------------SDLNAISENAVAEAQENGETEI  281

Query  1209  GIKKR-----NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAA  1373
              +K +     NK S  L   GL G+       SP+S AKA+KN  ELEGM+ CH+RD AA
Sbjct  282   KVKPKKLLLSNKSSWALSL-GLGGEEKVEESRSPISDAKAIKNETELEGMRQCHIRDGAA  340

Query  1374  LAHFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKP  1550
             L  ++AWLE+ +  +   + EV+ AEKL + RSK   F+  SFDTIS +G N A+IHYKP
Sbjct  341   LIEYFAWLEDSLVNRQAQIDEVQGAEKLEQIRSKGEHFVGLSFDTISSTGPNAAVIHYKP  400

Query  1551  EPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAV  1730
             EP +CS+++   ++L DSGAQY DGTTD TRT+HFG P+  E + +T VL+G IALD+AV
Sbjct  401   EPGNCSVIDPKAVYLCDSGAQYFDGTTDTTRTLHFGTPTQMEIKSYTLVLKGVIALDRAV  460

Query  1731  FPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPG  1907
             FP+ T GF +DAFAR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G
Sbjct  461   FPKGTTGFAIDAFARQHLWREGLDYRHGTGHGVGSFLNVHEGPIGIGTRSAYSEVSLSIG  520

Query  1908  MVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSIL  2087
              V+S+EPGYYED +FGIRIEN++  +E  T ++FG   ++GFE +T VP+  KL+D  +L
Sbjct  521   NVISDEPGYYEDGNFGIRIENMIMAQEAKTNHKFGDKPWIGFEHVTMVPMCRKLIDPLLL  580

Query  2088  SAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
                E  WLN+YH +VW+K S     D R   WL   T  I
Sbjct  581   DPEERDWLNNYHKEVWDKTSPFFQNDDRTTTWLQRETAII  620



>gb|KHJ36228.1| putative metallopeptidase family m24 [Erysiphe necator]
Length=661

 Score =   543 bits (1398),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 289/637 (45%), Positives = 395/637 (62%), Gaps = 28/637 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  DRL  LR+   +   N+D YIIPS+D+H SE+IA C  RR++I+GFTGSAG AVVT
Sbjct  46    VDTSDRLARLREHMRKS--NVDIYIIPSEDSHSSEYIAACDARRSFITGFTGSAGCAVVT  103

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QA KQL S+W+L++ G   VPT  EW       G   G+DP + ++
Sbjct  104   LEKAALATDGRYFNQATKQLDSNWLLLKQGIQDVPTWQEWTALQSKDGKVAGVDPKVITA  163

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
                ++L   I K   + +   + NLVD +W   RPQ P  P++V    Y+G D  +KL  
Sbjct  164   PDVKKLTNSIKKKGGKGLIAIDSNLVDLVWGSERPQRPAFPVKVLGQLYSGKDTQTKLKE  223

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR++L    S  I++SMLDEIAWL NLRGSD+ ++PV ++Y  +    A L++D  K+  
Sbjct  224   LRAELHKKKSDGIIVSMLDEIAWLFNLRGSDIPYNPVFFSYACITPSTATLYVDSHKLDS  283

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             E  +YLK   + +R YE I                D+  + A ++   K   +R     G
Sbjct  284   ECSNYLKENKILVRPYEEI---------------FDEGKLLAELS---KHKDERSQSEIG  325

Query  1212  IKK---RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
              K+     K S  L+   L G+       SP+  AKA+KN+ EL GM+ CH+RD A L  
Sbjct  326   TKRFLVSTKTSWALE-RALKGEADLEEIRSPIGDAKAMKNATELAGMRACHIRDGATLTE  384

Query  1383  FWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             F++WLE + + ++  + EV  A+KL E RSKQ  ++  SF+TIS SG N A+IHY P+  
Sbjct  385   FFSWLEYKLLVENAIIDEVMAADKLEELRSKQENYVGLSFETISSSGPNAAVIHYAPKRG  444

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +CSI++   ++L DSGAQY+DGTTD TRT+HF +P+  EK+ +T VL+G+IALD A+FP+
Sbjct  445   NCSIIDPKLIYLCDSGAQYLDGTTDTTRTLHFTQPTEMEKKAYTLVLKGNIALDMAIFPQ  504

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVV  1916
              T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P+ PG V+
Sbjct  505   KTTGFSLDTLARQFLWEEGLDYRHGTGHGVGSYLNVHEGPIGIGTRIQYSEVPLAPGNVI  564

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYED  FGIRIEN++ V+E+ T NRFG   +LGFE +T VP   KL+D  +L+  
Sbjct  565   SNEPGYYEDGVFGIRIENVIIVREVQTKNRFGDKPFLGFEHVTMVPYCRKLIDERLLTPK  624

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  WLN YH ++W    G    +  A++WL   TRP+
Sbjct  625   EREWLNKYHKEIWTATEGFFAEESIAKKWLERETRPL  661



>ref|XP_006778760.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Myotis davidii]
Length=655

 Score =   543 bits (1398),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 291/632 (46%), Positives = 394/632 (62%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T+D 
Sbjct  42    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEDH  101

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  102   AAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  161

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  162   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKDKVADLRL  219

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++  KLFID  +I  P V
Sbjct  220   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIKLFIDGDRIDAPSV  279

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L ++   AE    +   KS     I N  K  C   S    + 
Sbjct  280   KEHL-------------LLDLSLEAEYRIQVLPYKS-----ILNELKALCTSLSLKEKVW  321

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  + +  +  +       +P+ +AKAVKNSAE EGM+  H++DA AL   + WL
Sbjct  322   VSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWL  380

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  381   EKEVPKG-GVTEIAAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLS  439

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
               E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  440   LDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGHL  499

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  500   LDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  559

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLNS
Sbjct  560   EDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNS  619

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    + +   +  + R    EWL   T+P+
Sbjct  620   YHQTCRDVIGKELQKQGRQEALEWLIRETQPV  651



>sp|C5GXZ9.1|AMPP1_AJEDR RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Blastomyces dermatitidis 
ER-3]
 gb|EEQ85970.1| xaa-pro aminopeptidase [Blastomyces dermatitidis ER-3]
 gb|EGE82855.1| xaa-Pro aminopeptidase [Blastomyces dermatitidis ATCC 18188]
Length=617

 Score =   541 bits (1394),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 291/636 (46%), Positives = 395/636 (62%), Gaps = 28/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D YI+PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  4     VDTSQRLARLRELMQ--ERKVDVYIVPSEDSHQSEYIAPCDGRREFISGFTGSAGCAIVS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL ++W+L++ G   +PT  EW       G  +G+DP L ++
Sbjct  62    MSKAALSTDGRYFNQAAKQLDNNWMLLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L  +   NL+D +W + RP  P + + +H +++AG     K+  
Sbjct  122   SEARSLSETIEKSGGSLQGVQE-NLIDLVWGKERPARPSEKVALHPIEFAGKSFEEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S+  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+IDD K+  
Sbjct  181   LRKELQKKKSAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITPTTADLYIDDEKLPA  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  YL    V ++ Y               +++ D   ++ +   A K +    S SP 
Sbjct  241   EVKKYLGDQ-VSVKPY--------------GSIFEDAKALSQS---AQKKSDGDASTSPS  282

Query  1212  IK--KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
              K     K S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL  +
Sbjct  283   EKFLISTKASWSLSL-ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALTEY  341

Query  1386  WAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDS  1562
             +AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E D+
Sbjct  342   FAWLENELVNKKTVLNEVDGSDKLEQIRSKHKHFVGLSFDTISSTGPNAAVIHYKAERDT  401

Query  1563  CSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPEN  1742
             CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G I++D AVFP+ 
Sbjct  402   CSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMERKAYTLVLKGLISIDTAVFPKG  461

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVS  1919
             T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R       + PG V+S
Sbjct  462   TTGFALDAFARQHLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYAEVAITPGNVIS  521

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             +EPG+YED  FGIRIEN++  KE+ T + FG   +LGFE +T  P+  KL++ S+L+  E
Sbjct  522   DEPGFYEDGVFGIRIENIIIAKEVKTTHGFGEKPWLGFEHVTMTPLCQKLINPSLLTDGE  581

Query  2100  VAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
               W+N YH +VWEK S     D   R WL   T+PI
Sbjct  582   KKWVNDYHSKVWEKTSSYFENDELTRNWLKRETQPI  617



>gb|EQL32794.1| xaa-Pro aminopeptidase [Blastomyces dermatitidis ATCC 26199]
Length=663

 Score =   542 bits (1396),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 291/636 (46%), Positives = 395/636 (62%), Gaps = 28/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D YI+PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  50    VDTSQRLARLRELMQ--ERKVDVYIVPSKDSHQSEYIAPCDGRREFISGFTGSAGCAIVS  107

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL ++W+L++ G   +PT  EW       G  +G+DP L ++
Sbjct  108   MSKAALSTDGRYFNQAAKQLDNNWMLLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  167

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L  +   NL+D +W + RP  P + + +H +++AG     K+  
Sbjct  168   SEARSLSETIEKSGGSLQGVQE-NLIDLVWGKERPARPSEKVALHPIEFAGKSFEEKISD  226

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S+  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+IDD K+  
Sbjct  227   LRKELQKKKSAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITPTTADLYIDDEKLPA  286

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  YL    V ++ Y               +++ D   ++ +   A K +    S SP 
Sbjct  287   EVKKYLGD-QVSVKPY--------------GSIFEDAKALSQS---AQKKSDGDASTSPS  328

Query  1212  IK--KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
              K     K S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL  +
Sbjct  329   EKFLISTKASWSLSL-ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALTEY  387

Query  1386  WAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDS  1562
             +AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E D+
Sbjct  388   FAWLENELVNKKTVLNEVDGSDKLEQIRSKHKHFVGLSFDTISSTGPNAAVIHYKAERDT  447

Query  1563  CSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPEN  1742
             CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G I++D AVFP+ 
Sbjct  448   CSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMERKAYTLVLKGLISIDTAVFPKG  507

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVS  1919
             T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R       + PG V+S
Sbjct  508   TTGFALDAFARQHLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYAEVAITPGNVIS  567

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             +EPG+YED  FGIRIEN++  KE+ T + FG   +LGFE +T  P+  KL++ S+L+  E
Sbjct  568   DEPGFYEDGVFGIRIENIIIAKEVKTTHGFGEKPWLGFEHVTMTPLCQKLINPSLLTDGE  627

Query  2100  VAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
               W+N YH +VWEK S     D   R WL   T+PI
Sbjct  628   KKWVNDYHSKVWEKTSSYFENDELTRNWLKRETQPI  663



>gb|ABU48597.1| aminopeptidase P [Trichophyton tonsurans]
 gb|ABU48598.1| aminopeptidase P [Trichophyton equinum]
Length=614

 Score =   540 bits (1391),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 289/637 (45%), Positives = 390/637 (61%), Gaps = 29/637 (5%)
 Frame = +3

Query  303   PRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTA  482
             P  +D   RL  LR+L ++    +D YI+PS+D+HQSE+IA C  RRA+IS FTGSAG A
Sbjct  3     PPPVDTTQRLAKLRELMAQN--KVDVYIVPSEDSHQSEYIAPCDGRRAFISSFTGSAGCA  60

Query  483   VVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFL  662
             +V+  KAAL TDGRYF QA KQL ++W L++ G  GVPT  EW       G  +G+DP L
Sbjct  61    IVSMSKAALSTDGRYFSQAAKQLDANWTLLKRGVEGVPTWEEWTAEQAENGKVVGVDPSL  120

Query  663   FSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSK  842
              ++  A +L + +      LV +   NL+D +W + RP  P   I V  ++ AG     K
Sbjct  121   ITAADARKLSQTLKSTGGSLVGIDQ-NLIDAVWGDERPARPANQITVQPVERAGKSFEEK  179

Query  843   LFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSK  1022
             +  LR +L     SA+VIS LDEIAWL NLRGSD+ ++PV ++Y IV    A+L++D+SK
Sbjct  180   VEDLRKELAAKKRSAMVISTLDEIAWLFNLRGSDIPYNPVFFSYAIVTPSVAELYVDESK  239

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             ++PE   +L+   V L+ Y                     S   A+   A   A      
Sbjct  240   LSPEARKHLEG-KVVLKPY--------------------DSIFQASKVLAESKASASSGS  278

Query  1203  SPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             S      NK S +L    L G+ + +   SP++ AKA+KN  ELEG + CH+RD AAL  
Sbjct  279   SGKFLLSNKASWSLSL-ALGGEQNVVEVRSPITDAKAIKNEVELEGFRKCHIRDGAALIE  337

Query  1383  FWAWLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE  + K+   L EV+ A KL E R K   F+  SFDTIS +GANGA IHYKPE  
Sbjct  338   YFAWLENALIKEGAKLDEVDGANKLFEIRKKYDLFVGNSFDTISSTGANGATIHYKPEKS  397

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +C++++   ++L DSG QY+DGTTD TRT+HFGEP+  +K+ +  VL+GHI++D A+FP+
Sbjct  398   TCAVIDPKAMYLCDSGGQYLDGTTDTTRTLHFGEPTEFQKKAYALVLKGHISIDNAIFPK  457

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVV  1916
              T G+ +D+FAR  LWK GLDY HGTGHGVG+ LNVHEGP GI  R      P+    V+
Sbjct  458   GTTGYAIDSFARQHLWKEGLDYLHGTGHGVGSFLNVHEGPMGIGSRAQYAEVPLSASNVL  517

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYED +FGIR+ENL+  KE+ T ++FG   +LGFE +T VP   KL+D S+L+ A
Sbjct  518   SNEPGYYEDGNFGIRLENLVICKEVQTAHKFGDKPFLGFESITLVPFCQKLLDASLLTEA  577

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  W+N YH +VWEK S     D     WL   T+PI
Sbjct  578   ERKWVNDYHARVWEKTSPFFEKDELTTAWLKRETQPI  614



>gb|KFY25496.1| hypothetical protein V493_04635 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=614

 Score =   540 bits (1390),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 291/627 (46%), Positives = 388/627 (62%), Gaps = 33/627 (5%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
             N+D YIIPS+D+H SE+IA C  RR +I GF+GSAG AVVT+DKAAL TDGRYF QA+KQ
Sbjct  5     NVDVYIIPSEDSHASEYIASCDGRREFICGFSGSAGCAVVTQDKAALATDGRYFNQAQKQ  64

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDI-SKGNHELV  725
             L  SW L++ G   VPT  EW          +G+DP + S+  A +L + I + G  +L+
Sbjct  65    LDDSWTLLKQGLLDVPTWQEWTAEQAEGSKTVGVDPTVISAPDARKLADKIKAAGGADLI  124

Query  726   FLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISML  905
              + + NL+D++W   RP  P + +     +++G  V +KL  LR +L    SS +V+SML
Sbjct  125   AVED-NLIDKVWGADRPAKPTQAVNPLGEEFSGKSVIAKLEDLRKELDKKKSSGLVVSML  183

Query  906   DEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYes  1085
             DEIAWL NLRG+D+ ++PV ++Y I+    A L++D SK++ E  D+L    + +R+Y +
Sbjct  184   DEIAWLFNLRGNDIPYNPVFFSYAIITPTSATLYVDSSKLSKEAQDHLARNCISIRSYNA  243

Query  1086  ilseieslAEKGANLWLDKSTVNAAI---TNAYKTACDRYSRSPGIKK--------RNKK  1232
                           ++ D + +  +I   T    ++ D  S+ P I++         NK 
Sbjct  244   --------------IFEDAAVLGRSIQASTTKEASSGDGPSK-PAIQETKVKKFMVSNKA  288

Query  1233  STNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-I  1409
             S  L    L G  +     SP+  AKAVKN  ELEGM+ CH+RD AAL  F+AWLE E I
Sbjct  289   SWAL-KRALGGDANVDEVRSPIGDAKAVKNETELEGMRACHIRDGAALTEFFAWLENELI  347

Query  1410  CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHEL  1589
              K   + EVE  EKL + RSK   F+  SFDTIS +GAN AIIHYKPEP +CSI++ + +
Sbjct  348   EKKAIVNEVEALEKLEKMRSKHKHFVGLSFDTISSTGANAAIIHYKPEPGNCSIIDPNAV  407

Query  1590  FLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAF  1769
             +L DSGAQY DGTTD TRT+HFG P+  EK+ +T VL+G+IALD A+FP+ T GF LD  
Sbjct  408   YLCDSGAQYFDGTTDTTRTLHFGTPTEMEKKAYTLVLKGNIALDTAIFPKGTSGFSLDTL  467

Query  1770  ARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDH  1946
             AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R      P+  G V+SNEPGYYED 
Sbjct  468   ARQFLWEEGLDYRHGTGHGVGSFLNVHEGPIGIGTRIQYTEVPLAIGNVISNEPGYYEDG  527

Query  1947  SFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHL  2126
             SFGIRIEN++ V E  T + FG   YLGFE +T VP   KL+D S+L+  E  WLN YH 
Sbjct  528   SFGIRIENIIMVTEAKTKHTFGEKPYLGFEHVTMVPYCRKLIDESLLTDKEKRWLNEYHA  587

Query  2127  QVWEKVSGLVD--GRAREWLWNNTRPI  2201
              ++ K  G  +       WL    +P 
Sbjct  588   DIFAKTKGYFEPGSVTMRWLEREVQPF  614



>ref|XP_004265912.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform 1 [Orcinus orca]
Length=666

 Score =   541 bits (1394),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 298/659 (45%), Positives = 406/659 (62%), Gaps = 42/659 (6%)
 Frame = +3

Query  249   VRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL--FSRPDINIDAYIIPSQDAHQSEFI  422
             V   S +A K +SE  ++ R        +A+R L   + P   I AYIIPS DAHQSE+I
Sbjct  38    VEADSRMAPKVTSELLRQLR--------QAMRNLEYVTEP---IQAYIIPSGDAHQSEYI  86

Query  423   ADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTP  602
             A C  RRA++SGF GSAGTA+VT++ AA+WTDGRYFLQA KQ+ S+W LM+ G    PT 
Sbjct  87    APCDCRRAFVSGFDGSAGTAIVTEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQ  146

Query  603   SEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQP  782
              +WL SVL  GSR+G+DP +  +D  +++ + +    H L+ +   NLVD+IW + RP+ 
Sbjct  147   EDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPER  204

Query  783   PKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPV  962
             P KP+    L Y G     K+  LR  +        V++ LDEIAWL NLRGSDV H+PV
Sbjct  205   PCKPLITLGLDYTGISWKDKVVDLRLKMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPV  264

Query  963   MYAYLIVEIDGAKLFID-DSKITPEVMDYLK-SVGVELRAYesilseieslAEKGANLWL  1136
              ++Y I+ ++   LFID D    P V ++L   +G+E              AE    +  
Sbjct  265   FFSYAIIGLETIMLFIDGDRTDAPSVKEHLLLDLGLE--------------AEYRIQVLP  310

Query  1137  DKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAV  1316
              KS     I +  KT C   S    +   +K S  + +  +          +P+ +AKAV
Sbjct  311   YKS-----ILSELKTLCASLSPREKVWVSDKASYAV-SEAIPKDHRCCMPYTPICIAKAV  364

Query  1317  KNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTS  1496
             KNSAE EGM+  H++DA AL   + WLE+E+ K  G+TE+  A+K  EFR +Q  F+D S
Sbjct  365   KNSAESEGMRRAHIKDAVALCELFNWLEKEVPKG-GVTEISAADKAEEFRRQQADFVDLS  423

Query  1497  FDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSRE  1676
             F TIS +G NGAIIHY P P++   ++  E++L+DSGAQY DGTTD+TRT+HFG P++ E
Sbjct  424   FPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYE  483

Query  1677  KECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEG  1856
             KECFT VL+GHIA+  AVFP  T G +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEG
Sbjct  484   KECFTCVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEG  543

Query  1857  PQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFE  2036
             P GIS++  +  P+  GM+V++EPGYYED +FGIRIEN++ V  + T   F   G L F+
Sbjct  544   PCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFD  603

Query  2037  KLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
              LT VPIQ K++D+  L+  E  WLN+YHL   + +   +  + R    EWL   T+PI
Sbjct  604   PLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI  662



>ref|XP_007781198.1| X-Pro aminopeptidase [Coniosporium apollinis CBS 100218]
 gb|EON65881.1| X-Pro aminopeptidase [Coniosporium apollinis CBS 100218]
Length=630

 Score =   540 bits (1391),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 298/641 (46%), Positives = 406/641 (63%), Gaps = 32/641 (5%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             +RL  LR L  +  ++I  YI+PS+D+HQSE+IA C  RR +I GF+GSAGTAVVT DKA
Sbjct  8     ERLAHLRDLMQKHKVDI--YIVPSEDSHQSEYIAPCDARREFICGFSGSAGTAVVTHDKA  65

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
             AL TDGRYF QAEKQL S+W L++ G   VPT  EW       G  +G+DP + ++  A 
Sbjct  66    ALATDGRYFNQAEKQLDSNWELLKQGLQDVPTWQEWAADQSEGGKSVGVDPTVITAPDAR  125

Query  684   ELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +L E I K G  ELV +   NLVD +W +++P  P + ++    ++AG     KL  LR 
Sbjct  126   KLSEKIKKKGGAELVAVEE-NLVDTVWGKAKPPRPNETVKALGTEFAGKKFEDKLEDLRK  184

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVM  1040
             +L    S+  V+SMLDEIAWL NLRG+D+ ++PV ++Y +V    A L+++DSK+  +  
Sbjct  185   ELDKKKSAGFVVSMLDEIAWLYNLRGNDIPYNPVFFSYAVVTPTSATLYVNDSKLDSDAK  244

Query  1041  DYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK  1220
              +L    VE+R YE+I  ++++L++K      D +T +              S SP    
Sbjct  245   SHLGDA-VEIRPYEAIFGDVKALSKKTPETEPDGNTGS--------------SSSPKKFL  289

Query  1221  RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLE  1400
              + K++      L G+       SP+  AKAVKN  ELEGM+NCH+RD AAL  ++AWLE
Sbjct  290   ISTKASWALNKSLGGEEKVEEVRSPIGDAKAVKNETELEGMRNCHIRDGAALIEYFAWLE  349

Query  1401  EE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             ++ I K   L EVE A+KL   R+KQ  F+  SFDTIS +G N A+IHYKPE  +CS+++
Sbjct  350   DQLINKGAKLDEVEAADKLEACRAKQEHFVGLSFDTISSTGPNAAVIHYKPERGNCSVID  409

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
                ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G+IAL++A FP+ T GF 
Sbjct  410   PKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMERKSYTLVLKGNIALEKAKFPKGTSGFA  469

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAAL---------NVHEGPQGISFRFG-NMTPMVPG  1907
             LD  AR  LW  GLDYRHGTGHGVG+ L         NVHEGP GI  R   +   +  G
Sbjct  470   LDTLARQFLWAEGLDYRHGTGHGVGSYLARSLANILQNVHEGPIGIGTRVQYSEVSLSVG  529

Query  1908  MVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSIL  2087
              V+S+EPGYYED SFGIRIEN++ VKE++T +RFG   YLGFE +T VP+  KL+D+ +L
Sbjct  530   NVLSDEPGYYEDGSFGIRIENIIMVKEVETNHRFGDKPYLGFEHVTLVPMCRKLIDVRLL  589

Query  2088  SAAEVAWLNSYHLQVWEKVSGLVDGRA--REWLWNNTRPID  2204
             SAAE  +LN Y+ +V EK  G   G +    WL   T P +
Sbjct  590   SAAEKEYLNDYNKEVMEKTKGFFKGDSLTMAWLERETHPFE  630



>gb|EGW06752.1| Xaa-Pro aminopeptidase 1 [Cricetulus griseus]
Length=623

 Score =   539 bits (1389),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 296/634 (47%), Positives = 394/634 (62%), Gaps = 34/634 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T++ 
Sbjct  10    LRQLRQAMRNVEYVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEH  69

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  70    AAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  129

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  130   KKMAKVLRSAGHHLVPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKEKVADLRL  187

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y IV ++   LFID  +I  P V
Sbjct  188   KMAERNIVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIVGLEAIMLFIDGDRIDAPSV  247

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
               +L   +G+E              AE    +   KS     I +  KT C   S    +
Sbjct  248   KQHLLLDLGLE--------------AEYRIQVLPYKS-----ILSELKTLCSDLSPREKV  288

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  + +  +  +       +P+ +AKAVKN AE EGM+  H++DA AL   + W
Sbjct  289   WVSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNLAESEGMRRAHIKDAVALCELFNW  347

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  348   LEKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  406

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G 
Sbjct  407   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGH  466

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGY
Sbjct  467   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGY  526

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN
Sbjct  527   YEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLN  586

Query  2115  SYHLQVWEKVSG---LVDGR--AREWLWNNTRPI  2201
             SYH Q    V G    + GR  A EWL   T PI
Sbjct  587   SYH-QTCRDVIGKELQIQGRQEALEWLLRETEPI  619



>ref|XP_007446583.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Lipotes vexillifer]
Length=666

 Score =   540 bits (1392),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 296/659 (45%), Positives = 406/659 (62%), Gaps = 42/659 (6%)
 Frame = +3

Query  249   VRNSSNIAAKPSSEFQKKPRGLDQEDRLRALRQL--FSRPDINIDAYIIPSQDAHQSEFI  422
             V   S +A K +SE  ++ R        +A+R L   + P   I AYIIPS DAHQSE+I
Sbjct  38    VETDSRMAPKVTSELLRQLR--------QAMRNLEYVTEP---IQAYIIPSGDAHQSEYI  86

Query  423   ADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTP  602
             A C  RRA++SGF GSAGTA++T++ AA+WTDGRYFLQA KQ+ S+W LM+ G    PT 
Sbjct  87    APCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQ  146

Query  603   SEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQP  782
              +WL SVL  GSR+G+DP +  +D  +++ + +    H L+ +   NLVD+IW + RP+ 
Sbjct  147   EDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPER  204

Query  783   PKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPV  962
             P KP+    L Y G     K+  LR  +        V++ LDEIAWL NLRG+DV H+PV
Sbjct  205   PCKPLITLGLDYTGISWKDKVVDLRLKMAERNVVWFVVTALDEIAWLFNLRGADVEHNPV  264

Query  963   MYAYLIVEIDGAKLFID-DSKITPEVMDYLK-SVGVELRAYesilseieslAEKGANLWL  1136
              ++Y I+ ++   LFID D    P V ++L   +G+E              AE    +  
Sbjct  265   FFSYAIIGLETIMLFIDGDRTDAPSVKEHLLLDLGLE--------------AEYRIQVLP  310

Query  1137  DKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAV  1316
              KS     I +  KT C   S    +   +K S  + +  +          +P+ +AKAV
Sbjct  311   YKS-----ILSELKTLCASLSPREKVWVSDKASYAV-SEAIPKDHRCCMPYTPICIAKAV  364

Query  1317  KNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTS  1496
             KNSAE EGM+  H++DA AL   + WLE+E+ K  G+TE+  A+K  EFR +Q  F+D S
Sbjct  365   KNSAESEGMRRAHIKDAVALCELFNWLEKEVPKG-GVTEISAADKAEEFRRQQADFVDLS  423

Query  1497  FDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSRE  1676
             F TIS +G NGAIIHY P P++   ++  E++L+DSGAQY DGTTD+TRT+HFG P++ E
Sbjct  424   FPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYE  483

Query  1677  KECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEG  1856
             KECFT VL+GHIA+  AVFP  T G +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEG
Sbjct  484   KECFTCVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEG  543

Query  1857  PQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFE  2036
             P GIS++  +  P+  GM+V++EPGYYED +FGIRIEN++ V  + T   F   G L F+
Sbjct  544   PCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFD  603

Query  2037  KLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
              LT VPIQ K++D+  L+  E  WLN+YHL   + +   +  + R    EWL   T+PI
Sbjct  604   PLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI  662



>gb|EGD93125.1| aminopeptidase [Trichophyton tonsurans CBS 112818]
 gb|EZF29231.1| hypothetical protein H101_07090 [Trichophyton interdigitale H6]
 gb|KDB27823.1| hypothetical protein H109_00391 [Trichophyton interdigitale MR816]
Length=655

 Score =   540 bits (1391),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 289/637 (45%), Positives = 390/637 (61%), Gaps = 29/637 (5%)
 Frame = +3

Query  303   PRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTA  482
             P  +D   RL  LR+L ++    +D YI+PS+D+HQSE+IA C  RRA+IS FTGSAG A
Sbjct  44    PPPVDTTQRLAKLRELMAQN--KVDVYIVPSEDSHQSEYIAPCDGRRAFISSFTGSAGCA  101

Query  483   VVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFL  662
             +V+  KAAL TDGRYF QA KQL ++W L++ G  GVPT  EW       G  +G+DP L
Sbjct  102   IVSMSKAALSTDGRYFSQAAKQLDANWTLLKRGVEGVPTWEEWTAEQAENGKVVGVDPSL  161

Query  663   FSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSK  842
              ++  A +L + +      LV +   NL+D +W + RP  P   I V  ++ AG     K
Sbjct  162   ITAADARKLSQTLKSTGGSLVGIDQ-NLIDAVWGDERPARPANQITVQPVERAGKSFEEK  220

Query  843   LFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSK  1022
             +  LR +L     SA+VIS LDEIAWL NLRGSD+ ++PV ++Y IV    A+L++D+SK
Sbjct  221   VEDLRKELAAKKRSAMVISTLDEIAWLFNLRGSDIPYNPVFFSYAIVTPSVAELYVDESK  280

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             ++PE   +L+   V L+ Y                     S   A+   A   A      
Sbjct  281   LSPEARKHLEG-KVVLKPY--------------------DSIFQASKVLAESKASASSGS  319

Query  1203  SPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             S      NK S +L    L G+ + +   SP++ AKA+KN  ELEG + CH+RD AAL  
Sbjct  320   SGKFLLSNKASWSLSL-ALGGEQNVVEVRSPITDAKAIKNEVELEGFRKCHIRDGAALIE  378

Query  1383  FWAWLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE  + K+   L EV+ A KL E R K   F+  SFDTIS +GANGA IHYKPE  
Sbjct  379   YFAWLENALIKEGAKLDEVDGANKLFEIRKKYDLFVGNSFDTISSTGANGATIHYKPEKS  438

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +C++++   ++L DSG QY+DGTTD TRT+HFGEP+  +K+ +  VL+GHI++D A+FP+
Sbjct  439   TCAVIDPKAMYLCDSGGQYLDGTTDTTRTLHFGEPTEFQKKAYALVLKGHISIDNAIFPK  498

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVV  1916
              T G+ +D+FAR  LWK GLDY HGTGHGVG+ LNVHEGP GI  R      P+    V+
Sbjct  499   GTTGYAIDSFARQHLWKEGLDYLHGTGHGVGSFLNVHEGPMGIGSRAQYAEVPLSASNVL  558

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             SNEPGYYED +FGIR+ENL+  KE+ T ++FG   +LGFE +T VP   KL+D S+L+ A
Sbjct  559   SNEPGYYEDGNFGIRLENLVICKEVQTAHKFGDKPFLGFESITLVPFCQKLLDASLLTEA  618

Query  2097  EVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             E  W+N YH +VWEK S     D     WL   T+PI
Sbjct  619   ERKWVNDYHARVWEKTSPFFEKDELTTAWLKRETQPI  655



>ref|XP_005063526.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Mesocricetus 
auratus]
Length=666

 Score =   540 bits (1391),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 295/634 (47%), Positives = 395/634 (62%), Gaps = 34/634 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T++ 
Sbjct  53    LRQLRQAMRNVEYVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEH  112

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  113   AAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  172

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  173   KKMAKVLRSAGHHLVPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKEKVADLRL  230

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +     +  V++ LDEIAWL NLRGSDV H+PV ++Y I+ ++   LFID  +I  P V
Sbjct  231   KMAERSIAWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLEAIMLFIDGDRIDAPGV  290

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
               +L   +G+E              AE    +   KS     I +  KT C   S    +
Sbjct  291   KQHLLLDLGLE--------------AEYKIRVLPYKS-----ILSELKTLCSDLSPREKV  331

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  + +  +          +P+ +AKAVKNSAE EGM+  H++DA AL   + W
Sbjct  332   WVSDKASYAV-SEAIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFCW  390

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K V +TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  391   LEKEVPKGV-VTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  449

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G 
Sbjct  450   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGH  509

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGY
Sbjct  510   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGY  569

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN
Sbjct  570   YEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLN  629

Query  2115  SYHLQVWEKVSG---LVDGR--AREWLWNNTRPI  2201
             SYH Q    V G    + GR  A EWL   T P+
Sbjct  630   SYH-QTCRDVIGKELQIQGRQEALEWLLRETEPV  662



>ref|XP_003045304.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 sp|C7Z9Z7.1|AMPP1_NECH7 RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Nectria haematococca mpVI 
77-13-4]
 gb|EEU39591.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=619

 Score =   538 bits (1387),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 295/628 (47%), Positives = 391/628 (62%), Gaps = 25/628 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL +LR      + N+  YIIPS+D+H SE+IADC  RR +ISGFTGSAG AVVT
Sbjct  4     IDTTSRLTSLRGFMK--ERNVQVYIIPSEDSHSSEYIADCDARREHISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              + AAL TDGRYF QA  QL S+W L++ G   VPT  EW     S G  +G+DP L S 
Sbjct  62    LETAALATDGRYFNQAAAQLDSNWTLLKQGLQDVPTWQEWSAEQSSGGKNVGVDPSLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + V   + AG  V++KL 
Sbjct  122   ATAKNLAEKIRKSGGAELVPIEG-NLVDLVWGKERPARPSEKVIVQPDELAGESVTNKLT  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    S   ++SMLDEIAWL NLRG+D+  +PV ++Y IV  D A L+IDDSK+ 
Sbjct  181   KLRQELEKKRSPGFLVSMLDEIAWLFNLRGNDIPFNPVFFSYAIVTPDVATLYIDDSKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L +  VE++ Y+              ++  D   ++A+++   K+  +  + + 
Sbjct  241   DKCRSHLSANKVEIKPYD--------------SILDDARKLHASVSEKGKS--ENAAPTG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        SPV  AKA+K+ AEL GM+ CH+RD AAL  ++
Sbjct  285   NFLISNKGSWAL-KRALGGDSSVDEIRSPVGDAKAIKSEAELVGMRACHVRDGAALIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EVE A+KL E RS++  F+  SF TIS +GAN AIIHY PE  SC
Sbjct  344   AWLEDQLVNKKATLDEVEAADKLEELRSQKSDFVGLSFPTISSTGANAAIIHYGPERGSC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG P+  E+E +T VL+GHIALDQAVFP+ T
Sbjct  404   ATIDPEAIYLCDSGAQYHDGTTDTTRTLHFGTPTEAEREAYTLVLKGHIALDQAVFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMVPGMVVS  1919
              GF LD  AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R  F  +  + PG V+S
Sbjct  464   TGFALDGLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQFAEVA-LAPGNVLS  522

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             NEPGYYED  +GIRIEN++ VKE+ T ++FG   +LGFE +T VP    L+D  +L++ E
Sbjct  523   NEPGYYEDGKYGIRIENIVVVKEIKTKHKFGDKPFLGFEHVTMVPYCRNLIDTKLLTSEE  582

Query  2100  VAWLNSYHLQVWEKVSGLVDGRAREWLW  2183
               WLN+Y+ +V +K  G  +G      W
Sbjct  583   KEWLNAYNAKVVDKTQGYFEGDDVTLAW  610



>ref|XP_007173125.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=623

 Score =   538 bits (1386),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 291/633 (46%), Positives = 393/633 (62%), Gaps = 32/633 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA+VT++ 
Sbjct  10    LRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIVTEEH  69

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ S+W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  70    AAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  129

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H L+ +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  130   KKMAKVLRSAGHHLIPVKE-NLVDKIWTD-RPERPCKPLITLGLDYTGISWKDKVVDLRL  187

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFID-DSKITPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y ++ ++   LFID D    P V
Sbjct  188   KMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAVIGLETIMLFIDGDRTDVPSV  247

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
              ++L   +G+E              AE    +   KS     I +  KT C   S    +
Sbjct  248   KEHLLLDLGLE--------------AEYRIQVLPYKS-----ILSELKTLCASLSPREKV  288

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  + +  +          +P+ +AKAVKNSAE EGM+  H++DA AL   + W
Sbjct  289   WVSDKASYAV-SEAIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNW  347

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  348   LEKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  406

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  AVFP  T G 
Sbjct  407   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGH  466

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGY
Sbjct  467   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGY  526

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L F+ LT VPIQ K++D+  L+  E  WLN
Sbjct  527   YEDGAFGIRIENVVLVVPVKTKYNFSNRGSLTFDPLTLVPIQTKMIDVDSLTDKECDWLN  586

Query  2115  SYHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             +YHL   + +   +  + R    EWL   T PI
Sbjct  587   NYHLTCRDVIGKELQKQGRQEALEWLIRETEPI  619



>ref|XP_007438892.1| PREDICTED: xaa-Pro aminopeptidase 1-like isoform X1 [Python bivittatus]
 ref|XP_007438893.1| PREDICTED: xaa-Pro aminopeptidase 1-like isoform X2 [Python bivittatus]
Length=623

 Score =   538 bits (1386),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 287/643 (45%), Positives = 389/643 (60%), Gaps = 44/643 (7%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             L+ LRQ+          I AYI+PS DAHQSE+IA C  RR +I GF GSAGTA++T+  
Sbjct  10    LKQLRQVMKNSRYVHEPIQAYIVPSGDAHQSEYIAPCDCRREFICGFNGSAGTAIITEQD  69

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA +Q+ S+W LM+ G    P   +WL SVL  GSR+G+DP +  +D  
Sbjct  70    AAMWTDGRYFLQATQQMDSNWTLMKMGLKDTPAQEDWLVSVLPQGSRVGVDPSIIPADQW  129

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             + + + +    H LV + + NL+D IW + RP  P KP+   DL + G     K+ +LR 
Sbjct  130   KRMSKVLKCAGHVLVPIKD-NLIDAIWAD-RPPRPCKPLMTLDLSFTGISWKEKITALRG  187

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT-PEV  1037
              +    +   V++ LD++AWL NLRGSDV ++PV +AY I+ ID  +LFID +++  P V
Sbjct  188   KMSERKALWFVVTALDDVAWLFNLRGSDVEYNPVFFAYAIIGIDTIRLFIDGNRLVDPSV  247

Query  1038  MDYL-------KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRY  1196
              ++L         + V++  Y+                         +I    K+ C+  
Sbjct  248   REHLFLDSAQDPELHVQVLPYD-------------------------SILTVLKSVCETL  282

Query  1197  SRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAAL  1376
             S    +   +K S  L T  +      L   +P+ MAKAVKN  E EGM+  H++DA AL
Sbjct  283   SPHEKVWLSDKASYAL-TQAIPKDHRYLTPYTPICMAKAVKNVTEAEGMRKAHIKDAVAL  341

Query  1377  AHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEP  1556
                + WLE+E+ K   +TE+  AEK  EFRS+Q  F+D SF TIS +G NGAIIHYKP P
Sbjct  342   CELFNWLEKEVPKG-NITEIIAAEKAEEFRSQQENFVDLSFATISSTGPNGAIIHYKPSP  400

Query  1557  DSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFP  1736
             ++   ++ +E++LLDSGAQY DGTTD+TRT+HFG PS  EKECFT VL+GHIA+  A+FP
Sbjct  401   ETNRTLSLNEIYLLDSGAQYKDGTTDVTRTMHFGTPSVYEKECFTYVLKGHIAVSAAIFP  460

Query  1737  ENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVV  1916
               T G +LD+FARS+LW  GLDY HGTGHGVGA LNVHEGP GIS++     P+  GM+V
Sbjct  461   NGTKGHLLDSFARSALWDQGLDYLHGTGHGVGAFLNVHEGPCGISYKTFADEPLEAGMIV  520

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             S+EPGYYED  FGIRIEN++ V    T   F   G L FE LT VPIQ K++ + +L+  
Sbjct  521   SDEPGYYEDGCFGIRIENVVIVVPAQTKYNFSNRGSLTFEPLTLVPIQTKMIQIHLLTQR  580

Query  2097  EVAWLNSYHLQVWEKVSGLVDGRAR----EWLWNNTRPIDSSP  2213
             E  WLN YH +  E +   ++ + R    +WL   T PI   P
Sbjct  581   ECDWLNDYHRKCREVIGAELEQQGRHEALQWLIRETEPISQIP  623



>ref|XP_003511990.2| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Cricetulus griseus]
Length=666

 Score =   539 bits (1388),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 296/634 (47%), Positives = 394/634 (62%), Gaps = 34/634 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T++ 
Sbjct  53    LRQLRQAMRNVEYVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEH  112

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  113   AAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  172

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  173   KKMAKVLRSAGHHLVPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKEKVADLRL  230

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y IV ++   LFID  +I  P V
Sbjct  231   KMAERNIVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIVGLEAIMLFIDGDRIDAPSV  290

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
               +L   +G+E              AE    +   KS     I +  KT C   S    +
Sbjct  291   KQHLLLDLGLE--------------AEYRIQVLPYKS-----ILSELKTLCSDLSPREKV  331

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  + +  +  +       +P+ +AKAVKN AE EGM+  H++DA AL   + W
Sbjct  332   WVSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNLAESEGMRRAHIKDAVALCELFNW  390

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  391   LEKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  449

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G 
Sbjct  450   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGH  509

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGY
Sbjct  510   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGY  569

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN
Sbjct  570   YEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLN  629

Query  2115  SYHLQVWEKVSG---LVDGR--AREWLWNNTRPI  2201
             SYH Q    V G    + GR  A EWL   T PI
Sbjct  630   SYH-QTCRDVIGKELQIQGRQEALEWLLRETEPI  662



>ref|XP_009217422.1| xaa-Pro aminopeptidase 1 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT81413.1| xaa-Pro aminopeptidase 1 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=700

 Score =   539 bits (1389),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 292/636 (46%), Positives = 387/636 (61%), Gaps = 28/636 (4%)
 Frame = +3

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
             + +D   RL  LR L      NID Y++P++DAH SE+IA C  RR YISGF+GSAGT +
Sbjct  84    KTVDTTARLAELRGLMKAR--NIDVYVVPTEDAHSSEYIAPCDARREYISGFSGSAGTVI  141

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             VT + AAL TDGRYF QA  QL  +W L++ G   VPT   W  + +S G  +G+DP + 
Sbjct  142   VTLEGAALATDGRYFSQAATQLDKNWELLKQGQPDVPTWQGWTVNQVSGGKTVGVDPSVL  201

Query  666   SSDAAEELKEDIS-KGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSK  842
             SS  A +L + I   G  ELV +S  NLVD +W   RP  P  PI + +  Y G D  +K
Sbjct  202   SSSQARDLNDKIKDNGGKELVAVSE-NLVDLVWGRHRPARPSNPIVLLEQHYTGKDTQTK  260

Query  843   LFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSK  1022
             L  LR++L     S  V+S LDE+AWL NLRGSDV ++PV ++Y ++  D A L++D SK
Sbjct  261   LKELRAELEKQKLSVFVVSALDEVAWLFNLRGSDVPYNPVFFSYAVITADSATLYVDSSK  320

Query  1023  ITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             ++ +   YL    V+++ Y SI                D S   A   +A         +
Sbjct  321   LSAQCHSYLAENKVDVKPYGSI---------------FDDSRALAQTVSAKGAEGKDKPK  365

Query  1203  SPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
                I K+   +  L    L G        SP+  +K++KN AELEGM+ CH+RD AAL  
Sbjct  366   KLAISKKTSWALKL---ALGGDGAVEEVKSPICDSKSIKNEAELEGMRQCHIRDGAALTE  422

Query  1383  FWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE+++  +   L EV+ A KL E RSK+  F+  SF TIS SGANGAIIHY PE D
Sbjct  423   YFAWLEDQLVDQRTVLDEVQGATKLFEIRSKRANFVGNSFTTISASGANGAIIHYGPEED  482

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             SC+ ++ + ++L DSGAQY+DGTTD TRT+HFG P+  +K  +T VL+GHIALDQA+FP 
Sbjct  483   SCAKIDPNAVYLCDSGAQYLDGTTDTTRTLHFGTPTDVQKNAYTLVLKGHIALDQAIFPR  542

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMVPGMV  1913
              T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R  +  +  +  G V
Sbjct  543   GTTGFSLDCLARQFLWQEGLDYRHGTGHGVGSYLNVHEGPIGIGTRKHYAEVA-LAAGNV  601

Query  1914  VSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSA  2093
              S EPG+YED S+GIR+EN+  V+E+ T ++FG   YLGFE +T VP   ++V+ S+L+A
Sbjct  602   TSIEPGFYEDGSYGIRLENIAIVREVKTKHQFGDKPYLGFEYVTMVPFCRRMVEPSLLNA  661

Query  2094  AEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTR  2195
              E  WLN YH  VWEK SG    D     WL   T+
Sbjct  662   KEKKWLNDYHAAVWEKTSGYFKDDPLTTAWLKRETQ  697



>ref|XP_001229888.1| hypothetical protein CHGG_03372 [Chaetomium globosum CBS 148.51]
 sp|Q2H8T2.1|AMPP1_CHAGB RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Chaetomium globosum CBS 
148.51]
 gb|EAQ91437.1| hypothetical protein CHGG_03372 [Chaetomium globosum CBS 148.51]
Length=624

 Score =   536 bits (1380),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 296/637 (46%), Positives = 393/637 (62%), Gaps = 33/637 (5%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LR L     ++I   I+PS+D+H SE+IA C  RRA+ISGFTGSAGTAVVT+DKAA
Sbjct  9     RLTTLRSLMKENGVDIYGIIVPSEDSHASEYIAPCDGRRAFISGFTGSAGTAVVTQDKAA  68

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA KQL  +W L+++G   VPT  +W     + G  +G+DP L SS  AE+
Sbjct  69    LATDGRYFNQAGKQLDGNWHLLKTGLQDVPTWQDWTAEASAGGKTVGVDPSLISSPIAEK  128

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L E I K     +   + NLVD +W   RP     P+++   KY+G D ++KL  LR +L
Sbjct  129   LDESIKKSGGAGLKAVSENLVDPVWGSDRPARSSNPVKLLIGKYSGKDTAAKLTELRKEL  188

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
                 ++A V+SMLDE+AWL NLRGSD+ ++PV Y+Y IV  D A L++D SK+  E   Y
Sbjct  189   EKKKAAAFVLSMLDEVAWLFNLRGSDITYNPVFYSYAIVTQDSATLYVDVSKLDDESRSY  248

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLD-KSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             L    V ++ Y+               L+ D K+  +AA       A  +Y  S      
Sbjct  249   LDQNKVTIKPYD--------------TLFEDAKALASAAEAKGTSEAPRKYFVS------  288

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             NK S  L    L G        SPV  AKAVKN  ELEGM+ CH+RD  AL  F+AWLE+
Sbjct  289   NKGSWALKL-ALGGDKFVEEVRSPVGDAKAVKNDTELEGMRQCHIRDGVALIQFFAWLED  347

Query  1404  EIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNR  1580
             ++  K   L EV  A++L   RSKQ  F+  SFDTIS +G N A+IHYKPEP +CSI++ 
Sbjct  348   QLVNKKAVLDEVAAADQLEALRSKQTDFVGLSFDTISSTGPNAAVIHYKPEPGACSIIDP  407

Query  1581  HELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVL  1760
               ++L DSGAQ++DGTTD+TRT+HFG P++ +K+ +T VL+G+IALD A+FP+ T G+ +
Sbjct  408   EAIYLCDSGAQFLDGTTDVTRTLHFGTPTAEQKKAYTLVLKGNIALDTAIFPKGTTGYAI  467

Query  1761  DAFARSSLW-------KVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVV  1916
             D  AR  LW       K GLDYRHGTGHGVG+ LNVHEGP GI  R       +  G V+
Sbjct  468   DCLARQFLWASSPFSTKQGLDYRHGTGHGVGSYLNVHEGPIGIGTRKQYAEVALAAGNVL  527

Query  1917  SNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAA  2096
             S EPG+YED S+GIRIENL  V+E+ T + FG   +LGFE +T VP   KL+D ++L+A 
Sbjct  528   SIEPGFYEDGSYGIRIENLAMVREVKTEHSFGDKPFLGFEHVTMVPYCRKLIDEALLTAE  587

Query  2097  EVAWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPI  2201
             E  WLN  + ++ EK++G  DG    + WL   T+P 
Sbjct  588   EREWLNQSNKEIREKMAGRFDGDQLTQAWLERETQPF  624



>gb|EUC55311.1| Xaa-pro aminopeptidase P, putative [Rhizoctonia solani AG-3 Rhs1AP]
Length=641

 Score =   535 bits (1379),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 298/638 (47%), Positives = 403/638 (63%), Gaps = 29/638 (5%)
 Frame = +3

Query  306   RGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAV  485
             R ++  +R+ ALR L    +  +DAY++ S+D H SE++ADC  RRA+ISGF GSAG AV
Sbjct  13    RTVNTTERINALRLLLR--ENQVDAYVVVSEDQHSSEYLADCDARRAFISGFDGSAGCAV  70

Query  486   VTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF  665
             V+   A L+TDGRYFLQAE+QL S+W LM+ G  GVPT  E+L   L  G++IGIDP L 
Sbjct  71    VSVSGAFLFTDGRYFLQAEQQLDSNWTLMKQGLPGVPTWQEFLAKKLPEGTKIGIDPTLI  130

Query  666   SSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKL  845
             S   A  L+  ++  N  LV ++  NLVD+IW  SRP  P KPI    LKYAG   + KL
Sbjct  131   SVSDATSLRTTLASRNSSLVPIAT-NLVDKIWT-SRPPRPAKPIHPLSLKYAGTSPAEKL  188

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
              +LR+ L  A ++ +VI++LDE+AWL+ +RGSD+ ++PV +AY IV    A LF++ S+I
Sbjct  189   STLRAKLARADATGVVITLLDEVAWLVGMRGSDIDYNPVFFAYAIVTPAAATLFVNSSQI  248

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRS  1205
             T E  +YLK  G E+  YE+I+  +E L  K      ++           K   D     
Sbjct  249   TSEAQEYLKESGWEVDRYENIIKRLEELGSKAEEAKEEQ-----------KDTEDHDGDE  297

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRS------SPVSMAKAVKNSAELEGMQNCHLRDA  1367
               +K   K    +D+       HAL         S V+ AK++KN AEL+G +N H+RD 
Sbjct  298   AQLKGEAKGKVLIDSKASLAVAHALGEGHYHVVRSSVADAKSIKNGAELDGFRNSHIRDG  357

Query  1368  AALAHFWAWLEEEIC--KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIH  1541
              ALA ++A LEE +   ++   +E + A+ L  +RS+   F   SF TIS +G NGAIIH
Sbjct  358   VALARYFAHLEEHLLGPEEPKWSEYQAAQVLERYRSELDLFKGLSFTTISSTGPNGAIIH  417

Query  1542  YKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALD  1721
             Y P  +  + + + +++L DSGAQ++DGTTD+TRT HFG P+  EK  FTRVLQGHI++D
Sbjct  418   YSPPEEGSAEIKKEQIYLCDSGAQFLDGTTDVTRTWHFGTPTEEEKRAFTRVLQGHISID  477

Query  1722  QAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPM  1898
              AVFP  T G+VLDAFAR +LW  GL  +HGTGHGVG  L VHEGPQGI  R   N T +
Sbjct  478   TAVFPNGTTGYVLDAFARRALWADGLG-KHGTGHGVGHYLCVHEGPQGIGTRIAYNDTKL  536

Query  1899  VPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDL  2078
               GMV+SNEPGYY D  FGIR+E++++V++  TPN FG  GYLGFE +T  PI  KLV++
Sbjct  537   KEGMVLSNEPGYYADGKFGIRLESIVFVRKASTPNDFGSRGYLGFEHVTMCPIHTKLVEV  596

Query  2079  SILSAAEVAWLNSYHLQVWEKV----SGLVDGRAREWL  2180
             S+L+ AE  WLN YH +V EKV    + + D RA+ WL
Sbjct  597   SLLNDAERKWLNDYHAEVLEKVGPELAKVGDLRAQAWL  634



>ref|XP_010667693.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Beta vulgaris subsp. 
vulgaris]
Length=653

 Score =   535 bits (1379),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 290/654 (44%), Positives = 404/654 (62%), Gaps = 35/654 (5%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D+L ALR L +     + A I+PS+D HQSE++++   RR +ISGF+GSAG A++T + A
Sbjct  3     DKLSALRTLMASHSPPLHALIVPSEDYHQSEYVSNRDKRRQFISGFSGSAGLALITTNDA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQAEKQLS+ W LMR G    P    W+   L   + IGIDP+  S D A+
Sbjct  63    RLWTDGRYFLQAEKQLSTQWRLMRMGE--DPAVEIWMADNLPEEAAIGIDPWCVSIDTAQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
               +  + K   +LV  SN NLVD+IWK+ RP+   KP++V  L++AG  V+ KL  +R  
Sbjct  121   RWERALEKKRQKLVSTSN-NLVDQIWKD-RPETEVKPVKVQPLEFAGRTVAEKLQDVRGK  178

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    + +IVI+ LDE+AWL N+RG+DV + PV++A+ +V    A  ++D  K++PEV+ 
Sbjct  179   LTQEKAHSIVITALDEVAWLYNVRGNDVSYCPVVHAFAVVTSAAAFFYVDQQKVSPEVIS  238

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKS-TVNAAITNAYKTACDRYSRSPGIKK  1220
              +K   +E+R Y+++ ++++ LA       LD S +VNAA   A       +      K+
Sbjct  239   QMKKNNIEVRDYDAVSADVDLLASNQ----LDSSLSVNAAEDKAVSGTTPEHKTGDMRKE  294

Query  1221  RN-----KKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
              N      +S                + SP+++AKA+KNSAE+EG++N H+RD AA+  F
Sbjct  295   CNFVWMDPRSCCYALYSKLKSDQVFLQQSPLALAKALKNSAEMEGLRNAHMRDGAAVVQF  354

Query  1386  WAWLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFDT  1505
               WLE+++ +  G                    LTEV V++KL  FR+ +  F   SF T
Sbjct  355   LVWLEQQMQELYGAPGYFSEAETERKKPSEAQKLTEVSVSDKLEGFRASKEHFRGLSFPT  414

Query  1506  ISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKEC  1685
             IS  G N AIIHY P+P++C+ ++   ++L DSGAQY DGTTDITRTVHFG+PS+ EK C
Sbjct  415   ISSVGPNAAIIHYGPDPETCAEMDPDRIYLFDSGAQYQDGTTDITRTVHFGQPSAHEKTC  474

Query  1686  FTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQG  1865
             +T VL+GHIAL  A FP+ T G  LD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP  
Sbjct  475   YTGVLKGHIALGNARFPKGTNGHALDILARVPLWKYGLDYRHGTGHGIGSYLNVHEGPHL  534

Query  1866  ISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKL  2042
             ISFR      P+   M V++EPGYYED +FGIR+EN+L V E +T   FG  GYL FE +
Sbjct  535   ISFRPQAQNVPLQAAMTVTDEPGYYEDGNFGIRLENVLIVNEANTKFNFGDRGYLEFEHI  594

Query  2043  TFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPID  2204
             T+ P Q KL+DL +L+  E++W+N+YH +  E +S  ++     WL   T PID
Sbjct  595   TWAPYQHKLIDLKLLTPEEISWVNTYHSRCREILSPYMNETEMAWLRKATEPID  648



>ref|XP_003002386.1| xaa-Pro aminopeptidase [Verticillium alfalfae VaMs.102]
 sp|C9SR45.1|AMPP1_VERA1 RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Verticillium alfalfae VaMs.102]
 gb|EEY20847.1| xaa-Pro aminopeptidase [Verticillium alfalfae VaMs.102]
Length=612

 Score =   533 bits (1372),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 291/642 (45%), Positives = 399/642 (62%), Gaps = 45/642 (7%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L      +ID Y++PS+D+H SE+IA C  RR +ISGF+GSAG AV+T
Sbjct  4     VDTSGRLSKLRELMRAH--SIDVYVVPSEDSHSSEYIAACDARREFISGFSGSAGCAVIT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL  +W+L++ G   VPT  +W     + G  + +DP L ++
Sbjct  62    LDKAALATDGRYFNQASKQLDHNWLLLKQGLQDVPTWQDWSAEQSAGGKIVAVDPELIAA  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
              AA++L   I K G  ELV L   NLVD +W + RP  P+ P+ + D  ++G +V +KL 
Sbjct  122   AAAKKLAAKIHKFGGSELVALER-NLVDVVWGKDRPDRPRNPVVILDTAFSGKNVETKLR  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L+   S  +V+SMLDE+AWLLNLRGSD+ ++PV ++Y ++ +D A LF+DD+K+ 
Sbjct  181   DLRQELVKKDSLGMVVSMLDEVAWLLNLRGSDIPYNPVFFSYAVITLDTATLFVDDTKLH  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
             P+ ++YL+  G+  + Y                         + I +  K      + S 
Sbjct  241   PDSLEYLRKNGIVTKPY-------------------------SCIFDDVKA----LTSSK  271

Query  1209  GIKKRNK------KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAA  1370
             G++ R K      K++      L G        S +  AKAVKN AEL GM+ CH+RD  
Sbjct  272   GVQGREKRTLLSSKASWALKRALGGDDLVEEVRSFIGDAKAVKNEAELAGMRACHIRDGI  331

Query  1371  ALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYK  1547
             AL  ++AWLE++ + K + L EVE A+KL E R KQ  ++  SFDTIS +GAN A+IHYK
Sbjct  332   ALIEYFAWLEDQLVAKRIVLDEVEAADKLEELRQKQENYVGLSFDTISSTGANAAVIHYK  391

Query  1548  PEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQA  1727
             PE  SC  ++   ++L DSGAQY+DGTTD+TRTVHFG P++ EK  +T VL+G+IALD A
Sbjct  392   PERGSCPAIDPEAIYLCDSGAQYLDGTTDVTRTVHFGCPTAAEKLAYTLVLKGNIALDSA  451

Query  1728  VFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMV  1901
             +FP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R  F  ++ + 
Sbjct  452   IFPKGTTGFALDCLARQHLWREGLDYRHGTGHGVGSYLNVHEGPIGIGTRVQFAEVS-LA  510

Query  1902  PGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLS  2081
              G VVS EPG+YED +FGIRIENL  V+E+ T + FG   YLGFE +T  P    L+D+S
Sbjct  511   SGNVVSIEPGFYEDGAFGIRIENLAIVREVQTQHSFGDKPYLGFEHVTMAPYCKNLIDIS  570

Query  2082  ILSAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             IL+ AE  WLN+++  ++ K       D     WL   T+PI
Sbjct  571   ILTTAEKEWLNAHNTDIFNKTKDAFKDDALTLAWLTRETQPI  612



>dbj|GAK66037.1| creatinase/aminopeptidase [Pseudozyma antarctica]
Length=710

 Score =   536 bits (1381),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 297/627 (47%), Positives = 389/627 (62%), Gaps = 35/627 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   R+RALR+L ++    +DAY+IPS D H SE+ A+  +RR YI+GFTGSAG+AVVT
Sbjct  107   VDTTQRVRALRELMAKH--GVDAYVIPSGDEHASEYPAESDLRRGYITGFTGSAGSAVVT  164

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
               KA L+TDGRYFLQA +QL  S W LM+ G   VPT  E+L+  L   S+IG+D  L S
Sbjct  165   TSKALLFTDGRYFLQAGQQLEPSVWTLMKQGEPNVPTWQEYLSKDLPANSKIGMDASLIS  224

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +D A+++  ++SK    LV +   NLVD +W + RP  P +PI V D K AG   S K+ 
Sbjct  225   ADDAKDITAELSKKGSSLVSIRE-NLVDNVWSD-RPTRPGQPIFVLDEKVAGRSSSDKIR  282

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR ++    +   V +MLDE AWL NLRG+DV ++PV +++ +V +D   L+++DS++T
Sbjct  283   ELRDEIKKKSAHGFVANMLDETAWLFNLRGTDVPYNPVFFSFALVLLDKVLLYVNDSQLT  342

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              EV   L S  V LR Y              A  + D  +V A +    K    + S S 
Sbjct  343   DEVKASLSSE-VTLRPY--------------AEFYNDLHSVGAELGEGNKILIGK-SASL  386

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +++            L G        S V   K++KN  EL+G +  H+RD AAL  F+
Sbjct  387   AVQE-----------ALGGAAKVEIVRSIVGDQKSIKNDVELDGFRQSHIRDGAALCQFF  435

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEE++     +TE E A+KL E+R     F   SF TIS +G NGAIIHY P+P SC 
Sbjct  436   AWLEEQLVAGNKVTESEGADKLSEYRQSLDHFRGESFTTISSTGPNGAIIHYSPDPSSCP  495

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ +E++L DSGAQ+ DGTTD+TRT HFGEP +     FTRVLQGHIA+D+AVFP+ T 
Sbjct  496   AIDVNEIYLCDSGAQFTDGTTDVTRTWHFGEPKAEHIRAFTRVLQGHIAIDRAVFPKGTT  555

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNE  1925
             G++LD  AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +   MVVSNE
Sbjct  556   GYLLDVLARRALWEDGLDYRHGTGHGVGHFLNVHEGPQGIGTRAVFNETSLKENMVVSNE  615

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  +GIRIENL+ V+   TPN FG  GYL FE LT  PIQ  LVD ++L+  +  
Sbjct  616   PGYYEDGKWGIRIENLVIVRPAKTPNNFGSKGYLTFEHLTMCPIQVSLVDPTLLNQDDKN  675

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWL  2180
             WLNSYH +V  KV  L+  D RA  WL
Sbjct  676   WLNSYHDEVQAKVGPLLQNDQRALAWL  702



>sp|C6HSY3.1|AMPP1_AJECH RecName: Full=Probable Xaa-Pro aminopeptidase P; Short=AMPP; 
Short=Aminopeptidase P; AltName: Full=Aminoacylproline aminopeptidase; 
AltName: Full=Prolidase [Histoplasma capsulatum H143]
 gb|EER36658.1| xaa-pro aminopeptidase [Histoplasma capsulatum H143]
Length=636

 Score =   533 bits (1373),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 289/656 (44%), Positives = 399/656 (61%), Gaps = 49/656 (7%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    +  +D Y++PS+D+HQSE+IA C  RR +ISGFTGSAG A+V+
Sbjct  4     IDTSQRLARLRELMQ--ERKVDVYVVPSEDSHQSEYIAHCDGRREFISGFTGSAGCAIVS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL ++WIL++ G   +PT  EW       G  +G+DP L ++
Sbjct  62    MTKAALSTDGRYFNQAAKQLDNNWILLKRGFENMPTWQEWTAEQAEGGKVVGVDPSLITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E I K    L+ +   NLVD +W   RP  P + + +H +++AG     K+  
Sbjct  122   SDARNLSETIKKCGGSLLGVQE-NLVDLVWGAERPARPSEKVALHPIEFAGKSFEEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L     +  VISMLDEIAWL NLRG+D+ ++PV +AY I+    A L+ID+ K+  
Sbjct  181   LRKELQKKKCAGFVISMLDEIAWLFNLRGNDIPYNPVFFAYAIITQSTADLYIDEEKLPA  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV +YL    V L+ Y              ++++ D   +  +  N  K+  +  ++ P 
Sbjct  241   EVKNYLGD-KVSLKPY--------------SSIFEDAKVLGQSAQN--KSDGETSTKPPQ  283

Query  1212  ---IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
                I  R   S +L    L G+ +     SP++ AKA+KN AELEGM+ CH+RD AAL+ 
Sbjct  284   KFLISTRASWSLSL---ALGGEKNVEEVRSPITDAKAIKNEAELEGMRACHIRDGAALSE  340

Query  1383  FWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPD  1559
             ++AWLE E+  K   L EV+ ++KL + RSK   F+  SFDTIS +G N A+IHYK E +
Sbjct  341   YFAWLENELVNKKTVLNEVDASDKLEQIRSKHQHFVGLSFDTISSTGPNAAVIHYKAERN  400

Query  1560  SCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPE  1739
             +CSI++   ++L DSGAQY+DGTTD TRT+HFGEP+  EK+ +T VL+G I++D AVFP+
Sbjct  401   NCSIIDPKAVYLCDSGAQYLDGTTDTTRTLHFGEPTEMEKKAYTLVLKGLISIDTAVFPK  460

Query  1740  NTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVV  1916
              T GF LDAFAR  LWK GLDY HGTGHGVG+ LNVHEGP G+  R   +   + PG V+
Sbjct  461   GTTGFALDAFARQYLWKEGLDYLHGTGHGVGSYLNVHEGPIGLGTRVQYSEVAIAPGNVI  520

Query  1917  SNEPGYYEDHSFGIRIE-------------------NLLYVKEMDTPNRFGGIGYLGFEK  2039
             S+EPGYYED  FGIRIE                   +++  KE+ T ++FG   +LGFE 
Sbjct  521   SDEPGYYEDGVFGIRIESPFFPHLLINLPFLLTPIIDIIMAKEVKTTHKFGEKPWLGFEH  580

Query  2040  LTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             +T  P+  KL++ S+LS  E  W+N YH ++WEK S     D   R WL   T+PI
Sbjct  581   VTMTPLCQKLINPSLLSDVEKKWVNDYHTEIWEKTSKYFENDELTRNWLKRETQPI  636



>emb|CDS08656.1| hypothetical protein LRAMOSA10017 [Absidia idahoensis var. thermophila]
Length=606

 Score =   532 bits (1370),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 286/632 (45%), Positives = 394/632 (62%), Gaps = 38/632 (6%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL ALR+  S+    IDA++IPS+DAHQSE+ A+C  RRA+ISGFTGSAG A+VT+D AA
Sbjct  6     RLEALRKAMSQSTDKIDAFVIPSEDAHQSEYTAECDNRRAWISGFTGSAGCAIVTQDTAA  65

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             ++TDGRYFLQA ++L  SW LM+ G  GVPT  E+L   L  G RIG+D  L ++  A  
Sbjct  66    MFTDGRYFLQASQELDQSWTLMKQGLPGVPTWKEYLTKNLPSGCRIGVDATLVTAADAVA  125

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L+ +++K +  LV +S  N VD+I ++ RP  P  P+  HD++YAG    +KL  LR ++
Sbjct  126   LENELAKVSSTLVPVSE-NPVDKI-RQDRPARPTNPVVAHDIQYAGKSRETKLDELRHEI  183

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFID--DSKITPEVM  1040
                G    V+S LDEIAWLLNLRGSD+   P+ +AY +V    A L+I   D +++ ++ 
Sbjct  184   RRKGYDGTVVSALDEIAWLLNLRGSDIHCCPIFFAYCVVTNTDAVLYISNADKRLSQDIQ  243

Query  1041  DYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK  1220
               LK   ++LR Y+ I  ++  ++++   + +D S  N +I  A                
Sbjct  244   QQLKGSSIQLRDYDQIFDDLGRVSQQQRYV-IDPSLTNLSIVQA----------------  286

Query  1221  RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLE  1400
                         L G  H     S +++AKA+KN AEL GM+ CH RD AA++  +AWL 
Sbjct  287   ------------LGGLEHVGQEPSTITLAKAIKNDAELAGMRACHKRDGAAVSRHFAWLA  334

Query  1401  EEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             + +C +   ++E + A  L E RS+   ++  SFDT++ +G NGAIIHY+P P   +I++
Sbjct  335   DMLCNQQRKVSEADAAAHLEEMRSQSSKYVGMSFDTVAATGPNGAIIHYQPSPTHSAIID  394

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHF-GEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
               +++L DSGA Y+DGTTDITRT  F GEPS  +K  FTRVLQ HIALDQAVFP  T G+
Sbjct  395   PRQIYLCDSGAHYIDGTTDITRTYLFDGEPSEFQKRAFTRVLQSHIALDQAVFPSGTSGY  454

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPG  1931
              LD  AR+ LW+ GLD+RHGTGHGVGA LNVHEGP GI  R       +  GMVV+NEPG
Sbjct  455   QLDTIARAPLWQDGLDFRHGTGHGVGAYLNVHEGPHGIGARDAYRHIALQEGMVVTNEPG  514

Query  1932  YYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWL  2111
             YY+D  FGIRIEN+L V +  TP +FGG  YLGFE  TFVP+  +L+D  +L+     W+
Sbjct  515   YYQDGEFGIRIENVLIVNKAMTPYKFGGQEYLGFEHATFVPLGRRLLDHQLLTDKCREWI  574

Query  2112  NSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             N YH +  + +   +  D RA EW+   T+ I
Sbjct  575   NKYHQECRKVLEPQLKNDRRALEWVEMETQVI  606



>ref|XP_009657602.1| xaa-Pro aminopeptidase [Verticillium dahliae VdLs.17]
 gb|EGY15439.1| xaa-Pro aminopeptidase [Verticillium dahliae VdLs.17]
Length=612

 Score =   531 bits (1369),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 290/642 (45%), Positives = 394/642 (61%), Gaps = 45/642 (7%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L      +ID Y++PS+D+H SE+IA C  RR +ISGF+GSAG AV+T
Sbjct  4     VDTSGRLSKLRELMKAH--SIDVYVVPSEDSHSSEYIAACDARREFISGFSGSAGCAVIT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              DKAAL TDGRYF QA KQL  +W+L++ G   VPT  +W     + G  + +DP L ++
Sbjct  62    LDKAALATDGRYFNQASKQLDHNWLLLKQGLQDVPTWQDWSAEQSAGGKTVAVDPELITA  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
              AA++L   I K G  ELV L   NLVD +W + RP  P+ P+ + D  ++G +V +KL 
Sbjct  122   AAAKKLASKIQKFGGSELVALER-NLVDIVWGKDRPDRPRNPVVILDTAFSGKNVETKLR  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    S  +V+SMLDEIAWLLNLRGSD+ ++PV ++Y ++ +D A LFIDD+K+ 
Sbjct  181   DLRQELAKKDSLGMVVSMLDEIAWLLNLRGSDIPYNPVFFSYAVITLDTATLFIDDTKLH  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              + ++YL+  G+  + Y                         + I +  K        S 
Sbjct  241   SDSLEYLRKNGIVTKPY-------------------------SCIFDNVKA----LKSSK  271

Query  1209  GIKKRNK------KSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAA  1370
             G++ R K      K++      L G        S +  AKAVKN AEL GM+ CH+RD  
Sbjct  272   GVQGREKRTLLSSKASWALKRALGGDDLVEEVRSFIGDAKAVKNEAELAGMRACHIRDGI  331

Query  1371  ALAHFWAWLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYK  1547
             AL  ++AWLE++ + K   L EVE A+KL + R KQ  ++  SFDTIS +GAN A+IHYK
Sbjct  332   ALIEYFAWLEDQLVAKRTVLDEVEAADKLEQLRQKQANYVGLSFDTISSTGANAAVIHYK  391

Query  1548  PEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQA  1727
             PE  SC  ++   ++L DSGAQY+DGTTD+TRTVHFG P++ EK  +T VL+G+IALD A
Sbjct  392   PERGSCPAIDPEAIYLCDSGAQYLDGTTDVTRTVHFGCPTAAEKLAYTLVLKGNIALDSA  451

Query  1728  VFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR--FGNMTPMV  1901
             +FP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R  F  ++ + 
Sbjct  452   IFPKGTTGFALDCLARQHLWREGLDYRHGTGHGVGSYLNVHEGPIGIGTRVQFAEVS-LA  510

Query  1902  PGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLS  2081
              G VVS EPG+YED +FGIRIENL  VKE+ T + FG   YLGFE +T  P    L+D++
Sbjct  511   SGNVVSIEPGFYEDGAFGIRIENLAIVKEVQTQHSFGDKPYLGFEHVTMAPYCKNLIDIN  570

Query  2082  ILSAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             IL+  E  WLN+++  ++ K       D     WL   T+PI
Sbjct  571   ILTTTEKEWLNAHNTDIFNKTKDAFKDDALTLAWLTRETQPI  612



>ref|XP_002433995.1| aminopeptidase, putative [Ixodes scapularis]
 gb|EEC05395.1| aminopeptidase, putative, partial [Ixodes scapularis]
Length=654

 Score =   531 bits (1369),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 290/637 (46%), Positives = 395/637 (62%), Gaps = 49/637 (8%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RLRAL +  +     I AYI+PS DAHQSE+IA C  RRA+++GFTGSAGTA+VT+D+AA
Sbjct  54    RLRALMKNTTHVSETIQAYIVPSGDAHQSEYIAPCDKRRAFLTGFTGSAGTAIVTEDQAA  113

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWL-NSVLSPGSRIGIDPFLFSSDAAE  683
             LWTDGRYFLQAE+QL S+WILM+ G W     + WL   VLS GSR+G+DPFL   DA +
Sbjct  114   LWTDGRYFLQAEQQLDSNWILMKDG-WSRSKQTTWLWVQVLSSGSRVGVDPFLMPYDAWK  172

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             +L   +    H LV +S  NLVD IW+E RP PP +P+    + Y G     K+  +R D
Sbjct  173   QLCNQLDASGHSLVPVSQ-NLVDLIWEE-RPSPPSRPLDSLSIIYTGKFWQDKIADIRQD  230

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             +    +S +VI+ LDEIAWL NLRGSD+ ++PV +AY ++ +D A LFID++K++  +  
Sbjct  231   MTQKSASVLVITALDEIAWLFNLRGSDIDYNPVFFAYAVITMDSAHLFIDENKLSATLQR  290

Query  1044  YL------KSVGVELRAYesilseieslA-EKGANLWLDKSTVNAAITNAYKTACDRYSR  1202
             +L      KSV V++R Y      +  L  ++   +W+   +  A +           S+
Sbjct  291   HLSADRNEKSVAVDIRPYRVFKDFLSLLINQQSGKIWVSSCSSYAVV-----------SQ  339

Query  1203  SPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
              P  K+R  +STN                 PV + KA+KN  E+E M+  H++DA AL  
Sbjct  340   VP--KERRIESTN-----------------PVMLRKAIKNETEIECMRRAHIKDAVALCE  380

Query  1383  FWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDS  1562
             F+ W+E ++ K   +TE+  A KL  FR  Q  ++  SF+TIS SG N AIIHY+PE DS
Sbjct  381   FFVWMESQVPKG-EVTEITAAAKLEHFRRCQEDYVGPSFETISASGPNAAIIHYRPEEDS  439

Query  1563  CSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPEN  1742
                V   E++L DSG QY DGTTD+TRT HFG PS  EKECFTRV++G+IAL  A+FP  
Sbjct  440   DRRVTTEEVYLCDSGGQYRDGTTDVTRTWHFGMPSQYEKECFTRVVKGNIALSSAIFPRL  499

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSN  1922
               G +LD  AR +LW+VGLDY HGTGHGVGA LNVHEG         N   +  GM++S 
Sbjct  500   VKGQMLDTLARRALWEVGLDYLHGTGHGVGAYLNVHEGDW---MPHPNDPGLQEGMILSI  556

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED+ FGIRIENL+ V++  T   F   G+L F+ LT VPIQ K+++  +L+A EV
Sbjct  557   EPGYYEDNQFGIRIENLVLVRKAATKYNFKDRGFLAFDSLTLVPIQTKMLNPLMLTADEV  616

Query  2103  AWLNSYHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
              WL++YH    + +   ++ + R    +WL   T+P+
Sbjct  617   EWLDTYHQACRDVIGRALEEQGRDLALQWLLRETQPL  653



>ref|XP_007876858.1| hypothetical protein PFL1_01164 [Pseudozyma flocculosa PF-1]
 gb|EPQ30975.1| hypothetical protein PFL1_01164 [Pseudozyma flocculosa PF-1]
Length=612

 Score =   530 bits (1365),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 286/627 (46%), Positives = 392/627 (63%), Gaps = 35/627 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   R+ ALR+L  +   N+ AY++PS+D H SE+ AD  +RR YI+GFTGSAG A+VT
Sbjct  9     VDTAQRVAALRKLMEQE--NVQAYVVPSEDEHASEYPADSDLRRGYITGFTGSAGCAIVT  66

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
               +A L+TDGRYFLQA +QL    W LM+ G   VPT  E+L+  +   SRIG+DP L S
Sbjct  67    LKEALLFTDGRYFLQAGQQLEPGVWTLMKQGEPNVPTWQEYLSKNVPANSRIGMDPSLIS  126

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +D A+++  +++K    LV + + NLVD++W + RP  P +PI V   +YAG   + K+ 
Sbjct  127   ADDAKDISSELAKIGSSLVGIRD-NLVDQVWTD-RPSRPHEPIFVLTDEYAGRGYADKIQ  184

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR ++        V +MLDE AWL NLRG+DV ++PV +++ +V +D   L++DD +++
Sbjct  185   ELRDEISKKNGKGFVANMLDETAWLFNLRGTDVPYNPVFFSFALVLLDRTLLYVDDRQLS  244

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +V  +L S  V LR Y              ++ + D   V A + +  K          
Sbjct  245   DDVRSHLGS-DVTLRPY--------------SSFYDDLRNVGAELKDGEKIII-------  282

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                   K+++      L G        S V   K++KN  EL+G + CH+RD AAL  ++
Sbjct  283   -----GKRASLAVQEALGGPGKVEIARSIVGDQKSIKNDTELDGFRACHIRDGAALCQYF  337

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEE++     +TE E A+ L ++R K   F   SF TIS +G NGAIIHY P+P SC 
Sbjct  338   AWLEEKLQAGEKVTESEGADVLSQYRQKLDHFRGESFTTISSTGPNGAIIHYSPDPASCP  397

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++  E++L DSGAQ+ DGTTD+TRT HFG+P+  +   FTRVLQGHIA+D+AVFP+ T 
Sbjct  398   AIDVDEIYLCDSGAQFTDGTTDVTRTWHFGKPTDAQVRAFTRVLQGHIAIDRAVFPKGTT  457

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNE  1925
             G++LD  AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +   MVVSNE
Sbjct  458   GYLLDVLARRALWEDGLDYRHGTGHGVGHFLNVHEGPQGIGTRTVFNDTSLKENMVVSNE  517

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  +GIRIENL+ V+   TPN FG  GYL FE LT  PIQ KL+D S+L+A E  
Sbjct  518   PGYYEDGKWGIRIENLVIVRPAKTPNNFGEKGYLTFEHLTMCPIQVKLIDASLLNADEKK  577

Query  2106  WLNSYHLQVWEKVSGLVDG--RAREWL  2180
             W+N YH +V +KV+ L+ G  RA +WL
Sbjct  578   WINEYHAEVEQKVAPLLAGDERALKWL  604



>gb|ETS64187.1| hypothetical protein PaG_01425 [Pseudozyma aphidis DSM 70725]
Length=745

 Score =   535 bits (1377),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 295/627 (47%), Positives = 390/627 (62%), Gaps = 35/627 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   R++ALR+L ++    +DAY+IPS D H SE+ A+  +RR YI+GFTGSAG+AVVT
Sbjct  142   VDTTQRVQALRELMAKH--GVDAYVIPSGDEHASEYPAESDLRRGYITGFTGSAGSAVVT  199

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
               KA L+TDGRYFLQA +QL  S W LM+ G   VPT  E+L+  L   S+IG+D  L S
Sbjct  200   TSKALLFTDGRYFLQAGQQLEPSVWTLMKQGEPNVPTWQEYLSKDLPANSKIGMDASLIS  259

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +D A+++  ++SK    LV +   NLVD +W + RP  P +PI V D K AG   S K+ 
Sbjct  260   ADDAKDITAELSKKGSSLVSIRE-NLVDNVWSD-RPTRPGQPIFVLDEKVAGRSSSDKIR  317

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR ++    +   V +MLDE AWL NLRG+DV ++PV +++ +V +D   L+++DS++T
Sbjct  318   ELRDEIKKKSAHGFVANMLDETAWLFNLRGTDVPYNPVFFSFALVLLDKVLLYVNDSQLT  377

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              EV   L S  V LR Y              A  + D  +V A +    K    + S S 
Sbjct  378   DEVKASLSSE-VTLRPY--------------AEFYNDLHSVGAELGEGNKILIGK-SASL  421

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +++            L G        S V   K++KN  EL+G +  H+RD AAL  ++
Sbjct  422   AVQE-----------ALGGAAKVEIVRSIVGDQKSIKNDVELDGFRQSHIRDGAALCQYF  470

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEE++     +TE E A+KL E+R     F   SF TIS +G+NGAIIHY P+P SC 
Sbjct  471   AWLEEQLIAGKKVTESEGADKLSEYRQSLDHFRGESFTTISSTGSNGAIIHYSPDPSSCP  530

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ +E++L DSGAQ+ DGTTD+TRT HFGEP +     FTRVLQGHIA+D+AVFP+ T 
Sbjct  531   AIDVNEIYLCDSGAQFTDGTTDVTRTWHFGEPKAEHIRAFTRVLQGHIAIDRAVFPKGTT  590

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNE  1925
             G++LD  AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +   MVVSNE
Sbjct  591   GYLLDVLARRALWEDGLDYRHGTGHGVGHFLNVHEGPQGIGTRAVFNETSLKENMVVSNE  650

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  +GIRIENL+ V+   TPN FG  GYL FE LT  PIQ  LVD ++L+  +  
Sbjct  651   PGYYEDGKWGIRIENLVIVRPAKTPNNFGSKGYLTFEHLTMCPIQVSLVDPTLLTQDDKN  710

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWL  2180
             WLNSYH +V  KV  L+  D RA  WL
Sbjct  711   WLNSYHDEVQAKVGPLLQNDQRALAWL  737



>gb|EGE04562.1| aminopeptidase P [Trichophyton equinum CBS 127.97]
Length=662

 Score =   530 bits (1366),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 287/644 (45%), Positives = 389/644 (60%), Gaps = 36/644 (6%)
 Frame = +3

Query  303   PRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADC-------YMRRAYISGF  461
             P  +D   RL  LR+L ++    +D YI+PS+D+HQSE+IA C        +  A+IS F
Sbjct  44    PPPVDTTQRLAKLRELMAQN--KVDVYIVPSEDSHQSEYIAPCDGVETLIRITAAFISSF  101

Query  462   TGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSR  641
             TGSAG A+V+  KAAL TDGRYF QA KQL ++W L++ G  GVPT  EW       G  
Sbjct  102   TGSAGCAIVSMSKAALSTDGRYFSQAAKQLDANWTLLKRGVEGVPTWEEWTAEQAENGKV  161

Query  642   IGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYA  821
             +G+DP L ++  A +L + +      LV +   NL+D +W + RP  P   I V  ++ A
Sbjct  162   VGVDPSLITAADARKLSQTLKSTGGSLVGIDQ-NLIDAVWGDERPARPANQITVQPVERA  220

Query  822   GADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAK  1001
             G     K+  LR +L     SA+VIS LDEIAWL NLRGSD+ ++PV ++Y IV    A+
Sbjct  221   GKSFEEKVEDLRKELAAKKRSAMVISTLDEIAWLFNLRGSDIPYNPVFFSYAIVTPSVAE  280

Query  1002  LFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKT  1181
             L++D+SK++PE   +L+   V L+ Y                     S   A+   A   
Sbjct  281   LYVDESKLSPEARKHLEG-KVVLKPY--------------------DSIFQASKVLAESK  319

Query  1182  ACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLR  1361
             A      S      NK S +L    L G+ + +   SP++ AKA+KN  ELEG + CH+R
Sbjct  320   ASASSGSSGKFLLSNKASWSLSL-ALGGEQNVVEVRSPITDAKAIKNEVELEGFRKCHIR  378

Query  1362  DAAALAHFWAWLEEEICKD-VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAII  1538
             D AAL  ++AWLE  + K+   L EV+ A KL E R K   F+  SFDTIS +GANGA I
Sbjct  379   DGAALIEYFAWLENALIKEGAKLDEVDGANKLFEIRKKYDLFVGNSFDTISSTGANGATI  438

Query  1539  HYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIAL  1718
             HYKPE  +C++++   ++L DSG QY+DGTTD TRT+HFGEP+  +K+ +  VL+GHI++
Sbjct  439   HYKPEKSTCAVIDPKAMYLCDSGGQYLDGTTDTTRTLHFGEPTEFQKKAYALVLKGHISI  498

Query  1719  DQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TP  1895
             D A+FP+ T G+ +D+FAR  LWK GLDY HGTGHGVG+ LNVHEGP GI  R      P
Sbjct  499   DNAIFPKGTTGYAIDSFARQHLWKEGLDYLHGTGHGVGSFLNVHEGPMGIGSRAQYAEVP  558

Query  1896  MVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVD  2075
             +    V+SNEPGYYED +FGIR+ENL+  KE+ T ++FG   +LGFE +T VP   KL+D
Sbjct  559   LSASNVLSNEPGYYEDGNFGIRLENLVICKEVQTAHKFGDKPFLGFESITLVPFCQKLLD  618

Query  2076  LSILSAAEVAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
              S+L+ AE  W+N YH +VWEK S     D     WL   T+PI
Sbjct  619   ASLLTEAERKWVNDYHARVWEKTSPFFEKDELTTAWLKRETQPI  662



>gb|EKG15991.1| Creatinase [Macrophomina phaseolina MS6]
Length=600

 Score =   528 bits (1359),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 297/616 (48%), Positives = 398/616 (65%), Gaps = 23/616 (4%)
 Frame = +3

Query  363   DINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAE  542
             D  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTAV+T DKAAL TDGRYF QAE
Sbjct  3     DHQVDVYIVPSEDSHQSEYIAPCDARREFISGFSGSAGTAVITLDKAALATDGRYFNQAE  62

Query  543   KQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHEL  722
             KQL ++W L++ G   VPT  EW       G  +G+DP + ++  A +L E I K     
Sbjct  63    KQLDNNWELLKQGLQDVPTWQEWTADRSEGGKTVGVDPTIITASDARKLAEKIKKKGGAD  122

Query  723   VFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISM  902
             +     NLVD +W  S+P  P + ++V   +++G + S KL  +R DL    S+  V+SM
Sbjct  123   LKSVRENLVDIVWGTSKPARPNEKVQVQPYEFSGKEFSEKLSDIRQDLTKRKSAGFVVSM  182

Query  903   LDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYe  1082
             LDEIAWL NLRG+D+ ++PV ++Y +V  + A L+I+  K+TPEV  +L    V++R YE
Sbjct  183   LDEIAWLYNLRGNDIPYNPVFFSYAVVTPETATLYINADKLTPEVKTHLGD-AVDIRPYE  241

Query  1083  silseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLS  1262
             SI S+IE+L+++           NA      ++   +Y  S      NK S  L    L 
Sbjct  242   SIFSDIEALSQQ-----------NALNGENAESPAQKYLIS------NKASWAL-VQSLG  283

Query  1263  GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE-ICKDVGLTEVE  1439
             G        SP++ AKAVKN  ELEGM+ CH+RD AAL  ++AWLE++ I K   L EVE
Sbjct  284   GDKKVDEVRSPIADAKAVKNKIELEGMRACHVRDGAALIEYFAWLEDQLIAKGAKLDEVE  343

Query  1440  VAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYV  1619
              A+KL   RSK   F+  SFDTIS +G N A+IHYKPE  +CS+++   ++L DSGAQY 
Sbjct  344   AADKLEAIRSKHDKFVGLSFDTISSTGPNAAVIHYKPEKGNCSVIDPKAVYLCDSGAQYR  403

Query  1620  DGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGL  1799
             DGTTD TRT+HFGEP+  EK+ +T VL+G+IAL++A FP+ T GF LD  AR  LW  GL
Sbjct  404   DGTTDTTRTLHFGEPTEMEKKAYTLVLKGNIALERARFPKGTSGFALDTLARQFLWAEGL  463

Query  1800  DYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYEDHSFGIRIENLL  1976
             DYRHGTGHGVG+ LNVHEGP GI  R   +   +  G V+S+EPGYYED +FGIRIEN++
Sbjct  464   DYRHGTGHGVGSFLNVHEGPIGIGTRVQYSEVSLAVGNVISDEPGYYEDGNFGIRIENII  523

Query  1977  YVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLV  2156
              VKE+DTP++FG   YLGFE +T VP+  KL+D ++L+ AE  WLN YH +V EK +   
Sbjct  524   MVKEVDTPHKFGDKPYLGFEHVTLVPMCRKLIDETLLTPAEKTWLNDYHAEVREKTAPYF  583

Query  2157  --DGRAREWLWNNTRP  2198
               D    +WL   T+P
Sbjct  584   TNDAVTLKWLERETQP  599



>ref|XP_005706654.1| X-Pro dipeptidase [Galdieria sulphuraria]
 gb|EME30134.1| X-Pro dipeptidase [Galdieria sulphuraria]
Length=623

 Score =   528 bits (1360),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 288/645 (45%), Positives = 393/645 (61%), Gaps = 47/645 (7%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +  E+++  LR+     D+ +DA+IIPS+DAHQSE++A+C  RR +IS FTGSAG AVVT
Sbjct  9     MKAEEKVVRLRKYLK--DLQLDAFIIPSEDAHQSEYVANCDQRRQFISDFTGSAGFAVVT  66

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVL---SPGS--RIGID  653
             + +A LWTDGRYFLQAEK+L    W LMR       +  +WL       SP +   IG+D
Sbjct  67    QQEALLWTDGRYFLQAEKELDPKVWKLMRMLE--DKSMEDWLVDCFIAESPQTVRSIGMD  124

Query  654   PFLFSSDAAEELK---EDISKGNHELVFL--SNLNLVDEIWKESRPQPPKKPIRVHDLKY  818
                 S  + + L+   +D       LV L     NLVD++W + +P  PK  + +H  +Y
Sbjct  125   GRFISVASFKRLERILQDKCPSCASLVLLPIGEENLVDKVWGKHKPPIPKSLVFLHSEEY  184

Query  819   AGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGA  998
             AG  V SKL  +R  +     + +++S LDE+AWL NLRGSDV ++PV  +Y I+    +
Sbjct  185   AGESVKSKLARVRESMAKNHCNLLIVSALDEVAWLFNLRGSDVEYNPVFLSYAIITETQS  244

Query  999   KLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK  1178
              LF+D S++  E    LK   ++   YE+I   ++  A K   +WLDK+  N A+    +
Sbjct  245   LLFMDSSRLEKEAQQSLKEQNIQTIPYENIFQVLQEKA-KDCIVWLDKNKGNMALYQVCQ  303

Query  1179  TA-CDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCH  1355
              A C +   +P                            P+S  KAVKN  E++G +  H
Sbjct  304   NAPCKKIVENP---------------------------CPISWFKAVKNEKEVQGAKEAH  336

Query  1356  LRDAAALAHFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGA  1532
             +RDA AL  ++AWLE ++  +    TE E A+ L   RSKQ  F+  SF TIS  G+N A
Sbjct  337   VRDAVALITYFAWLEHQVVVEQQKPTECEAADILDSLRSKQSLFVSLSFPTISSVGSNAA  396

Query  1533  IIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHI  1712
             IIHY+P P  C  V+   ++L DSG QY DGTTD+TRT+HFG PS REKEC+TRVL+ HI
Sbjct  397   IIHYRPNPKDCKRVDNEHIYLCDSGGQYRDGTTDVTRTLHFGVPSQREKECYTRVLKSHI  456

Query  1713  ALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNM  1889
              +D A+FP+ T G  LD   R+ LWKVGLDYRHGTGHGVG+ LNVHEGPQ ISFR   + 
Sbjct  457   QMDTAIFPKGTSGLALDCLTRAPLWKVGLDYRHGTGHGVGSFLNVHEGPQSISFRPSASE  516

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
               + P M+V++EPGYYED  FGIRIEN+L VK + TPN+FGG  Y GFE +TFVP++ +L
Sbjct  517   VALEPNMLVTDEPGYYEDGVFGIRIENVLLVKSVKTPNQFGGKPYFGFEHITFVPMENRL  576

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKVS-GLVDGRAREWLWNNTRPI  2201
             +DL++L+  E+AW+N YH + W KVS  L D +A +WL   T P+
Sbjct  577   IDLNLLTDEELAWINRYHEECWNKVSPHLKDEKAFKWLQEKTCPL  621



>ref|XP_011099591.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Sesamum indicum]
Length=645

 Score =   528 bits (1361),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 287/650 (44%), Positives = 399/650 (61%), Gaps = 28/650 (4%)
 Frame = +3

Query  321   EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             E+ L ALR L +     +DA ++PS+D HQSE+++    RRA++SGFTGSAG A+VT ++
Sbjct  3     EETLAALRSLMASHSPKLDALVVPSEDYHQSEYVSARDRRRAFVSGFTGSAGLALVTANE  62

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             A LWTDGRYFLQAE++LS  W LMR G    P    W+   L   + IG+DP+  S D +
Sbjct  63    ALLWTDGRYFLQAEQELSKQWKLMRMGE--DPAVDIWMADNLPTEAAIGVDPWCVSVDTS  120

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +  +   +K   +L+  +  NLVD++W  SRP     P+ VH L++AG  V  KL  LR 
Sbjct  121   QRWERAFAKKQQKLI-QTTTNLVDQVWT-SRPPAEINPVIVHPLEFAGRSVEDKLKDLRE  178

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVM  1040
              L+   + AI+++ LDE+AWL N+RGSDV ++PV +AY IV +  A  ++D  KI+ EV 
Sbjct  179   KLVQEKARAIILTTLDEVAWLYNIRGSDVPYNPVAHAYAIVTLAAAFFYVDKRKISSEVS  238

Query  1041  DYLKSVGVELRAYesilseieslA-EKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              Y++  G+E+R Y  + S+   LA ++ A+    K T  A  T +  +  +R +    I 
Sbjct  239   SYMEKNGIEVRDYGVVSSDTALLASDQLASTNSAKETGKAGTTVSDNSVEERRNDLVWI-  297

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +  +          Q     +SSP+++AKA+KN  ELEG++N H+RD AA+  +  WL
Sbjct  298   --DPGTCCFALYSKLNQDKLFLQSSPLALAKAIKNPVELEGLKNAHIRDGAAVVQYLVWL  355

Query  1398  EE---------------EICKD----VGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSG  1520
             +                E+ KD      LTEV V++KL  FR+ +  F   SF TIS  G
Sbjct  356   DNQMQEIYGAAGYFVDGEVNKDQPRTAKLTEVSVSDKLEGFRASKEHFRGLSFPTISSVG  415

Query  1521  ANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVL  1700
              NGAIIHY PE ++C+ ++ + ++L DSGAQY+DGTTDITRTVHFG+P+S EK C+T VL
Sbjct  416   PNGAIIHYCPEAETCAELDPNSMYLFDSGAQYLDGTTDITRTVHFGKPTSHEKACYTAVL  475

Query  1701  QGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-  1877
             +GHI L  A FP  T G +LD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP  ISFR 
Sbjct  476   KGHIGLGNARFPNGTTGHILDVLARLPLWKYGLDYRHGTGHGIGSYLNVHEGPHQISFRP  535

Query  1878  FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPI  2057
                   + P M V++EPGYYED +FGIR+EN+L VKE  T   FG  GYL FE +T+ P 
Sbjct  536   AARNVALQPSMTVTDEPGYYEDGNFGIRLENVLIVKEGGTKFNFGDRGYLSFEHITWAPY  595

Query  2058  QAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPIDS  2207
             Q KL+D+S+L   E+ WLN+YH +  E ++  ++    EWL   T PI +
Sbjct  596   QKKLMDVSLLVPEEIEWLNNYHSKCREILAPYLNASEMEWLKKATEPISA  645



>ref|XP_680999.1| hypothetical protein AN7730.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61245.1| hypothetical protein AN7730.2 [Aspergillus nidulans FGSC A4]
Length=1742

 Score =   558 bits (1438),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 291/610 (48%), Positives = 389/610 (64%), Gaps = 27/610 (4%)
 Frame = +3

Query  309   GLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVV  488
              +D   RL +LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA++
Sbjct  3     AVDTTKRLSSLRQLMR--EHKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAII  60

Query  489   TKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
             + ++AAL TDGRYF QA KQL ++W L++ G  GVPT  EW+      G  +G+DP L +
Sbjct  61    SLNEAALSTDGRYFNQAAKQLDNNWTLLKRGVEGVPTSQEWITQQAEGGKVVGVDPALIT  120

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               AA  L + + K    L+ +S  NLVD +W   RP PP++ +RVH  KYAG     K+ 
Sbjct  121   GAAARSLSDALQKSGASLIGVSQ-NLVDLVWGNDRPAPPREKVRVHPEKYAGKSFQEKVS  179

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L N  ++  VISMLDEIAWLLNLRGSD+ ++PV  +Y IV     +L+IDD K+T
Sbjct  180   DLRKELENKKAAGFVISMLDEIAWLLNLRGSDIPYNPVFISYCIVTPTKVELYIDDEKLT  239

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
             PEV  +L    V ++ Y+              +++ D      A+  A K   D  S   
Sbjct  240   PEVKAHLGD-DVIIKPYD--------------SIFADAK----ALFEAKKKDPDAPSSKF  280

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +  R   + NL    L G+ H     SP+  AKAVKN  EL GM+ CH+RD AAL  ++
Sbjct  281   LLSNRASWALNL---SLGGEDHVEEIRSPIGDAKAVKNEVELAGMRACHIRDGAALIEYF  337

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE E+  K   L EV+ A+KL + RSKQ  F   SFDTIS +G NGA+IHYKPE  SC
Sbjct  338   AWLENELVNKKSTLDEVDAADKLEQLRSKQELFAGLSFDTISSTGPNGAVIHYKPEKGSC  397

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             S+++ + ++L DSG QY+DGTTD+TRT HFG+P+  EK+ FT VL+G I LD AVFP+ T
Sbjct  398   SVIDPNAIYLCDSGGQYLDGTTDVTRTFHFGQPTELEKKAFTLVLKGCIGLDSAVFPKGT  457

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSN  1922
              GF LD  AR  LWK GLD+ HGTGHG+G+ LNVHEGP GI  R      P+ PG V+S+
Sbjct  458   SGFALDVLARQHLWKEGLDFLHGTGHGIGSYLNVHEGPVGIGTRVQYTEVPLAPGNVISD  517

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPG+YED  FGIRIEN++ V+E+ T ++FG   +LGFE +T  PI   L++ S+LS +E+
Sbjct  518   EPGFYEDGKFGIRIENVIMVREVQTTHKFGERPWLGFEHVTMCPIGQNLIEPSLLSDSEI  577

Query  2103  AWLNSYHLQV  2132
              WLN YH + 
Sbjct  578   KWLNDYHAEC  587



>dbj|GAC74223.1| xaa-pro aminopeptidase [Pseudozyma antarctica T-34]
Length=711

 Score =   531 bits (1367),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 294/627 (47%), Positives = 388/627 (62%), Gaps = 35/627 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   R++ALR+L ++    +DAY+IPS D H SE+ A+  +RR YI+GFTGSAG+AVVT
Sbjct  108   VDTTQRVQALRELMAKH--GVDAYVIPSGDEHASEYPAESDLRRGYITGFTGSAGSAVVT  165

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
               KA L+TDGRYFLQA +QL  S W LM+ G   VPT  E+L+  L   S+IG+D  L S
Sbjct  166   TSKALLFTDGRYFLQAGQQLEPSVWTLMKQGEPNVPTWQEYLSKDLPANSKIGMDASLIS  225

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +D A+++  ++SK    LV +   NLVD +W + RP  P +PI V D K AG   S K+ 
Sbjct  226   ADDAKDITAELSKKGSSLVSIRE-NLVDNVWSD-RPTRPGQPIFVLDEKVAGRSSSDKIR  283

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR ++    +   V +MLDE AWL NLRG+DV ++PV +++ +V +D   L+++DS++T
Sbjct  284   ELRDEIKKKSAHGFVANMLDETAWLFNLRGTDVPYNPVFFSFALVLLDKVLLYVNDSQLT  343

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              EV   L S  V LR Y              A  + D  +V A +    K    + S S 
Sbjct  344   DEVKASLSSE-VTLRPY--------------AEFYNDLHSVGAELGEGNKILIGK-SASL  387

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +++            L G        S V   K++KN  EL+G +  H+RD AAL  ++
Sbjct  388   AVQE-----------ALGGAAKVEIVRSIVGDQKSIKNDVELDGFRQSHIRDGAALCQYF  436

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEE++     +TE E A+KL E+R     F   SF TIS +G NGAIIHY P+P SC 
Sbjct  437   AWLEEQLIAGKKVTESEGADKLSEYRQLLDHFRGESFTTISSTGPNGAIIHYSPDPSSCP  496

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ +E++L DSGAQ+ DGTTD+TRT HFGEP +     FTRVLQGHIA+D+AVFP+ T 
Sbjct  497   AIDVNEIYLCDSGAQFTDGTTDVTRTWHFGEPKAEHIRAFTRVLQGHIAIDRAVFPKGTT  556

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNE  1925
             G++LD  AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +   MVVSNE
Sbjct  557   GYLLDVLARRALWEDGLDYRHGTGHGVGHFLNVHEGPQGIGTRAVFNETSLKENMVVSNE  616

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  +GIRIENL+ V+   TPN FG  GY  FE LT  PIQ  LVD ++L+  +  
Sbjct  617   PGYYEDGKWGIRIENLVIVRPAKTPNNFGSKGYFTFEHLTMCPIQVSLVDPTLLTQDDKN  676

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWL  2180
             WLNSYH +V  KV  L+  D RA  WL
Sbjct  677   WLNSYHDEVQAKVGPLLQNDQRALAWL  703



>gb|KGB77178.1| cytoplasm protein [Cryptococcus gattii R265]
Length=646

 Score =   528 bits (1361),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 288/645 (45%), Positives = 391/645 (61%), Gaps = 25/645 (4%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +L  +RQL    +  +DAY++PS+DAH SE++A C  RRAYI+GFTGSAG AV+T DKA 
Sbjct  7     KLSGVRQLMK--EQGVDAYVVPSEDAHASEYLAPCDARRAYITGFTGSAGCAVITHDKAL  64

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
              WTDGRY+LQAEKQL   W LM+SG   VPT ++WL++ +SP S IGIDP +     A  
Sbjct  65    CWTDGRYWLQAEKQLGEGWALMKSGLPEVPTWAQWLSTEVSPNSLIGIDPTVIPYSEALS  124

Query  687   LKEDISKGNHELV-----FLSNLNLVDEIW-KESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             L   +   +          +   NL+D +W   SRP  P +PI     KY G  VSSKL 
Sbjct  125   LHSSLPLSSPTPGSSSSRLIPTPNLIDSLWVPPSRPLRPSQPIFQLADKYTGEPVSSKLR  184

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR  L+  GS  +V++ LDEIAW+ NLRG+D+ ++PV +AY I+  D   LF+  S +T
Sbjct  185   RLRDKLVKIGSPGMVVASLDEIAWVFNLRGADIPYNPVFFAYTIITPDDCTLFVSPSSLT  244

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              EV  YL+S GV +  Y  + + +E+  E+   L LD+   +    +  K A        
Sbjct  245   TEVRSYLRSNGVAVLDYSQVWTSLEAWKER---LKLDQEIKSKEQRDGVKRARLEEEAKK  301

Query  1209  GIKKRNKKSTN--LDTNGLS-------GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLR  1361
               +    K TN  L  N  S       G+ +   R S +   KA KN+ E+EG + CH+R
Sbjct  302   EEEGEKLKKTNKVLIGNKTSWAVAKAVGEDNVEVRRSLIEEMKAKKNATEIEGFRQCHIR  361

Query  1362  DAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIH  1541
             D AAL  + AWLEE +      TE + A KL +FR +   F+  SF+TIS +GAN A+IH
Sbjct  362   DGAALVRYLAWLEEALENGESWTEYDAATKLEDFRKENKLFMGLSFETISSTGANAAVIH  421

Query  1542  YKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALD  1721
             Y P      ++ + +++L DSGAQY+DGTTD+TRT+HFG P+  +K  FTRVLQGHI+LD
Sbjct  422   YSPPEKGSKVIEKKQMYLCDSGAQYLDGTTDVTRTLHFGTPNEDQKRAFTRVLQGHISLD  481

Query  1722  QAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPM  1898
               VFP+ T G++LD  AR +LW  GLDYRH T HG+G+ LNVHEGPQG+  R   N   +
Sbjct  482   TIVFPQGTTGYILDVLARRALWSDGLDYRHSTSHGIGSFLNVHEGPQGVGQRPAYNEVAL  541

Query  1899  VPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDL  2078
               GMV+SNEPGYY+D  +GIRIE +  ++  +T   FGG G+LG E++T  PIQ KLVD 
Sbjct  542   QEGMVISNEPGYYKDGEWGIRIEGVDVIERRETRENFGGKGWLGLERITMCPIQTKLVDP  601

Query  2079  SILSAAEVAWLNSYHLQVWEKVSGLV----DGRAREWLWNNTRPI  2201
             S+L   E  WLN YH +V  K++ ++    D RA +WL    RP+
Sbjct  602   SLLGVEEKDWLNEYHAEVLAKLTPVLKEMGDERAGKWLERECRPL  646



>ref|XP_003196663.1| cytoplasm protein [Cryptococcus gattii WM276]
 gb|ADV24876.1| Cytoplasm protein, putative [Cryptococcus gattii WM276]
Length=646

 Score =   528 bits (1359),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 287/645 (44%), Positives = 392/645 (61%), Gaps = 25/645 (4%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             +L  +RQL    +  +DAY++PS+DAH SE++A C  RRAYI+GFTGSAG AV+T DKA 
Sbjct  7     KLSGVRQLMK--EQGVDAYVVPSEDAHASEYLAPCDARRAYITGFTGSAGCAVITHDKAL  64

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
              WTDGRY+LQAEKQL   W LM+SG   VPT ++WL++ +SP S IGIDP +     A  
Sbjct  65    CWTDGRYWLQAEKQLGEGWALMKSGLPEVPTWAQWLSTEVSPNSLIGIDPTVIPYSEALS  124

Query  687   LKEDISKGNHELV-----FLSNLNLVDEIW-KESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             L   +   +          ++  NL+D +W   SRP  P + I     KY G  VSSKL 
Sbjct  125   LHSSLPLSSPTPGSSSSRLIATPNLIDSLWVPPSRPLRPSQSIFQLADKYTGEPVSSKLR  184

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR  L+  GS  +V++ LDEIAW+ NLRG+D+ ++PV +AY I+  D   LF+  S +T
Sbjct  185   RLRDKLVKIGSPGMVVASLDEIAWVFNLRGADIPYNPVFFAYTIITPDDCTLFVSPSSLT  244

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              EV  YL++ GV +  Y  + + +E+  E+   L +D+ T +    +  K A        
Sbjct  245   TEVRSYLRTNGVAVLDYSQVWTSLEAWKER---LKVDQETKSKEQRDGVKRARLEEEARK  301

Query  1209  GIKKRNKKSTN--LDTNGLS-------GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLR  1361
               +    K TN  L  N  S       G+ +   R S +   KA KN+ E+EG + CH+R
Sbjct  302   EEEGEKLKKTNKVLIGNKTSWAVAKAVGEDNVEVRRSLIEEMKAKKNATEIEGFRQCHIR  361

Query  1362  DAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIH  1541
             D AAL  + AWLEE +      TE + A KL EFR +   F+  SF+TIS +GAN A+IH
Sbjct  362   DGAALVRYLAWLEEALENGESWTEYDAATKLEEFRKENKLFMGLSFETISSTGANAAVIH  421

Query  1542  YKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALD  1721
             Y P      ++ + +++L DSGAQY+DGTTD+TRT+HFG P+  +K  FTRVLQGHI+LD
Sbjct  422   YSPPEKGSKVIEKKQMYLCDSGAQYLDGTTDVTRTIHFGTPTEDQKRAFTRVLQGHISLD  481

Query  1722  QAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPM  1898
               VFP+ T G++LD  AR +LW  GLDYRH T HG+G+ LNVHEGPQG+  R   N   +
Sbjct  482   TIVFPQGTTGYILDVLARRALWSDGLDYRHSTSHGIGSFLNVHEGPQGVGQRPAYNEVAL  541

Query  1899  VPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDL  2078
               GMV+SNEPGYY+D  +GIRIE +  ++  +T   FGG G+LG E++T  PIQ KLVD 
Sbjct  542   QEGMVISNEPGYYKDGEWGIRIEGVDVIERRETRENFGGKGWLGLERITMCPIQTKLVDP  601

Query  2079  SILSAAEVAWLNSYHLQVWEKVSGLV----DGRAREWLWNNTRPI  2201
              +LS  E  WLN YH +V  K++ ++    D RA +WL    RP+
Sbjct  602   LLLSVKEKDWLNEYHAEVLAKLAPMLKDMGDERAGKWLERECRPL  646



>emb|CCX09767.1| Similar to Probable Xaa-Pro aminopeptidase P; acc. no. D5GAC6 
[Pyronema omphalodes CBS 100304]
Length=709

 Score =   529 bits (1363),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 286/646 (44%), Positives = 391/646 (61%), Gaps = 33/646 (5%)
 Frame = +3

Query  288   EFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTG  467
             E Q++   ++  DRL ALR   SR   N+D Y++PS+D+H SE+I     RRAY+SGFTG
Sbjct  85    ETQQEIMTVNTTDRLVALRAAMSRE--NVDIYVVPSEDSHNSEYICAADARRAYLSGFTG  142

Query  468   SAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIG  647
             SAG AVVTKDKA L TDGRYF QA KQL S+W L++ G   V T  EW       G  +G
Sbjct  143   SAGCAVVTKDKAILSTDGRYFNQATKQLDSNWELLKQGMPDVLTWQEWTCKQSEGGKTVG  202

Query  648   IDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGA  827
             +D  L ++  A+  +  I K     +     NL+DEIW + RP  P  P+ V   ++AG 
Sbjct  203   VDATLITAQQAKSFEARIKKAGGAGLKGLEKNLIDEIWTD-RPARPNNPVIVLGNEFAGQ  261

Query  828   DVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLF  1007
                 KL ++R +L    S   V+SMLDEIAWL NLRGSD+ ++PV +AY +V    A L+
Sbjct  262   PFQEKLEAVRKELEKKKSPGFVVSMLDEIAWLYNLRGSDIPYNPVFFAYALVTPTTATLY  321

Query  1008  IDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTAC  1187
             ID +K+  + + +L    V +  Y               +++    T++A +    + A 
Sbjct  322   IDSAKLPSDALAHLGD-AVTIAPY--------------TSIFSHLRTLSAEVKATAEAA-  365

Query  1188  DRYSRSPGIKK---RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHL  1358
                  +  +KK    NK S  L +  L G+       SP+  +KAVKN  E EGM+ CH+
Sbjct  366   -----NEPVKKWLISNKTSWQL-SQSLGGEDAIEVVRSPIEESKAVKNETEREGMRKCHI  419

Query  1359  RDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAII  1538
             RD AAL  ++AWLE+ +     + E + A+KL E RS    F   SFDTIS +G N A+I
Sbjct  420   RDGAALIKYFAWLEKTLLAGEKIDECQAADKLEELRSVGENFKGLSFDTISSTGPNAAVI  479

Query  1539  HYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIAL  1718
             HYKPEP +CS+++ + ++L DSGAQY+DGTTD TRT+HFGEP+  E++ +T VL+G +AL
Sbjct  480   HYKPEPGACSVIDPNAIYLCDSGAQYLDGTTDTTRTLHFGEPTEMERKSYTLVLKGMVAL  539

Query  1719  DQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTP  1895
             D+ VFP+ T GF LD  AR  LW+ GLDYRHGTGHGVG+ LNVHEGP GI  R   +  P
Sbjct  540   DRVVFPKGTSGFALDVLARQFLWREGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYSEVP  599

Query  1896  MVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVD  2075
             + PGMV+S+EPGYYED +FGIRIEN++ V+ + T + FGG  + GFE +T VP+  KL +
Sbjct  600   LAPGMVISDEPGYYEDGNFGIRIENVIMVRTVKTTHEFGGKPWYGFEHVTMVPMCKKLTN  659

Query  2076  LSILSAAEVAWLNSYHLQVWEKVSGLVDGR----AREWLWNNTRPI  2201
             L +L+  E  WLN YH +V E   G ++G      REWL     P+
Sbjct  660   LELLTKEEKIWLNDYHKEVLENTKGFLEGEENRYVREWLERECEPV  705



>dbj|BAD45377.1| putative Xaa-Pro aminopeptidase 2 [Oryza sativa Japonica Group]
 gb|EEE66177.1| hypothetical protein OsJ_22272 [Oryza sativa Japonica Group]
Length=648

 Score =   527 bits (1357),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 284/656 (43%), Positives = 402/656 (61%), Gaps = 51/656 (8%)
 Frame = +3

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             L  LR L +    ++ A ++PS+DAHQSE++++   RR ++SGFTGSAG A++T  +A L
Sbjct  14    LDELRALMAAHSPSLHALVVPSEDAHQSEYVSERDKRRQFVSGFTGSAGLALITMKEALL  73

Query  510   WTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEEL  689
             WTDGRYFLQAE+QL++ W LMR G    P    W+   LS  + IGI+P+  S D A+  
Sbjct  74    WTDGRYFLQAEQQLTNRWKLMRMGE--DPPVEVWIADNLSDEAVIGINPWCISVDTAQRY  131

Query  690   KEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLI  869
             +   SK  H+ +F  + +LVDEIWK+ RP     P+ V  ++YAG  V+ KL  LR  L 
Sbjct  132   EHAFSK-KHQTLFQLSSDLVDEIWKD-RPPVNALPVFVQPVEYAGCSVTEKLKELREKLQ  189

Query  870   NAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYL  1049
             +  +  I+I+ LDE+AWL N+RG+DV +SPV+++Y IV +  A  ++D  K++ EV +Y+
Sbjct  190   HEKARGIIIAALDEVAWLYNIRGNDVHYSPVVHSYSIVTLHSAFFYVDKRKVSVEVQNYM  249

Query  1050  KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNK  1229
                G++++ Y  + S+   LA       L  S VN +              S G    N+
Sbjct  250   TENGIDIKDYNMVQSDASLLASGQ----LKGSAVNGS--------------SHGENDMNE  291

Query  1230  KSTN-LDTNGLS-------GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
              S   +D+N           Q   L   SP+++ KAVKN  EL+G++  H+RD AA+  +
Sbjct  292   NSKVWIDSNSCCLALYSKLDQYQVLMLQSPIALPKAVKNPVELDGLRKAHIRDGAAVVQY  351

Query  1386  WAWLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFDT  1505
              AWL++++ ++ G                    LTEV V++KL  FR+ +  F   SF T
Sbjct  352   LAWLDKQMQENYGASGYFTEAKGSQKKEHMNVKLTEVSVSDKLEGFRASKEHFKGLSFPT  411

Query  1506  ISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKEC  1685
             IS  G N A+IHYKPE  SC+ ++  +++L DSGAQY+DGTTDITRTVHFG+PS  EK C
Sbjct  412   ISSVGPNAAVIHYKPEASSCAELDADKIYLCDSGAQYLDGTTDITRTVHFGKPSEHEKSC  471

Query  1686  FTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQG  1865
             +T VL+GHIALD AVFP  T G  +D  AR+ LW+ GLDYRHGTGHG+G+ LNVHEGP  
Sbjct  472   YTAVLKGHIALDTAVFPNGTTGHAIDILARTPLWRSGLDYRHGTGHGIGSYLNVHEGPHL  531

Query  1866  ISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKL  2042
             ISFR      P+   M V++EPGYYED SFGIR+EN+L VKE +T   FG  GYL FE +
Sbjct  532   ISFRPSARNVPLQASMTVTDEPGYYEDGSFGIRLENVLIVKEANTKFNFGDKGYLAFEHI  591

Query  2043  TFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPIDSS  2210
             T+ P Q KL+D ++L+ AE+ W+N+YH    + +   ++ + +EWL   T PI +S
Sbjct  592   TWTPYQTKLIDTTLLTPAEIEWVNAYHSDCRKILQPYLNEQEKEWLRKATEPIAAS  647



>ref|XP_001512739.2| PREDICTED: xaa-Pro aminopeptidase 1 [Ornithorhynchus anatinus]
Length=623

 Score =   525 bits (1353),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 282/632 (45%), Positives = 384/632 (61%), Gaps = 30/632 (5%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYI+PS DAHQSE+IA C  RRA++SGF GSAGTA++T+  
Sbjct  10    LRQLRQAMKNTEYVSEAIQAYIVPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEQH  69

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL SVL  GS++G+DP +  +D  
Sbjct  70    AAMWTDGRYFLQAAKQMDNNWTLMKLGLKDTPTQEDWLVSVLPEGSKVGVDPLIIPADQW  129

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++   +    H L+ + + NL+D+IW  +RP  P KP+    L Y G     K+  LR 
Sbjct  130   KKMSRVLRSAGHYLIPVED-NLIDKIWV-NRPVRPCKPLLPLGLNYTGVAWKDKIAELRV  187

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV ++Y ++  D  +LFID  ++  P+V
Sbjct  188   KMAERKVLWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAVIGADTIRLFIDGDRVKAPDV  247

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIK  1217
              ++L             L +    AE    +   KS     I    KT C        + 
Sbjct  248   REHL-------------LLDSALTAEFQIQVLPYKS-----ILTELKTICANLGPKEKVW  289

Query  1218  KRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWL  1397
               +K S  L T  +          +P+ +AKAVKN+ E EGM+  H++DA AL   + WL
Sbjct  290   VSDKASYGL-TEAIPKAHRYFVPYTPICIAKAVKNATESEGMRRAHIKDAVALCELFNWL  348

Query  1398  EEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVN  1577
             E E+ K   +TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   ++
Sbjct  349   ENEVPKG-KVTEISAADKAEEFRRQQDDFVDLSFPTISSTGPNGAIIHYTPVPETNRTLS  407

Query  1578  RHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFV  1757
              +E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G +
Sbjct  408   VNEVYLIDSGAQYKDGTTDVTRTMHFGTPTTYEKECFTYVLKGHIAVSAAIFPNGTKGHL  467

Query  1758  LDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGYY  1937
             LD+FARS+LW  GLDY HGTGHGVGA LNVHEGP GIS++  +  P+  GM+V++EPGYY
Sbjct  468   LDSFARSALWDSGLDYLHGTGHGVGAFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYY  527

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED SFGIRIEN++ V    T   F   G L FE LT VP+Q K++D+  L+  E  W+N 
Sbjct  528   EDGSFGIRIENVVLVVPTKTKYNFNSRGSLTFEPLTLVPMQTKMIDVDSLTQKECDWVND  587

Query  2118  YHLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             YH    E +   +  + R    +WL   T PI
Sbjct  588   YHKTCREVIGKELQKQGRQEALQWLIRETSPI  619



>gb|EEC68306.1| hypothetical protein OsI_36387 [Oryza sativa Indica Group]
Length=645

 Score =   526 bits (1354),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 284/654 (43%), Positives = 397/654 (61%), Gaps = 54/654 (8%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
              LRAL    S P   + A ++PS+DAHQSE++++   RR ++SGFTGSAG A++T  +A 
Sbjct  12    ELRALMAAHSPP---LHALVVPSEDAHQSEYVSERDKRRQFVSGFTGSAGLALITMKEAL  68

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             LWTDGRYFLQAE+QLS  W LMR G    P    W+   LS  + +GI+P+  S D A+ 
Sbjct  69    LWTDGRYFLQAEQQLSDRWKLMRMGE--DPPVEVWIADNLSDEAVVGINPWCISVDTAQR  126

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
              +   SK  H+ +F  + +L+DEIWK+ RP     P+ V  ++YAG  V+ KL  LR  L
Sbjct  127   YEHAFSK-KHQTLFQLSSDLIDEIWKD-RPSAEALPVFVQPVEYAGRTVTEKLKELREKL  184

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
             ++  +  I+I+ LDE+AWL N+RG DV +SPV+++Y IV +  A  ++D  K++ EV +Y
Sbjct  185   LHEKARGIIIAALDEVAWLYNIRGDDVHYSPVVHSYSIVTLHSAFFYVDKRKVSVEVQNY  244

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             +   G++++ Y  + S+   LA       L  S VN +              S G    N
Sbjct  245   MTDNGIDIKDYNMVQSDASLLASGQ----LKGSAVNGS--------------SYGENDMN  286

Query  1227  KKSTN-LDTNGLS-------GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             + S   +D+N           Q   L   SP+++ KAVKN  EL+G++  H+RD AA+  
Sbjct  287   ENSKVWIDSNSCCLALYSKLDQDQVLMLQSPIALPKAVKNPVELDGLRKAHIRDGAAVVQ  346

Query  1383  FWAWLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFD  1502
             + AWL+ ++ ++ G                    LTEV V++KL  FR+ +  F   SF 
Sbjct  347   YLAWLDNQMQENYGASGYFSEAKGSQKKQHMEVKLTEVSVSDKLEGFRASKEHFKGLSFP  406

Query  1503  TISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKE  1682
             TIS  G N A+IHY PE  SC+ ++  +++L DSGAQY+DGTTDITRTVHFG+PS  EK 
Sbjct  407   TISSVGPNAAVIHYSPEASSCAELDADKIYLCDSGAQYLDGTTDITRTVHFGKPSEHEKS  466

Query  1683  CFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQ  1862
             C+T VL+GHIALD AVFP  T G  LD  AR+ LW+ GLDYRHGTGHG+G+ LNVHEGP 
Sbjct  467   CYTAVLKGHIALDSAVFPNGTTGHALDILARTPLWRSGLDYRHGTGHGIGSYLNVHEGPH  526

Query  1863  GISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEK  2039
              ISFR      P+   M V++EPGYYED SFGIR+EN+L VKE +T   FG  GYL FE 
Sbjct  527   LISFRPSARNVPLQASMTVTDEPGYYEDGSFGIRLENVLIVKEANTKYNFGDKGYLAFEH  586

Query  2040  LTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +T+ P Q KL+D ++L+ AE+ W+N+YH    + +   ++ + +EWL   T PI
Sbjct  587   ITWAPYQTKLIDTTLLTPAEIEWVNAYHADCRKILQPYLNEQEKEWLRKATEPI  640



>ref|XP_010029831.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X2 [Eucalyptus 
grandis]
 gb|KCW56800.1| hypothetical protein EUGRSUZ_I02468 [Eucalyptus grandis]
Length=658

 Score =   526 bits (1356),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 290/670 (43%), Positives = 394/670 (59%), Gaps = 60/670 (9%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D L ALR L S     +DA ++PS+D HQSE+++    RR ++SGFTGSAG A++T +KA
Sbjct  3     DTLAALRSLMSSHSPPLDALVVPSEDYHQSEYVSSRDKRREFVSGFTGSAGLALITINKA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQA +QLS  W LMR G    P    W+   L   + IG DP+  S D A+
Sbjct  63    LLWTDGRYFLQAAQQLSDQWKLMRIGE--DPAVDVWMADNLPNNAAIGTDPWCVSIDTAQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
               +   +K   +LV  S  NL+DE+WK +RP     P  VH L++AG  V+ KL  LR  
Sbjct  121   RWERAFAKKQQKLVQTST-NLIDEVWK-NRPPLEINPANVHALEFAGRSVTDKLNDLRER  178

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    +  I+I+ LDE+AWL N+RGSDV + PV++A+ IV    A  ++D  K++ EV  
Sbjct  179   LTQEKARGIIITTLDEVAWLYNIRGSDVSYCPVVHAFAIVTPTSAFFYVDQRKLSSEVSG  238

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             YLK  G+E+R Y ++ +++ SLA             N     A+K A    S    I  R
Sbjct  239   YLKENGIEVREYSAVSADVSSLAS------------NQLGPCAFKEAQSEVSGRTDIGSR  286

Query  1224  NKKSTNLDTNGLSGQP------------HALY----------RSSPVSMAKAVKNSAELE  1337
                + ++ T    G              +ALY          + SP+++AKA+KN  EL+
Sbjct  287   EDAAESIKTEAEDGDTIDLIWADPGSCCYALYSKLDSNRVLLKQSPLALAKALKNPIELD  346

Query  1338  GMQNCHLRDAAALAHFWAWLEEEICKDVG---------------------LTEVEVAEKL  1454
             G++  H+RD AA+  +  WL++++ ++ G                     LTEV V++KL
Sbjct  347   GLRKAHIRDGAAVVQYLVWLDKQMQENYGASGFFVEGETLAQKKQLKGNKLTEVTVSDKL  406

Query  1455  LEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTD  1634
               FR+ +  F   SF TIS  G N AIIHY P+PD+C+ ++   ++L DSGAQY+DGTTD
Sbjct  407   ESFRASKEHFKGLSFPTISSVGPNAAIIHYSPQPDTCAELDADCIYLFDSGAQYLDGTTD  466

Query  1635  ITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHG  1814
             ITRTVHFG PS+ EK C+T VL+GHIAL  A FP  T G+ LD  AR  LWK GLDYRHG
Sbjct  467   ITRTVHFGRPSAHEKACYTAVLKGHIALGNARFPNGTNGYALDILARVPLWKDGLDYRHG  526

Query  1815  TGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEM  1991
             TGHG+G+ LNVHEGP  ISFR      PM   M V++EPGYYED SFGIR+EN+L V E 
Sbjct  527   TGHGIGSYLNVHEGPHLISFRPHARNVPMQASMTVTDEPGYYEDGSFGIRLENVLVVNEA  586

Query  1992  DTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAR  2171
             DT   FG  GYL FE +T+ P Q KL++LS+L+  E+ WLN+YH +  + ++  +D    
Sbjct  587   DTKFNFGDKGYLSFEHITWAPYQTKLINLSLLTPEEIDWLNTYHSKCRDILAPYLDDAEM  646

Query  2172  EWLWNNTRPI  2201
              WL   T P+
Sbjct  647   AWLKKATEPV  656



>ref|XP_010029830.1| PREDICTED: probable Xaa-Pro aminopeptidase P isoform X1 [Eucalyptus 
grandis]
 gb|KCW56799.1| hypothetical protein EUGRSUZ_I02468 [Eucalyptus grandis]
Length=659

 Score =   526 bits (1354),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 290/671 (43%), Positives = 394/671 (59%), Gaps = 61/671 (9%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D L ALR L S     +DA ++PS+D HQSE+++    RR ++SGFTGSAG A++T +KA
Sbjct  3     DTLAALRSLMSSHSPPLDALVVPSEDYHQSEYVSSRDKRREFVSGFTGSAGLALITINKA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQA +QLS  W LMR G    P    W+   L   + IG DP+  S D A+
Sbjct  63    LLWTDGRYFLQAAQQLSDQWKLMRIGE--DPAVDVWMADNLPNNAAIGTDPWCVSIDTAQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
               +   +K   +LV  S  NL+DE+WK +RP     P  VH L++AG  V+ KL  LR  
Sbjct  121   RWERAFAKKQQKLVQTST-NLIDEVWK-NRPPLEINPANVHALEFAGRSVTDKLNDLRER  178

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    +  I+I+ LDE+AWL N+RGSDV + PV++A+ IV    A  ++D  K++ EV  
Sbjct  179   LTQEKARGIIITTLDEVAWLYNIRGSDVSYCPVVHAFAIVTPTSAFFYVDQRKLSSEVSG  238

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             YLK  G+E+R Y ++ +++ SLA             N     A+K A    S    I  R
Sbjct  239   YLKENGIEVREYSAVSADVSSLAS------------NQLGPCAFKEAQSEVSGRTDIGSR  286

Query  1224  NKKSTNLDTNGLSGQP------------HALY----------RSSPVSMAKAVKNSAELE  1337
                + ++ T    G              +ALY          + SP+++AKA+KN  EL+
Sbjct  287   EDAAESIKTEAEDGDTIDLIWADPGSCCYALYSKLDSNRVLLKQSPLALAKALKNPIELD  346

Query  1338  GMQNCHLRDAAALAHFWAWLEEEICKDVG----------------------LTEVEVAEK  1451
             G++  H+RD AA+  +  WL++++ ++ G                      LTEV V++K
Sbjct  347   GLRKAHIRDGAAVVQYLVWLDKQMQENYGASGFFVEGETLAQKKQFRKGNKLTEVTVSDK  406

Query  1452  LLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTT  1631
             L  FR+ +  F   SF TIS  G N AIIHY P+PD+C+ ++   ++L DSGAQY+DGTT
Sbjct  407   LESFRASKEHFKGLSFPTISSVGPNAAIIHYSPQPDTCAELDADCIYLFDSGAQYLDGTT  466

Query  1632  DITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRH  1811
             DITRTVHFG PS+ EK C+T VL+GHIAL  A FP  T G+ LD  AR  LWK GLDYRH
Sbjct  467   DITRTVHFGRPSAHEKACYTAVLKGHIALGNARFPNGTNGYALDILARVPLWKDGLDYRH  526

Query  1812  GTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKE  1988
             GTGHG+G+ LNVHEGP  ISFR      PM   M V++EPGYYED SFGIR+EN+L V E
Sbjct  527   GTGHGIGSYLNVHEGPHLISFRPHARNVPMQASMTVTDEPGYYEDGSFGIRLENVLVVNE  586

Query  1989  MDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRA  2168
              DT   FG  GYL FE +T+ P Q KL++LS+L+  E+ WLN+YH +  + ++  +D   
Sbjct  587   ADTKFNFGDKGYLSFEHITWAPYQTKLINLSLLTPEEIDWLNTYHSKCRDILAPYLDDAE  646

Query  2169  REWLWNNTRPI  2201
               WL   T P+
Sbjct  647   MAWLKKATEPV  657



>ref|XP_003577500.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Brachypodium distachyon]
Length=648

 Score =   525 bits (1352),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 288/656 (44%), Positives = 400/656 (61%), Gaps = 48/656 (7%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D LRAL    S P   I A I+PS+DAHQSE++++   RR +ISGFTGSAG A++T  +A
Sbjct  13    DELRALMAAHSPP---IHALIVPSEDAHQSEYVSERDKRRQFISGFTGSAGLALITTKEA  69

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQA +QLS SW LMR G    P    W+   LS  + IGIDP+  S DAA+
Sbjct  70    LLWTDGRYFLQASQQLSDSWKLMRMGE--DPPVEVWIADNLSDEAVIGIDPWCISVDAAQ  127

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
               ++   K  H+ +F  + +LVDEIWK+ RP     P+ VH +++AG  V+ K+  LR  
Sbjct  128   RYEQSFLK-KHQTLFQLSSDLVDEIWKD-RPPNDALPVVVHPVEFAGRSVAEKIKELREK  185

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L +  ++ I+I+ LDE+AWL N+RG+DV  SPV++++ IV +  A  ++D  K+T EV +
Sbjct  186   LEHEKANGIIITALDEVAWLYNVRGADVHFSPVVHSFAIVTLHNAFFYVDKRKVTAEVQN  245

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSR------S  1205
             Y+   G+++R Y ++  ++  LA       L  S VN ++          +S+      S
Sbjct  246   YMAENGIDIREYHTVQPDVSLLASGH----LKGSAVNGSLQVENDINKVEHSKIWIDSNS  301

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
               +   +K STN            L   SP+++ KAVKN  EL+G++  H+RD AA+  +
Sbjct  302   CCLALYSKLSTN----------QVLMLQSPIALPKAVKNPMELDGLRKAHIRDGAAVVQY  351

Query  1386  WAWLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFDT  1505
              AWL+ ++ ++ G                    LTEV V++KL  FR+ +  F   SF T
Sbjct  352   LAWLDNQMQENYGAPGYFSEANGSQRKEHLEIKLTEVSVSDKLEGFRATKELFKGLSFPT  411

Query  1506  ISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKEC  1685
             IS  G N AIIHY PE ++C+ ++  +++L DSGAQY+DGTTDITRTVHFG PS  EK C
Sbjct  412   ISSVGPNAAIIHYSPEANTCAELDADKIYLCDSGAQYLDGTTDITRTVHFGRPSEHEKSC  471

Query  1686  FTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQG  1865
             +T VL+GHIALD AVFP  T G  LD  AR+ LWK GLDYRHGTGHG+G+ LNVHEGP  
Sbjct  472   YTAVLKGHIALDAAVFPNGTTGHALDILARTPLWKSGLDYRHGTGHGIGSYLNVHEGPHL  531

Query  1866  ISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKL  2042
             ISFR      P+   M V++EPGYYED +FGIR+EN+L VK  DT   FG  GYL FE +
Sbjct  532   ISFRPSARNVPLQASMTVTDEPGYYEDGNFGIRLENVLIVKGADTKFNFGEKGYLSFEHI  591

Query  2043  TFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPIDSS  2210
             T+ P Q KL++ ++L+  E+ W+N YH    + +   ++ + +EWL   T PI  S
Sbjct  592   TWAPYQTKLINTTLLTPEEIDWVNMYHSDCRKILGSYLNEQEKEWLRKATEPITVS  647



>gb|ABA94110.1| metallopeptidase family M24 containing protein, expressed [Oryza 
sativa Japonica Group]
Length=645

 Score =   525 bits (1351),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 283/654 (43%), Positives = 396/654 (61%), Gaps = 54/654 (8%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
              LRAL    S P   + A ++PS+DAHQSE++++   RR ++SGFTGSAG A++T  +A 
Sbjct  12    ELRALMAAHSPP---LHALVVPSEDAHQSEYVSERDKRRQFVSGFTGSAGLALITMKEAL  68

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             LWTDGRYFLQAE+QLS  W LMR G    P    W+   LS  + +GI+P+  S D A+ 
Sbjct  69    LWTDGRYFLQAEQQLSDRWKLMRMGE--DPPVEVWIADNLSDEAVVGINPWCISVDTAQR  126

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
              +   SK  H+ +F  + +L+DEIWK+ RP     P+ V  ++YAG  V+ KL  LR   
Sbjct  127   YEHAFSK-KHQTLFQLSSDLIDEIWKD-RPSAEALPVFVQPVEYAGRTVTEKLKELREKF  184

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
             ++  +  I+I+ LDE+AWL N+RG DV +SPV+++Y IV +  A  ++D  K++ EV +Y
Sbjct  185   LHEKARGIIIAALDEVAWLYNIRGDDVHYSPVVHSYSIVTLHSAFFYVDKRKVSVEVQNY  244

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             +   G++++ Y  + S+   LA       L  S VN +              S G    N
Sbjct  245   MTDNGIDIKDYNMVQSDASLLASGQ----LKGSAVNGS--------------SYGENDMN  286

Query  1227  KKSTN-LDTNGLS-------GQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
             + S   +D+N           Q   L   SP+++ KAVKN  EL+G++  H+RD AA+  
Sbjct  287   ENSKVWIDSNSCCLALYSKLDQDQVLMLQSPIALPKAVKNPVELDGLRKAHIRDGAAVVQ  346

Query  1383  FWAWLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFD  1502
             + AWL+ ++ ++ G                    LTEV V++KL  FR+ +  F   SF 
Sbjct  347   YLAWLDNQMQENYGASGYFSEAKGSQKKQHMEVKLTEVSVSDKLEGFRASKEHFKGLSFP  406

Query  1503  TISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKE  1682
             TIS  G N A+IHY PE  SC+ ++  +++L DSGAQY+DGTTDITRTVHFG+PS  EK 
Sbjct  407   TISSVGPNAAVIHYSPEASSCAELDADKIYLCDSGAQYLDGTTDITRTVHFGKPSEHEKS  466

Query  1683  CFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQ  1862
             C+T VL+GHIALD AVFP  T G  LD  AR+ LW+ GLDYRHGTGHG+G+ LNVHEGP 
Sbjct  467   CYTAVLKGHIALDSAVFPNGTTGHALDILARTPLWRSGLDYRHGTGHGIGSYLNVHEGPH  526

Query  1863  GISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEK  2039
              ISFR      P+   M V++EPGYYED SFGIR+EN+L VKE +T   FG  GYL FE 
Sbjct  527   LISFRPSARNIPLQASMTVTDEPGYYEDGSFGIRLENVLIVKEANTKYNFGDKGYLAFEH  586

Query  2040  LTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             +T+ P Q KL+D ++L+ AE+ W+N+YH    + +   ++ + +EWL   T PI
Sbjct  587   ITWAPYQTKLIDTTLLTPAEIEWVNAYHADCRKILQPYLNEQEKEWLRKATEPI  640



>ref|XP_007204612.1| hypothetical protein PRUPE_ppa002705mg [Prunus persica]
 gb|EMJ05811.1| hypothetical protein PRUPE_ppa002705mg [Prunus persica]
Length=642

 Score =   524 bits (1349),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 290/653 (44%), Positives = 394/653 (60%), Gaps = 38/653 (6%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D L ALR L +     +DA ++PS+D HQSE+++    RR ++SGFTGSAG A+VTK++A
Sbjct  3     DTLSALRSLMASHSPPLDALVVPSEDYHQSEYVSARDKRREFVSGFTGSAGLALVTKNEA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQA ++LS  W LMR G    P    W+   L   S IGIDP+  S D A+
Sbjct  63    RLWTDGRYFLQATQELSDQWQLMRMGE--DPAVDIWMADNLPRDSAIGIDPWCVSIDTAQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKK--PIRVHDLKYAGADVSSKLFSLR  857
             + +   SK + +LV  S  NLVDE+WK    QPP +  P+ VH L+YAG  V+ KL  LR
Sbjct  121   KWELAFSKKHQKLVQTST-NLVDEVWKN---QPPAEINPVIVHPLQYAGRSVADKLKDLR  176

Query  858   SDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEV  1037
               LI   +  I+IS LDE+AWL N+RGSDV +SPV++A+ IV  + A  ++D  K++ EV
Sbjct  177   ERLIQENARGIIISALDEVAWLYNIRGSDVSYSPVVHAFAIVTSNSAFFYVDKRKVSSEV  236

Query  1038  MDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITN-AYKTACDRYSRSPGI  1214
               YL+  G+E+R Y+S+ S++  LA         ++ +    TN A     D+    PG 
Sbjct  237   NTYLEENGIEVRDYKSVSSDVALLASNQLKPSFKETEITGNGTNKAEDKNDDQIWADPG-  295

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                   S              + + SP+++AKA+KN  ELEG++  H+RD AA+  +  W
Sbjct  296   ------SCCYALYSKLNPEKVILQQSPLALAKALKNPIELEGLKKAHIRDGAAVVQYLVW  349

Query  1395  LEEEI---------------------CKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTIS  1511
             L+++                       K   LTEV  ++KL  FR+ +  F   SF TIS
Sbjct  350   LDKQAQEIYGASGFFSEGEGMDKKKHSKTTKLTEVTASDKLEGFRASKENFRGLSFPTIS  409

Query  1512  GSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFT  1691
               G N AIIHY P+ ++C+  +   ++L DSGAQY+DGTTDITRTVHFG+PS+ EK C+T
Sbjct  410   SVGPNAAIIHYSPQAETCAEFDPDSIYLFDSGAQYLDGTTDITRTVHFGKPSAHEKACYT  469

Query  1692  RVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGIS  1871
              VL+GHIAL  A FP  T G  LD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP  IS
Sbjct  470   AVLKGHIALGNARFPNGTNGHALDILARVPLWKSGLDYRHGTGHGIGSYLNVHEGPHLIS  529

Query  1872  FR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTF  2048
             FR      P+   M V++EPGYYED +FGIR+EN+L + + DT   FG  GYL FE +T+
Sbjct  530   FRPHARNVPLQASMTVTDEPGYYEDGNFGIRLENVLIINQADTKFNFGDKGYLQFEHITW  589

Query  2049  VPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPIDS  2207
              P Q KL+DLS+L+  E+ WLN+YH +  + ++  VD   + WL   T PI +
Sbjct  590   APYQRKLIDLSLLAPEELEWLNTYHSKCRDILAPYVDESEKAWLKKATEPISA  642



>gb|ERE78056.1| xaa-Pro aminopeptidase 1 [Cricetulus griseus]
Length=653

 Score =   523 bits (1346),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 293/634 (46%), Positives = 387/634 (61%), Gaps = 47/634 (7%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T++ 
Sbjct  53    LRQLRQAMRNVEYVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEH  112

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  113   AAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  172

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  173   KKMAKVLRSAGHHLVPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKEKVADLRL  230

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV             LFID  +I  P V
Sbjct  231   KMAERNIVWFVVTALDEIAWLFNLRGSDVEHNPV-------------LFIDGDRIDAPSV  277

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
               +L   +G+E              AE    +   KS     I +  KT C   S    +
Sbjct  278   KQHLLLDLGLE--------------AEYRIQVLPYKS-----ILSELKTLCSDLSPREKV  318

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  + +  +  +       +P+ +AKAVKN AE EGM+  H++DA AL   + W
Sbjct  319   WVSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNLAESEGMRRAHIKDAVALCELFNW  377

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  378   LEKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  436

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G 
Sbjct  437   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGH  496

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGY
Sbjct  497   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGY  556

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN
Sbjct  557   YEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLN  616

Query  2115  SYHLQVWEKVSG---LVDGR--AREWLWNNTRPI  2201
             SYH Q    V G    + GR  A EWL   T PI
Sbjct  617   SYH-QTCRDVIGKELQIQGRQEALEWLLRETEPI  649



>gb|ERE78057.1| xaa-Pro aminopeptidase 1 [Cricetulus griseus]
Length=658

 Score =   523 bits (1346),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 293/634 (46%), Positives = 387/634 (61%), Gaps = 47/634 (7%)
 Frame = +3

Query  330   LRALRQLFSRPDI---NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             LR LRQ     +     I AYIIPS DAHQSE+IA C  RRA++SGF GSAGTA++T++ 
Sbjct  58    LRQLRQAMRNVEYVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEH  117

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             AA+WTDGRYFLQA KQ+ ++W LM+ G    PT  +WL SVL  GSR+G+DP +  +D  
Sbjct  118   AAMWTDGRYFLQAAKQMDNNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYW  177

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +++ + +    H LV +   NLVD+IW + RP+ P KP+    L Y G     K+  LR 
Sbjct  178   KKMAKVLRSAGHHLVPVKE-NLVDKIWTD-RPERPCKPLLTLGLDYTGISWKEKVADLRL  235

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI-TPEV  1037
              +        V++ LDEIAWL NLRGSDV H+PV             LFID  +I  P V
Sbjct  236   KMAERNIVWFVVTALDEIAWLFNLRGSDVEHNPV-------------LFIDGDRIDAPSV  282

Query  1038  MDYLK-SVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
               +L   +G+E              AE    +   KS     I +  KT C   S    +
Sbjct  283   KQHLLLDLGLE--------------AEYRIQVLPYKS-----ILSELKTLCSDLSPREKV  323

Query  1215  KKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAW  1394
                +K S  + +  +  +       +P+ +AKAVKN AE EGM+  H++DA AL   + W
Sbjct  324   WVSDKASYAV-SEAIPKEHRCCMPYTPICIAKAVKNLAESEGMRRAHIKDAVALCELFNW  382

Query  1395  LEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIV  1574
             LE+E+ K  G+TE+  A+K  EFR +Q  F+D SF TIS +G NGAIIHY P P++   +
Sbjct  383   LEKEVPKG-GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTL  441

Query  1575  NRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGF  1754
             +  E++L+DSGAQY DGTTD+TRT+HFG P++ EKECFT VL+GHIA+  A+FP  T G 
Sbjct  442   SLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAIFPTGTKGH  501

Query  1755  VLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNMTPMVPGMVVSNEPGY  1934
             +LD+FARS+LW  GLDY HGTGHGVG+ LNVHEGP GIS++  +  P+  GM+V++EPGY
Sbjct  502   LLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGY  561

Query  1935  YEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLN  2114
             YED +FGIRIEN++ V  + T   F   G L FE LT VPIQ K++D+  L+  E  WLN
Sbjct  562   YEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLN  621

Query  2115  SYHLQVWEKVSG---LVDGR--AREWLWNNTRPI  2201
             SYH Q    V G    + GR  A EWL   T PI
Sbjct  622   SYH-QTCRDVIGKELQIQGRQEALEWLLRETEPI  654



>gb|AFR98124.2| xaa-Pro aminopeptidase [Cryptococcus neoformans var. grubii H99]
Length=646

 Score =   521 bits (1342),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 285/648 (44%), Positives = 389/648 (60%), Gaps = 29/648 (4%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             ++L  LRQL    +  +DAY++PS+DAH SE++A C  RRAYI+GFTGSAG AV+T DKA
Sbjct  6     NKLAGLRQLMR--EQGVDAYVVPSEDAHASEYLAPCDARRAYITGFTGSAGCAVITHDKA  63

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLF-----S  668
               WTDGRY+LQAEKQL   W LM+SG   VPT S+WL++ +SP S IGIDP +       
Sbjct  64    LCWTDGRYWLQAEKQLGEGWALMKSGLPEVPTWSQWLSTEVSPNSLIGIDPTVIPYSEAL  123

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIW-KESRPQPPKKPIRVHDLKYAGADVSSKL  845
                +       +        +   NL+D +W   SRP  P +PI     KY G  VSSKL
Sbjct  124   LLHSSLPSSSPAPSASPSRLIPTPNLIDSLWVPPSRPLRPSQPIFHLADKYTGEPVSSKL  183

Query  846   FSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKI  1025
               LR  LI  GS   V++ LDEIAW+ NLRG+D+ ++PV +AY I+  D   LF+  S +
Sbjct  184   RRLRDKLIKIGSPGTVVASLDEIAWVFNLRGADIPYNPVFFAYTIITPDDCTLFVSPSSL  243

Query  1026  TPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTA-------  1184
             T EV  YL + GV +  Y  + + +E+  ++   L  D+        +  K A       
Sbjct  244   TIEVRSYLHANGVAVLDYSHVWTSLEAWKKR---LKFDQENKTREQRDGVKRARLEEEAK  300

Query  1185  ----CDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNC  1352
                  +R  ++  I   NK  T+       G+ +   R S +   KA KN+ E+EG + C
Sbjct  301   KEEEGERLKKTDKILIGNK--TSWAVAKAVGEDNVEVRRSLIEEMKAKKNATEIEGFRQC  358

Query  1353  HLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGA  1532
             H+RD AAL  + AWLEE +      TE + A KL +FR +   F+  SF+TIS +GAN A
Sbjct  359   HIRDGAALVRYLAWLEEALENGESWTEYDAATKLEDFRKENKLFMGLSFETISSTGANAA  418

Query  1533  IIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHI  1712
             +IHY P      ++ + +++L DSGAQY+DGTTD+TRT+HFG P+  +K  FTRVLQGHI
Sbjct  419   VIHYSPPEQGSKVIEKKQMYLCDSGAQYLDGTTDVTRTLHFGTPNEEQKRAFTRVLQGHI  478

Query  1713  ALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NM  1889
             +LD  VFP+ T G++LD  AR +LW  GLDYRH T HG+G+ LNVHEGPQGI  R   N 
Sbjct  479   SLDTIVFPQGTTGYILDVLARRALWSDGLDYRHSTSHGIGSFLNVHEGPQGIGQRPAYNE  538

Query  1890  TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKL  2069
               +  GMV+SNEPGYY+D  +GIRIE +  ++  +T   FGG G+LGFE++T  PIQ KL
Sbjct  539   VALQEGMVISNEPGYYKDGEWGIRIEGVDVIERRETRENFGGKGWLGFERITMCPIQRKL  598

Query  2070  VDLSILSAAEVAWLNSYHLQVWEKVSGLV----DGRAREWLWNNTRPI  2201
             VD  +L+  E  WLN YH +V  K++ ++    D RA +WL    +P+
Sbjct  599   VDPPLLTIEEKDWLNEYHAEVLAKLAPVLKEMGDERAGKWLERECQPL  646



>gb|EMF12275.1| Creatinase/aminopeptidase [Sphaerulina musiva SO2202]
Length=622

 Score =   520 bits (1340),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 278/637 (44%), Positives = 392/637 (62%), Gaps = 25/637 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             ++  DRL+ALR L S+    +D YI+PSQDAH SE+IA    RR +ISGF+GSAGTA+V 
Sbjct  4     VNTTDRLQALRHLMSQH--KVDLYIVPSQDAHSSEYIAPTDARREFISGFSGSAGTAIVA  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             +D+AAL TDGRYF QA  QL S+W L++ G   VPT  EW       G  +G+DP   ++
Sbjct  62    QDRAALATDGRYFNQASHQLDSNWTLLKQGLQDVPTWQEWTLEQAEGGKTVGVDPTTITA  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L E I K   + +     NLVD++W + +P  P +P+RV +++YAG     K+  
Sbjct  122   PEARKLAEKIKKKGGKGLVAIAENLVDKVWAKDKPARPNEPVRVLEMQYAGKKFQEKIEE  181

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    ++  V+SMLDEIAWL NLRGSD+ ++PV ++Y +V      L++D++K+  
Sbjct  182   LRKELDKKKAAGFVVSMLDEIAWLFNLRGSDIPYNPVFFSYAVVTPTTTTLYVDETKLPD  241

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAA--ITNAYKTACDRYSRS  1205
                 +L   G+ +R Y+              +++ D +T+ A    T+    A     + 
Sbjct  242   NAKAHL--AGIHIRPYD--------------DIFSDIATLAAETPTTDGEGKADAMAKKK  285

Query  1206  PGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHF  1385
                    + S  L    L G+ +     SP+  AKA+KN+ ELEGM+ CH+RD AAL  +
Sbjct  286   KKYLISTQASWALQ-RSLGGEENVDEVRSPIGDAKAIKNTVELEGMRQCHIRDGAALIEY  344

Query  1386  WAWLEEEICKDVGLTEVEV-AEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDS  1562
             +AWLE ++  +    +    A+KL   RSK   F   SFDTIS +G N A+IHYKPEP S
Sbjct  345   FAWLEHQLVVEKVEVDEVAGADKLEAIRSKHDKFAGLSFDTISSTGPNAAVIHYKPEPGS  404

Query  1563  CSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPEN  1742
             CS+++ ++++L DSGAQY DGTTD TRT+HFG P ++E E +T VL+G+I L+ AVFP+ 
Sbjct  405   CSVIDPNQVYLCDSGAQYYDGTTDTTRTLHFGTPDAKEIEAYTLVLKGNIGLELAVFPKG  464

Query  1743  TPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVS  1919
             T G  LD  AR  LW+ GL+YRHGTGHGVG+ LNVHEGP GI  R   +  P+  G V+S
Sbjct  465   TSGLALDTLARQYLWQNGLEYRHGTGHGVGSFLNVHEGPIGIGTRPQYSEVPLSVGNVIS  524

Query  1920  NEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAE  2099
             +EPGYYED SFG+RIEN++ VKE+ T   FG   Y GFE +T VP   +L D+S+L+  E
Sbjct  525   DEPGYYEDESFGVRIENVIMVKEVKTKYNFGDKAYFGFEHVTMVPHCRRLTDISMLTKIE  584

Query  2100  VAWLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPID  2204
             + ++N+YH +VWEK S     D R  +WL    +P +
Sbjct  585   LDYINAYHKEVWEKTSPFFKNDERTLKWLERECQPYE  621



>gb|KIL95817.1| xaa-pro aminopeptidase [Fusarium avenaceum]
Length=652

 Score =   521 bits (1342),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 297/636 (47%), Positives = 390/636 (61%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    +++I  Y+IPS+D+H SE+IADC  RRAYISGFTGSAG AVVT
Sbjct  37    LDTTSRLTRLRGLMKERNVHI--YVIPSEDSHSSEYIADCDARRAYISGFTGSAGCAVVT  94

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              D AAL TDGRYF QA  QL  +W L++ G   VPT  +W     S G  +G+D  L S 
Sbjct  95    LDSAALATDGRYFNQATSQLDDNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDATLISG  154

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  VS+KL 
Sbjct  155   STAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPARPSEKVIIQPDELAGESVSNKLV  213

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D AKL+IDDSK+ 
Sbjct  214   KLRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAAKLYIDDSKLD  273

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L S  VE++ Y+              +++ D   ++AA+T   K+  +  + + 
Sbjct  274   DKCRSHLVSNKVEIKPYD--------------SIFDDAKALHAAVTE--KSKSNDKTPTG  317

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        S +  AKA+K  AEL GM+ CH+RD A+L  ++
Sbjct  318   SFLISNKGSWAL-KRSLGGDSSVDEVRSLIGDAKAIKTEAELNGMRECHIRDGASLIQYF  376

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  377   AWLEDQLVNKKTTLDEVQAADKLEELRKQKKDFVGLSFPTISSTGANAAIIHYGPERGNC  436

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  437   ATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGTPTDAEREAYTLVLKGHISLDQAIFPKGT  496

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LDA AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  497   TGFALDALARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  556

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+     FG   +LGFE +T VP    L+D  +L++ E 
Sbjct  557   EPGYYEDGKYGIRIENMVLVKEVKAKYSFGDKPFLGFEYVTMVPYCRNLIDTKLLTSEEK  616

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK  G  DG      WL   T  ID
Sbjct  617   EWLNTYNEKVLEKTQGYFDGDDVTLAWLKRETVRID  652



>dbj|GAA91305.1| exocyst complex component Sec8 [Aspergillus kawachii IFO 4308]
Length=594

 Score =   518 bits (1333),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 283/634 (45%), Positives = 380/634 (60%), Gaps = 49/634 (8%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  +RL  LRQL    +  +D Y                     +ISGF+GSAGTA+V+
Sbjct  4     VDTSERLARLRQLMQ--ERKVDVY--------------------KFISGFSGSAGTAIVS  41

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W L++ G  G PT  EW       G  +G+DP L + 
Sbjct  42    MTKAALSTDGRYFNQASKQLDSNWALLKRGVEGFPTWQEWTTEQAEGGKVVGVDPALVTP  101

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E + K    LV +   NLVD +W + RP PP++ +RVH  +YAG     K+  
Sbjct  102   AGARSLSETLKKNGSSLVGVEQ-NLVDLVWGKDRPAPPREAVRVHPAQYAGKSFQEKIGD  160

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L N  ++ IVISMLDEIAWL NLRG+D+ ++PV ++Y ++      L++D+ K+TP
Sbjct  161   LRKELENKKAAGIVISMLDEIAWLFNLRGTDIPYNPVFFSYALITPTTVDLYVDEDKLTP  220

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ Y+              +++ D      A++ A K   D    +P 
Sbjct  221   EVKAHLGQ-DVVIKPYD--------------SIFADAK----ALSEARKQ--DATGAAPK  259

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+       SP++ AKAVKN  EL GM+ CH+RD AAL  ++A
Sbjct  260   FLLSNKASWALSLS-LGGEEQVEEVRSPIADAKAVKNDVELAGMRACHVRDGAALIEYFA  318

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E I K   L EV+ A+KL + RSK   +   SFDTIS +G NGA+IHYKPE  SCS
Sbjct  319   WLENELINKKTTLDEVDAADKLEQIRSKHDLYAGLSFDTISSTGPNGAVIHYKPEKGSCS  378

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSGAQY+DGTTD+TRT HFG+P+  EK+ FT VL+G I++D AVFP+ T 
Sbjct  379   IIDPTAIYLCDSGAQYLDGTTDVTRTFHFGKPTELEKKAFTLVLKGLISIDTAVFPKGTS  438

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LDA AR  LWK GLDY HGTGHG+G+ LNVHEGP GI  R      P+  G V+S+E
Sbjct  439   GFALDALARQFLWKEGLDYLHGTGHGIGSYLNVHEGPMGIGTRVQYTEVPIAAGNVISDE  498

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED  FGIRIEN++  +E+ T ++FG   +LGFE +T  P+   L++ S+LS  E+ 
Sbjct  499   PGFYEDGKFGIRIENVIMAREVQTTHKFGEKPWLGFEHVTMAPLGRNLINASLLSEHEIK  558

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRPI  2201
             W+N YH +VWEK       D   R WL   T+PI
Sbjct  559   WVNDYHAEVWEKTHRFFENDDYTRSWLQRETQPI  592



>ref|XP_010254935.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nelumbo nucifera]
 ref|XP_010254936.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Nelumbo nucifera]
Length=657

 Score =   520 bits (1338),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 287/663 (43%), Positives = 402/663 (61%), Gaps = 45/663 (7%)
 Frame = +3

Query  321   EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             ED L ALR L +     +DA I+PS+D HQSE++++   RR ++SGF+GSAG A++T ++
Sbjct  2     EDPLDALRPLMASHSPPLDALIVPSEDYHQSEYVSERDKRRQFVSGFSGSAGLALITMNE  61

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             A LWTDGRYFLQA +QLS  W LMR G    P+   W+   L   + IG+DP+  S + A
Sbjct  62    ARLWTDGRYFLQAMQQLSDRWKLMRIGE--DPSVETWIADNLPKDTAIGVDPWCVSIETA  119

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +  +   +K   +LV  S  NLVDEIWK +RP P  KP+  H L+++G  V  KL +LR 
Sbjct  120   QRWENAFTKKQQKLVRTST-NLVDEIWK-NRPLPEIKPVIAHPLEFSGRSVVEKLNNLRE  177

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVM  1040
              L    +  I+I+ LDE+AWL N+RG+DV + PV++A+ IV  + A  ++D  K++ EV 
Sbjct  178   KLSQEKAHGILITALDEVAWLYNVRGNDVSYCPVVHAFGIVTSNSAFFYVDKKKMSDEVH  237

Query  1041  DYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK  1220
              Y+K  G+E+R Y+++ S+   LA       L+ S +N A     K A +  S +  ++ 
Sbjct  238   SYMKENGIEVRDYDTVKSDTALLASGQ----LNSSLINGAHVECLKDA-EVTSETGLVRN  292

Query  1221  RNKKSTNLDTNGLSGQP----HALY----------RSSPVSMAKAVKNSAELEGMQNCHL  1358
                ++     + +   P    +ALY          + SP+++AKA+KN  EL+G++  H+
Sbjct  293   GENEAEESKKSLIWADPGSCCYALYSVLNSDQVLLQQSPLALAKAIKNPVELDGLRKAHI  352

Query  1359  RDAAALAHFWAWLEEEICKDVG---------------------LTEVEVAEKLLEFRSKQ  1475
             RD AA+  +  WL++++ +  G                     LTEV V++KL  FR+ +
Sbjct  353   RDGAAVVQYLVWLDKQMQEVYGASGYFLEPDGTNKRKHTETMKLTEVTVSDKLEGFRASK  412

Query  1476  YGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHF  1655
               F   SF TIS  G N AIIHY P+  +CS ++   ++L DSGAQY+DGTTDITRTVHF
Sbjct  413   EHFRGLSFPTISSVGPNAAIIHYSPDSKTCSELDADSIYLFDSGAQYLDGTTDITRTVHF  472

Query  1656  GEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGA  1835
             G+PS+ EK C+T VL+GHIALD A FP  T G  LD  AR  LWK GLDYRHGTGHG+G+
Sbjct  473   GKPSAHEKACYTAVLKGHIALDTARFPNGTNGHALDILARVPLWKDGLDYRHGTGHGIGS  532

Query  1836  ALNVHEGPQGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFG  2012
              L VHEGP  ISFR      P+   M V++EPGYYED SFGIR+EN+L VKE DT   FG
Sbjct  533   YLYVHEGPHLISFRPQARNVPLKVSMTVTDEPGYYEDGSFGIRLENVLIVKEADTKFNFG  592

Query  2013  GIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNT  2192
               GYL FE +T+ P Q KL+DL +L+  E+ W+N+YH +  E ++  +D     WL   T
Sbjct  593   DKGYLSFEHITWAPYQKKLMDLRVLAPEEIEWVNTYHARCRELLAPFLDESEMAWLKKAT  652

Query  2193  RPI  2201
              PI
Sbjct  653   EPI  655



>gb|EUN24303.1| hypothetical protein COCVIDRAFT_106402 [Bipolaris victoriae FI3]
Length=654

 Score =   519 bits (1336),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 289/633 (46%), Positives = 393/633 (62%), Gaps = 27/633 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    + N+D Y++PS+D+HQSE+IA C  RRAYISGFTGSAG AV+T
Sbjct  44    VDTSHRLAELRKLMK--ERNVDIYMVPSEDSHQSEYIAPCDARRAYISGFTGSAGYAVIT  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QAEKQL S+W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  102   HEKAALSTDGRYFNQAEKQLDSNWELLKQGIQDVPTIQEWTADQAEGGKVVGVDPSVVAA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L + I K   E   +   NLVD +W   RP  P + + V   KYAG   S K+  
Sbjct  162   ADARKLADKIKKKGGEYKAVDE-NLVDLVWGAERPARPSEKVIVQPDKYAGKSFSDKIDD  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S   V+SMLDE+AWL NLRG+D+ ++PV ++Y ++    A L++DDSK+  
Sbjct  221   LRKELEKKKSLGFVVSMLDEVAWLFNLRGNDIPYNPVFFSYAVITPTAATLYVDDSKLPE  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +V ++L    V +R YE               ++ D + +N  ++       ++ +    
Sbjct  281   DVKNHLGD-KVTIRPYE--------------EIFGDVTALNKELS----ATGEKDATPKK  321

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 N+ S  L+   L G+       SP+  AKAVKN  ELEGM+ CH+RD AAL+ ++A
Sbjct  322   FLTSNRASWALN-KALGGEDKVEETRSPIGDAKAVKNEVELEGMRQCHIRDGAALSEYFA  380

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE++ I K   L EV+ A+KL E R K   F+  SFDTIS +G N A+IHYKPE  +CS
Sbjct  381   WLEDQLINKKATLDEVDAADKLEEIRKKHDMFMGLSFDTISSTGPNAAVIHYKPEKGACS  440

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++   ++L DSGAQY DGTTD TRT+HF EP+  E++ +T VL+G++AL++  FP+ T 
Sbjct  441   VIDPKAIYLCDSGAQYRDGTTDTTRTLHFTEPTEMERKAYTLVLKGNMALERVRFPKGTT  500

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LD+ AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G VVS+E
Sbjct  501   GFALDSLARQFLWAEGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYSEVSLAVGNVVSDE  560

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  FGIRIEN++ VKE++T ++FG   YLGFE +T  P    LVD+S+L+  E A
Sbjct  561   PGYYEDGKFGIRIENMIMVKEVETKHKFGDKPYLGFEHVTMTPHCRNLVDMSLLTEDEKA  620

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRP  2198
             +LN YH +V+EK S     D    EWL   T P
Sbjct  621   FLNDYHKEVYEKTSKFFENDALTLEWLKRETAP  653



>ref|XP_007697321.1| hypothetical protein COCSADRAFT_83782 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD67746.1| hypothetical protein COCSADRAFT_83782 [Bipolaris sorokiniana 
ND90Pr]
Length=654

 Score =   519 bits (1336),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 294/633 (46%), Positives = 396/633 (63%), Gaps = 27/633 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    + N+D Y++PS+D+HQSE+IA C  RRAYISGFTGSAG AV+T
Sbjct  44    VDTSHRLAELRKLMK--ERNVDIYMVPSEDSHQSEYIAPCDARRAYISGFTGSAGYAVIT  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QAEKQL S+W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  102   HEKAALSTDGRYFNQAEKQLDSNWELLKQGIQDVPTIQEWTADQAEGGKVVGVDPSVVTA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L + I K   E   +   NLVD +W   RP  P + + V   KYAG   S K+  
Sbjct  162   ADARKLADKIKKKGGEYKAVDE-NLVDLVWGAERPARPSEKVIVQPDKYAGKSFSDKIED  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S   V+SMLDE+AWL NLRGSD+ ++PV ++Y ++    A L++DDSK+  
Sbjct  221   LRKELDKKKSLGFVVSMLDEVAWLFNLRGSDIPYNPVFFSYAVITPTAATLYVDDSKLPE  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +V  +L    V +R YE I  ++ +L+++     L  ++   A    + T+         
Sbjct  281   DVKKHLGD-KVTIRPYEEIFGDVTALSKE-----LSATSEKDATPKKFLTS---------  325

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 N+ S  L+   L G+       SPV  AKAVKN  ELEGM+ CH+RD AAL+ ++A
Sbjct  326   ----NRASWALN-KALGGEDKVEETRSPVGDAKAVKNEVELEGMRQCHIRDGAALSEYFA  380

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE++ I K   L EV+ A+KL E R K   F+  SFDTIS +G N A+IHYKPE  +CS
Sbjct  381   WLEDQLINKKATLDEVDAADKLEEIRKKHDMFMGLSFDTISSTGPNAAVIHYKPEKGACS  440

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++   ++L DSGAQY DGTTD TRT+HF EP+  E++ +T VL+G++AL++  FP+ T 
Sbjct  441   VIDPKAIYLCDSGAQYRDGTTDTTRTLHFTEPTEMERKAYTLVLKGNMALERVKFPKGTT  500

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LD+ AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G VVS+E
Sbjct  501   GFALDSLARQFLWAEGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYSEVSLAVGNVVSDE  560

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  FGIRIEN++ VKE++T ++FG   YLGFE +T  P    LVD+S+L+  E A
Sbjct  561   PGYYEDGKFGIRIENMVMVKEVETKHKFGDKPYLGFEHVTMTPHCRNLVDMSLLTEDEKA  620

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRP  2198
             +LN YH +V+EK S     D    EWL   T P
Sbjct  621   FLNDYHKEVYEKTSKFFENDALTLEWLKRETAP  653



>ref|XP_759880.1| hypothetical protein UM03733.1 [Ustilago maydis 521]
 gb|EAK84911.1| hypothetical protein UM03733.1 [Ustilago maydis 521]
Length=723

 Score =   521 bits (1342),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 281/627 (45%), Positives = 393/627 (63%), Gaps = 35/627 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   R++ LRQL S+  +   AY+IPS D H SE+ A+  +RR YI+GFTGSAG+AVVT
Sbjct  120   VDTTQRVQLLRQLMSKHGVT--AYVIPSGDEHASEYPAESDLRRGYITGFTGSAGSAVVT  177

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
              +KA L+TDGRYFLQA +QL  S W LM+ G   VPT  E+L+  L   S+IG+D  L S
Sbjct  178   TNKALLFTDGRYFLQAGQQLDPSVWTLMKQGEPNVPTWQEYLSKNLPANSKIGMDASLIS  237

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             ++ A+++  ++++    LV +   NLVD++W + RP  P +PI V   + AG   S K+ 
Sbjct  238   AEDAKDITAELTRIGSSLVPIRE-NLVDQVWAD-RPARPGQPIFVLKDEIAGRSSSDKIR  295

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              L+ ++    +   V +MLDE+AWL NLRG+DV ++PV +++ +V +D   L+++D+++T
Sbjct  296   ELQEEIKKKSAQGFVANMLDEVAWLFNLRGTDVPYNPVFFSFAMVLLDKVLLYVNDNQLT  355

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +V + L S  V LR Y              A  + D   + A +   +K    + S S 
Sbjct  356   EDVKNSLGSE-VTLRPY--------------AEFYNDLHKIGAELGEGHKILIGK-SASL  399

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +++            L G        S V   K++KN  EL+G +  H+RD AAL  ++
Sbjct  400   AVQE-----------ALGGASKVEIVRSIVGDQKSIKNEVELQGFRQSHIRDGAALCQYF  448

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEE++     +TE + A+KL E+R     F   SF TIS +G NGAIIHY P+P SC 
Sbjct  449   AWLEEQLHAGNKVTESQGADKLSEYRQSLDHFRGESFTTISSTGPNGAIIHYSPDPSSCP  508

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ +E++L DSGAQ+ DGTTD+TRT HFG+P+  +   FTRVLQGHIA+D+A+FP+ T 
Sbjct  509   AIDVNEIYLCDSGAQFTDGTTDVTRTWHFGKPAPEQIRAFTRVLQGHIAIDRAIFPKGTT  568

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNE  1925
             G++LD  AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +   MV+SNE
Sbjct  569   GYLLDVLARRALWEDGLDYRHGTGHGVGHFLNVHEGPQGIGTRAVFNETSLKENMVISNE  628

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYY+D  +GIRIENL+ V+   TPN FG  GYL FE LT  PIQ  LVD  +L+  +  
Sbjct  629   PGYYQDGKWGIRIENLVIVRPAQTPNNFGSKGYLTFEHLTMCPIQVSLVDPDLLTKEDKQ  688

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWL  2180
             WLN YH +V++KV+ L+  D RA EWL
Sbjct  689   WLNDYHQEVYDKVAPLLQKDKRALEWL  715



>emb|CEF74930.1| unnamed protein product [Fusarium graminearum]
Length=652

 Score =   518 bits (1335),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 297/646 (46%), Positives = 394/646 (61%), Gaps = 28/646 (4%)
 Frame = +3

Query  282   SSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGF  461
             SSE   K   LD   RL  LR L    + N+  YIIPS+D+H SE+IA+C  RRAYISGF
Sbjct  30    SSEIMAK---LDSTSRLTRLRGLMK--ERNVQVYIIPSEDSHSSEYIAECDARRAYISGF  84

Query  462   TGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSR  641
             TGSAG AVVT + AAL TDGRYF QA  QL  +W L++ G   VPT  +W     S G  
Sbjct  85    TGSAGCAVVTLESAALATDGRYFNQAASQLDDNWTLLKQGLQDVPTWQDWSAEQSSGGKN  144

Query  642   IGIDPFLFSSDAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKY  818
             +G+DP L S   A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + 
Sbjct  145   VGVDPTLISGSTAKGLAEKIRKNGGAELVAVDG-NLVDLVWGDERPARPSEKVIIQPDEL  203

Query  819   AGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGA  998
             AG  V +KL  +R ++    S   ++SMLDEIAWL NLRGSD+ ++PV +AY  V  D A
Sbjct  204   AGESVLNKLNKVRQEMGKKHSPGFLVSMLDEIAWLFNLRGSDIPYNPVFFAYATVTPDAA  263

Query  999   KLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK  1178
             KL+IDDSK+  E   +L S  VE++ Y+               ++ D   ++A+++   K
Sbjct  264   KLYIDDSKLDDECRSHLTSNKVEIKPYD--------------TVFEDSQALHASVSE--K  307

Query  1179  TACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHL  1358
             T  D  +        NK S  L    + G        S +  AKA+K  AEL+GM++CH+
Sbjct  308   TKTDDKAPKGNFLISNKGSWAL-KRAIGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHV  366

Query  1359  RDAAALAHFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             RD A+L  ++AWLE+++  K   L EV+ A+KL   R ++  F+  SF TIS +GAN AI
Sbjct  367   RDGASLIQYFAWLEDQLVNKKATLDEVQAADKLEALRKEKKDFVGLSFPTISSTGANAAI  426

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIA  1715
             IHY PE  +C+ ++   ++L DSGAQY DGTTD TRT+HFG P+  E+E +T VL+GHI+
Sbjct  427   IHYGPERGNCATIDPKAIYLCDSGAQYRDGTTDTTRTLHFGTPTDAEREAYTLVLKGHIS  486

Query  1716  LDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-T  1892
             LDQA+FP+ T GF LD  AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R      
Sbjct  487   LDQAIFPKGTTGFALDGLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEV  546

Query  1893  PMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLV  2072
              + PG V+SNEPGYYED  +GIRIEN++ VKE+ T + FG   +LGFE +T VP    L+
Sbjct  547   ALAPGNVLSNEPGYYEDGKYGIRIENMVLVKEVKTKHSFGDKPFLGFEYVTMVPYCRNLI  606

Query  2073  DLSILSAAEVAWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
             D ++L++ E  WLN+Y+ +V EK  G  +G      WL   T  ID
Sbjct  607   DTTLLTSVEKDWLNTYNEKVIEKTQGYFEGDDVTTAWLKRETVRID  652



>gb|EYB30877.1| hypothetical protein FG05_02603 [Fusarium graminearum]
Length=619

 Score =   517 bits (1331),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 293/636 (46%), Positives = 390/636 (61%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    + N+  YIIPS+D+H SE+IA+C  RRAYISGFTGSAG AVVT
Sbjct  4     LDSTSRLTRLRGLMK--ERNVQVYIIPSEDSHSSEYIAECDARRAYISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              + AAL TDGRYF QA  QL  +W L++ G   VPT  +W     S G  +G+DP L S 
Sbjct  62    LESAALATDGRYFNQAASQLDDNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  V +KL 
Sbjct  122   STAKGLAEKIRKNGGAELVAVDG-NLVDLVWGDERPARPSEKVIIQPDELAGESVLNKLN  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              +R ++    S   ++SMLDEIAWL NLRGSD+ ++PV +AY  V  D AKL+IDDSK+ 
Sbjct  181   KVRQEMGKKHSPGFLVSMLDEIAWLFNLRGSDIPYNPVFFAYATVTPDAAKLYIDDSKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              E   +L S  VE++ Y+               ++ D   ++A+++   KT  D  +   
Sbjct  241   DECRSHLTSNKVEIKPYD--------------TVFEDSQALHASVSE--KTKTDDKAPKG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    + G        S +  AKA+K  AEL+GM++CH+RD A+L  ++
Sbjct  285   NFLISNKGSWAL-KRAIGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGASLIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EV+ A+KL   R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  344   AWLEDQLVNKKATLDEVQAADKLEALRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  404   ATIDPKAIYLCDSGAQYRDGTTDTTRTLHFGTPTDAEREAYTLVLKGHISLDQAIFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LD  AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  464   TGFALDGLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  523

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+ T + FG   +LGFE +T VP    L+D ++L++ E 
Sbjct  524   EPGYYEDGKYGIRIENMVLVKEVKTKHSFGDKPFLGFEYVTMVPYCRNLIDTTLLTSVEK  583

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK  G  +G      WL   T  ID
Sbjct  584   DWLNTYNEKVIEKTQGYFEGDDVTTAWLKRETVRID  619



>gb|KHG00960.1| putative xaa-pro aminopeptidase p [Gossypium arboreum]
Length=645

 Score =   518 bits (1333),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 282/662 (43%), Positives = 408/662 (62%), Gaps = 51/662 (8%)
 Frame = +3

Query  321   EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             E+ L ALR L +     + A I+PS+D HQSE+++D   RR ++SGFTGSAG A++TKD+
Sbjct  2     EEILSALRSLMASHSPPLHALIVPSEDYHQSEYVSDRDKRREFVSGFTGSAGLALITKDE  61

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             A LWTDGRYFLQA +QLS  W LMR G    P+   W++  L   + IG+DP+  S D A
Sbjct  62    ARLWTDGRYFLQAMQQLSDQWQLMRIGE--DPSVDSWISDNLPREAAIGVDPWCVSVDTA  119

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKK--PIRVHDLKYAGADVSSKLFSL  854
             +  +   +K NH+ +  ++ NLVDE+WK    QPP +  P+ VH L++AG  V+ KL  L
Sbjct  120   QRWERAFAK-NHQKLIQTSSNLVDEVWKN---QPPAETNPVIVHPLEFAGRSVAEKLKDL  175

Query  855   RSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPE  1034
             R  L    +  I+I+ LDE+AWL N+RGSDV + PV++A+ IV ++ A L++D  K++ +
Sbjct  176   REKLAIEKACGIIITALDEVAWLYNIRGSDVSYCPVVHAFAIVTLNSAFLYVDKRKVSSK  235

Query  1035  VMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGI  1214
             V   ++  G+E+R Y ++ S++  LA       LDK T    +++     C+      G 
Sbjct  236   VSSSIQENGIEVREYSTVSSDVALLASNQ----LDKDT---GLSSGQNGVCES-----GT  283

Query  1215  KKRNKKSTNLDTNGLSGQPHALY----------RSSPVSMAKAVKNSAELEGMQNCHLRD  1364
              +  + + +L     +   +AL+          + SP+++AKA+KN  EL+G++N H+RD
Sbjct  284   CEAEENNNDLIWVDPASCCYALFSKLDAKKMLQQQSPLALAKALKNPVELDGLRNAHIRD  343

Query  1365  AAALAHFWAWLEEEICKDVG--------------------LTEVEVAEKLLEFRSKQYGF  1484
              AA+  +  WL++++ +  G                    LTEV  ++KL  FR+ +  F
Sbjct  344   GAAVVQYLVWLDKQMQEIYGASGYFLEGKGRSKKRSETMKLTEVTASDKLEGFRATKEHF  403

Query  1485  LDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEP  1664
                SF TIS  G N A+IHY P+P++C+ ++   ++L DSGAQY+DGTTD+TRTVHFG+P
Sbjct  404   RGLSFPTISSVGPNAAVIHYSPQPETCAELDPDSIYLFDSGAQYLDGTTDVTRTVHFGKP  463

Query  1665  SSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALN  1844
             S  EK C+T VL+GHIAL  A FP  T G  LD  AR  LW+ GLDYRHGTGHG+G+ LN
Sbjct  464   SEHEKACYTSVLKGHIALGNARFPNGTNGHALDILARIPLWRYGLDYRHGTGHGIGSYLN  523

Query  1845  VHEGPQGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIG  2021
             VHEGP  ISFR      P+   M V++EPGYYED +FGIR+EN+L +KE DT   FG  G
Sbjct  524   VHEGPHLISFRPQARNVPLQASMTVTDEPGYYEDGTFGIRLENVLVIKEADTEFNFGDKG  583

Query  2022  YLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             YL FE +T+ P Q KL+DLS+L+  E+ WLN+YH +  E ++  +D    +WL   T P+
Sbjct  584   YLSFEHITWAPYQIKLIDLSLLTPEEIEWLNTYHSKCREILAPSMDKNELDWLKKATEPV  643

Query  2202  DS  2207
              +
Sbjct  644   SA  645



>gb|EMS67821.1| Xaa-Pro aminopeptidase 1 [Triticum urartu]
Length=457

 Score =   510 bits (1314),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 250/363 (69%), Positives = 294/363 (81%), Gaps = 7/363 (2%)
 Frame = +3

Query  996   AKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAY  1175
             A LF+D +K++ EV+++LK  GV+L++YE+ILS++E LAEKGA LWLD S+VNAAI + +
Sbjct  4     ATLFVDSNKVSEEVLEHLKKAGVKLKSYEAILSDVERLAEKGAKLWLDSSSVNAAIVSVF  63

Query  1176  KTACDRYSRSPGIKKRN---KKSTNLDTNGLSG----QPHALYRSSPVSMAKAVKNSAEL  1334
             ++ CDRY R  G   R    + S++  T    G    + + LY++SPV++AK+VKN AE+
Sbjct  64    RSGCDRYMRKRGKTGRQIGKEASSDDPTTKKRGVQNMELNGLYKASPVTLAKSVKNEAEI  123

Query  1335  EGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISG  1514
              GM+N HLRDAAALA FW W+EEE+  +V LTEV+VAE LL FR KQ GF++TSFDTISG
Sbjct  124   RGMKNSHLRDAAALAEFWCWIEEEVRNNVALTEVQVAENLLGFRRKQDGFIETSFDTISG  183

Query  1515  SGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTR  1694
              GANGAIIHY P PDSCS V    LFLLDSGAQYVDGTTDITRTVHFGEPS R KECFTR
Sbjct  184   YGANGAIIHYNPTPDSCSSVGSDNLFLLDSGAQYVDGTTDITRTVHFGEPSPRHKECFTR  243

Query  1695  VLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISF  1874
             VLQGHIALDQAVFPE TPGFVLD  ARSSLWK+GLDYRHGTGHGVGAALNVHEGPQ IS+
Sbjct  244   VLQGHIALDQAVFPERTPGFVLDVLARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISY  303

Query  1875  RFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVP  2054
             R+GN+T +  GM+VSNEPGYYED SFGIRIENLL VKE++  N FGGI YLGFEKLTFVP
Sbjct  304   RYGNLTALQKGMIVSNEPGYYEDDSFGIRIENLLLVKEVNLANSFGGISYLGFEKLTFVP  363

Query  2055  IQA  2063
             IQA
Sbjct  364   IQA  366



>ref|XP_007707634.1| hypothetical protein COCCADRAFT_84038 [Bipolaris zeicola 26-R-13]
 gb|EUC38063.1| hypothetical protein COCCADRAFT_84038 [Bipolaris zeicola 26-R-13]
Length=654

 Score =   517 bits (1332),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 288/633 (45%), Positives = 393/633 (62%), Gaps = 27/633 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    + N+D Y++PS+D+HQSE+IA C  RRAYISGFTGSAG AV+T
Sbjct  44    VDTSHRLAELRKLMK--ERNVDIYMVPSEDSHQSEYIAPCDARRAYISGFTGSAGYAVIT  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              +KAAL TDGRYF QAEKQL S+W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  102   HEKAALSTDGRYFNQAEKQLDSNWELLKQGIQDVPTIQEWTADQAEGGKVVGVDPSVVAA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L + I K   E   +   NLVD +W   RP  P + + V   KYAG   S K+  
Sbjct  162   ADARKLADKIKKKGGEYKAVDE-NLVDLVWGAERPARPSEKVIVQPDKYAGKSFSDKIDD  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S   V+SMLDE+AWL NLRG+D+ ++PV ++Y ++    A L++DDSK+  
Sbjct  221   LRKELEKKKSLGFVVSMLDEVAWLFNLRGNDIPYNPVFFSYAVITPTAATLYVDDSKLPE  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +V ++L    V +R YE               ++ D + +N  ++       ++ +    
Sbjct  281   DVKNHLGD-KVTIRPYE--------------EIFGDVTALNKELS----ATGEKDATPKK  321

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 N+ S  L+   L G+       SP+  AKAVKN  ELEGM+ CH+RD AAL+ ++A
Sbjct  322   FLTSNRASWALN-KALGGEDKVEETRSPIGDAKAVKNEVELEGMRQCHIRDGAALSEYFA  380

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE++ I K   L EV+ A+KL E R K   F+  SFDTIS +G N A+IHYKPE  +CS
Sbjct  381   WLEDQLINKKATLDEVDAADKLEEIRKKHDMFMGLSFDTISSTGPNAAVIHYKPEKGACS  440

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++   ++L DSGAQY DGTTD TRT+HF EP+  E++ +T VL+G++AL++  FP+ T 
Sbjct  441   VIDPKAIYLCDSGAQYRDGTTDTTRTLHFTEPTEMERKAYTLVLKGNMALERVRFPKGTT  500

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LD+ AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G VVS+E
Sbjct  501   GFALDSLARQFLWAEGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYSEVSLAVGNVVSDE  560

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  FGIRIEN++ VKE++T ++FG   YLGFE +T  P    LVD+S+L+  E A
Sbjct  561   PGYYEDGKFGIRIENMIMVKEVETKHKFGDKPYLGFEHVTMTPHCRNLVDMSLLTEDEKA  620

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRP  2198
             +LN YH +V++K S     D    EWL   T P
Sbjct  621   FLNEYHKEVYKKTSKFFENDALTLEWLKRETAP  653



>ref|XP_005088947.1| PREDICTED: xaa-Pro aminopeptidase 1-like [Aplysia californica]
Length=607

 Score =   516 bits (1328),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 291/631 (46%), Positives = 400/631 (63%), Gaps = 41/631 (6%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RLR+  +  +     +DAYI+P+ DAHQSE++A+C  RR+++SGFTGSAG A+VT   AA
Sbjct  11    RLRSFMRNPAHVSQPLDAYIVPTGDAHQSEYVAECDSRRSFLSGFTGSAGVAIVTTKLAA  70

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             LWTDGRY+LQA +QLS  W LM+ G    P+ SEWLN VL  G R+G DP L + D   +
Sbjct  71    LWTDGRYYLQAGQQLSGDWELMKDGLPDTPSYSEWLNKVLPVGGRVGCDPSLLAYDRWMK  130

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L +++    HELV +   NLVD +W E RP PP   + +  L  AG     K+ +++  L
Sbjct  131   LYKELKCDGHELVDVDE-NLVDLVWTE-RPDPPCSQLIILTLDEAGLSWQQKVSNIQESL  188

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
             +    SA+VI+ LDE+AWL N+RG+D+  +PV  +Y IV  D A LFIDD K+T +V  +
Sbjct  189   VELSVSAVVITALDEVAWLFNMRGADIEFNPVFISYAIVTRDSANLFIDDEKLTSKVRQH  248

Query  1047  LKSVGVELRAYesilseieslAEK-GANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             L   GV++  Y S+ S + +LA+   + +W+++++  A            + + P +K+ 
Sbjct  249   LS--GVKIHPYSSVYSFLSTLAQTDSSKIWVNETSSFAI-----------FRQVPKVKRH  295

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
                                   SPV++ KAVKN+ E++GM+   ++DA AL  F+ WLE+
Sbjct  296   -------------------VEPSPVAVKKAVKNANEMKGMERAQVKDAVALCEFFHWLEK  336

Query  1404  EICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
             E+ K   +TE+  AEK    RS+Q  ++  SFDTIS  G +GAIIHYKP PD+ + V   
Sbjct  337   EVPKG-NVTEMSAAEKAENLRSQQENYVSLSFDTISSIGPHGAIIHYKPTPDTDTPVTTE  395

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
             E+FL+DSGAQY DGTTD TRTVH G PS  E+ECFTRVL+GHI L  A+FP    G +LD
Sbjct  396   EVFLVDSGAQYRDGTTDTTRTVHLGTPSKHEQECFTRVLKGHINLSSAIFPNGIKGQMLD  455

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRF-GNMTPMVPGMVVSNEPGYYE  1940
               AR+SLW VGLDYRHGTGHGVGA LNVHEGP GISFR   N  P+   MV+++EPGYYE
Sbjct  456   TLARTSLWSVGLDYRHGTGHGVGAFLNVHEGPCGISFRVRNNEIPLEENMVLTDEPGYYE  515

Query  1941  DHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSY  2120
             D +FG+RIEN + V + DT + FG +G+L FE +T VPIQ K++D S+L+  EV+WLN Y
Sbjct  516   DGNFGVRIENCIKVVKADTKHNFGQVGFLTFEPITVVPIQKKMIDASLLTEFEVSWLNQY  575

Query  2121  HLQVWEKVSGLVDGRAR----EWLWNNTRPI  2201
             H +V   V   +  + +    +WL   T P+
Sbjct  576   HAKVRSLVGDELKRQGKKEVYQWLLQATEPL  606



>ref|XP_009142233.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Brassica rapa]
Length=638

 Score =   516 bits (1328),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 275/660 (42%), Positives = 394/660 (60%), Gaps = 66/660 (10%)
 Frame = +3

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             L +LR L +     +DA ++PS+D HQSE+++    RR ++SGFTGSAG A++TK++A L
Sbjct  5     LSSLRSLMASHSPPLDALVVPSEDYHQSEYVSARDKRREFVSGFTGSAGLALITKNEARL  64

Query  510   WTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEEL  689
             WTDGRYFLQA +QLS+ W LMR G    P    W++  LS  + IG+DP+  S D A   
Sbjct  65    WTDGRYFLQATQQLSNEWTLMRMGE--DPLLEVWMSDNLSEEANIGVDPWCVSVDTANRW  122

Query  690   KEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLI  869
              +  +K N +L+  +  +LVDE+W ++RP     P+ VH L++AG  V  KL  LRS L 
Sbjct  123   NKSFAKKNQKLI-PTTTDLVDEVW-QNRPPSQTSPLAVHPLEFAGRSVPDKLEELRSKLK  180

Query  870   NAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYL  1049
                +   VI+ LDE+AWL N+RG+DV + PV +A+ IV  D A L++D  K++ EV +Y 
Sbjct  181   QENARGYVIAALDEVAWLYNIRGTDVAYCPVAHAFAIVTTDSAFLYVDKKKVSDEVSEYF  240

Query  1050  KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNK  1229
             K +GVE+R Y                           I++    A DR   S     ++ 
Sbjct  241   KGLGVEVREYTD------------------------VISDVALLASDRLFLS--FSSKST  274

Query  1230  KSTNLDTNGLSGQP----HALY----------RSSPVSMAKAVKNSAELEGMQNCHLRDA  1367
             K   +D++ L   P    +ALY          + SP+S+ KA+KN  EL+G++  H+RD 
Sbjct  275   KDMEVDSDWLWVDPAKCCYALYSKLDADKVLLQPSPLSLPKALKNPVELDGLKKAHVRDG  334

Query  1368  AALAHFWAWLEEEICKDVG---------------------LTEVEVAEKLLEFRSKQYGF  1484
             AA+  +  WL++++ +  G                     LTE+ V++KL   R+ +  F
Sbjct  335   AAVVQYLVWLDQQMQELYGASGYFLEAESNKKKPTSETAKLTELTVSDKLESLRAAKEHF  394

Query  1485  LDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEP  1664
                SF TIS  G+N AIIHY PE  +C+ ++  +++L DSGAQY+DGTTDITRTVHFG+P
Sbjct  395   RGLSFPTISSVGSNAAIIHYSPEAGACAEMDPDKIYLCDSGAQYLDGTTDITRTVHFGKP  454

Query  1665  SSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALN  1844
             S+ EK+C+T V +GH+AL  A FP+ T G+ LD  AR+ LWK GLDYRHGTGHGVG+ L 
Sbjct  455   SAHEKDCYTAVFKGHVALGNARFPKGTSGYTLDILARAPLWKYGLDYRHGTGHGVGSYLF  514

Query  1845  VHEGPQGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIG  2021
             VHEGP  +SFR      P+   M V++EPGYYED +FGIR+EN+L V + +T   FG  G
Sbjct  515   VHEGPHQVSFRPHARNVPLQASMTVTDEPGYYEDGNFGIRLENVLVVNDAETEFNFGDKG  574

Query  2022  YLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             YL FE +T+ P Q KL++L  L+  E+ WLN+YHL+  + ++  ++    EWL   T P+
Sbjct  575   YLQFEHITWAPYQVKLINLEQLTQEEIEWLNTYHLKCKDILAPFMNQTEMEWLKKATEPV  634



>ref|XP_007173124.1| PREDICTED: xaa-Pro aminopeptidase 1 isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=587

 Score =   514 bits (1323),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 275/603 (46%), Positives = 376/603 (62%), Gaps = 29/603 (5%)
 Frame = +3

Query  411   SEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWG  590
             SE+IA C  RRA++SGF GSAGTA+VT++ AA+WTDGRYFLQA KQ+ S+W LM+ G   
Sbjct  4     SEYIAPCDCRRAFVSGFDGSAGTAIVTEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKD  63

Query  591   VPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKES  770
              PT  +WL SVL  GSR+G+DP +  +D  +++ + +    H L+ +   NLVD+IW + 
Sbjct  64    TPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKE-NLVDKIWTD-  121

Query  771   RPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVR  950
             RP+ P KP+    L Y G     K+  LR  +        V++ LDEIAWL NLRGSDV 
Sbjct  122   RPERPCKPLITLGLDYTGISWKDKVVDLRLKMAERNVVWFVVTALDEIAWLFNLRGSDVE  181

Query  951   HSPVMYAYLIVEIDGAKLFID-DSKITPEVMDYLK-SVGVELRAYesilseieslAEKGA  1124
             H+PV ++Y ++ ++   LFID D    P V ++L   +G+E              AE   
Sbjct  182   HNPVFFSYAVIGLETIMLFIDGDRTDVPSVKEHLLLDLGLE--------------AEYRI  227

Query  1125  NLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSM  1304
              +   KS     I +  KT C   S    +   +K S  + +  +          +P+ +
Sbjct  228   QVLPYKS-----ILSELKTLCASLSPREKVWVSDKASYAV-SEAIPKDHRCCMPYTPICI  281

Query  1305  AKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGF  1484
             AKAVKNSAE EGM+  H++DA AL   + WLE+E+ K  G+TE+  A+K  EFR +Q  F
Sbjct  282   AKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKG-GVTEISAADKAEEFRRQQADF  340

Query  1485  LDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEP  1664
             +D SF TIS +G NGAIIHY P P++   ++  E++L+DSGAQY DGTTD+TRT+HFG P
Sbjct  341   VDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTP  400

Query  1665  SSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALN  1844
             ++ EKECFT VL+GHIA+  AVFP  T G +LD+FARS+LW  GLDY HGTGHGVG+ LN
Sbjct  401   TAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLN  460

Query  1845  VHEGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGY  2024
             VHEGP GIS++  +  P+  GM+V++EPGYYED +FGIRIEN++ V  + T   F   G 
Sbjct  461   VHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFSNRGS  520

Query  2025  LGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAR----EWLWNNT  2192
             L F+ LT VPIQ K++D+  L+  E  WLN+YHL   + +   +  + R    EWL   T
Sbjct  521   LTFDPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRET  580

Query  2193  RPI  2201
              PI
Sbjct  581   EPI  583



>ref|XP_004512011.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Cicer arietinum]
Length=655

 Score =   516 bits (1329),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 278/657 (42%), Positives = 393/657 (60%), Gaps = 37/657 (6%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D L ALR L +     + A ++PS+D HQSE+++    RR ++SGFTGSAG A++TKD+A
Sbjct  3     DTLSALRSLMASHSPPLHALVVPSEDYHQSEYVSGRDKRRQFVSGFTGSAGLALITKDEA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQAE+QLS  W LMR      P    W+   L   + IG+DP+  S D A+
Sbjct  63    LLWTDGRYFLQAEQQLSDQWKLMRMAE--DPAVDIWMADNLPKDAAIGVDPWCISIDTAQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
               +   +K   +LV  +  NLVDE+W  +RP      + V  LK+AG  V+ KL  LR  
Sbjct  121   RWERAFAKNQQKLVQTTK-NLVDEVWT-NRPPAEINAVTVQPLKFAGRSVTDKLKDLRKK  178

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L+   +  I+ + LDE+AWL N+RG+DV + PV++A+ IV  + A +++D  K++ EV  
Sbjct  179   LVQEHARGIIFTTLDEVAWLYNIRGNDVAYCPVVHAFAIVTSNSAFIYLDTRKLSIEVKT  238

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +L+  G+E++ Y S+  ++  LA    +  +   T+      + K   + +    G  + 
Sbjct  239   HLEENGIEIKEYTSVSFDVALLATDELDS-VSTGTLAEVSKESAKIPSETHKSVNGKHQA  297

Query  1224  NKKSTNLDTNGLSGQPHALY----------RSSPVSMAKAVKNSAELEGMQNCHLRDAAA  1373
              + S+N           ALY          + SP+++ KA+KN  EL+G++  H+RD AA
Sbjct  298   GENSSNFIWADPGSCCFALYSKLNPDTVLLQQSPLALPKALKNPVELDGLRKAHIRDGAA  357

Query  1374  LAHFWAWLEEEI---------------------CKDVGLTEVEVAEKLLEFRSKQYGFLD  1490
             +  +  WL++++                      K + LTEV V++KL EFR+ +  F  
Sbjct  358   VVQYLVWLDKKMQEIYGASGYFLEENSVKKEKHLKPLKLTEVTVSDKLEEFRASKEHFRG  417

Query  1491  TSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSS  1670
              SF TIS  G N AIIHY P+ D+C+ ++  +++L DSGAQY+DGTTDITRTVHFG PS 
Sbjct  418   LSFPTISSVGPNAAIIHYSPQADTCAELDPDKIYLFDSGAQYLDGTTDITRTVHFGRPSD  477

Query  1671  REKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVH  1850
              EK C+T VL+GHIAL  A FP  T G  LD  AR  LW  GLDYRHGTGHG+G+ LNVH
Sbjct  478   HEKSCYTAVLKGHIALGNAKFPNGTNGHTLDILARIPLWNYGLDYRHGTGHGIGSYLNVH  537

Query  1851  EGPQGISFRFGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLG  2030
             EGPQ ISFR  N+ P+   M V++EPGYYED  FGIR+EN+L VKE DT   FG  GYL 
Sbjct  538   EGPQLISFRIRNV-PLQSSMTVTDEPGYYEDGEFGIRLENVLIVKEADTKFNFGDKGYLS  596

Query  2031  FEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             FE +T+ P Q KL+DL++L+  E+ WLNSYH +  + ++  +D     WL   T+P+
Sbjct  597   FEHITWAPYQTKLIDLNLLNPEEINWLNSYHSKCRDILAPYLDEAENAWLKKATQPV  653



>gb|KGN48807.1| hypothetical protein Csa_6G501960 [Cucumis sativus]
Length=637

 Score =   515 bits (1326),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 275/641 (43%), Positives = 399/641 (62%), Gaps = 23/641 (4%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D L ALR L +     +DA ++PS+D HQSE+++    RR ++SGFTGS G A+VT+ +A
Sbjct  3     DTLSALRILMASHTPPLDALVVPSEDYHQSEYVSARDKRREFVSGFTGSTGLALVTQTEA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTDGRYFLQA +QLS  W LMR G    P    W+   L   + +G+DP+  S + ++
Sbjct  63    LLWTDGRYFLQAIQQLSDPWKLMRMGE--DPPVDLWMADNLPADAAVGVDPWCVSVNTSQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
                   SK   +LV  +  NLVDE+WK +RP P   P+ +H L+Y G  V  KL +LR+ 
Sbjct  121   IWIRAFSKKEQKLV-QTTTNLVDEVWK-NRPPPEINPVMIHPLEYTGRSVEDKLKTLRTK  178

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    +  ++++ LDE+AWL N+RGSDV +SPV++A+ IV ++ A  ++D  K++ EV  
Sbjct  179   LSQEKAHGLIVTGLDEVAWLYNIRGSDVSYSPVVHAFAIVTLNSAFFYVDKRKVSDEVRL  238

Query  1044  YLKSVGVELRAYesilseieslA-------------EKGANLWLDKSTVNAAITNAYKTA  1184
             Y++  G+E+R Y ++++++  LA             E  AN+ ++ S+++ A +N  K  
Sbjct  239   YMERNGIEVRDYSAVITDVSLLASNQLNLSSFVKGSEVKANVEVELSSIDIAGSNGTKVE  298

Query  1185  CDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRD  1364
                 S+S  +   +                 L + SP+++ KA+KNS EL+G++  H+RD
Sbjct  299   ----SQSSDLIWVDPAQCCYALYSKLNSDKVLLQQSPLALEKALKNSVELDGLKKAHIRD  354

Query  1365  AAALAHFWAWLEEEICKDVG-LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIH  1541
               A+  +  WL+++  +D   LTEV V++KL  FR+ +  F   SF TIS  G+N AIIH
Sbjct  355   GVAVVQYLVWLDKQGMEDSKKLTEVSVSDKLEAFRASKEHFRGLSFPTISSVGSNAAIIH  414

Query  1542  YKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALD  1721
             Y P+ ++C+ ++   ++L DSGAQY+DGTTDITRTVHFG PS+ EK C+T VL+GHIAL 
Sbjct  415   YGPKTETCAELDPESIYLFDSGAQYLDGTTDITRTVHFGLPSAHEKACYTAVLKGHIALG  474

Query  1722  QAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPM  1898
              A FP  T G  LD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP  ISFR      P+
Sbjct  475   NARFPNGTNGHSLDILARVPLWKYGLDYRHGTGHGIGSFLNVHEGPHLISFRPQAQNVPL  534

Query  1899  VPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDL  2078
                M V++EPGYYED +FGIR+EN+L VK+ DT   FG  GYL FE +T+ P Q KL+++
Sbjct  535   QASMTVTDEPGYYEDGAFGIRLENVLVVKDADTKFNFGDKGYLSFEHITWAPYQRKLINI  594

Query  2079  SILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             S+L+  E+ W+N+YH Q  + ++  +D   + WL   T PI
Sbjct  595   SLLTFEELNWVNTYHSQCRDILAPYLDESEKLWLNKATEPI  635



>ref|XP_009263316.1| hypothetical protein FPSE_11924 [Fusarium pseudograminearum CS3096]
 gb|EKJ67915.1| hypothetical protein FPSE_11924 [Fusarium pseudograminearum CS3096]
Length=642

 Score =   514 bits (1325),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 292/631 (46%), Positives = 389/631 (62%), Gaps = 25/631 (4%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LR L    + N+  YIIPS+D+H SE+IA+C  RRA+ISGFTGSAG AVVT + AA
Sbjct  32    RLTRLRGLMK--ERNVQVYIIPSEDSHSSEYIAECDARRAFISGFTGSAGCAVVTLESAA  89

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA  QL  +W L++ G   VPT  +W     S G  +G+DP L S   A+ 
Sbjct  90    LATDGRYFNQAASQLDDNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISGSTAKG  149

Query  687   LKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
             L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  V +KL  +R +
Sbjct  150   LAEKIRKNGGAELVAVDG-NLVDLVWGDERPARPSEKVIIQPDELAGESVLNKLNKVRQE  208

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             +    S   ++SMLDEIAWL NLRGSD+ ++PV +AY  V  D AKL+IDDSK+  E   
Sbjct  209   MGKKHSPGFLVSMLDEIAWLFNLRGSDIPYNPVFFAYATVTPDAAKLYIDDSKLDDECRS  268

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKR  1223
             +L S  VE++ Y+               ++ D   ++AA++   KT  D  +        
Sbjct  269   HLTSNKVEIKPYD--------------TVFEDSQALHAAVSE--KTKTDDKAPKGNFLIS  312

Query  1224  NKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEE  1403
             NK S  L    + G        S +  AKA+K  AEL+GM++CH+RD A+L  ++AWLE+
Sbjct  313   NKGSWAL-KRAIGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGASLIQYFAWLED  371

Query  1404  EIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNR  1580
             ++  K+  L EV+ A+KL   R ++  F+  SF TIS +GAN AIIHY PE  +C+ ++ 
Sbjct  372   QLVNKNATLDEVQAADKLEALRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNCATIDP  431

Query  1581  HELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVL  1760
               ++L DSGAQY DGTTD TRT+HFG PS  E+E +T VL+GHI+LDQA+FP+ T GF L
Sbjct  432   KAIYLCDSGAQYRDGTTDTTRTLHFGTPSDAEREAYTLVLKGHISLDQAIFPKGTTGFAL  491

Query  1761  DAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSNEPGYY  1937
             D  AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SNEPGYY
Sbjct  492   DGLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSNEPGYY  551

Query  1938  EDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNS  2117
             ED  +GIRIEN++ VKE+ T + FG   +LGFE +T VP    L+D ++L++ E  WLN+
Sbjct  552   EDGKYGIRIENMVLVKEVKTKHSFGDKPFLGFEYVTMVPYCRNLIDTTLLTSEEKDWLNT  611

Query  2118  YHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
             Y+ +V EK  G  +G      WL   T  ID
Sbjct  612   YNEKVLEKTQGYFEGDDVTTAWLKRETVRID  642



>gb|KDB11556.1| Xaa-Pro aminopeptidase [Ustilaginoidea virens]
Length=618

 Score =   513 bits (1322),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 269/630 (43%), Positives = 372/630 (59%), Gaps = 22/630 (3%)
 Frame = +3

Query  327   RLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAA  506
             RL  LR L    + N+D Y+IPS+D+H SE+IA C  RR +ISGFTGSAG AVVT D A+
Sbjct  7     RLAKLRSLMK--ERNVDVYVIPSEDSHSSEYIAACDARREFISGFTGSAGCAVVTLDAAS  64

Query  507   LWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEE  686
             L TDGRYF QA ++L ++W L++ G   VPT  EW  +  + G  + +D  L    AA++
Sbjct  65    LATDGRYFSQAAQELDANWTLLKQGLQDVPTWQEWTANQAAGGKTVAVDSTLIPGLAAKK  124

Query  687   LKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDL  866
             L   I       +     NLVD +W   RP  P+ P+ V +  +AG     K+  L+ +L
Sbjct  125   LDGQIRNAGGAALIPLGENLVDMVWSSDRPSRPQLPVTVLEDNFAGKSAVRKIDELQQEL  184

Query  867   INAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDY  1046
                      +SMLDEIAWL NLRGSD+ ++PV ++Y  +  D A L+IDD ++T     +
Sbjct  185   RKKNCPGFFVSMLDEIAWLFNLRGSDIPYNPVFFSYATITPDAAILYIDDCRLTDACKAH  244

Query  1047  LKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRN  1226
             L++  ++++ Y+                + D   ++  +    ++A D   + PG+   +
Sbjct  245   LENSNIQVKPYDV--------------FFADAEKLHTEVAAKRQSAADE--KPPGMFLIS  288

Query  1227  KKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEE  1406
              K +      L G        SP+  AKA KN  E++GM++CH+RD AAL  F+AWLE++
Sbjct  289   NKGSWALGRALGGDGSVEEIRSPIGDAKATKNETEMKGMRDCHIRDGAALIEFFAWLEDQ  348

Query  1407  -ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRH  1583
              + K   + EV+ A+KL E RSK   F+  SF TIS SG N A+IHY P+   C+ ++  
Sbjct  349   LVAKKAMIDEVQAADKLEEIRSKHQRFMGLSFTTISSSGPNAAVIHYGPKRGDCATIDPA  408

Query  1584  ELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLD  1763
              ++L DSGAQY+DGTTD TRTVHFG+P   E+  +T VL+G I+LD AVFP+ T GF LD
Sbjct  409   SVYLCDSGAQYLDGTTDTTRTVHFGQPKDSERTAYTLVLKGLISLDTAVFPKGTTGFALD  468

Query  1764  AFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNEPGYYE  1940
               AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R      P+ PG V+SNEPGYYE
Sbjct  469   CLARQHLWKSGLDYRHGTGHGVGSYLNVHEGPIGIGTRVQYTEVPLAPGNVLSNEPGYYE  528

Query  1941  DHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSY  2120
             D +FG+RIEN++ V+E+ T + FG   +LGFE +T VP   +L+D  +L   E AWLN Y
Sbjct  529   DGNFGVRIENIMMVREVKTKHCFGDKPFLGFEHITMVPYCQRLIDRDLLGPDEKAWLNEY  588

Query  2121  HLQVWEKVSGLV--DGRAREWLWNNTRPID  2204
             + ++ E        D     WL   T  ID
Sbjct  589   NSEILESTKTFFENDALTMTWLQRETALID  618



>ref|XP_008023181.1| hypothetical protein SETTUDRAFT_128091 [Setosphaeria turcica 
Et28A]
 gb|EOA89396.1| hypothetical protein SETTUDRAFT_128091 [Setosphaeria turcica 
Et28A]
Length=654

 Score =   514 bits (1324),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 293/633 (46%), Positives = 392/633 (62%), Gaps = 27/633 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   RL  LR+L    + N+D Y++PS+D+HQSE+IA C  RRAYISGFTGSAG AVVT
Sbjct  44    VDTSHRLAELRKLMK--ERNVDIYMVPSEDSHQSEYIAPCDARRAYISGFTGSAGYAVVT  101

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
             +DKAAL TDGRYF QAEKQL S+W L++ G   VPT  EW       G  +G+DP + ++
Sbjct  102   QDKAALSTDGRYFNQAEKQLDSNWELLKQGIQDVPTIQEWTAEQAEGGKVVGVDPSVVTA  161

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A +L + I K   E   +   NLVD +W   RP  P + + V   KYAG   + K+  
Sbjct  162   ADARKLADKIKKKGGEYKAVDE-NLVDLVWGAERPARPSEMVIVQPDKYAGKSFTDKIED  220

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L    S   V+SMLDEIAWL NLRGSD+ ++PV ++Y ++    A L+++DSK++ 
Sbjct  221   LRKELDKRKSLGFVVSMLDEIAWLFNLRGSDIPYNPVFFSYAVITPTAATLYVNDSKLSE  280

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             +V  +L    V +R YE+              ++ D +    A++     A D  +    
Sbjct  281   DVKKHLGD-KVSIRPYEA--------------IFGDVT----ALSKEMFAANDEGAAPKK  321

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 N+ S  L+   L G+       SPV  AKAVKN  ELEGM+  H+RD AAL+ ++A
Sbjct  322   FLTSNRASWALN-KALGGEDKVEETRSPVGDAKAVKNEVELEGMRQSHIRDGAALSEYFA  380

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE++ I K   L EV+ A+KL E R K   F+  SFDTIS +G N A+IHYKPE  +CS
Sbjct  381   WLEDQLINKKATLDEVDAADKLEEIRKKHDMFMGLSFDTISSTGPNAAVIHYKPEKGACS  440

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             +++   ++L DSGAQY DGTTD TRT+HF EPS  E++ +T VL+G++AL++  FP+ T 
Sbjct  441   VIDPKAIYLCDSGAQYRDGTTDTTRTLHFTEPSEMERKAYTLVLKGNMALERVKFPKGTT  500

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LDA AR  LW  GLDYRHGTGHGVG+ LNVHEGP GI  R   +   +  G VVS+E
Sbjct  501   GFALDALARQFLWAEGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYSEVSLAVGNVVSDE  560

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  FGIRIEN++ VKE++T ++FG   YLGFE +T  P   KLVD+S+L+  E  
Sbjct  561   PGYYEDGKFGIRIENMVMVKEVETKHKFGDKPYLGFEHVTMTPHCRKLVDMSLLTDDEKK  620

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWLWNNTRP  2198
             +LN YH +V++K S     D     WL   T P
Sbjct  621   FLNEYHQEVYDKTSHFFEKDALTLAWLKRETAP  653



>ref|XP_003537557.1| PREDICTED: probable Xaa-Pro aminopeptidase P-like [Glycine max]
Length=657

 Score =   514 bits (1324),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 282/659 (43%), Positives = 397/659 (60%), Gaps = 37/659 (6%)
 Frame = +3

Query  321   EDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDK  500
             ED L ALR L       +DA ++PS+D HQSE+++    RR ++SGFTGSAG A++TK++
Sbjct  2     EDTLSALRSLMLSQSPPLDALVVPSEDYHQSEYVSARDKRREFVSGFTGSAGLALITKNE  61

Query  501   AALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAA  680
             A LWTDGRYFLQAE++LS+ W LMR G    P    W+   L   + IG+DP+  S D A
Sbjct  62    ALLWTDGRYFLQAEQELSAQWKLMRIGE--DPAVDIWMADNLPKEASIGVDPWCISIDTA  119

Query  681   EELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRS  860
             +  +   ++   +LV  S  NLVDE+W  +RPQP    + VH LK+AG  V+ KL  LR 
Sbjct  120   QRWERAFAEKQQKLVPTSK-NLVDEVWI-NRPQPQINAVIVHPLKFAGRSVADKLKDLRK  177

Query  861   DLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVM  1040
              L++  +  I+ + LDE+AWL N+RGSDV + PV++A+ IV  + A +++D  K++ EV 
Sbjct  178   KLVHEQARGIIFTALDEVAWLYNIRGSDVAYCPVVHAFAIVTSNSAFIYVDKRKVSVEVQ  237

Query  1041  DYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKK  1220
              +L   G+E+R Y ++ S+   LA    +  +  + V  A T   K   +    + G  +
Sbjct  238   AHLVENGIEIREYTAVSSDTTLLATDELDS-VSTAKVALAETEVRKIPNETAKHANGEHQ  296

Query  1221  RNKKSTNLDTNGLSGQPHALY----------RSSPVSMAKAVKNSAELEGMQNCHLRDAA  1370
               + S +L         +ALY            SP+++AKA+KNS EL+G++  H+RD A
Sbjct  297   AEENSNDLIWADPGSCCYALYAKLNPDTVLLHQSPLALAKALKNSVELDGLKKAHIRDGA  356

Query  1371  ALAHFWAWLEEEICKDVG---------------------LTEVEVAEKLLEFRSKQYGFL  1487
             A+  +  WL++++   +G                     LTEV V+++L  FR+ +  F 
Sbjct  357   AVVQYLVWLDKKMQDILGASGYFLENDSVKKEKHLQSLKLTEVTVSDQLEGFRASKEHFR  416

Query  1488  DTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPS  1667
               SF TIS  G N AIIHY P+ ++C+ ++  +++L DSGAQY+DGTTDITRTVHFG+PS
Sbjct  417   GLSFPTISSVGPNAAIIHYSPKAETCAELDPDKIYLFDSGAQYLDGTTDITRTVHFGKPS  476

Query  1668  SREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNV  1847
             + EK C+T VL+GHIAL  A FP  T G  LD  AR  LWK GLDYRHGTGHG+G+ LNV
Sbjct  477   THEKACYTAVLKGHIALGNARFPNGTNGHSLDILARIPLWKDGLDYRHGTGHGIGSYLNV  536

Query  1848  HEGPQGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGY  2024
             HEGP  ISFR      P+   M V++EPGYYED  FGIR+EN+L VKE  T   FG  GY
Sbjct  537   HEGPHLISFRPQARNVPLQSSMTVTDEPGYYEDGEFGIRLENVLIVKEAGTNFNFGDRGY  596

Query  2025  LGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             L FE +T+ P Q KL+DL++L   E+ WLNSYH    + ++  ++     WL   T P+
Sbjct  597   LSFEHITWAPYQTKLIDLNLLCPEEIDWLNSYHSTCRDILAPYLNEVENAWLKKATEPV  655



>emb|CCT69308.1| probable aminopeptidase P, cytoplasmic [Fusarium fujikuroi IMI 
58289]
Length=619

 Score =   512 bits (1319),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 292/636 (46%), Positives = 395/636 (62%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGFTGSAG AVVT
Sbjct  4     LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              + AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  +G+DP L S 
Sbjct  62    LESAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  V +KL 
Sbjct  122   STAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPSRPSEQVIIQPDELAGESVLNKLT  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D AKL+ID++K+ 
Sbjct  181   KVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAAKLYIDEAKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L S  V+++ YE+              ++ D   ++AA  +A K+       + 
Sbjct  241   DKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEKSKSGDKVPTG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        S +  AKA+K  AEL+GM++CH+RD AAL  ++
Sbjct  285   NFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGAALIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K V L EV+ A+KL E R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  344   AWLEDQLVNKKVKLDEVQAADKLEELRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  404   ATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTEAEREAYTLVLKGHISLDQAIFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  464   TGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  523

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+D ++L++ E 
Sbjct  524   EPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLIDTTLLTSEEK  583

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  584   EWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  619



>gb|EHA21208.1| hypothetical protein ASPNIDRAFT_213466 [Aspergillus niger ATCC 
1015]
Length=1756

 Score =   541 bits (1394),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 283/609 (46%), Positives = 386/609 (63%), Gaps = 27/609 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D  +RL  LRQL    +  +D YI+PS+D+HQSE+IA C  RR +ISGF+GSAGTA+++
Sbjct  4     VDTSERLTRLRQLMQ--ERKVDVYIVPSEDSHQSEYIAPCDGRREFISGFSGSAGTAIIS  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
               KAAL TDGRYF QA KQL S+W L++ G  G PT  EW       G  +G+DP L + 
Sbjct  62    MTKAALSTDGRYFNQASKQLDSNWALLKRGVEGFPTWQEWTTEQAEGGKVVGVDPALVTP  121

Query  672   DAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFS  851
               A  L E + K    LV +   NLVD +W + RP PP++ +RVH  +YAG     K+  
Sbjct  122   AGARSLSETLKKNGSSLVGVEQ-NLVDLVWGKDRPAPPREAVRVHPAQYAGKSFQEKISD  180

Query  852   LRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITP  1031
             LR +L N  ++ IVISMLDEIAWL NLRG+D+ ++PV ++Y ++      L++D+ K+TP
Sbjct  181   LRKELENKKAAGIVISMLDEIAWLFNLRGTDIPYNPVFFSYALITPTTVDLYVDEDKLTP  240

Query  1032  EVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPG  1211
             EV  +L    V ++ Y+              +++ D      A++ A K   D    +P 
Sbjct  241   EVKAHLGQ-DVVIKPYD--------------SIFADAK----ALSEARKQ--DATGAAPK  279

Query  1212  IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWA  1391
                 NK S  L  + L G+       SP++ AKA+KN  EL GM++CH+RD AAL  ++A
Sbjct  280   FLLSNKASWALSLS-LGGEEQVEEVRSPIADAKAIKNDVELAGMRSCHVRDGAALIEYFA  338

Query  1392  WLEEE-ICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             WLE E I K   L EV+ A+KL + RSK   +   SFDTIS +G NGA+IHYKPE  SCS
Sbjct  339   WLENELINKKTTLDEVDAADKLEQIRSKHDLYAGLSFDTISSTGPNGAVIHYKPEKGSCS  398

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
             I++   ++L DSGAQY+DGTTD+TRT HFG P+  EK+ FT VL+G I++D AVFP+ T 
Sbjct  399   IIDPTAIYLCDSGAQYLDGTTDVTRTFHFGNPTDLEKKAFTLVLKGLISIDTAVFPKGTS  458

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFG-NMTPMVPGMVVSNE  1925
             GF LDA AR  LWK GLDY HGTGHG+G+ LNVHEGP GI  R      P+  G V+S+E
Sbjct  459   GFALDALARQFLWKEGLDYLHGTGHGIGSYLNVHEGPMGIGTRVQYTEVPIAAGNVISDE  518

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PG+YED  FGIRIEN++  +E+ T ++FG   +LGFE +T  P+   L++ ++LS  E+ 
Sbjct  519   PGFYEDGKFGIRIENVIMAREVQTTHKFGEKPWLGFEHVTTAPLGRNLINATLLSEDELK  578

Query  2106  WLNSYHLQV  2132
             W+N YH +V
Sbjct  579   WVNEYHAEV  587



>gb|ENH74646.1| Putative Xaa-Pro aminopeptidase P [Fusarium oxysporum f. sp. 
cubense race 1]
Length=619

 Score =   511 bits (1316),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 292/636 (46%), Positives = 394/636 (62%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGFTGSAG AVVT
Sbjct  4     LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              D AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  +G+DP L S 
Sbjct  62    LDSAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  V +KL 
Sbjct  122   STAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPSRPSEQVIIQPDELAGESVLNKLT  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D AKL+ID++K+ 
Sbjct  181   KVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAAKLYIDEAKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L S  V+++ YE+              ++ D   ++AA  +A K+       + 
Sbjct  241   DKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEKSKSGDKVPTG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        S +  AKA+K  AEL+GM++CH+RD AAL  ++
Sbjct  285   NFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGAALIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  344   AWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  404   ATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHISLDQAIFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  464   TGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  523

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+D ++L++ E 
Sbjct  524   EPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLIDTTLLTSEEK  583

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  584   EWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  619



>gb|EXM23689.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23690.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23691.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=619

 Score =   511 bits (1316),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 292/636 (46%), Positives = 394/636 (62%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGFTGSAG AVVT
Sbjct  4     LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              D AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  +G+DP L S 
Sbjct  62    LDSAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  V +KL 
Sbjct  122   STAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPSRPSEQVIIQPDELAGESVLNKLT  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D AKL+ID++K+ 
Sbjct  181   KVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAAKLYIDEAKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L S  V+++ YE+              ++ D   ++AA  +A K+       + 
Sbjct  241   DKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEKSKSGDKVPTG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        S +  AKA+K  AEL+GM++CH+RD AAL  ++
Sbjct  285   NFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGAALIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  344   AWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  404   ATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHISLDQAIFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  464   TGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  523

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+D ++L++ E 
Sbjct  524   EPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLIDTTLLTSEER  583

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  584   EWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  619



>ref|XP_382779.1| hypothetical protein FG02603.1 [Fusarium graminearum PH-1]
Length=642

 Score =   511 bits (1317),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 286/617 (46%), Positives = 382/617 (62%), Gaps = 23/617 (4%)
 Frame = +3

Query  369   NIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQ  548
             N+  YIIPS+D+H SE+IA+C  RRAYISGFTGSAG AVVT + AAL TDGRYF QA  Q
Sbjct  44    NVQVYIIPSEDSHSSEYIAECDARRAYISGFTGSAGCAVVTLESAALATDGRYFNQAASQ  103

Query  549   LSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEELKEDISK-GNHELV  725
             L  +W L++ G   VPT  +W     S G  +G+DP L S   A+ L E I K G  ELV
Sbjct  104   LDDNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISGSTAKGLAEKIRKNGGAELV  163

Query  726   FLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLINAGSSAIVISML  905
              +   NLVD +W + RP  P + + +   + AG  V +KL  +R ++    S   ++SML
Sbjct  164   AVDG-NLVDLVWGDERPARPSEKVIIQPDELAGESVLNKLNKVRQEMGKKHSPGFLVSML  222

Query  906   DEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYLKSVGVELRAYes  1085
             DEIAWL NLRGSD+ ++PV +AY  V  D AKL+IDDSK+  E   +L S  VE++ Y+ 
Sbjct  223   DEIAWLFNLRGSDIPYNPVFFAYATVTPDAAKLYIDDSKLDDECRSHLTSNKVEIKPYD-  281

Query  1086  ilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSPGIKKRNKKSTNLDTNGLSG  1265
                           ++ D   ++A+++   KT  D  +        NK S  L    + G
Sbjct  282   -------------TVFEDSQALHASVSE--KTKTDDKAPKGNFLISNKGSWAL-KRAIGG  325

Query  1266  QPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLEEEIC-KDVGLTEVEV  1442
                     S +  AKA+K  AEL+GM++CH+RD A+L  ++AWLE+++  K   L EV+ 
Sbjct  326   DSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGASLIQYFAWLEDQLVNKKATLDEVQA  385

Query  1443  AEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVD  1622
             A+KL   R ++  F+  SF TIS +GAN AIIHY PE  +C+ ++   ++L DSGAQY D
Sbjct  386   ADKLEALRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNCATIDPKAIYLCDSGAQYRD  445

Query  1623  GTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLD  1802
             GTTD TRT+HFG P+  E+E +T VL+GHI+LDQA+FP+ T GF LD  AR  LWK GLD
Sbjct  446   GTTDTTRTLHFGTPTDAEREAYTLVLKGHISLDQAIFPKGTTGFALDGLARQHLWKNGLD  505

Query  1803  YRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSNEPGYYEDHSFGIRIENLLY  1979
             YRHGTGHGVG+ LNVHEGP GI  R       + PG V+SNEPGYYED  +GIRIEN++ 
Sbjct  506   YRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSNEPGYYEDGKYGIRIENMVL  565

Query  1980  VKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVD  2159
             VKE+ T + FG   +LGFE +T VP    L+D ++L++ E  WLN+Y+ +V EK  G  +
Sbjct  566   VKEVKTKHSFGDKPFLGFEYVTMVPYCRNLIDTTLLTSVEKDWLNTYNEKVIEKTQGYFE  625

Query  2160  GR--AREWLWNNTRPID  2204
             G      WL   T  ID
Sbjct  626   GDDVTTAWLKRETVRID  642



>gb|EMT70711.1| Putative Xaa-Pro aminopeptidase P [Fusarium oxysporum f. sp. 
cubense race 4]
 gb|EXL98860.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
 gb|EXL98861.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
 gb|EXL98862.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
Length=619

 Score =   511 bits (1315),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 291/636 (46%), Positives = 395/636 (62%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGFTGSAG AVVT
Sbjct  4     LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              + AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  +G+DP L S 
Sbjct  62    LESAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W++ RP  P + + +   + AG  V +KL 
Sbjct  122   STAKNLAEKIRKNGGAELVPVDG-NLVDLVWEDERPSRPSEQVIIQPDELAGESVLNKLT  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D AKL+ID++K+ 
Sbjct  181   KVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAAKLYIDEAKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L S  V+++ YE+              ++ D   ++AA  +A K+       + 
Sbjct  241   DKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEKSKSGDKVPTG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        S +  AKA+K  AEL+GM++CH+RD AAL  ++
Sbjct  285   NFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGAALIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  344   AWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  404   ATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHISLDQAIFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  464   TGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  523

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+D ++L++ E 
Sbjct  524   EPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLIDTTLLTSEEK  583

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  584   EWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  619



>gb|EXK92152.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK92153.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK92154.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. raphani 54005]
Length=619

 Score =   511 bits (1315),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 291/636 (46%), Positives = 394/636 (62%), Gaps = 25/636 (4%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGFTGSAG AVVT
Sbjct  4     LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGFTGSAGCAVVT  61

Query  492   KDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSS  671
              D AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  +G+DP L S 
Sbjct  62    LDSAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKNVGVDPTLISG  121

Query  672   DAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
               A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + AG  V +KL 
Sbjct  122   STAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPSRPSEQVIIQPDELAGESVLNKLT  180

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D AKL++D++K+ 
Sbjct  181   KVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAAKLYVDEAKLD  240

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +   +L S  V+++ YE+              ++ D   ++AA  +A K+       + 
Sbjct  241   DKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEKSKSGDKVPTG  284

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
                  NK S  L    L G        S +  AKA+K  AEL+GM++CH+RD AAL  ++
Sbjct  285   NFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHVRDGAALIQYF  343

Query  1389  AWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSC  1565
             AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AIIHY PE  +C
Sbjct  344   AWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAIIHYGPERGNC  403

Query  1566  SIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENT  1745
             + ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+LDQA+FP+ T
Sbjct  404   ATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHISLDQAIFPKGT  463

Query  1746  PGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-TPMVPGMVVSN  1922
              GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R       + PG V+SN
Sbjct  464   TGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVALAPGNVLSN  523

Query  1923  EPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEV  2102
             EPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+D ++L++ E 
Sbjct  524   EPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLIDTTLLTSEEK  583

Query  2103  AWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
              WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  584   EWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  619



>ref|XP_010029829.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Eucalyptus grandis]
Length=642

 Score =   511 bits (1316),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 278/648 (43%), Positives = 389/648 (60%), Gaps = 32/648 (5%)
 Frame = +3

Query  324   DRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKA  503
             D+L ALR L S     +DA ++PS+D HQSE+++    RR ++SGFTGS G A++T+ +A
Sbjct  3     DKLDALRSLMSSHSPPLDALVVPSEDYHQSEYVSSRDKRREFVSGFTGSTGLALITRKEA  62

Query  504   ALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAE  683
              LWTD RYFLQA +QLS  W LMR G    P    W+   L   + IG DP+  S D A+
Sbjct  63    LLWTDARYFLQAAQQLSDQWKLMRIGE--DPAVDVWMVDNLPHDAAIGTDPWCVSIDTAQ  120

Query  684   ELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSD  863
               +   +K   +LV  S  NLVDE+WK +RP     P+ VH L++AG   + KL  LR  
Sbjct  121   RWEPAFAKKQQKLVQTST-NLVDEVWK-NRPPLEINPVNVHALEFAGRSATDKLNDLRER  178

Query  864   LINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMD  1043
             L    +  I+I+ LDE+AWL N+RGSDV + PV+ A+ IV    A  ++D  K++ EV  
Sbjct  179   LTQEKARGIIITALDEVAWLYNIRGSDVSYCPVVQAFAIVTRTSAFFYVDQRKLSSEVSG  238

Query  1044  YLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAI-TNAYKTACDRYSRSPGIKK  1220
             YL   G+E+R Y ++ +++ SLA         K T   +I T A     D    +     
Sbjct  239   YLMENGIEVREYGAVTADVSSLASNQLGPCAFKETQTESIKTEAEDGGSDDLIWADPGSC  298

Query  1221  RNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFWAWLE  1400
                  + LD+N        L + SP+++AKA+KN  EL+G++  H+RD AA+  +  WL+
Sbjct  299   CYALYSKLDSNRF------LLKQSPLALAKALKNPIELDGLRKAHIRDGAAVVQYLVWLD  352

Query  1401  EEICKDVG--------------------LTEVEVAEKLLEFRSKQYGFLDTSFDTISGSG  1520
             +++ ++ G                    LTE+ V++KL  FR+ +  F   SF TIS  G
Sbjct  353   KQMHENYGASGYFEEGETLAQKNREGKKLTELTVSDKLESFRASKEHFKSLSFPTISSVG  412

Query  1521  ANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVL  1700
              N A+ HY+P+P++C+ ++   ++L DSGAQY+DGTTDITRTVHFG PS+ EK C+T VL
Sbjct  413   PNAAMNHYRPQPNTCAELDADSIYLFDSGAQYLDGTTDITRTVHFGRPSAHEKACYTAVL  472

Query  1701  QGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRF  1880
             +GHIAL  A FP+ T G+ LD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP  IS+  
Sbjct  473   KGHIALGNARFPKGTTGYALDILARLPLWKDGLDYRHGTGHGIGSYLNVHEGPHSISYGT  532

Query  1881  GNM-TPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPI  2057
               +  PM   M V++EPGYYED +FGIR+ENLL V E DT   FG  GYL FE +T+ P 
Sbjct  533   RALNVPMQASMTVTDEPGYYEDGNFGIRLENLLVVIEADTKFNFGDKGYLSFEHITWAPY  592

Query  2058  QAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
             Q KL++LS+L+  E+ WLN+YH +  + ++  +D     WL   T P+
Sbjct  593   QTKLINLSLLTTEEIDWLNAYHSKCRDILAPYLDDAEMAWLKKATEPV  640



>gb|EXK92149.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK92150.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK92151.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. raphani 54005]
Length=652

 Score =   511 bits (1317),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 295/646 (46%), Positives = 398/646 (62%), Gaps = 28/646 (4%)
 Frame = +3

Query  282   SSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGF  461
             SSE   K   LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGF
Sbjct  30    SSETMTK---LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGF  84

Query  462   TGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSR  641
             TGSAG AVVT D AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  
Sbjct  85    TGSAGCAVVTLDSAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKN  144

Query  642   IGIDPFLFSSDAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKY  818
             +G+DP L S   A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + 
Sbjct  145   VGVDPTLISGSTAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPSRPSEQVIIQPDEL  203

Query  819   AGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGA  998
             AG  V +KL  +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D A
Sbjct  204   AGESVLNKLTKVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAA  263

Query  999   KLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK  1178
             KL++D++K+  +   +L S  V+++ YE+              ++ D   ++AA  +A K
Sbjct  264   KLYVDEAKLDDKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEK  307

Query  1179  TACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHL  1358
             +       +      NK S  L    L G        S +  AKA+K  AEL+GM++CH+
Sbjct  308   SKSGDKVPTGNFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHV  366

Query  1359  RDAAALAHFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             RD AAL  ++AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AI
Sbjct  367   RDGAALIQYFAWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAI  426

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIA  1715
             IHY PE  +C+ ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+
Sbjct  427   IHYGPERGNCATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHIS  486

Query  1716  LDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-T  1892
             LDQA+FP+ T GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R      
Sbjct  487   LDQAIFPKGTTGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEV  546

Query  1893  PMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLV  2072
              + PG V+SNEPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+
Sbjct  547   ALAPGNVLSNEPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLI  606

Query  2073  DLSILSAAEVAWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
             D ++L++ E  WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  607   DTTLLTSEEKEWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  652



>dbj|GAC95812.1| hypothetical protein PHSY_003389 [Pseudozyma hubeiensis SY62]
Length=1128

 Score =   526 bits (1356),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 289/627 (46%), Positives = 390/627 (62%), Gaps = 35/627 (6%)
 Frame = +3

Query  312   LDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVT  491
             +D   R++ALRQL S+  +   AY+IPS D H SE+ A+  +RR YI+GFTGSAG+AVVT
Sbjct  525   VDTTQRVQALRQLMSKHGVT--AYVIPSGDEHASEYPAESDLRRGYITGFTGSAGSAVVT  582

Query  492   KDKAALWTDGRYFLQAEKQLSSS-WILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFS  668
              +KA L+TDGRYFLQA +QL  S W LM+ G   VPT  E+L+  L   S+IG+D  L S
Sbjct  583   TNKALLFTDGRYFLQAGQQLEPSVWTLMKQGEPSVPTWQEYLSKNLPANSKIGMDASLIS  642

Query  669   SDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLF  848
             +D A+++  ++SK    LV +   NLVD++W E RP  P +PI V   + AG   S K+ 
Sbjct  643   ADDAKDITAELSKIGSSLVPIRE-NLVDQVWTE-RPSRPGQPIFVLKDEIAGRSSSDKIR  700

Query  849   SLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKIT  1028
              LR ++    +   V +MLDE+AWL NLRG+DV ++PV +++ +V ++   L+++D ++ 
Sbjct  701   ELRDEIKKKSAHGFVANMLDEVAWLFNLRGTDVPYNPVFFSFALVLLEKVLLYVNDHQLD  760

Query  1029  PEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTACDRYSRSP  1208
              +V + L S  V LR Y              A  + D   V A + + +K    + S S 
Sbjct  761   NDVKNALGSE-VTLRPY--------------AEFYNDLHKVGAELGDGHKILIGK-SASL  804

Query  1209  GIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAHFW  1388
              +++            L G        S V   K++KN  ELEG +  H+RD AAL  ++
Sbjct  805   AVQE-----------ALGGASKVEIVRSIVVDQKSIKNDVELEGFRQSHIRDGAALCQYF  853

Query  1389  AWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAIIHYKPEPDSCS  1568
             AWLEE++     +TE E A+KL +FR     F   SF TIS +G NGAIIHY P+P SC 
Sbjct  854   AWLEEQLHAGKKVTESEGADKLSQFRQSLPHFRGESFTTISSTGPNGAIIHYSPDPSSCP  913

Query  1569  IVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIALDQAVFPENTP  1748
              ++ +E++L DSGAQ+ DGTTD+TRT HFG+P+      FTRVLQGHIA+D+A+FP+ T 
Sbjct  914   AIDVNEIYLCDSGAQFTDGTTDVTRTWHFGKPAPEHIRAFTRVLQGHIAIDRAIFPKGTT  973

Query  1749  GFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFR-FGNMTPMVPGMVVSNE  1925
             G++LD  AR +LW+ GLDYRHGTGHGVG  LNVHEGPQGI  R   N T +   MV+SNE
Sbjct  974   GYLLDVLARRALWEDGLDYRHGTGHGVGHFLNVHEGPQGIGTRAVFNETSLKENMVISNE  1033

Query  1926  PGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLVDLSILSAAEVA  2105
             PGYYED  +GIRIENL+ V+   TPN FG  GYL FE LT  PIQ  LVD  +L+  +  
Sbjct  1034  PGYYEDGKWGIRIENLVIVRPAKTPNNFGSKGYLTFEHLTMCPIQVSLVDADLLTREDKQ  1093

Query  2106  WLNSYHLQVWEKVSGLV--DGRAREWL  2180
             WLN YH +V  KV  L+  D RA+EWL
Sbjct  1094  WLNEYHEEVLAKVGPLLKEDKRAQEWL  1120



>gb|EXM23686.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23687.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23688.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=652

 Score =   511 bits (1316),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 296/646 (46%), Positives = 398/646 (62%), Gaps = 28/646 (4%)
 Frame = +3

Query  282   SSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGF  461
             SSE   K   LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGF
Sbjct  30    SSETMTK---LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGF  84

Query  462   TGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSR  641
             TGSAG AVVT D AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  
Sbjct  85    TGSAGCAVVTLDSAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKN  144

Query  642   IGIDPFLFSSDAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKY  818
             +G+DP L S   A+ L E I K G  ELV +   NLVD +W + RP  P + + +   + 
Sbjct  145   VGVDPTLISGSTAKNLAEKIRKNGGAELVPVDG-NLVDLVWGDERPSRPSEQVIIQPDEL  203

Query  819   AGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGA  998
             AG  V +KL  +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D A
Sbjct  204   AGESVLNKLTKVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAA  263

Query  999   KLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK  1178
             KL+ID++K+  +   +L S  V+++ YE+              ++ D   ++AA  +A K
Sbjct  264   KLYIDEAKLDDKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEK  307

Query  1179  TACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHL  1358
             +       +      NK S  L    L G        S +  AKA+K  AEL+GM++CH+
Sbjct  308   SKSGDKVPTGNFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHV  366

Query  1359  RDAAALAHFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             RD AAL  ++AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AI
Sbjct  367   RDGAALIQYFAWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAI  426

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIA  1715
             IHY PE  +C+ ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+
Sbjct  427   IHYGPERGNCATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHIS  486

Query  1716  LDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-T  1892
             LDQA+FP+ T GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R      
Sbjct  487   LDQAIFPKGTTGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEV  546

Query  1893  PMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLV  2072
              + PG V+SNEPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+
Sbjct  547   ALAPGNVLSNEPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLI  606

Query  2073  DLSILSAAEVAWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
             D ++L++ E  WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  607   DTTLLTSEEREWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  652



>ref|XP_011025722.1| PREDICTED: probable Xaa-Pro aminopeptidase P [Populus euphratica]
Length=644

 Score =   511 bits (1315),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 281/655 (43%), Positives = 389/655 (59%), Gaps = 48/655 (7%)
 Frame = +3

Query  330   LRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGFTGSAGTAVVTKDKAAL  509
             L +LR L +     +DA ++PS+D HQSE+++    RR ++SGFTGSAG A+VTK  A L
Sbjct  5     LASLRFLMASHSPPLDALVVPSEDYHQSEYVSARDKRREFVSGFTGSAGLALVTKKDARL  64

Query  510   WTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSRIGIDPFLFSSDAAEEL  689
             WTDGRYFLQA +QLS  W LMR G    P    W+   L   + IGIDP+  S D A+  
Sbjct  65    WTDGRYFLQATQQLSVEWTLMRMGE--DPGFDAWVADNLPVEAAIGIDPWCVSVDTAQRW  122

Query  690   KEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKYAGADVSSKLFSLRSDLI  869
             +   +K   +LV  +  NLVDE+WK SRP     P+ VH +++ G  V+ KL  LR+ L 
Sbjct  123   QLTFAKKQQKLV-QTETNLVDEVWK-SRPPAEINPVVVHPIEFTGCSVAQKLKDLRAKLK  180

Query  870   NAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGAKLFIDDSKITPEVMDYL  1049
             N  +  IV++ LDE+AWL N+RG+DV + PV++A+ I+  + A L++D  K++ E   Y+
Sbjct  181   NEKTRGIVVTTLDEVAWLYNIRGTDVSYCPVVHAFAIITSNSAFLYVDKKKVSAETNCYM  240

Query  1050  KSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYKTA---CDRYSRSPG---  1211
             +  G+++R Y  + S++  LA    +   +    + A  N    A    DR    PG   
Sbjct  241   EENGIDVRDYADVSSDVVLLASDQLDSTSEVKGTDTATGNGTTEAGHNIDRIWVDPGSCC  300

Query  1212  ---IKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHLRDAAALAH  1382
                  K N +  ++             + SP+++AKA+KN  EL+G++  H+RD AA+  
Sbjct  301   YALYSKLNSEKVHM-------------QQSPLALAKALKNPVELDGLKKAHVRDGAAVVQ  347

Query  1383  FWAWLEEEIC------------------KDVG---LTEVEVAEKLLEFRSKQYGFLDTSF  1499
             +  WL++++                   KD+G   LTEV V++KL  FR+ +  F   SF
Sbjct  348   YLVWLDKQMQESYGASGYFLEGQSANKKKDLGAIKLTEVTVSDKLEGFRASKEHFRGLSF  407

Query  1500  DTISGSGANGAIIHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREK  1679
              TIS  G N AIIHY P  ++C+ +N   ++L DSGAQY+DGTTDITRTVHFG PS+ EK
Sbjct  408   PTISSVGPNAAIIHYSPHAETCAELNPDSIYLFDSGAQYLDGTTDITRTVHFGNPSTHEK  467

Query  1680  ECFTRVLQGHIALDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGP  1859
              C+T VL+GHIAL  A FP  T G  LD  AR  LWK GLDYRHGTGHG+G+ LNVHEGP
Sbjct  468   ACYTAVLKGHIALGNACFPNGTNGHALDILARIPLWKDGLDYRHGTGHGIGSYLNVHEGP  527

Query  1860  QGISFR-FGNMTPMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFE  2036
               ISFR      P+   M V++EPGYYED +FGIR+EN+L VKE DT   FG  GYL FE
Sbjct  528   HLISFRPHARNVPLQASMTVTDEPGYYEDGNFGIRLENVLIVKEADTKFNFGDKGYLSFE  587

Query  2037  KLTFVPIQAKLVDLSILSAAEVAWLNSYHLQVWEKVSGLVDGRAREWLWNNTRPI  2201
              +T+ P Q K++DL++L   E+ WLN YH +  + ++  +D     WL   T PI
Sbjct  588   HITWAPYQTKMIDLTLLGPEEINWLNIYHGRCRDILAPYLDESEMAWLNKATEPI  642



>gb|EXL98857.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
 gb|EXL98858.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
 gb|EXL98859.1| xaa-Pro aminopeptidase [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
Length=652

 Score =   511 bits (1316),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 295/646 (46%), Positives = 399/646 (62%), Gaps = 28/646 (4%)
 Frame = +3

Query  282   SSEFQKKPRGLDQEDRLRALRQLFSRPDINIDAYIIPSQDAHQSEFIADCYMRRAYISGF  461
             SSE   K   LD   RL  LR L    +++I  YI+PS+D+H SE+IADC  RRAYISGF
Sbjct  30    SSETMTK---LDTTSRLTRLRGLMKERNVHI--YIVPSEDSHSSEYIADCDARRAYISGF  84

Query  462   TGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNWGVPTPSEWLNSVLSPGSR  641
             TGSAG AVVT + AAL TDGRYF QA  QL S+W L++ G   VPT  +W     S G  
Sbjct  85    TGSAGCAVVTLESAALATDGRYFNQATSQLDSNWTLLKQGLQDVPTWQDWSAEQSSGGKN  144

Query  642   IGIDPFLFSSDAAEELKEDISK-GNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLKY  818
             +G+DP L S   A+ L E I K G  ELV +   NLVD +W++ RP  P + + +   + 
Sbjct  145   VGVDPTLISGSTAKNLAEKIRKNGGAELVPVDG-NLVDLVWEDERPSRPSEQVIIQPDEL  203

Query  819   AGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDGA  998
             AG  V +KL  +R +L    S   ++SMLDEIAWL NLRG+D+ ++PV +AY  V  D A
Sbjct  204   AGESVLNKLTKVRQELEKKHSPGFLVSMLDEIAWLFNLRGNDIPYNPVFFAYATVTPDAA  263

Query  999   KLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAYK  1178
             KL+ID++K+  +   +L S  V+++ YE+              ++ D   ++AA  +A K
Sbjct  264   KLYIDEAKLDDKCRSHLTSNKVDIKPYEA--------------IFDDAQALHAA--HAEK  307

Query  1179  TACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCHL  1358
             +       +      NK S  L    L G        S +  AKA+K  AEL+GM++CH+
Sbjct  308   SKSGDKVPTGNFLISNKGSWAL-KRALGGDSSVDEIRSLIGDAKAIKTEAELKGMRDCHV  366

Query  1359  RDAAALAHFWAWLEEEIC-KDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             RD AAL  ++AWLE+++  K   L EV+ A+KL E R ++  F+  SF TIS +GAN AI
Sbjct  367   RDGAALIQYFAWLEDQLVNKKATLDEVQAADKLEEHRKEKKDFVGLSFPTISSTGANAAI  426

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQGHIA  1715
             IHY PE  +C+ ++   ++L DSGAQY DGTTD TRT+HFG+P+  E+E +T VL+GHI+
Sbjct  427   IHYGPERGNCATIDPEAIYLCDSGAQYRDGTTDTTRTLHFGKPTDAEREAYTLVLKGHIS  486

Query  1716  LDQAVFPENTPGFVLDAFARSSLWKVGLDYRHGTGHGVGAALNVHEGPQGISFRFGNM-T  1892
             LDQA+FP+ T GF LD+ AR  LWK GLDYRHGTGHGVG+ LNVHEGP GI  R      
Sbjct  487   LDQAIFPKGTTGFALDSLARQHLWKNGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEV  546

Query  1893  PMVPGMVVSNEPGYYEDHSFGIRIENLLYVKEMDTPNRFGGIGYLGFEKLTFVPIQAKLV  2072
              + PG V+SNEPGYYED  +GIRIEN++ VKE+   + FG   +LGFE +T VP    L+
Sbjct  547   ALAPGNVLSNEPGYYEDGKYGIRIENMVLVKEVKAKHSFGDKPFLGFEYVTLVPYCRNLI  606

Query  2073  DLSILSAAEVAWLNSYHLQVWEKVSGLVDGR--AREWLWNNTRPID  2204
             D ++L++ E  WLN+Y+ +V EK     +G      WL   T+ I+
Sbjct  607   DTTLLTSEEKEWLNTYNAKVLEKTQEYFEGDNVTLAWLKRETQHIE  652



>gb|KCW61794.1| hypothetical protein EUGRSUZ_H04494 [Eucalyptus grandis]
Length=379

 Score =   501 bits (1289),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 248/356 (70%), Positives = 303/356 (85%), Gaps = 7/356 (2%)
 Frame = +3

Query  636   SRIGIDPFLFSSDAAEELKEDISKGNHELVFLSNLNLVDEIWKESRPQPPKKPIRVHDLK  815
             S + ++ FLFSSDAAEELKE I+K NHELV L N+NLVDE+WKE RP+PP KP+R+HDLK
Sbjct  10    SALILEQFLFSSDAAEELKEAIAKKNHELVLLYNINLVDEVWKE-RPKPPNKPVRIHDLK  68

Query  816   YAGADVSSKLFSLRSDLINAGSSAIVISMLDEIAWLLNLRGSDVRHSPVMYAYLIVEIDG  995
             +AG DV+SKL  LR++ ++AG+SAI+ISMLDE+AWLLNLRG+DV +SPV+YAYL+V+ + 
Sbjct  69    FAGLDVASKLSFLRAEFVDAGASAIIISMLDEVAWLLNLRGNDVPNSPVVYAYLLVKTET  128

Query  996   AKLFIDDSKITPEVMDYLKSVGVELRAYesilseieslAEKGANLWLDKSTVNAAITNAY  1175
             A+LF+D SKITPEVMD+LK+ GVELR Y+ ILSEIE+LA++G NLWLD S+VNAAI N Y
Sbjct  129   AELFVDSSKITPEVMDHLKNAGVELRPYDKILSEIENLAKQGRNLWLDTSSVNAAIVNTY  188

Query  1176  KTACDRYSRSPGIKKRNKKSTNLDTNGLSGQPHALYRSSPVSMAKAVKNSAELEGMQNCH  1355
             K+ACD+Y     + K++K   + D NG S  P  +YR+SP+S+AKAVKN AEL+GM+N H
Sbjct  189   KSACDKY-----LNKKSKARVH-DYNGRSAMPSGVYRASPISLAKAVKNDAELQGMRNSH  242

Query  1356  LRDAAALAHFWAWLEEEICKDVGLTEVEVAEKLLEFRSKQYGFLDTSFDTISGSGANGAI  1535
             LRDAAALAHFW WLEEEI +   LTEVEVA+KLLEFRSKQ GF+DTSFDTIS SGANGA+
Sbjct  243   LRDAAALAHFWVWLEEEINRGAKLTEVEVADKLLEFRSKQDGFIDTSFDTISASGANGAV  302

Query  1536  IHYKPEPDSCSIVNRHELFLLDSGAQYVDGTTDITRTVHFGEPSSREKECFTRVLQ  1703
             IHYKPEP SCS+++  +LFLLDSGAQYVDGTTDITRTVHFGEP+ R+KECFTRVLQ
Sbjct  303   IHYKPEPGSCSVLDVEKLFLLDSGAQYVDGTTDITRTVHFGEPTPRQKECFTRVLQ  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7739709142688