BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c22860_g6_i1 len=3790 path=[16911:0-518 17429:519-521 2140:522-2096
4279:2097-2122 4305:2123-3789]

Length=3790
                                                                      Score     E

ref|XP_011073378.1|  PREDICTED: protein TOPLESS                        1937   0.0     
ref|XP_010318715.1|  PREDICTED: protein TOPLESS-like isoform X1        1935   0.0     
ref|XP_006341391.1|  PREDICTED: protein TOPLESS-like                   1934   0.0     
ref|XP_009611336.1|  PREDICTED: protein TOPLESS-like                   1930   0.0     
ref|XP_009796750.1|  PREDICTED: protein TOPLESS-like                   1929   0.0     
ref|XP_007214907.1|  hypothetical protein PRUPE_ppa000478mg            1923   0.0     
ref|XP_008228737.1|  PREDICTED: protein TOPLESS                        1914   0.0     
ref|XP_004303268.1|  PREDICTED: protein TOPLESS-like                   1906   0.0     
ref|XP_006427463.1|  hypothetical protein CICLE_v10024745mg            1902   0.0     
ref|XP_006427465.1|  hypothetical protein CICLE_v10024745mg            1902   0.0     
ref|XP_010691083.1|  PREDICTED: protein TOPLESS                        1898   0.0     
gb|KHG11821.1|  Protein TOPLESS -like protein                          1898   0.0     
ref|XP_006427464.1|  hypothetical protein CICLE_v10024745mg            1896   0.0     
ref|XP_002268265.1|  PREDICTED: protein TOPLESS                        1895   0.0     Vitis vinifera
ref|XP_007023319.1|  TOPLESS-related 1 isoform 1                       1894   0.0     
ref|XP_007150781.1|  hypothetical protein PHAVU_005G180100g            1893   0.0     
ref|XP_003543688.1|  PREDICTED: protein TOPLESS-like isoform X1        1892   0.0     
gb|KHG04944.1|  Topless-related 1 -like protein                        1891   0.0     
ref|XP_006492116.1|  PREDICTED: protein TOPLESS-like isoform X1        1890   0.0     
ref|XP_010097168.1|  Protein TOPLESS                                   1887   0.0     
gb|KDP37032.1|  hypothetical protein JCGZ_06088                        1886   0.0     
ref|XP_006492117.1|  PREDICTED: protein TOPLESS-like isoform X2        1885   0.0     
emb|CDO98186.1|  unnamed protein product                               1884   0.0     
ref|XP_011044878.1|  PREDICTED: topless-related protein 1 isoform X2   1883   0.0     
ref|XP_008372696.1|  PREDICTED: protein TOPLESS                        1882   0.0     
ref|XP_006585625.1|  PREDICTED: protein TOPLESS-like isoform X1        1882   0.0     
ref|XP_007135775.1|  hypothetical protein PHAVU_010G157700g            1877   0.0     
gb|AAN62336.1|AF506028_3  CTV.2                                        1874   0.0     Citrus trifoliata [hardy orange]
ref|XP_004165893.1|  PREDICTED: LOW QUALITY PROTEIN: protein TOPL...   1872   0.0     
gb|AES86542.2|  topless-like protein                                   1872   0.0     
ref|XP_004152185.1|  PREDICTED: protein TOPLESS-like                   1872   0.0     
ref|XP_008454191.1|  PREDICTED: protein TOPLESS                        1870   0.0     
ref|XP_008380984.1|  PREDICTED: topless-related protein 1-like         1868   0.0     
ref|XP_003599718.1|  WD repeat-containing protein, putative            1867   0.0     
ref|XP_011011325.1|  PREDICTED: protein TOPLESS-like                   1867   0.0     
ref|XP_011044877.1|  PREDICTED: topless-related protein 1 isoform X1   1867   0.0     
ref|XP_009338495.1|  PREDICTED: protein TOPLESS                        1866   0.0     
ref|XP_009348312.1|  PREDICTED: protein TOPLESS-like                   1863   0.0     
ref|XP_003597933.1|  WD repeat-containing protein, putative            1862   0.0     
gb|KHG27106.1|  Topless-related 1 -like protein                        1860   0.0     
ref|XP_003597931.1|  WD repeat-containing protein, putative            1858   0.0     
gb|AES68183.2|  topless-like protein                                   1857   0.0     
ref|XP_010250290.1|  PREDICTED: protein TOPLESS-like isoform X4        1856   0.0     
ref|XP_010250289.1|  PREDICTED: protein TOPLESS-like isoform X3        1854   0.0     
ref|XP_004486640.1|  PREDICTED: protein TOPLESS-like isoform X1        1853   0.0     
gb|KEH39609.1|  topless-like protein                                   1853   0.0     
ref|XP_010250288.1|  PREDICTED: protein TOPLESS-like isoform X2        1852   0.0     
gb|EYU21684.1|  hypothetical protein MIMGU_mgv1a000459mg               1852   0.0     
ref|XP_002517701.1|  WD-repeat protein, putative                       1851   0.0     Ricinus communis
ref|XP_010244894.1|  PREDICTED: topless-related protein 1-like is...   1850   0.0     
ref|XP_010250287.1|  PREDICTED: protein TOPLESS-like isoform X1        1850   0.0     
ref|XP_004486641.1|  PREDICTED: protein TOPLESS-like isoform X2        1849   0.0     
ref|XP_010244893.1|  PREDICTED: topless-related protein 1-like is...   1847   0.0     
ref|XP_010244892.1|  PREDICTED: topless-related protein 1-like is...   1840   0.0     
ref|XP_010244887.1|  PREDICTED: topless-related protein 1-like is...   1838   0.0     
gb|KHN22427.1|  Topless-related protein 1                              1835   0.0     
ref|XP_006595172.1|  PREDICTED: protein TOPLESS-like isoform X3        1833   0.0     
ref|XP_010497362.1|  PREDICTED: protein TOPLESS                        1829   0.0     
ref|XP_010476664.1|  PREDICTED: protein TOPLESS-like                   1827   0.0     
ref|XP_006369294.1|  WD-40 repeat family protein                       1827   0.0     
ref|XP_006597113.1|  PREDICTED: protein TOPLESS-like isoform X1        1827   0.0     
ref|NP_563981.1|  protein TOPLESS                                      1826   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532341.1|  PREDICTED: protein TOPLESS                        1825   0.0     
ref|XP_004506964.1|  PREDICTED: protein TOPLESS-like                   1820   0.0     
ref|XP_006306622.1|  hypothetical protein CARUB_v10008139mg            1820   0.0     
ref|XP_006416884.1|  hypothetical protein EUTSA_v10006622mg            1817   0.0     
ref|XP_002892877.1|  wus-interacting protein 1                         1816   0.0     
emb|CDX67950.1|  BnaA07g19900D                                         1815   0.0     
ref|XP_006389802.1|  hypothetical protein EUTSA_v10018037mg            1815   0.0     
ref|XP_010472918.1|  PREDICTED: topless-related protein 1 isoform X3   1811   0.0     
emb|CDX79383.1|  BnaC06g19200D                                         1811   0.0     
ref|NP_849913.2|  Topless-related protein 1                            1811   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887825.1|  hypothetical protein ARALYDRAFT_895943            1810   0.0     
ref|XP_009104466.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...   1810   0.0     
ref|XP_006389801.1|  hypothetical protein EUTSA_v10018037mg            1808   0.0     
ref|XP_010472916.1|  PREDICTED: topless-related protein 1 isoform X1   1807   0.0     
ref|XP_010472920.1|  PREDICTED: topless-related protein 1 isoform X4   1805   0.0     
ref|NP_178164.3|  Topless-related protein 1                            1805   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98958.1|  hypothetical protein                                  1805   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117812.1|  PREDICTED: protein TOPLESS                        1803   0.0     
ref|XP_010537925.1|  PREDICTED: protein TOPLESS-like                   1802   0.0     
gb|AES68182.2|  topless-like protein                                   1801   0.0     
ref|XP_003597932.1|  WD repeat-containing protein, putative            1801   0.0     
ref|XP_008801888.1|  PREDICTED: protein TOPLESS-like                   1799   0.0     
ref|XP_009148962.1|  PREDICTED: protein TOPLESS                        1797   0.0     
gb|KEH39610.1|  topless-like protein                                   1797   0.0     
ref|XP_010472917.1|  PREDICTED: topless-related protein 1 isoform X2   1796   0.0     
gb|AAF82145.1|AC034256_9  Strong similarity to an unknown protein...   1794   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDX81729.1|  BnaC08g38720D                                         1793   0.0     
ref|XP_010927352.1|  PREDICTED: protein TOPLESS                        1792   0.0     
ref|XP_006301454.1|  hypothetical protein CARUB_v10021876mg            1792   0.0     
ref|XP_010906011.1|  PREDICTED: protein TOPLESS                        1778   0.0     
ref|XP_010417699.1|  PREDICTED: topless-related protein 1-like         1775   0.0     
emb|CDY36584.1|  BnaA06g10370D                                         1775   0.0     
ref|XP_010063530.1|  PREDICTED: protein TOPLESS isoform X1             1770   0.0     
gb|KCW70758.1|  hypothetical protein EUGRSUZ_F03923                    1768   0.0     
emb|CDY33387.1|  BnaC05g11960D                                         1765   0.0     
ref|XP_009395915.1|  PREDICTED: topless-related protein 1-like         1761   0.0     
ref|XP_010928279.1|  PREDICTED: protein TOPLESS-like                   1758   0.0     
ref|XP_009407206.1|  PREDICTED: protein TOPLESS-like                   1756   0.0     
ref|XP_008813124.1|  PREDICTED: protein TOPLESS-like isoform X1        1753   0.0     
ref|XP_010539522.1|  PREDICTED: protein TOPLESS-like                   1753   0.0     
ref|XP_008788792.1|  PREDICTED: topless-related protein 1-like is...   1752   0.0     
ref|XP_004984974.1|  PREDICTED: protein TOPLESS-like isoform X3        1748   0.0     
ref|NP_001049587.1|  Os03g0254700                                      1747   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788791.1|  PREDICTED: topless-related protein 1-like is...   1746   0.0     
ref|XP_009405763.1|  PREDICTED: protein TOPLESS-like isoform X3        1746   0.0     
ref|XP_004984972.1|  PREDICTED: protein TOPLESS-like isoform X1        1744   0.0     
gb|EEC74885.1|  hypothetical protein OsI_10796                         1743   0.0     Oryza sativa Indica Group [Indian rice]
gb|EPS69099.1|  hypothetical protein M569_05666                        1741   0.0     
ref|XP_004984975.1|  PREDICTED: protein TOPLESS-like isoform X4        1740   0.0     
emb|CDY53312.1|  BnaA09g56690D                                         1735   0.0     
ref|XP_002465540.1|  hypothetical protein SORBIDRAFT_01g040800         1734   0.0     Sorghum bicolor [broomcorn]
gb|ACN26165.1|  unknown                                                1732   0.0     Zea mays [maize]
ref|XP_006649759.1|  PREDICTED: protein TOPLESS-like                   1732   0.0     
ref|XP_006855163.1|  hypothetical protein AMTR_s00051p00079490         1729   0.0     
gb|EMT24067.1|  hypothetical protein F775_25939                        1727   0.0     
ref|XP_009405760.1|  PREDICTED: protein TOPLESS-like isoform X1        1726   0.0     
gb|EMS49891.1|  Topless-related protein 1                              1721   0.0     
ref|XP_003558327.1|  PREDICTED: topless-related protein 1-like         1720   0.0     
ref|XP_010063532.1|  PREDICTED: protein TOPLESS isoform X2             1719   0.0     
gb|KCW70755.1|  hypothetical protein EUGRSUZ_F03923                    1717   0.0     
gb|KGN52925.1|  hypothetical protein Csa_4G006320                      1706   0.0     
tpg|DAA44432.1|  TPA: hypothetical protein ZEAMMB73_624785             1706   0.0     
ref|XP_008456966.1|  PREDICTED: topless-related protein 4-like is...   1655   0.0     
ref|XP_009405761.1|  PREDICTED: protein TOPLESS-like isoform X2        1654   0.0     
ref|XP_008456943.1|  PREDICTED: topless-related protein 4-like is...   1653   0.0     
ref|XP_008456978.1|  PREDICTED: topless-related protein 4-like is...   1650   0.0     
ref|XP_008456972.1|  PREDICTED: topless-related protein 4-like is...   1648   0.0     
ref|XP_010250163.1|  PREDICTED: protein TOPLESS-like                   1648   0.0     
emb|CDP10439.1|  unnamed protein product                               1640   0.0     
ref|XP_004139298.1|  PREDICTED: topless-related protein 4-like         1640   0.0     
ref|XP_007013506.1|  WUS-interacting protein 2 isoform 1               1639   0.0     
ref|XP_007013508.1|  WUS-interacting protein 2 isoform 3               1638   0.0     
ref|XP_010656454.1|  PREDICTED: topless-related protein 4 isoform X4   1635   0.0     
ref|XP_010103710.1|  Topless-related protein 4                         1634   0.0     
ref|XP_007013509.1|  WUS-interacting protein 2 isoform 4               1634   0.0     
gb|AES91574.2|  topless-like protein                                   1634   0.0     
ref|XP_007013510.1|  WUS-interacting protein 2 isoform 5               1634   0.0     
ref|XP_010241551.1|  PREDICTED: topless-related protein 1-like is...   1632   0.0     
ref|XP_002285341.2|  PREDICTED: topless-related protein 4 isoform X3   1632   0.0     Vitis vinifera
ref|XP_006594237.1|  PREDICTED: topless-related protein 4-like is...   1632   0.0     
ref|XP_007013507.1|  WUS-interacting protein 2 isoform 2               1632   0.0     
ref|XP_010656453.1|  PREDICTED: topless-related protein 4 isoform X2   1632   0.0     
ref|XP_004508472.1|  PREDICTED: topless-related protein 4-like is...   1632   0.0     
ref|XP_003549747.1|  PREDICTED: topless-related protein 4-like is...   1632   0.0     
ref|XP_008242803.1|  PREDICTED: topless-related protein 4-like         1631   0.0     
ref|XP_007155032.1|  hypothetical protein PHAVU_003G167500g            1631   0.0     
ref|XP_010241550.1|  PREDICTED: topless-related protein 4-like is...   1630   0.0     
ref|XP_007155034.1|  hypothetical protein PHAVU_003G167500g            1630   0.0     
ref|XP_010656452.1|  PREDICTED: topless-related protein 4 isoform X1   1629   0.0     
ref|XP_004508471.1|  PREDICTED: topless-related protein 4-like is...   1629   0.0     
ref|XP_006594236.1|  PREDICTED: topless-related protein 4-like is...   1628   0.0     
ref|XP_006600746.1|  PREDICTED: topless-related protein 4-like is...   1627   0.0     
ref|XP_007204297.1|  hypothetical protein PRUPE_ppa000492mg            1627   0.0     
ref|XP_007155033.1|  hypothetical protein PHAVU_003G167500g            1624   0.0     
ref|XP_007155035.1|  hypothetical protein PHAVU_003G167500g            1623   0.0     
ref|XP_003609377.1|  WD repeat-containing protein                      1620   0.0     
ref|XP_009803406.1|  PREDICTED: topless-related protein 4-like is...   1613   0.0     
ref|XP_009595072.1|  PREDICTED: topless-related protein 4-like is...   1613   0.0     
ref|XP_006364222.1|  PREDICTED: topless-related protein 4-like         1612   0.0     
ref|XP_009772956.1|  PREDICTED: topless-related protein 4 isoform X2   1612   0.0     
ref|XP_008337262.1|  PREDICTED: topless-related protein 4              1611   0.0     
ref|XP_009613435.1|  PREDICTED: topless-related protein 4 isoform X2   1611   0.0     
ref|XP_009772955.1|  PREDICTED: topless-related protein 4 isoform X1   1610   0.0     
ref|XP_010318717.1|  PREDICTED: protein TOPLESS-like isoform X2        1609   0.0     
ref|XP_009363995.1|  PREDICTED: topless-related protein 4-like         1608   0.0     
ref|XP_009613434.1|  PREDICTED: topless-related protein 4 isoform X1   1607   0.0     
ref|XP_004235952.1|  PREDICTED: topless-related protein 4 isoform X1   1607   0.0     
ref|XP_010318758.1|  PREDICTED: topless-related protein 4 isoform X2   1607   0.0     
ref|XP_009803412.1|  PREDICTED: topless-related protein 4-like is...   1607   0.0     
ref|XP_009595073.1|  PREDICTED: topless-related protein 4-like is...   1606   0.0     
ref|XP_006450874.1|  hypothetical protein CICLE_v10007287mg            1605   0.0     
ref|XP_011017797.1|  PREDICTED: topless-related protein 4-like is...   1603   0.0     
ref|XP_011020160.1|  PREDICTED: topless-related protein 4-like is...   1601   0.0     
ref|XP_011017798.1|  PREDICTED: topless-related protein 4-like is...   1599   0.0     
ref|XP_002527178.1|  WD-repeat protein, putative                       1599   0.0     Ricinus communis
ref|XP_002308068.1|  WD-40 repeat family protein                       1598   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011020157.1|  PREDICTED: topless-related protein 4-like is...   1595   0.0     
gb|KEH32128.1|  topless-like protein                                   1595   0.0     
ref|XP_002324641.2|  WD-40 repeat family protein                       1595   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006381123.1|  hypothetical protein POPTR_0006s06570g            1594   0.0     
ref|XP_011073420.1|  PREDICTED: topless-related protein 4              1593   0.0     
gb|KDP30260.1|  hypothetical protein JCGZ_17042                        1593   0.0     
ref|XP_006584165.1|  PREDICTED: protein TOPLESS-like                   1593   0.0     
ref|XP_011020159.1|  PREDICTED: topless-related protein 4-like is...   1592   0.0     
ref|XP_010656455.1|  PREDICTED: topless-related protein 4 isoform X5   1578   0.0     
ref|XP_006358294.1|  PREDICTED: topless-related protein 4-like is...   1576   0.0     
ref|XP_006358293.1|  PREDICTED: topless-related protein 4-like is...   1576   0.0     
emb|CDO98161.1|  unnamed protein product                               1567   0.0     
ref|XP_004287287.1|  PREDICTED: topless-related protein 4-like         1564   0.0     
ref|XP_002265778.1|  PREDICTED: topless-related protein 4              1564   0.0     Vitis vinifera
ref|XP_010687938.1|  PREDICTED: topless-related protein 4              1563   0.0     
ref|XP_010323294.1|  PREDICTED: topless-related protein 4-like is...   1561   0.0     
ref|XP_004242769.1|  PREDICTED: topless-related protein 4-like is...   1556   0.0     
gb|EYU21655.1|  hypothetical protein MIMGU_mgv1a000483mg               1554   0.0     
ref|XP_006406906.1|  hypothetical protein EUTSA_v10019944mg            1552   0.0     
gb|KHN22119.1|  Topless-related protein 4                              1551   0.0     
ref|XP_010465580.1|  PREDICTED: topless-related protein 4              1548   0.0     
emb|CAN64663.1|  hypothetical protein VITISV_035348                    1547   0.0     Vitis vinifera
ref|XP_010533140.1|  PREDICTED: topless-related protein 4-like         1546   0.0     
ref|XP_010545756.1|  PREDICTED: topless-related protein 4              1546   0.0     
emb|CDX82426.1|  BnaA03g33950D                                         1546   0.0     
ref|XP_010487431.1|  PREDICTED: topless-related protein 4-like         1545   0.0     
ref|XP_009135464.1|  PREDICTED: topless-related protein 4              1545   0.0     
emb|CDX75851.1|  BnaC03g39340D                                         1543   0.0     
ref|NP_851003.2|  WUS-interacting protein 2                            1540   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011017799.1|  PREDICTED: topless-related protein 4-like is...   1540   0.0     
ref|NP_188209.3|  WUS-interacting protein 2                            1539   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368882.1|  PREDICTED: topless-related protein 4-like         1539   0.0     
emb|CDY20161.1|  BnaA01g28410D                                         1538   0.0     
ref|XP_009115193.1|  PREDICTED: topless-related protein 4              1537   0.0     
emb|CDY21881.1|  BnaC01g35670D                                         1535   0.0     
ref|XP_006296854.1|  hypothetical protein CARUB_v10012841mg            1533   0.0     
ref|XP_002885113.1|  hypothetical protein ARALYDRAFT_479043            1532   0.0     
gb|KDO80174.1|  hypothetical protein CISIN_1g001163mg                  1531   0.0     
ref|XP_001781989.1|  predicted protein                                 1527   0.0     
ref|XP_001768092.1|  predicted protein                                 1524   0.0     
dbj|BAB02318.1|  unnamed protein product                               1519   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960294.1|  hypothetical protein SELMODRAFT_163891            1513   0.0     
ref|NP_001189905.1|  WUS-interacting protein 2                         1513   0.0     
ref|XP_002967419.1|  hypothetical protein SELMODRAFT_439915            1504   0.0     
ref|XP_008803471.1|  PREDICTED: topless-related protein 1-like is...   1491   0.0     
ref|XP_010928336.1|  PREDICTED: protein TOPLESS-like isoform X2        1489   0.0     
ref|XP_010928335.1|  PREDICTED: protein TOPLESS-like isoform X1        1489   0.0     
ref|XP_008803470.1|  PREDICTED: topless-related protein 1-like is...   1489   0.0     
ref|NP_001061055.1|  Os08g0162100                                      1487   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_002275116.1|  PREDICTED: protein TOPLESS isoform X3             1486   0.0     Vitis vinifera
ref|XP_010943653.1|  PREDICTED: topless-related protein 1-like is...   1483   0.0     
ref|XP_010942722.1|  PREDICTED: protein TOPLESS-like                   1483   0.0     
ref|XP_010662133.1|  PREDICTED: protein TOPLESS isoform X1             1483   0.0     
ref|XP_010662135.1|  PREDICTED: protein TOPLESS isoform X4             1481   0.0     
ref|XP_010943652.1|  PREDICTED: topless-related protein 1-like is...   1481   0.0     
ref|XP_009396205.1|  PREDICTED: topless-related protein 1-like         1481   0.0     
ref|XP_010662134.1|  PREDICTED: protein TOPLESS isoform X2             1479   0.0     
gb|KDO80172.1|  hypothetical protein CISIN_1g001163mg                  1478   0.0     
ref|XP_006659155.1|  PREDICTED: protein TOPLESS-like                   1478   0.0     
ref|XP_006478900.1|  PREDICTED: protein TOPLESS-like isoform X2        1478   0.0     
gb|KCW70759.1|  hypothetical protein EUGRSUZ_F03923                    1477   0.0     
ref|XP_004972767.1|  PREDICTED: topless-related protein 1-like         1474   0.0     
ref|XP_006478899.1|  PREDICTED: protein TOPLESS-like isoform X1        1474   0.0     
dbj|BAC99788.1|  WD-40 repeat protein-like                             1474   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243111.1|  PREDICTED: protein TOPLESS-like                   1473   0.0     
ref|XP_002520011.1|  conserved hypothetical protein                    1473   0.0     Ricinus communis
ref|XP_010278757.1|  PREDICTED: topless-related protein 1-like is...   1472   0.0     
ref|XP_007023214.1|  WUS-interacting protein 2 isoform 1               1471   0.0     
ref|XP_009597375.1|  PREDICTED: topless-related protein 1-like is...   1470   0.0     
ref|XP_009597374.1|  PREDICTED: topless-related protein 1-like is...   1470   0.0     
gb|EMT12268.1|  hypothetical protein F775_05335                        1469   0.0     
ref|XP_010278758.1|  PREDICTED: topless-related protein 1-like is...   1468   0.0     
ref|XP_009801466.1|  PREDICTED: topless-related protein 1-like is...   1467   0.0     
ref|XP_003573449.1|  PREDICTED: topless-related protein 1-like         1467   0.0     
ref|XP_009801463.1|  PREDICTED: topless-related protein 1-like is...   1467   0.0     
ref|NP_001167872.2|  ramosa 1 enhancer locus 2                         1466   0.0     Zea mays [maize]
ref|XP_009395448.1|  PREDICTED: topless-related protein 1-like is...   1465   0.0     
ref|XP_009395446.1|  PREDICTED: topless-related protein 1-like is...   1465   0.0     
gb|EYU23277.1|  hypothetical protein MIMGU_mgv1a000461mg               1461   0.0     
ref|XP_002967579.1|  hypothetical protein SELMODRAFT_88677             1460   0.0     
gb|KDP21790.1|  hypothetical protein JCGZ_00577                        1459   0.0     
ref|XP_010920062.1|  PREDICTED: protein TOPLESS-like                   1458   0.0     
ref|XP_011074840.1|  PREDICTED: topless-related protein 1-like         1457   0.0     
ref|XP_009400780.1|  PREDICTED: topless-related protein 1-like         1456   0.0     
ref|XP_002981766.1|  hypothetical protein SELMODRAFT_115161            1456   0.0     
gb|EMS60597.1|  Topless-related protein 1                              1456   0.0     
ref|XP_008788808.1|  PREDICTED: protein TOPLESS-like                   1452   0.0     
ref|XP_006352936.1|  PREDICTED: protein TOPLESS-like isoform X2        1451   0.0     
ref|XP_009597373.1|  PREDICTED: topless-related protein 1-like is...   1451   0.0     
ref|XP_009597371.1|  PREDICTED: topless-related protein 1-like is...   1451   0.0     
ref|XP_009396116.1|  PREDICTED: protein TOPLESS-like isoform X2        1449   0.0     
ref|XP_009396112.1|  PREDICTED: protein TOPLESS-like isoform X1        1449   0.0     
ref|XP_007029510.1|  WD-40 repeat protein-like isoform 2               1449   0.0     
ref|XP_006352935.1|  PREDICTED: protein TOPLESS-like isoform X1        1448   0.0     
ref|XP_004245913.1|  PREDICTED: topless-related protein 1-like is...   1448   0.0     
ref|XP_010325598.1|  PREDICTED: topless-related protein 1-like is...   1446   0.0     
ref|XP_010325597.1|  PREDICTED: topless-related protein 1-like is...   1446   0.0     
gb|EYU29078.1|  hypothetical protein MIMGU_mgv1a000445mg               1446   0.0     
ref|XP_007029509.1|  WD-40 repeat protein-like isoform 1               1444   0.0     
ref|XP_007029511.1|  WD-40 repeat protein-like isoform 3               1443   0.0     
ref|XP_010034954.1|  PREDICTED: protein TOPLESS-like isoform X1        1443   0.0     
ref|XP_011010172.1|  PREDICTED: protein TOPLESS-like isoform X1        1441   0.0     
ref|XP_006376018.1|  hypothetical protein POPTR_0013s08030g            1440   0.0     
ref|XP_011010174.1|  PREDICTED: protein TOPLESS-like isoform X2        1437   0.0     
ref|XP_011092591.1|  PREDICTED: topless-related protein 1-like is...   1437   0.0     
ref|XP_011092590.1|  PREDICTED: topless-related protein 1-like is...   1437   0.0     
ref|XP_006376017.1|  hypothetical protein POPTR_0013s08030g            1435   0.0     
ref|XP_009361201.1|  PREDICTED: topless-related protein 1-like is...   1434   0.0     
ref|XP_008376897.1|  PREDICTED: topless-related protein 1-like is...   1433   0.0     
ref|XP_009361190.1|  PREDICTED: topless-related protein 1-like is...   1432   0.0     
ref|XP_008376892.1|  PREDICTED: topless-related protein 1-like is...   1431   0.0     
ref|XP_008234585.1|  PREDICTED: topless-related protein 1-like         1428   0.0     
ref|XP_006399361.1|  hypothetical protein EUTSA_v10012501mg            1428   0.0     
ref|XP_009351851.1|  PREDICTED: topless-related protein 1-like is...   1428   0.0     
ref|XP_011092592.1|  PREDICTED: topless-related protein 1-like is...   1427   0.0     
gb|EPS70365.1|  hypothetical protein M569_04393                        1427   0.0     
ref|XP_009351850.1|  PREDICTED: topless-related protein 1-like is...   1427   0.0     
ref|XP_002443908.1|  hypothetical protein SORBIDRAFT_07g004180         1425   0.0     
ref|XP_010928339.1|  PREDICTED: protein TOPLESS-like isoform X5        1424   0.0     
gb|KHG17585.1|  Protein TOPLESS -like protein                          1423   0.0     
ref|XP_009351849.1|  PREDICTED: topless-related protein 1-like is...   1423   0.0     
ref|XP_009351848.1|  PREDICTED: topless-related protein 1-like is...   1422   0.0     
ref|XP_010087497.1|  Protein TOPLESS                                   1422   0.0     
ref|XP_010928338.1|  PREDICTED: protein TOPLESS-like isoform X4        1420   0.0     
ref|XP_009397650.1|  PREDICTED: topless-related protein 1-like         1420   0.0     
ref|XP_004307882.1|  PREDICTED: protein TOPLESS-like                   1420   0.0     
gb|KCW70760.1|  hypothetical protein EUGRSUZ_F03923                    1419   0.0     
ref|XP_008219537.1|  PREDICTED: topless-related protein 1-like         1417   0.0     
gb|KCW70761.1|  hypothetical protein EUGRSUZ_F03923                    1417   0.0     
ref|XP_010928337.1|  PREDICTED: protein TOPLESS-like isoform X3        1415   0.0     
ref|XP_007023323.1|  Transducin family protein / WD-40 repeat fam...   1415   0.0     
ref|XP_009395322.1|  PREDICTED: protein TOPLESS-like isoform X2        1415   0.0     
ref|XP_009395318.1|  PREDICTED: protein TOPLESS-like isoform X1        1415   0.0     
ref|XP_002515477.1|  WD-repeat protein, putative                       1414   0.0     
ref|XP_007225505.1|  hypothetical protein PRUPE_ppa000570mg            1413   0.0     
ref|XP_008798009.1|  PREDICTED: topless-related protein 1-like is...   1405   0.0     
ref|XP_002309645.1|  WD-40 repeat family protein                       1405   0.0     
ref|XP_007013512.1|  Transducin family protein / WD-40 repeat fam...   1404   0.0     
ref|XP_011039629.1|  PREDICTED: topless-related protein 1-like is...   1404   0.0     
gb|KDP33561.1|  hypothetical protein JCGZ_07132                        1403   0.0     
ref|XP_008798012.1|  PREDICTED: protein TOPLESS-like isoform X2        1402   0.0     
ref|XP_007013513.1|  Transducin family protein / WD-40 repeat fam...   1402   0.0     
ref|XP_010933383.1|  PREDICTED: topless-related protein 1-like is...   1394   0.0     
ref|XP_010933382.1|  PREDICTED: topless-related protein 1-like is...   1392   0.0     
ref|XP_009395323.1|  PREDICTED: protein TOPLESS-like isoform X3        1391   0.0     
ref|XP_010259448.1|  PREDICTED: topless-related protein 2 isoform X1   1385   0.0     
ref|XP_002324880.2|  WD-40 repeat family protein                       1385   0.0     
ref|XP_011036611.1|  PREDICTED: topless-related protein 1-like         1384   0.0     
ref|XP_010259449.1|  PREDICTED: topless-related protein 2 isoform X2   1384   0.0     
ref|XP_010099861.1|  Topless-related protein 1                         1384   0.0     
gb|KDO80173.1|  hypothetical protein CISIN_1g001163mg                  1384   0.0     
ref|XP_011039630.1|  PREDICTED: topless-related protein 1-like is...   1381   0.0     
ref|XP_006606545.1|  PREDICTED: topless-related protein 3-like         1379   0.0     
ref|XP_006589130.1|  PREDICTED: topless-related protein 3-like is...   1379   0.0     
ref|XP_004144768.1|  PREDICTED: topless-related protein 3-like         1376   0.0     
ref|XP_010938346.1|  PREDICTED: topless-related protein 2-like is...   1376   0.0     
ref|XP_009125736.1|  PREDICTED: topless-related protein 4-like is...   1376   0.0     
ref|XP_010938347.1|  PREDICTED: topless-related protein 2-like is...   1374   0.0     
gb|KDO71780.1|  hypothetical protein CISIN_1g001178mg                  1373   0.0     
ref|XP_010921588.1|  PREDICTED: topless-related protein 2-like is...   1372   0.0     
gb|KDO71781.1|  hypothetical protein CISIN_1g001178mg                  1372   0.0     
ref|XP_010921589.1|  PREDICTED: topless-related protein 2-like is...   1372   0.0     
ref|XP_008228696.1|  PREDICTED: topless-related protein 4 isoform X1   1372   0.0     
ref|XP_004495685.1|  PREDICTED: topless-related protein 3-like is...   1368   0.0     
ref|XP_011092107.1|  PREDICTED: topless-related protein 3-like         1367   0.0     
ref|XP_004495684.1|  PREDICTED: topless-related protein 3-like is...   1367   0.0     
ref|XP_010034955.1|  PREDICTED: protein TOPLESS-like isoform X2        1367   0.0     
gb|ABD28351.1|  Lissencephaly type-1-like homology motif; CTLH, C...   1366   0.0     
ref|XP_006589131.1|  PREDICTED: topless-related protein 3-like is...   1366   0.0     
ref|XP_009125737.1|  PREDICTED: topless-related protein 4-like is...   1365   0.0     
ref|XP_006419483.1|  hypothetical protein CICLE_v10004197mg            1364   0.0     
ref|XP_006385278.1|  hypothetical protein POPTR_0003s02400g            1364   0.0     
ref|XP_006489020.1|  PREDICTED: topless-related protein 2-like is...   1364   0.0     
ref|XP_008453896.1|  PREDICTED: topless-related protein 3-like         1363   0.0     
ref|XP_006489019.1|  PREDICTED: topless-related protein 2-like is...   1363   0.0     
ref|XP_008790866.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...   1362   0.0     
ref|XP_004495686.1|  PREDICTED: topless-related protein 3-like is...   1362   0.0     
gb|KFK39016.1|  hypothetical protein AALP_AA3G189500                   1362   0.0     
gb|KHN16088.1|  Topless-related protein 3                              1361   0.0     
ref|XP_006406802.1|  hypothetical protein EUTSA_v10019939mg            1359   0.0     
ref|XP_007144973.1|  hypothetical protein PHAVU_007G198900g            1358   0.0     
ref|XP_003591186.1|  WD repeat-containing protein                      1358   0.0     
emb|CDX95900.1|  BnaC05g36510D                                         1354   0.0     
ref|XP_007217290.1|  hypothetical protein PRUPE_ppa018125mg            1354   0.0     
ref|XP_009421409.1|  PREDICTED: topless-related protein 2-like         1353   0.0     
gb|EPS69182.1|  hypothetical protein M569_05580                        1353   0.0     
ref|XP_007029512.1|  WD-40 repeat protein-like isoform 4               1353   0.0     
emb|CDP17223.1|  unnamed protein product                               1352   0.0     
ref|XP_009766750.1|  PREDICTED: topless-related protein 3-like is...   1351   0.0     
ref|XP_009766749.1|  PREDICTED: topless-related protein 3-like is...   1351   0.0     
ref|XP_002283157.1|  PREDICTED: topless-related protein 3              1351   0.0     
ref|XP_010313271.1|  PREDICTED: topless-related protein 3 isoform X2   1351   0.0     
ref|NP_188306.2|  Topless-related 2 protein                            1351   0.0     
dbj|BAA95777.1|  unnamed protein product                               1351   0.0     
ref|XP_009611827.1|  PREDICTED: topless-related protein 3-like is...   1350   0.0     
ref|XP_008228697.1|  PREDICTED: topless-related protein 4 isoform X2   1350   0.0     
ref|XP_011036914.1|  PREDICTED: topless-related protein 3              1350   0.0     
ref|XP_004230269.1|  PREDICTED: topless-related protein 3 isoform X3   1350   0.0     
ref|XP_006854127.1|  hypothetical protein AMTR_s00048p00159380         1350   0.0     
ref|XP_002307097.2|  WD-40 repeat family protein                       1348   0.0     
ref|XP_010487553.1|  PREDICTED: topless-related protein 2-like         1348   0.0     
ref|XP_009611828.1|  PREDICTED: topless-related protein 3-like is...   1348   0.0     
ref|XP_006644007.1|  PREDICTED: topless-related protein 2-like         1348   0.0     
ref|XP_007031064.1|  TOPLESS-related 3 isoform 1                       1348   0.0     
ref|XP_009146056.1|  PREDICTED: topless-related protein 2-like         1347   0.0     
ref|XP_010504697.1|  PREDICTED: topless-related protein 2              1347   0.0     
ref|XP_002883029.1|  hypothetical protein ARALYDRAFT_479149            1347   0.0     
ref|XP_009616373.1|  PREDICTED: topless-related protein 3-like         1346   0.0     
emb|CDX92100.1|  BnaA05g23070D                                         1346   0.0     
ref|XP_007163345.1|  hypothetical protein PHAVU_001G227000g            1346   0.0     
ref|XP_003626186.1|  hypothetical protein MTR_7g112460                 1346   0.0     
ref|XP_010094719.1|  Topless-related protein 3                         1345   0.0     
ref|XP_006344708.1|  PREDICTED: topless-related protein 3-like is...   1345   0.0     
ref|XP_010245460.1|  PREDICTED: topless-related protein 2-like is...   1345   0.0     
ref|XP_006344709.1|  PREDICTED: topless-related protein 3-like is...   1345   0.0     
gb|KDO81757.1|  hypothetical protein CISIN_1g001190mg                  1344   0.0     
ref|XP_002512473.1|  WD-repeat protein, putative                       1344   0.0     
ref|XP_006472151.1|  PREDICTED: topless-related protein 3-like         1344   0.0     
ref|XP_006433483.1|  hypothetical protein CICLE_v10000084mg            1343   0.0     
ref|XP_004508183.1|  PREDICTED: topless-related protein 2-like         1343   0.0     
ref|NP_001042616.1|  Os01g0254100                                      1343   0.0     
ref|XP_010086586.1|  Topless-related protein 3                         1343   0.0     
emb|CDY50502.1|  BnaC01g44400D                                         1342   0.0     
ref|XP_010024093.1|  PREDICTED: topless-related protein 3 isoform X1   1341   0.0     
ref|XP_009114175.1|  PREDICTED: topless-related protein 2              1341   0.0     
ref|XP_007163344.1|  hypothetical protein PHAVU_001G227000g            1340   0.0     
ref|XP_010449856.1|  PREDICTED: topless-related protein 2-like         1340   0.0     
ref|XP_010024094.1|  PREDICTED: topless-related protein 3 isoform X2   1340   0.0     
ref|XP_010674104.1|  PREDICTED: topless-related protein 3-like         1339   0.0     
gb|KFK27551.1|  hypothetical protein AALP_AA8G398300                   1338   0.0     
ref|XP_006299477.1|  hypothetical protein CARUB_v10015642mg            1337   0.0     
ref|XP_010313267.1|  PREDICTED: topless-related protein 3 isoform X1   1337   0.0     
gb|KCW60526.1|  hypothetical protein EUGRSUZ_H03269                    1337   0.0     
ref|XP_010245461.1|  PREDICTED: topless-related protein 2-like is...   1336   0.0     
ref|XP_006577218.1|  PREDICTED: topless-related protein 3-like         1335   0.0     
emb|CDY25010.1|  BnaC02g39980D                                         1335   0.0     
ref|XP_007035675.1|  TOPLESS-related 2 isoform 1                       1335   0.0     
ref|XP_004967836.1|  PREDICTED: topless-related protein 2-like         1335   0.0     
ref|XP_006604796.1|  PREDICTED: topless-related protein 3-like         1333   0.0     
ref|XP_004296880.1|  PREDICTED: topless-related protein 2-like         1333   0.0     
ref|XP_007035676.1|  TOPLESS-related 2 isoform 2                       1332   0.0     
ref|XP_011023731.1|  PREDICTED: topless-related protein 3-like         1332   0.0     
gb|KHG26583.1|  Topless-related 3 -like protein                        1332   0.0     
ref|XP_009785868.1|  PREDICTED: topless-related protein 3-like         1331   0.0     
ref|XP_006344707.1|  PREDICTED: topless-related protein 3-like is...   1331   0.0     
ref|XP_010043204.1|  PREDICTED: topless-related protein 3-like         1331   0.0     
ref|XP_010524851.1|  PREDICTED: topless-related protein 3-like is...   1330   0.0     
ref|XP_006414395.1|  hypothetical protein EUTSA_v10024263mg            1330   0.0     
ref|XP_010524852.1|  PREDICTED: topless-related protein 3-like is...   1330   0.0     
ref|XP_009129893.1|  PREDICTED: topless-related protein 3              1330   0.0     
ref|XP_010546752.1|  PREDICTED: topless-related protein 3 isoform X2   1329   0.0     
ref|XP_010546750.1|  PREDICTED: topless-related protein 3 isoform X1   1328   0.0     
ref|XP_010465706.1|  PREDICTED: topless-related protein 2-like         1327   0.0     
ref|XP_010230706.1|  PREDICTED: topless-related protein 2-like is...   1327   0.0     
ref|XP_002319498.2|  WD-40 repeat family protein                       1327   0.0     
ref|XP_008673871.1|  PREDICTED: topless-related protein 2 isoform X1   1327   0.0     
gb|EAY73338.1|  hypothetical protein OsI_01216                         1327   0.0     
ref|XP_004158753.1|  PREDICTED: topless-related protein 3-like         1326   0.0     
gb|AES91919.2|  topless-like protein                                   1326   0.0     
ref|XP_003566431.1|  PREDICTED: topless-related protein 2-like is...   1326   0.0     
ref|XP_008245640.1|  PREDICTED: topless-related protein 3              1325   0.0     
ref|XP_004494565.1|  PREDICTED: topless-related protein 3-like         1323   0.0     
ref|XP_007227035.1|  hypothetical protein PRUPE_ppa000503mg            1322   0.0     
ref|XP_008223259.1|  PREDICTED: topless-related protein 2              1321   0.0     
ref|XP_007204953.1|  hypothetical protein PRUPE_ppa000487mg            1321   0.0     
emb|CDY05552.1|  BnaA02g31390D                                         1320   0.0     
emb|CDM82632.1|  unnamed protein product                               1320   0.0     
dbj|BAJ85297.1|  predicted protein                                     1318   0.0     
ref|XP_008673872.1|  PREDICTED: topless-related protein 2 isoform X2   1318   0.0     
dbj|BAJ96033.1|  predicted protein                                     1318   0.0     
ref|XP_010230707.1|  PREDICTED: topless-related protein 2-like is...   1316   0.0     
gb|KDO81755.1|  hypothetical protein CISIN_1g001190mg                  1315   0.0     
ref|XP_002870186.1|  predicted protein                                 1315   0.0     
ref|XP_006394928.1|  hypothetical protein EUTSA_v10003550mg            1315   0.0     
ref|XP_010528913.1|  PREDICTED: topless-related protein 3-like         1313   0.0     
ref|XP_010259450.1|  PREDICTED: topless-related protein 2 isoform X3   1313   0.0     
ref|XP_009382518.1|  PREDICTED: topless-related protein 2-like is...   1311   0.0     
ref|XP_009382517.1|  PREDICTED: topless-related protein 2-like is...   1310   0.0     
ref|XP_008388509.1|  PREDICTED: topless-related protein 3-like         1309   0.0     
emb|CDX80607.1|  BnaC07g28370D                                         1308   0.0     
ref|XP_009362316.1|  PREDICTED: topless-related protein 1-like is...   1307   0.0     
ref|XP_009382516.1|  PREDICTED: topless-related protein 2-like is...   1303   0.0     
ref|XP_008370405.1|  PREDICTED: topless-related protein 3-like is...   1300   0.0     
ref|XP_009362314.1|  PREDICTED: topless-related protein 1-like is...   1300   0.0     
ref|XP_006285940.1|  hypothetical protein CARUB_v10007460mg            1298   0.0     
emb|CAN79774.1|  hypothetical protein VITISV_013612                    1298   0.0     
ref|XP_009369993.1|  PREDICTED: topless-related protein 2-like         1298   0.0     
ref|XP_009338217.1|  PREDICTED: topless-related protein 3 isoform X1   1297   0.0     
ref|XP_008394115.1|  PREDICTED: topless-related protein 1-like is...   1297   0.0     
gb|KHN03954.1|  Topless-related protein 3                              1297   0.0     
ref|NP_198055.3|  Topless-related protein 3                            1294   0.0     
ref|XP_009362315.1|  PREDICTED: topless-related protein 1-like is...   1293   0.0     
ref|XP_008394116.1|  PREDICTED: topless-related protein 1-like is...   1293   0.0     
emb|CDX88252.1|  BnaA06g28430D                                         1292   0.0     
ref|XP_008353208.1|  PREDICTED: topless-related protein 2-like         1289   0.0     
ref|XP_009151171.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...   1289   0.0     
ref|XP_008390610.1|  PREDICTED: topless-related protein 2-like         1286   0.0     
gb|EMS62858.1|  Topless-related protein 2                              1286   0.0     
ref|XP_008370406.1|  PREDICTED: topless-related protein 3-like is...   1285   0.0     
gb|KCW60528.1|  hypothetical protein EUGRSUZ_H03269                    1283   0.0     
ref|XP_009338219.1|  PREDICTED: topless-related protein 3 isoform X2   1283   0.0     
ref|XP_008340770.1|  PREDICTED: topless-related protein 2              1282   0.0     
gb|KDO81758.1|  hypothetical protein CISIN_1g001190mg                  1280   0.0     
ref|NP_001190409.1|  Topless-related protein 3                         1279   0.0     
ref|XP_007029513.1|  WD-40 repeat protein-like isoform 5               1278   0.0     
ref|XP_009346204.1|  PREDICTED: topless-related protein 2-like is...   1275   0.0     
ref|XP_007031066.1|  TOPLESS-related 3 isoform 3                       1274   0.0     
gb|KDO81756.1|  hypothetical protein CISIN_1g001190mg                  1274   0.0     
ref|XP_007035678.1|  TOPLESS-related 2 isoform 4                       1273   0.0     
ref|XP_009355784.1|  PREDICTED: topless-related protein 1-like is...   1272   0.0     
ref|XP_007035677.1|  TOPLESS-related 2 isoform 3                       1270   0.0     
ref|XP_010440213.1|  PREDICTED: topless-related protein 2-like         1267   0.0     
ref|XP_009355785.1|  PREDICTED: topless-related protein 1-like is...   1267   0.0     
ref|XP_009346203.1|  PREDICTED: topless-related protein 2-like is...   1261   0.0     
ref|XP_004292971.1|  PREDICTED: topless-related protein 1-like         1253   0.0     
gb|KDO81759.1|  hypothetical protein CISIN_1g001190mg                  1234   0.0     
ref|XP_011010175.1|  PREDICTED: protein TOPLESS-like isoform X3        1231   0.0     
ref|XP_010033967.1|  PREDICTED: topless-related protein 4 isoform X2   1221   0.0     
gb|KCW53830.1|  hypothetical protein EUGRSUZ_J03067                    1221   0.0     
ref|XP_010033966.1|  PREDICTED: topless-related protein 4 isoform X1   1214   0.0     
ref|XP_009348015.1|  PREDICTED: topless-related protein 4-like         1204   0.0     
ref|XP_009355787.1|  PREDICTED: topless-related protein 1-like is...   1201   0.0     



>ref|XP_011073378.1| PREDICTED: protein TOPLESS [Sesamum indicum]
Length=1132

 Score =  1937 bits (5019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 992/1136 (87%), Positives = 1048/1136 (92%), Gaps = 13/1136 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNW+EVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWEEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG-SVPKPGGFPPLGAHGPF  2997
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG +VPKPGGFPPLGAH PF
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGGAVPKPGGFPPLGAHVPF  240

Query  2996  QPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             QP P  VPT LAGWMSN PT +HPAVSGGPIGL   +IPAALKHPRTPPTNPSVD+PS D
Sbjct  241   QPTPAPVPTPLAGWMSNPPTGTHPAVSGGPIGLGAPTIPAALKHPRTPPTNPSVDFPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             S+H SKR R LGISDEVNLP+NVLPVSFPGH HSQ  S  DDLPK VARTLNQGSSPMSM
Sbjct  301   SEHASKRTRPLGISDEVNLPVNVLPVSFPGHAHSQTFSAPDDLPKTVARTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGTNVGD+ LWEVGSRE+LV RNFKVWDL +C+MPLQ ALVKDPGVSVN
Sbjct  361   DFHPIQQTLLLVGTNVGDLGLWEVGSRERLVQRNFKVWDLGSCTMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRH+VQI+SYHGNDDVRQHLEIDAH+GGVNDLAFSHPNKQL VIT
Sbjct  421   RVIWSPDGSLFGVAYSRHLVQIFSYHGNDDVRQHLEIDAHIGGVNDLAFSHPNKQLSVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDK IKVWDAT G KQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKFIKVWDATTGTKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS G
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFS+KFWDMD+ Q+LTS DADGGLPASPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSVKFWDMDNTQLLTSTDADGGLPASPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVV  1557
             ENGIK+LANTDG+RLLRTFENL     A  +  A+KP+VNPIS A+AS+AG  ERVASVV
Sbjct  661   ENGIKILANTDGLRLLRTFENL--AFDASRASEAAKPTVNPISAAAASSAGLTERVASVV  718

Query  1556  GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLI  1377
               S MNGDAR N+GDVKPRITEETNDKSK+WKL+EI+EPS CR+LKLPENLRVTKISRLI
Sbjct  719   SISAMNGDAR-NLGDVKPRITEETNDKSKIWKLSEISEPSQCRSLKLPENLRVTKISRLI  777

Query  1376  YTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPE  1197
             YTNSG+A+LALASNAIHLLWKWQR ERNSSGKATA +PPQLWQPSSGILMTNDV+D NPE
Sbjct  778   YTNSGNAILALASNAIHLLWKWQRSERNSSGKATATVPPQLWQPSSGILMTNDVSDTNPE  837

Query  1196  DAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIG  1017
             +AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG
Sbjct  838   EAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG  897

Query  1016  MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQK  837
             MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VWSSDGWEKQK
Sbjct  898   MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWSSDGWEKQK  957

Query  836   SKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPI  660
             S+FL LP+GR+ + QS+TRVQFHQDQIHFLVVHETQLAIYE TKLECVKQWV RE+AAPI
Sbjct  958   SRFLQLPSGRSPAAQSETRVQFHQDQIHFLVVHETQLAIYETTKLECVKQWVPRESAAPI  1017

Query  659   SHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQ  480
             SHATFSCDSQLVYASFLDATVC+FTAA+L LRCRI   +       SS VHPLV+AAHPQ
Sbjct  1018  SHATFSCDSQLVYASFLDATVCIFTAAHLRLRCRI-NPSAYLSPGVSSNVHPLVIAAHPQ  1076

Query  479   DPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN--TTPV-----SDQPPR  333
             +PNQFALGLSDG V VFEPLESEGKWGVPPP ENGS S+  TTP+     SDQ  R
Sbjct  1077  EPNQFALGLSDGSVHVFEPLESEGKWGVPPPAENGSTSSVPTTPLVGASASDQAQR  1132



>ref|XP_010318715.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum lycopersicum]
 ref|XP_010318716.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum lycopersicum]
Length=1130

 Score =  1935 bits (5012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 990/1134 (87%), Positives = 1053/1134 (93%), Gaps = 11/1134 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSK VEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKGVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPG FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGSFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  V   LAGWMSN PTV+HPAVSGGP+GL  SSIPA+LKHPRTPPTNPS+DYPSG+S
Sbjct  241   PGPAPVAAPLAGWMSNPPTVAHPAVSGGPMGLGPSSIPASLKHPRTPPTNPSIDYPSGES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DH +KR RSLGISDEVNLP+NVLP+SFPG GH+Q+ +  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHAAKRTRSLGISDEVNLPVNVLPISFPGQGHNQSLTVPDDLPKTVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP QQTLLLVGTNVGDIALWEVGSRE+LVLRNFKVWDLSACSMPLQTALVKDPGVSVN 
Sbjct  361   FHPSQQTLLLVGTNVGDIALWEVGSRERLVLRNFKVWDLSACSMPLQTALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHGNDD+RQH+EIDAHVGGVNDLAFSHPNKQL VITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGNDDIRQHVEIDAHVGGVNDLAFSHPNKQLSVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDAT+GA+QYTFEGHEAPVYSVCPHHKE +QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDATSGARQYTFEGHEAPVYSVCPHHKETIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNR+LAAGDDFSIKFWDMD V +LTSIDADGGLPASPRIRFNKDG+LLAVSANE
Sbjct  601   VQFDTTKNRFLAAGDDFSIKFWDMDHVPLLTSIDADGGLPASPRIRFNKDGSLLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN DGIRL+RTFENL     A  +   +KP+VNPISVASA+N+GFA+RVASVVG
Sbjct  661   NGIKILANNDGIRLIRTFENL--AYDASRASETTKPTVNPISVASANNSGFADRVASVVG  718

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              S MNGDARN V DVKPRI EE NDKSK+WKLTEI+E S CR+LKLPENLRVTKISRLIY
Sbjct  719   ISGMNGDARNPV-DVKPRINEEPNDKSKIWKLTEISESSQCRSLKLPENLRVTKISRLIY  777

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++ PQLWQPSSGILMTNDV + N E+
Sbjct  778   TNSGNAVLALASNAIHLLWKWQRNERNTSGKATASVSPQLWQPSSGILMTNDVHEPNHEE  837

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  838   AVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  897

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGAD+QL VWS+DGWEKQ++
Sbjct  898   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADSQLCVWSTDGWEKQRA  957

Query  833   KFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISH  654
             + L LP GR++ QSDTRVQFHQDQ HFL VHE Q+AI+E TKLEC+KQWV RE+AAPISH
Sbjct  958   RTLQLP-GRSTSQSDTRVQFHQDQTHFLAVHEAQIAIFETTKLECLKQWVPRESAAPISH  1016

Query  653   ATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDP  474
             ATFSCDSQL+YASFLDATVCVFTA +L +RCRI PSAYLSPS+S+S +HP+VVAAHPQDP
Sbjct  1017  ATFSCDSQLIYASFLDATVCVFTAGHLHMRCRIIPSAYLSPSISNSNIHPVVVAAHPQDP  1076

Query  473   NQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTPV-----SDQPPR  333
             NQFALGLSDG V VFEPLESEGKWGVPPP+ENGS  G  T P      SDQ PR
Sbjct  1077  NQFALGLSDGSVHVFEPLESEGKWGVPPPLENGSTNGMPTAPSIGASGSDQAPR  1130



>ref|XP_006341391.1| PREDICTED: protein TOPLESS-like [Solanum tuberosum]
Length=1130

 Score =  1934 bits (5011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 988/1134 (87%), Positives = 1054/1134 (93%), Gaps = 11/1134 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSK VEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKGVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPG FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGSFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  V   LAGWMSN+PTV+HPAVSGGP+GL  SSIPA+LKHPRTPPTNPS+DYPSG+S
Sbjct  241   PGPAPVXXPLAGWMSNSPTVAHPAVSGGPMGLGPSSIPASLKHPRTPPTNPSIDYPSGES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DH +KR RSLGISDEVNLP+NVLP+SFPG GH+Q+ +  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHAAKRTRSLGISDEVNLPVNVLPISFPGQGHNQSLTVPDDLPKTVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP QQTLLLVGTNVGDIALWEVGSRE+LVLRNFKVWDLSACSMPLQTALVKDPGVSVN 
Sbjct  361   FHPSQQTLLLVGTNVGDIALWEVGSRERLVLRNFKVWDLSACSMPLQTALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHGNDD+RQH+EIDAHVGGVNDLAFSHPNKQL VITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGNDDIRQHVEIDAHVGGVNDLAFSHPNKQLSVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDAT+GA+QYTFEGHEAPVYSVCPHHKE +QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDATSGARQYTFEGHEAPVYSVCPHHKETIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNR+LAAGDDFSIKFWDMD V +LTSIDADGGLPASPRIRFNKDG+LLAVSANE
Sbjct  601   VQFDTTKNRFLAAGDDFSIKFWDMDHVPLLTSIDADGGLPASPRIRFNKDGSLLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN DGIRL+RTFENL     A  +   +KP+VNPIS+ASA+N+GFA+RVASVVG
Sbjct  661   NGIKILANNDGIRLVRTFENL--AYDASRASETTKPTVNPISIASANNSGFADRVASVVG  718

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              S MNGDARN V DVKPRI EE NDKSK+WKLTEI+E S CR+LKLPENLRVTKISRLIY
Sbjct  719   ISGMNGDARNPV-DVKPRINEEPNDKSKIWKLTEISESSQCRSLKLPENLRVTKISRLIY  777

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR +RN+SGKATA++ PQLWQPSSGILMTNDV + N E+
Sbjct  778   TNSGNAVLALASNAIHLLWKWQRNDRNTSGKATASVSPQLWQPSSGILMTNDVHEPNHEE  837

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  838   AVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  897

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGAD+QL VWS+DGWEKQ++
Sbjct  898   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADSQLCVWSTDGWEKQRA  957

Query  833   KFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISH  654
             + L LP GR++ QSDTRVQFHQDQ HFL VHE Q+AI+E TKLEC+KQWV RE+AAPISH
Sbjct  958   RTLQLP-GRSTSQSDTRVQFHQDQTHFLAVHEAQIAIFETTKLECLKQWVPRESAAPISH  1016

Query  653   ATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDP  474
             ATFSCDSQL+YASFLDATVCVFTA +L +RCRI PSAYLSPS+S+S +HP+VVAAHPQDP
Sbjct  1017  ATFSCDSQLIYASFLDATVCVFTAGHLHMRCRIIPSAYLSPSISNSNIHPVVVAAHPQDP  1076

Query  473   NQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTPV-----SDQPPR  333
             NQFALGLSDG V VFEPLESEGKWGVPPP+ENGS  G  T P      SDQ PR
Sbjct  1077  NQFALGLSDGSVHVFEPLESEGKWGVPPPLENGSANGMPTAPSIGASGSDQAPR  1130



>ref|XP_009611336.1| PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis]
 ref|XP_009611337.1| PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis]
Length=1127

 Score =  1930 bits (5001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 994/1134 (88%), Positives = 1050/1134 (93%), Gaps = 14/1134 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSK VEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKGVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPG FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGSFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  V   LAGWMSNTPTV+HPAVSGGP+GL  SSIPA+LKHPRTPPTNPS+DYPSG+S
Sbjct  241   PGPPPVAAPLAGWMSNTPTVAHPAVSGGPMGLGSSSIPASLKHPRTPPTNPSIDYPSGES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHV+KR RSLGISDEVNLP+NVLP+SFPG GH+QA S  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHVAKRTRSLGISDEVNLPVNVLPISFPGQGHNQALSVPDDLPKTVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP QQTLLLVGTNVGDIALWEVGSRE+LVLRNFKVWDL ACSMPLQTALVKDPGVSVN 
Sbjct  361   FHPSQQTLLLVGTNVGDIALWEVGSRERLVLRNFKVWDLGACSMPLQTALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHGNDD+RQHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGNDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDAT+GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDATSGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTY GFRKRS GV
Sbjct  541   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYLGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNR+LAAGDDFSIKFWDMD VQ+LTSIDADGGLPASPRIRFNKDG+LLAVSANE
Sbjct  601   VQFDTTKNRFLAAGDDFSIKFWDMDHVQLLTSIDADGGLPASPRIRFNKDGSLLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN+DGIRL+R FENL     A  +  ++KP+VN I   SAS++GFA+RVAS VG
Sbjct  661   NGIKILANSDGIRLVRAFENL--AYDASRASESAKPTVNQI---SASSSGFADRVASGVG  715

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              S MNGDARN V DVKPRI EE NDKSK+WKLTEITEPS CR+LKLPENLRVTKISRLIY
Sbjct  716   ISGMNGDARNTV-DVKPRIVEEPNDKSKIWKLTEITEPSQCRSLKLPENLRVTKISRLIY  774

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQPSSGILMTNDV + N E+
Sbjct  775   TNSGNAILALASNAIHLLWKWQRNERNSSGKATASVSPQLWQPSSGILMTNDVTELNHEE  834

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  835   AVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  894

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VWS+DGWEKQ++
Sbjct  895   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHSLNVLVSSGADSQLCVWSTDGWEKQRA  954

Query  833   KFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISH  654
             + L L  GR++ QSDTRVQFHQDQ HFLVVHE Q+AIYE TKLECVKQWV RE+AAPISH
Sbjct  955   RSLQL-LGRSTSQSDTRVQFHQDQTHFLVVHEAQIAIYETTKLECVKQWVPRESAAPISH  1013

Query  653   ATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDP  474
             ATFSCDSQL+YASFLDATVCVFT   L +RCRI PSAYLSPS+S+S VHP+VVAAHPQDP
Sbjct  1014  ATFSCDSQLIYASFLDATVCVFTFTPLHMRCRIIPSAYLSPSISNSNVHPVVVAAHPQDP  1073

Query  473   NQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTPV-----SDQPPR  333
             NQFALGLSDG V VFEPLESEGKWGVPPP+ENGS  G  T P      S+Q PR
Sbjct  1074  NQFALGLSDGSVHVFEPLESEGKWGVPPPLENGSANGMPTAPSVGASGSEQAPR  1127



>ref|XP_009796750.1| PREDICTED: protein TOPLESS-like [Nicotiana sylvestris]
 ref|XP_009796751.1| PREDICTED: protein TOPLESS-like [Nicotiana sylvestris]
Length=1127

 Score =  1929 bits (4997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 992/1134 (87%), Positives = 1050/1134 (93%), Gaps = 14/1134 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSK VEIL KDLKVF+SFNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKGVEILVKDLKVFASFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPG FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGSFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  V   LAGWMSN PTV+HPAVSGGP+GL  SSIPA+LKHPRTPPTNPS+DYPSG+S
Sbjct  241   PGPPPVAAPLAGWMSNAPTVAHPAVSGGPMGLGSSSIPASLKHPRTPPTNPSMDYPSGES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHV+KR RSLGISDEVNLP+NVLP+SFPG GH+QA S  DD+PK VARTLNQGSSPMSMD
Sbjct  301   DHVAKRTRSLGISDEVNLPVNVLPISFPGQGHNQALSVPDDMPKTVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP QQTLLLVGTNVGDIALWEVGSRE+LVLRNFKVWDL ACSMPLQTALVKDPGVSVN 
Sbjct  361   FHPSQQTLLLVGTNVGDIALWEVGSRERLVLRNFKVWDLGACSMPLQTALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHGNDD+RQHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGNDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDAT+GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDATSGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTY GFRKRS GV
Sbjct  541   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYLGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNR+LAAGDDFSIKFWDMD VQ+LTSIDADGGLPASPRIRFNKDG+LLAVSANE
Sbjct  601   VQFDTTKNRFLAAGDDFSIKFWDMDHVQLLTSIDADGGLPASPRIRFNKDGSLLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN+DGIRL+RTFENL     A  +  ++KP+VN I   SAS++GFA+RVAS VG
Sbjct  661   NGIKILANSDGIRLVRTFENL--AYDASRASESAKPTVNQI---SASSSGFADRVASGVG  715

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              S MNGDARN V DVKPRI EE NDKSK+WKLTEITEPS CR+LKLPENLRVTKISRLIY
Sbjct  716   ISGMNGDARNTV-DVKPRIVEEPNDKSKIWKLTEITEPSQCRSLKLPENLRVTKISRLIY  774

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQPSSGILMTNDV + N E+
Sbjct  775   TNSGNAILALASNAIHLLWKWQRNERNSSGKATASVSPQLWQPSSGILMTNDVTEPNHEE  834

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  835   AVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  894

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VWS+DGWEKQ++
Sbjct  895   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHSLNVLVSSGADSQLCVWSTDGWEKQRA  954

Query  833   KFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISH  654
             + L L  GR++ QSDTRVQFHQDQ HFLVVHE Q+AIYE TKLECVKQWV RE+AAPISH
Sbjct  955   RSLQL-LGRSTSQSDTRVQFHQDQTHFLVVHEAQIAIYETTKLECVKQWVPRESAAPISH  1013

Query  653   ATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDP  474
             ATFSCDSQL+YASFLDATVCVFT   L +RCRI PSAYLSPS+S+S VHP+VVAAHPQDP
Sbjct  1014  ATFSCDSQLIYASFLDATVCVFTFTPLHMRCRIIPSAYLSPSISNSNVHPVVVAAHPQDP  1073

Query  473   NQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTPV-----SDQPPR  333
             NQFALGLSDG V VFEPLESEGKWGVPPP+ENGS  G  T P      S+Q PR
Sbjct  1074  NQFALGLSDGSVHVFEPLESEGKWGVPPPLENGSANGMPTAPSAGASGSEQAPR  1127



>ref|XP_007214907.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica]
 gb|EMJ16106.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica]
Length=1139

 Score =  1923 bits (4982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 983/1141 (86%), Positives = 1047/1141 (92%), Gaps = 16/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVS-GGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+HPA S GG IGL   SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTPAPVPIPLAGWMSNPSTVTHPAASEGGAIGLGAPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +G+S EVNLP+N+LPV+FPGHGH QA +  DDLPKNV RTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGLSSEVNLPVNMLPVTFPGHGHGQALNAPDDLPKNVTRTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDLS+CSMPLQ ALVKDPGVSVN
Sbjct  361   DFHPLQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLSSCSMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG DD+RQH EIDAHVGGVNDLAFSHPNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDDIRQHKEIDAHVGGVNDLAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDAT GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDATTGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRSFG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDG+LLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGSLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV------ASASNAGFAE  1575
             ENGIKVLAN DGIRLLRTFEN     A+R SE  +KP++NPISV      A+A++AG A+
Sbjct  661   ENGIKVLANADGIRLLRTFENHLSYDASRTSEVVTKPAINPISVAAAAAAAAATSAGLAD  720

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R AS V  S MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI EPS CR+L+LPEN+RVT
Sbjct  721   RSASAVSISGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEINEPSQCRSLRLPENMRVT  779

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             KISRLIYTNSGSA+LALASNAIHLLWKWQR ERNS+ KATA++ PQLWQPSSGILMTND+
Sbjct  780   KISRLIYTNSGSAILALASNAIHLLWKWQRSERNSASKATASVSPQLWQPSSGILMTNDI  839

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             AD +PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  840   ADTSPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  899

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+SD
Sbjct  900   NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSD  959

Query  854   GWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQKS+FL LPAGR +  QSDTRVQFHQDQ+HFLVVHETQLAIYE TKLECVKQWV R
Sbjct  960   GWEKQKSRFLQLPAGRTTASQSDTRVQFHQDQMHFLVVHETQLAIYETTKLECVKQWVPR  1019

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             ++AAPISHATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  S+ V PLV
Sbjct  1020  DSAAPISHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSVYLPANVSNNVQPLV  1078

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT------TPVSDQPP  336
             +AAHPQ+PNQFALGLSDG V VFEPLESEGKWGVPPPVENGS S+       T  SDQ  
Sbjct  1079  IAAHPQEPNQFALGLSDGAVHVFEPLESEGKWGVPPPVENGSASSVPATQVGTAGSDQAQ  1138

Query  335   R  333
             R
Sbjct  1139  R  1139



>ref|XP_008228737.1| PREDICTED: protein TOPLESS [Prunus mume]
Length=1139

 Score =  1914 bits (4958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 980/1141 (86%), Positives = 1043/1141 (91%), Gaps = 16/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVS-GGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+HPA S GG IGL   SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTPAPVPIPLAGWMSNPSTVTHPAASEGGAIGLGAPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +G+S EVNLP+N+LPV+FPGHGH QA +  DDLPKNV RTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGLSSEVNLPVNMLPVTFPGHGHGQALNAPDDLPKNVTRTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL +CSMPLQ ALVKDPGVSVN
Sbjct  361   DFHPLQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGSCSMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG DD+RQH EIDAHVGGVNDLAFSHPNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDDIRQHQEIDAHVGGVNDLAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDAT GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDATTGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFRKRSFG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+ Q+LT++DADGGLPASPRIRFNKDG+LLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNTQLLTTVDADGGLPASPRIRFNKDGSLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV------ASASNAGFAE  1575
             ENGIKVLAN DGIRLLRTFEN     A+R SE  +KP++NPISV      A+A++AG A+
Sbjct  661   ENGIKVLANADGIRLLRTFENHLSYDASRTSEVVTKPAINPISVAAAAAAAAATSAGLAD  720

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R AS V  S MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI EPS CR+L+LPEN+RVT
Sbjct  721   RSASAVSISGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEINEPSQCRSLRLPENMRVT  779

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             KISRLIYTNSGSA+LALASNAIHLLWKWQR ERNS+ KATA++ PQLWQPSSGILMTNDV
Sbjct  780   KISRLIYTNSGSAILALASNAIHLLWKWQRSERNSTSKATASVSPQLWQPSSGILMTNDV  839

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             AD +PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  840   ADTSPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  899

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+ D
Sbjct  900   NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNPD  959

Query  854   GWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQKS+FL LPAGR +  QSDTRVQFHQDQ+HFLVVHETQL IYE TKLECVKQWV R
Sbjct  960   GWEKQKSRFLQLPAGRTTASQSDTRVQFHQDQMHFLVVHETQLGIYETTKLECVKQWVPR  1019

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             ++AAPISHATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  S+ V PLV
Sbjct  1020  DSAAPISHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSVYLPANVSNNVQPLV  1078

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT------TPVSDQPP  336
             +AAHPQ+PNQFALGLSDG V VFEPLESEGKWGVPPPVENGS S+       T  SDQ  
Sbjct  1079  IAAHPQEPNQFALGLSDGAVHVFEPLESEGKWGVPPPVENGSASSVPATQVGTAGSDQAQ  1138

Query  335   R  333
             R
Sbjct  1139  R  1139



>ref|XP_004303268.1| PREDICTED: protein TOPLESS-like [Fragaria vesca subsp. vesca]
Length=1138

 Score =  1906 bits (4938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 976/1124 (87%), Positives = 1041/1124 (93%), Gaps = 9/1124 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVS-GGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+HPAVS GG IGL   SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTPAPVPIPLAGWMSNASTVTHPAVSEGGAIGLGGPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +G+S+EVNLP+N+LPVSFPGH HSQA +  DDLPKNVARTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGLSNEVNLPVNILPVSFPGHSHSQALNAPDDLPKNVARTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQ TLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL +CSMPLQ ALVKDPGVSVN
Sbjct  361   DFHPVQLTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGSCSMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVNDLAFSHPNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  G+KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDAATGSKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFRKRSFG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV-----ASASNAGFAER  1572
             ENGIK+L N DGIRLLRTFENL    A+R SE  +KP++NPISV     A+AS+AG AER
Sbjct  661   ENGIKILGNADGIRLLRTFENL-SYDASRTSEVVTKPAMNPISVAAAAAAAASSAGLAER  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              AS V  S MNG+AR N+GDVKPRITEE+NDKSK+WKLTEI EPS CR+L+LPEN+RVTK
Sbjct  720   SASAVAISGMNGEAR-NLGDVKPRITEESNDKSKIWKLTEINEPSQCRSLRLPENMRVTK  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG+A+LALASNAIHLLWKWQR +R S  KATA++ PQLWQP+SGILMTNDV 
Sbjct  779   ISRLIYTNSGNAILALASNAIHLLWKWQRNDRTSVSKATASVSPQLWQPTSGILMTNDVT  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D + E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  839   DTSSEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQ+ VW+SDG
Sbjct  899   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQVCVWNSDG  958

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQKS+FL LPAGR  S QSDTRVQFHQDQ HFLVVHETQLAI+E TKLECVKQWV R+
Sbjct  959   WEKQKSRFLQLPAGRTPSSQSDTRVQFHQDQTHFLVVHETQLAIFETTKLECVKQWVPRD  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             +AAPISHATFSCDSQL+YASFLDATVCVF+AANL LRCRI P  YL  ++SSS V PLV+
Sbjct  1019  SAAPISHATFSCDSQLIYASFLDATVCVFSAANLRLRCRINPPVYLPANVSSSNVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             AAHPQ+PNQFALGLSDG V VFEPLESEGKWGVPPP ENGS S+
Sbjct  1079  AAHPQEPNQFALGLSDGAVHVFEPLESEGKWGVPPPAENGSASS  1122



>ref|XP_006427463.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
 gb|ESR40703.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
Length=1136

 Score =  1902 bits (4928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 976/1139 (86%), Positives = 1043/1139 (92%), Gaps = 15/1139 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN PTV+HPAVSGG IGL   SIPAA LKHPRTPPTNPSVDYPSGD
Sbjct  241   PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDH+SKR R +GISDE+NLP+NVLPVSF GH HSQA S  +DLPK V RTLNQGSSPMSM
Sbjct  301   SDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSQAFSAPEDLPKTVTRTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL ACSMPLQ ALVKDPGVSVN
Sbjct  361   DFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDATNGAKQY FEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS G
Sbjct  541   SRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LTSIDADGGLPASPRIRFNKDG LLAVS N
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCLLAVSTN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFAERVA  1566
             +NGIK+LA +DGIRLLRTFENL     A  +   SKP+++PIS    A+A++AG A+R A
Sbjct  661   DNGIKILATSDGIRLLRTFENL--AYDASRTSENSKPTISPISAAAAAAATSAGLADRAA  718

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             S+V    MNGD R ++ DVKPRITEE+NDKSKVWKLTE++EP+ CR+L+LPENLR TKIS
Sbjct  719   SMVSIPGMNGDVR-SLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRATKIS  777

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLI+TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQP SGI+MTNDV D 
Sbjct  778   RLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTNDVTDS  837

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNII
Sbjct  838   NPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNII  897

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDS+IQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VW SDGWE
Sbjct  898   AIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWGSDGWE  957

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQK++FL +P GR  + QSDTRVQFHQDQIHFLVVHETQLAI+E TKLECVKQWV RE++
Sbjct  958   KQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVPRESS  1017

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             API+HATFSCDSQLVYA FLDATVCVF+AANL LRCRI PSAYL   +SSS VHPLV+AA
Sbjct  1018  APITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRINPSAYLPAGVSSSNVHPLVIAA  1077

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN---TTPV----SDQPPR  333
             HPQ+PN+FALGLSDGGV VFEPLESEGKWGVPPPV+NGS S+   T PV    SDQ  R
Sbjct  1078  HPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGSDQAQR  1136



>ref|XP_006427465.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
 gb|ESR40705.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
Length=1142

 Score =  1902 bits (4926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 976/1145 (85%), Positives = 1043/1145 (91%), Gaps = 21/1145 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPA-------ALKHPRTPPTNPSV  2835
             P P  VPT LAGWMSN PTV+HPAVSGG IGL   SIPA       ALKHPRTPPTNPSV
Sbjct  241   PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAGTSLSHSALKHPRTPPTNPSV  300

Query  2834  DYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQG  2655
             DYPSGDSDH+SKR R +GISDE+NLP+NVLPVSF GH HSQA S  +DLPK V RTLNQG
Sbjct  301   DYPSGDSDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSQAFSAPEDLPKTVTRTLNQG  360

Query  2654  SSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKD  2475
             SSPMSMDFHPVQQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL ACSMPLQ ALVKD
Sbjct  361   SSPMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKD  420

Query  2474  PGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  2295
             PGVSVN + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNK
Sbjct  421   PGVSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNK  480

Query  2294  QLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAW  2115
             QLCVITCGDDKTIKVWDATNGAKQY FEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAW
Sbjct  481   QLCVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAW  540

Query  2114  LYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  1935
             LYDN+GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF
Sbjct  541   LYDNLGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGF  600

Query  1934  RKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTL  1755
             RKRS GVVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LTSIDADGGLPASPRIRFNKDG L
Sbjct  601   RKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCL  660

Query  1754  LAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAG  1584
             LAVS N+NGIK+LA +DGIRLLRTFENL     A  +   SKP+++PIS    A+A++AG
Sbjct  661   LAVSTNDNGIKILATSDGIRLLRTFENL--AYDASRTSENSKPTISPISAAAAAAATSAG  718

Query  1583  FAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENL  1404
              A+R AS+V    MNGD R ++ DVKPRITEE+NDKSKVWKLTE++EP+ CR+L+LPENL
Sbjct  719   LADRAASMVSIPGMNGDVR-SLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENL  777

Query  1403  RVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMT  1224
             R TKISRLI+TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQP SGI+MT
Sbjct  778   RATKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMT  837

Query  1223  NDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHP  1044
             NDV D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHP
Sbjct  838   NDVTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHP  897

Query  1043  QDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVW  864
             QDNNIIAIGMDDS+IQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VW
Sbjct  898   QDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVW  957

Query  863   SSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW  687
              SDGWEKQK++FL +P GR  + QSDTRVQFHQDQIHFLVVHETQLAI+E TKLECVKQW
Sbjct  958   GSDGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQW  1017

Query  686   VQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVH  507
             V RE++API+HATFSCDSQLVYA FLDATVCVF+AANL LRCRI PSAYL   +SSS VH
Sbjct  1018  VPRESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRINPSAYLPAGVSSSNVH  1077

Query  506   PLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN---TTPV----S  348
             PLV+AAHPQ+PN+FALGLSDGGV VFEPLESEGKWGVPPPV+NGS S+   T PV    S
Sbjct  1078  PLVIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGS  1137

Query  347   DQPPR  333
             DQ  R
Sbjct  1138  DQAQR  1142



>ref|XP_010691083.1| PREDICTED: protein TOPLESS [Beta vulgaris subsp. vulgaris]
 ref|XP_010691084.1| PREDICTED: protein TOPLESS [Beta vulgaris subsp. vulgaris]
Length=1141

 Score =  1898 bits (4917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 967/1130 (86%), Positives = 1044/1130 (92%), Gaps = 10/1130 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VP  LAGWMSN  TVSHPAVSGGPIGL   S+PAALKHPRTPPTN S+DYPSGDS
Sbjct  241   PTPAPVPAPLAGWMSNPATVSHPAVSGGPIGLGAPSMPAALKHPRTPPTNSSMDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHV+KR R +GI+DEVNLP+NVLPVSFPGHGH+QA +  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHVAKRTRPIGIADEVNLPVNVLPVSFPGHGHNQAFNVPDDLPKTVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP Q TLLLVGTNVGDIALWE+GSRE+LVLRNFKVWDLS CSMPLQ ALVKDP VSVN 
Sbjct  361   FHPGQLTLLLVGTNVGDIALWEIGSRERLVLRNFKVWDLSTCSMPLQAALVKDPAVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHG +DVRQHLEIDAHVGGVND+AFS PNKQLCVITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGGEDVRQHLEIDAHVGGVNDIAFSTPNKQLCVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTA+DGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDAATGTKQYTFEGHEAPVYSVCPHYKENIQFIFSTAVDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYS DGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYDAPGRWCTTMAYSQDGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LTS+DADGGLPASPRIRFNKDGTLLAVSA+E
Sbjct  601   VQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTSMDADGGLPASPRIRFNKDGTLLAVSASE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-------VASASNAGFAE  1575
             NGIK++AN+DG+RLLRT+ENL    ++RASES +KPS+NPIS        A+A+++G  +
Sbjct  661   NGIKIMANSDGLRLLRTYENL-SYDSSRASESLTKPSINPISAAAAAAAAAAATSSGIPD  719

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R + +V  + MNGDAR ++GDVK RI EE+NDKSK+WKL EI+EPS CR+L+LPE++R  
Sbjct  720   RSSPMVAMTGMNGDAR-SLGDVKSRILEESNDKSKIWKLCEISEPSQCRSLRLPEHMRAA  778

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             KISRLIYTNSG+A+LALASNAIHLLWKWQR ERNSSGKA+AN+PPQLWQPSSGILMTNDV
Sbjct  779   KISRLIYTNSGNAILALASNAIHLLWKWQRNERNSSGKASANVPPQLWQPSSGILMTNDV  838

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D +PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMT FMPPPPAATFLAFHPQDN
Sbjct  839   SDASPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTVFMPPPPAATFLAFHPQDN  898

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH+LNVLVSSGADAQL VWSSD
Sbjct  899   NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHLLNVLVSSGADAQLCVWSSD  958

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
              WEKQ+SKFL LPAGRA + QSDTRVQFHQDQ HFLVVHETQLAI+E  +LECVKQWV R
Sbjct  959   NWEKQRSKFLQLPAGRAPTAQSDTRVQFHQDQTHFLVVHETQLAIFETKQLECVKQWVPR  1018

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             E++APISHATFSCDSQLVYASFLDATVCVF+A+NL LRCRI PSAYL  ++SSS VHPLV
Sbjct  1019  ESSAPISHATFSCDSQLVYASFLDATVCVFSASNLRLRCRINPSAYLPANVSSSNVHPLV  1078

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             +AAHPQ+ NQFA+GLSDGGV VFEPLESEGKWGVPPP+ENGS   + P +
Sbjct  1079  IAAHPQEGNQFAVGLSDGGVHVFEPLESEGKWGVPPPMENGSAGGSVPTT  1128



>gb|KHG11821.1| Protein TOPLESS -like protein [Gossypium arboreum]
Length=1134

 Score =  1898 bits (4916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 964/1121 (86%), Positives = 1036/1121 (92%), Gaps = 8/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVH+LEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHRLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK D SKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDLSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGGLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VP  LAGWMSN  TV+HPAVSGG IGL  SSIPAALKHPRTPPTNPSVDYPSGDS
Sbjct  241   PTPAPVPAPLAGWMSNPSTVTHPAVSGGAIGLGPSSIPAALKHPRTPPTNPSVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHVSKR R +GISDEVNLP+NVLPV+FPGHGHSQ  +  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHVSKRTRPMGISDEVNLPVNVLPVTFPGHGHSQTFNAPDDLPKAVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDIALWE+GSRE+LVL+NFKVWDLSACSMPLQ ALVKDP VSVN 
Sbjct  361   FHPVQQTLLLVGTNVGDIALWEIGSRERLVLKNFKVWDLSACSMPLQAALVKDPAVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQLCV+TC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDLAFSHPNKQLCVVTC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDK IKVW+ATNG KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNMGS
Sbjct  481   GDDKMIKVWEATNGTKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNMGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKEGESFIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ LTS+DADGGLPASPRIRFNKDG+LLAVSAN+
Sbjct  601   VQFDTTKNRYLAAGDDFSIKFWDMDNVQPLTSVDADGGLPASPRIRFNKDGSLLAVSAND  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI---SVASASNAGFAERVAS  1563
             NGIK+LAN+DG+RLLRT ENL     A  +  A KP++NPI   + A A++AG A+R AS
Sbjct  661   NGIKILANSDGMRLLRTLENL--SYDASRTSEAPKPTINPISAAAAAVATSAGLADRSAS  718

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV  + MNGDAR ++GDVKPRITEE++DKSK+WKLTEI+EPS CR+L+LPENLRVTKISR
Sbjct  719   VVAIAGMNGDAR-SLGDVKPRITEESSDKSKIWKLTEISEPSQCRSLRLPENLRVTKISR  777

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LI+TNSG+A+LALASNAIHLLWKWQR ERNS+GKATA++ PQLWQPSSGILMTNDVAD +
Sbjct  778   LIFTNSGNAILALASNAIHLLWKWQRSERNSNGKATASVLPQLWQPSSGILMTNDVADTS  837

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPP ATFLAFHPQDNNIIA
Sbjct  838   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPPATFLAFHPQDNNIIA  897

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVL+VLVSSGAD+QL VW++DGWEK
Sbjct  898   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLSVLVSSGADSQLCVWNTDGWEK  957

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+S+FL +P+GR  +  SDTRVQFHQDQ+HFLVVHETQLAIYE TKLE VKQWV  E++A
Sbjct  958   QRSRFLQVPSGRTPTTLSDTRVQFHQDQMHFLVVHETQLAIYETTKLERVKQWVPLESSA  1017

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HATFSCDSQLVYASFLDATVCVFTAANL LRCRI   +   P+  SS VHPLV+AAH
Sbjct  1018  PITHATFSCDSQLVYASFLDATVCVFTAANLRLRCRI-NPSAYLPASVSSNVHPLVIAAH  1076

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             P +PN+FALGLSDGGV VFEPLESE KWGVPPPVENGS SN
Sbjct  1077  PSEPNEFALGLSDGGVHVFEPLESENKWGVPPPVENGSSSN  1117



>ref|XP_006427464.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
 ref|XP_006427466.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
 gb|ESR40704.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
 gb|ESR40706.1| hypothetical protein CICLE_v10024745mg [Citrus clementina]
Length=1141

 Score =  1896 bits (4911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 971/1145 (85%), Positives = 1039/1145 (91%), Gaps = 22/1145 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPA-------ALKHPRTPPTNPSV  2835
             P P  VPT LAGWMSN PTV+HPAVSGG IGL   SIPA       ALKHPRTPPTNPSV
Sbjct  241   PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAGTSLSHSALKHPRTPPTNPSV  300

Query  2834  DYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQG  2655
             DYPSGDSDH+SKR R +GISDE+NLP+NVLPVSF GH HSQA S  +DLPK V RTLNQG
Sbjct  301   DYPSGDSDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSQAFSAPEDLPKTVTRTLNQG  360

Query  2654  SSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKD  2475
             SSPMSMDFHPVQQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL ACSMPLQ ALVKD
Sbjct  361   SSPMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKD  420

Query  2474  PGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  2295
             PGVSVN + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNK
Sbjct  421   PGVSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNK  480

Query  2294  QLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAW  2115
             QLCVITCGDDKTIKVWDATNGAKQY FEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAW
Sbjct  481   QLCVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAW  540

Query  2114  LYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  1935
             LYDN+GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF
Sbjct  541   LYDNLGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGF  600

Query  1934  RKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTL  1755
             RKRS GVVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LTSIDADGGLPASPRIRFNKDG L
Sbjct  601   RKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCL  660

Query  1754  LAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAG  1584
             LAVS N+NGIK+LA +DGIRLLRTFENL     A  +   SKP+++PIS    A+A++AG
Sbjct  661   LAVSTNDNGIKILATSDGIRLLRTFENL--AYDASRTSENSKPTISPISAAAAAAATSAG  718

Query  1583  FAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENL  1404
              A+R AS+V    MNGD R ++ DVKPRITEE+NDKSKVWKLTE++EP+ CR+L+LPENL
Sbjct  719   LADRAASMVSIPGMNGDVR-SLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENL  777

Query  1403  RVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMT  1224
             R TKISRLI+TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQP SGI+MT
Sbjct  778   RATKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMT  837

Query  1223  NDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHP  1044
             NDV D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHP
Sbjct  838   NDVTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHP  897

Query  1043  QDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVW  864
             QDNNIIAIGMDDS+IQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VW
Sbjct  898   QDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVW  957

Query  863   SSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW  687
              SDGWEKQK++FL +P GR  + QSDTRVQFHQDQIHFLVVHETQLAI+E TKLECVKQW
Sbjct  958   GSDGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQW  1017

Query  686   VQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVH  507
             V RE++API+HATFSCDSQLVYA FLDATVCVF+AANL LRCRI   +   P+  SS VH
Sbjct  1018  VPRESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRI-NPSAYLPAGVSSNVH  1076

Query  506   PLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN---TTPV----S  348
             PLV+AAHPQ+PN+FALGLSDGGV VFEPLESEGKWGVPPPV+NGS S+   T PV    S
Sbjct  1077  PLVIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGS  1136

Query  347   DQPPR  333
             DQ  R
Sbjct  1137  DQAQR  1141



>ref|XP_002268265.1| PREDICTED: protein TOPLESS [Vitis vinifera]
 emb|CBI36431.3| unnamed protein product [Vitis vinifera]
Length=1138

 Score =  1895 bits (4910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 976/1141 (86%), Positives = 1040/1141 (91%), Gaps = 17/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPHLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VPT L  WMSN  TV+HPAVSGGPIGL   SIPAALKHPRTPPTNPSVDYPSGDS
Sbjct  241   PTPAPVPTPL--WMSNPSTVTHPAVSGGPIGLGAPSIPAALKHPRTPPTNPSVDYPSGDS  298

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             +HV+KR R +GISDEVNLP+NVLPV+FPGHGHSQA +  DDLPK + R L QGSSPMSMD
Sbjct  299   EHVAKRGRPMGISDEVNLPVNVLPVTFPGHGHSQAFNAPDDLPKTLVRNLTQGSSPMSMD  358

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDI LWEVGS++KLV RNFKVWD+ ACS+PLQ AL KDPGVSVN 
Sbjct  359   FHPVQQTLLLVGTNVGDIGLWEVGSKQKLVSRNFKVWDIGACSVPLQAALAKDPGVSVNR  418

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             I WSPDGSLFGVAYSRHIVQIYSYHG DDVRQHLEIDAH GGVNDLAFSHPNKQLCVITC
Sbjct  419   IIWSPDGSLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHAGGVNDLAFSHPNKQLCVITC  478

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDATNG KQYTFEGHE  VYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  479   GDDKTIKVWDATNGTKQYTFEGHEDAVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGS  538

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  539   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFRKRSLGV  598

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADG---GLPASPRIRFNKDGTLLAVS  1743
             VQFDTTKNR+LAAGDDFSIKFWDMD++Q+LT +DA+G   GLPASPRIRFNKDGTLLAVS
Sbjct  599   VQFDTTKNRFLAAGDDFSIKFWDMDNIQLLTILDAEGGLPGLPASPRIRFNKDGTLLAVS  658

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesas---kpSVNPISVASASNAGFAER  1572
             ANEN IK+LAN+DG+RLLRTF+NL+YDA+  +               + A+A++AG A+R
Sbjct  659   ANENSIKILANSDGLRLLRTFDNLSYDASRASESVTKPAINSISAAAAAAAATSAGLADR  718

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              ASVV  + MNGDAR N+GDVKPR+ EETNDKSK+WKLTEI E S CR+L+L ENLR+TK
Sbjct  719   GASVVAIAGMNGDAR-NMGDVKPRLAEETNDKSKIWKLTEINETSQCRSLRLQENLRITK  777

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG+A+LALASNAIH LWKWQR +RNSSGKATA + PQLWQP+SGILMTNDVA
Sbjct  778   ISRLIYTNSGNAILALASNAIHFLWKWQRNDRNSSGKATATVSPQLWQPTSGILMTNDVA  837

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  838   DTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  897

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VWSSDG
Sbjct  898   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWSSDG  957

Query  851   WEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQKS+FL +PAGR S  QSDTRVQFHQDQ HFLVVHETQLAIYEATKL+CVKQWVQRE
Sbjct  958   WEKQKSRFLQVPAGRTSTGQSDTRVQFHQDQTHFLVVHETQLAIYEATKLDCVKQWVQRE  1017

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             AAAPISHATFSCDS LVYASFLDATVCVF+AANL LRCRI P+AYL  S+S+S VHPLV+
Sbjct  1018  AAAPISHATFSCDSLLVYASFLDATVCVFSAANLRLRCRINPTAYLPASVSNSNVHPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT--TPV-----SDQPP  336
             AAHPQ+PNQFALGLSDGGV VFEPLESEGKWGVPPPVENGS S+   TP      SDQP 
Sbjct  1078  AAHPQEPNQFALGLSDGGVCVFEPLESEGKWGVPPPVENGSASSVPATPSVGPSGSDQPQ  1137

Query  335   R  333
             R
Sbjct  1138  R  1138



>ref|XP_007023319.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 ref|XP_007023320.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 ref|XP_007023321.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 ref|XP_007023322.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 gb|EOY25941.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 gb|EOY25942.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 gb|EOY25943.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
 gb|EOY25944.1| TOPLESS-related 1 isoform 1 [Theobroma cacao]
Length=1142

 Score =  1894 bits (4907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 963/1129 (85%), Positives = 1036/1129 (92%), Gaps = 16/1129 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVS-GGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P QVP  LAGWMSN  TV+HPAVS GG IGL  SSIPAALKHPRTPPTNPSVDYP GD
Sbjct  241   PTPAQVPAPLAGWMSNPSTVTHPAVSGGGAIGLGASSIPAALKHPRTPPTNPSVDYPPGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +GISDEVNLP+NVLPV+FPGHGHSQ  +  DDLPK VARTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGISDEVNLPVNVLPVTFPGHGHSQTFNAPDDLPKTVARTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQTLLLVGTNVG+IALWEVGSRE+LVL+NF+VW+LSACSMPLQ AL KDP VSVN
Sbjct  361   DFHPKQQTLLLVGTNVGEIALWEVGSREQLVLKNFRVWELSACSMPLQAALAKDPAVSVN  420

Query  2456  CITWS---PDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
              + W+   P+GSLFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFS PNKQLC
Sbjct  421   RVIWNQPHPEGSLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSLPNKQLC  480

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             VITCGDDKTIKVWDA+ GAKQ+ FEGHEAPVYSVCPHHKEN+QFIFSTA+DGKIKAWLYD
Sbjct  481   VITCGDDKTIKVWDASTGAKQFIFEGHEAPVYSVCPHHKENIQFIFSTAVDGKIKAWLYD  540

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             NMGSRVDY+APGRWCTTMAYSADGTRLFSCGTSK+G+S IVEWNESEGAVKRTYQGFRKR
Sbjct  541   NMGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKEGDSFIVEWNESEGAVKRTYQGFRKR  600

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTTKNRYLAAGDDFSIKFWDMD++ +LTSIDADGGLPASPRIRFNKDG+LLAV
Sbjct  601   SLGVVQFDTTKNRYLAAGDDFSIKFWDMDNISLLTSIDADGGLPASPRIRFNKDGSLLAV  660

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-------VASASNA  1587
             S N+NGIK+LAN+DG+RLLRT ENL     A  +  A KP++N IS         +A++A
Sbjct  661   STNDNGIKILANSDGMRLLRTMENL--SYDASRASEAPKPTINSISAAAAAAAAVAATSA  718

Query  1586  GFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
             G A+R ASVV  + MNGDAR ++GDVKPRITEE++DKSK+WKLTEI+EPS CR+L+LPEN
Sbjct  719   GIADRSASVVAIAAMNGDAR-SLGDVKPRITEESSDKSKIWKLTEISEPSQCRSLRLPEN  777

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             LRVTKISRLI+TNSG+A+LALASNAIHLLWKWQR ERN+ GKATA++PPQLWQPSSGILM
Sbjct  778   LRVTKISRLIFTNSGNAILALASNAIHLLWKWQRSERNTIGKATASVPPQLWQPSSGILM  837

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TNDVAD NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFH
Sbjct  838   TNDVADTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFH  897

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGAD+QL V
Sbjct  898   PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADSQLCV  957

Query  866   WSSDGWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             W++DGWEKQK++FL + AGR  + QSDTRVQFHQDQIHFLVVHETQLAIYE TKLECVKQ
Sbjct  958   WNTDGWEKQKARFLQVSAGRTPMAQSDTRVQFHQDQIHFLVVHETQLAIYETTKLECVKQ  1017

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             WV RE++API+HATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  SS V
Sbjct  1018  WVPRESSAPITHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSAYLPASISSNV  1076

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             HPLV+AAHP +PN+FALGLSDGGV VFEPLESE KWGVPPPVENGS S+
Sbjct  1077  HPLVIAAHPSEPNEFALGLSDGGVHVFEPLESENKWGVPPPVENGSASS  1125



>ref|XP_007150781.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 ref|XP_007150782.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 gb|ESW22775.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 gb|ESW22776.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
Length=1132

 Score =  1893 bits (4904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 963/1126 (86%), Positives = 1033/1126 (92%), Gaps = 8/1126 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPA+NPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPASNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VPT LAGWMSN  TV+HPAVSGG IGL   SIPAALKHPRTPPTNPSVDYPSGDS
Sbjct  241   PTPAPVPTPLAGWMSNPTTVAHPAVSGGAIGLGAPSIPAALKHPRTPPTNPSVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHVSKR R +GISDEVNLP+NVL  +FPGHGH QA +  DDLPK V RTLNQGSSPMSMD
Sbjct  301   DHVSKRTRPMGISDEVNLPVNVLSATFPGHGHGQAFNAPDDLPKTVMRTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDIALWEVGSRE+L++RNFKVWDLSACSMP Q ALVKDPGVSVN 
Sbjct  361   FHPVQQTLLLVGTNVGDIALWEVGSRERLLMRNFKVWDLSACSMPFQAALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDG+LFGVAYSRHIVQIYSYHG D+ RQHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  421   VIWSPDGALFGVAYSRHIVQIYSYHGGDEARQHLEIDAHVGGVNDLAFSHPNKQLCVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA +GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDAASGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKEGESSIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDG LLAVSANE
Sbjct  601   VQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGALLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFAERVAS  1563
             NGIK+LAN DGIRLLRT EN +    +R SE+ +KP++NPIS    A+A++A  AER AS
Sbjct  661   NGIKILANGDGIRLLRTLEN-SLYDTSRTSEAMTKPAINPISAAAAAAATSAALAER-AS  718

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
              V  + MNGDAR N+GDVKPRI+EE+NDKSK+WKLTEI E S CR+LKLPEN+RV KISR
Sbjct  719   SVAITAMNGDAR-NMGDVKPRISEESNDKSKIWKLTEINEQSQCRSLKLPENVRVNKISR  777

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKWQR +RNS+GKA+A + PQLWQPSSGILMTND+ D N
Sbjct  778   LIYTNSGNAILALASNAIHLLWKWQRSDRNSTGKASATVQPQLWQPSSGILMTNDLTDSN  837

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
              EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  838   TEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  897

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQL VW++DGWEK
Sbjct  898   IGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQLCVWNTDGWEK  957

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             QKS+FL LPAGR    Q+DTRVQFHQDQI FLVVHETQLAIYEATKLEC+KQW  RE+AA
Sbjct  958   QKSRFLQLPAGRTPPAQADTRVQFHQDQIRFLVVHETQLAIYEATKLECLKQWFPRESAA  1017

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             P+SHATFSCDSQL+YASFLDATVCVF+A+NL LRCRI   +    +  SS V PLV+AAH
Sbjct  1018  PVSHATFSCDSQLIYASFLDATVCVFSASNLRLRCRI-NPSAYLSASVSSNVQPLVIAAH  1076

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             PQ+PNQFA+GLSDGGV VFEPLESEGKWGVPPP ENGS SN    S
Sbjct  1077  PQEPNQFAVGLSDGGVHVFEPLESEGKWGVPPPNENGSTSNMAATS  1122



>ref|XP_003543688.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max]
 ref|XP_006595171.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max]
 gb|KHN44197.1| Topless-related protein 1 [Glycine soja]
Length=1132

 Score =  1892 bits (4902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 957/1125 (85%), Positives = 1032/1125 (92%), Gaps = 6/1125 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VPT LAGWMSN  TV+HPAVSGG IGL   SIPAALKHPRTPPTNPSVDYPSGDS
Sbjct  241   PTPAPVPTPLAGWMSNPTTVAHPAVSGGAIGLGAPSIPAALKHPRTPPTNPSVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHVSKR R +G+SDEVNLP+NVL  +FPGHGH QA +  DDLPK   R+LNQGSSPMSMD
Sbjct  301   DHVSKRTRPIGMSDEVNLPVNVLSATFPGHGHGQAFNAPDDLPKTAMRSLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDIALWEVGSRE+L++RNFKVWDLSACSMP Q ALVKDPGVSVN 
Sbjct  361   FHPVQQTLLLVGTNVGDIALWEVGSRERLLMRNFKVWDLSACSMPFQAALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDG+LFGVAYSRHIVQIYSYHG DDV QHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  421   VIWSPDGALFGVAYSRHIVQIYSYHGGDDVGQHLEIDAHVGGVNDLAFSHPNKQLCVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  GAKQYTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDAATGAKQYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKEGESSIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDG LLAVSANE
Sbjct  601   VQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGALLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAERVASV  1560
             NGIK+LAN DGIRLLRT EN +    +R SE+ +KP++NPI  + A+A++A  AER +SV
Sbjct  661   NGIKILANADGIRLLRTLEN-SLYDTSRTSEAMTKPTINPISAAAAAATSAALAERASSV  719

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V  + MNGDAR N+GDVKPRI+EE+NDKSK+WKLTEI EPS CR+LKLPEN+RV KISRL
Sbjct  720   VAITAMNGDAR-NLGDVKPRISEESNDKSKIWKLTEINEPSQCRSLKLPENVRVNKISRL  778

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             IYTNSG+A+LALASNAIHLLWKWQR +RNS+GKATA++ PQLWQPSSGILMTND+ D N 
Sbjct  779   IYTNSGNAILALASNAIHLLWKWQRNDRNSTGKATASVQPQLWQPSSGILMTNDITDNNT  838

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAI
Sbjct  839   EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAI  898

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGWEKQ
Sbjct  899   GMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGWEKQ  958

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KS+FL LPAGR    Q+DTRVQFHQDQI FLVVHETQLAIYEATKLEC+KQW  R+++AP
Sbjct  959   KSRFLQLPAGRTPPAQADTRVQFHQDQIRFLVVHETQLAIYEATKLECLKQWFPRDSSAP  1018

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             ISHATFSCDSQL+YASFLDATVCV + +NL LRCRI   +    +  SS V PLV+AAHP
Sbjct  1019  ISHATFSCDSQLIYASFLDATVCVLSVSNLRLRCRI-NPSAYLSASVSSNVQPLVIAAHP  1077

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             Q+PNQFA+GLSDGGV VFEP ESEGKWGVPPP+ENGS SN    S
Sbjct  1078  QEPNQFAVGLSDGGVHVFEPHESEGKWGVPPPIENGSTSNMAATS  1122



>gb|KHG04944.1| Topless-related 1 -like protein [Gossypium arboreum]
Length=1135

 Score =  1891 bits (4899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 961/1128 (85%), Positives = 1036/1128 (92%), Gaps = 17/1128 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P QVP  LAGWMSN  TV+HPAVSGG IGL  +SIPAALKHPRTPPTNPSVDYPSGDS
Sbjct  241   PTPAQVPAPLAGWMSNPSTVTHPAVSGGAIGLG-ASIPAALKHPRTPPTNPSVDYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHVSKR R +GISDEVNLP+NV+PV F GHGHSQA S  DDLP+ VAR LNQGSSPMSMD
Sbjct  300   DHVSKRTRPMGISDEVNLPVNVMPVPFQGHGHSQAFSAPDDLPRAVARMLNQGSSPMSMD  359

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDIALWE GSRE+LVL+NFKVWDL+ACSMPLQ ALVKDP VSVN 
Sbjct  360   FHPVQQTLLLVGTNVGDIALWEAGSRERLVLKNFKVWDLTACSMPLQAALVKDPAVSVNR  419

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNK LCVITC
Sbjct  420   VIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKLLCVITC  479

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA+NG KQYTFEGHEAPVYSVCPH+KEN+QFIFSTA+DGKIKAWLYDNMGS
Sbjct  480   GDDKTIKVWDASNGTKQYTFEGHEAPVYSVCPHYKENIQFIFSTAVDGKIKAWLYDNMGS  539

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  540   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRSLGV  599

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKN+YLAAGDDFSIKFWDMD++Q LTS DADGGLPASPRIRFNKDG+LLAVS N+
Sbjct  600   VQFDTTKNKYLAAGDDFSIKFWDMDNIQPLTSFDADGGLPASPRIRFNKDGSLLAVSTND  659

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS--------VASASNAGFA  1578
             NGIK+LAN+DG+RLLRT ENL     A  +  A KP++NPIS         A+A++AG A
Sbjct  660   NGIKILANSDGMRLLRTLENL--SYDALRTAEAPKPTINPISAAAAAAAAAAAATSAGLA  717

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R  ++ G   MNGDAR ++GDVKPRITEE++DKSK+WKLTEI EPS CR+L+LPENLRV
Sbjct  718   DRSVAIAG---MNGDAR-SLGDVKPRITEESSDKSKIWKLTEINEPSQCRSLRLPENLRV  773

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             TKISRLI+TNSG+A+LALASNAIHLLWKWQR +RNS+GKATA++ PQLWQPSSGILMTND
Sbjct  774   TKISRLIFTNSGNAILALASNAIHLLWKWQRSDRNSNGKATASVAPQLWQPSSGILMTND  833

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             VAD NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQD
Sbjct  834   VADTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQD  893

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVL+VLVSSGAD+QL VW++
Sbjct  894   NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLSVLVSSGADSQLCVWNT  953

Query  857   DGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQK++FL +PAGR  +  SDTRVQFHQDQIHFLVVHETQLAIYE TKL+C+KQWV 
Sbjct  954   DGWEKQKARFLQVPAGRTPTALSDTRVQFHQDQIHFLVVHETQLAIYETTKLDCMKQWVP  1013

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             R+++API+HATFSCDSQLVYASFLDA+VCVFTAANL LRCRI   +   P+  SS VHPL
Sbjct  1014  RDSSAPITHATFSCDSQLVYASFLDASVCVFTAANLRLRCRI-NPSAYLPTNISSNVHPL  1072

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             V+AAHP +PN+FALGLSDGGV VFEPLESE KWGVPPPVENGS S+ T
Sbjct  1073  VIAAHPSEPNEFALGLSDGGVHVFEPLESENKWGVPPPVENGSTSSMT  1120



>ref|XP_006492116.1| PREDICTED: protein TOPLESS-like isoform X1 [Citrus sinensis]
Length=1140

 Score =  1890 bits (4896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 977/1143 (85%), Positives = 1045/1143 (91%), Gaps = 19/1143 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN PTV+HPAVSGG IGL   SIPAA LKHPRTPPTNPSVDYPSGD
Sbjct  241   PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS----QAHSTLDDLPKNVARTLNQGSS  2649
             SDH+SKR R +GISDE+NLP+NVLPVSF GH HS    QA ST +DLPK V RTLNQGSS
Sbjct  301   SDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSS  360

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
             PMSMDFHPVQQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL ACSMPLQ ALVKDPG
Sbjct  361   PMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPG  420

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
             VSVN + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNKQL
Sbjct  421   VSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQL  480

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CVITCGDDKTIKVWDATNGAKQY FEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLY
Sbjct  481   CVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLY  540

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DN+GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRK
Sbjct  541   DNLGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRK  600

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             RS GVVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LTSIDADGGLPASPRIRFNKDG LLA
Sbjct  601   RSLGVVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTSIDADGGLPASPRIRFNKDGCLLA  660

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFA  1578
             VS N+NGIK+LA +DGIRLLRTFENL     A  +   SKP+++PIS    A+A++AG A
Sbjct  661   VSTNDNGIKILATSDGIRLLRTFENL--SYDASRTSENSKPTISPISAAAAAAATSAGLA  718

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R AS+V    MNGD R ++ DVKPRITEE+NDKSKVWKLTE++EP+ CR+L+LPENLR 
Sbjct  719   DRAASMVSIPGMNGDVR-SLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRA  777

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             TKISRLI+TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQP SGI+MTND
Sbjct  778   TKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTND  837

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             V D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQD
Sbjct  838   VTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQD  897

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDDS+IQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VWSS
Sbjct  898   NNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWSS  957

Query  857   DGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQK++FL +P GR  + QSDTRVQFHQDQIHFLVVHETQLAI+E TKLECVKQWV 
Sbjct  958   DGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVP  1017

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             RE++API+HATFSCDSQLVYA FLDATVCVF+AANL LRCRI PSAYL   +SSS VHPL
Sbjct  1018  RESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRINPSAYLPAGVSSSNVHPL  1077

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN---TTPV----SDQ  342
             V+AAHPQ+PN+FALGLSDGGV VFEPLESEGKWGVPPPV+NGS S+   T PV    SDQ
Sbjct  1078  VIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGSDQ  1137

Query  341   PPR  333
               R
Sbjct  1138  AQR  1140



>ref|XP_010097168.1| Protein TOPLESS [Morus notabilis]
 gb|EXB67235.1| Protein TOPLESS [Morus notabilis]
Length=1138

 Score =  1887 bits (4887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 967/1130 (86%), Positives = 1035/1130 (92%), Gaps = 11/1130 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPQLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG++PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSGD  2817
             PAP  VPT LAGWMSN  TV+HPAVSGG        SIPAALKHPRTPPTNPSVDYPSGD
Sbjct  241   PAPAPVPTPLAGWMSNPSTVAHPAVSGGGAIGLGGPSIPAALKHPRTPPTNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAH-STLDDLPKNVARTLNQGSSPMS  2640
             SDHVSKR R +GI+DEVNLP+N+LPVSFPGH HSQA  +  DDLPK V RTLNQGSSPMS
Sbjct  301   SDHVSKRTRPMGITDEVNLPVNMLPVSFPGHAHSQAFINAPDDLPKTVTRTLNQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP QQTLLLVGTNVGDI LWEVGSRE+LVL+NFKVWDLS CSMPLQ ALVK+PGVSV
Sbjct  361   MDFHPAQQTLLLVGTNVGDIGLWEVGSRERLVLKNFKVWDLSTCSMPLQAALVKEPGVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQIYSYHGNDDVR HLEI+AHVGGVNDLAFSHPNKQLCVI
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQIYSYHGNDDVRHHLEIEAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVSA
Sbjct  601   GVVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesas----kpSVNPISVASASNAGFAER  1572
             N+NGIK+LANTDGIRLLRTF+NL+YDA+  +           S    + ++A++AG +ER
Sbjct  661   NDNGIKILANTDGIRLLRTFDNLSYDASRTSETVTKPTVGAISAAAAAASAATSAGLSER  720

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              +SVV  + MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI+EPS CR+L+L ENLRVTK
Sbjct  721   ASSVVTIAGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEISEPSQCRSLRLQENLRVTK  779

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG+A+LALASNAIHLLWKWQR +RNS+G+ATA++ PQLWQP+SGILMTNDVA
Sbjct  780   ISRLIYTNSGNAILALASNAIHLLWKWQRSDRNSTGRATASVSPQLWQPTSGILMTNDVA  839

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPE+ VPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  840   DTNPEETVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  899

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQ+ VWSSDG
Sbjct  900   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQICVWSSDG  959

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ+++FL +P+GR  S QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW+ RE
Sbjct  960   WEKQRNRFLQIPSGRTPSSQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWIPRE  1019

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             +AA ISHATFSCDSQLVYASFLDATVCVF AANL LRCRI   +   P+  SS V PLV+
Sbjct  1020  SAASISHATFSCDSQLVYASFLDATVCVFGAANLRLRCRI-TPSAYLPANISSSVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT--TPV  351
             AAHPQ+ NQFALGLSDGGV VFEPLESEGKWGVPPP ENGS S+   TPV
Sbjct  1079  AAHPQEANQFALGLSDGGVHVFEPLESEGKWGVPPPAENGSTSSVPATPV  1128



>gb|KDP37032.1| hypothetical protein JCGZ_06088 [Jatropha curcas]
Length=1140

 Score =  1886 bits (4886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 967/1126 (86%), Positives = 1037/1126 (92%), Gaps = 12/1126 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK++RSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQNRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+H AVSGG  IGL   SIPAALKHPRTPPTN SVDYPSGD
Sbjct  241   PTPASVPAPLAGWMSNPSTVTHQAVSGGGAIGLGAPSIPAALKHPRTPPTNASVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHV+KR R +GI+DEVNLP+NVLPVSFPGHGH Q  +  DDLPK VARTLNQGSSPMSM
Sbjct  301   SDHVAKRTRPMGITDEVNLPVNVLPVSFPGHGHGQTFNAPDDLPKTVARTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQTLLLVGTNVGD+ LWEVGSRE LV RNFKVWD+S+CSMPLQ ALVKDPGVSVN
Sbjct  361   DFHPVQQTLLLVGTNVGDVGLWEVGSRELLVSRNFKVWDVSSCSMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG  DVRQHLEIDAHVGGVNDLAFS PNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGGDVRQHLEIDAHVGGVNDLAFSTPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA +GAKQY FEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDAASGAKQYIFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEG VKR+YQGFRKRS G
Sbjct  541   SRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGNVKRSYQGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LTSIDADGGLPASPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTSIDADGGLPASPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI-------SVASASNAGFA  1578
             ENGIK+LAN+DG+RLLR+FEN+    A+RASE+ +KP +NPI       + A+A++AG A
Sbjct  661   ENGIKILANSDGLRLLRSFENI-SYDASRASENVTKPIINPISAAAAAAAAATATSAGLA  719

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R ASVV    +NGDAR N+GDVKPRIT+E+NDKSK+WKLTEI EPS CR+L+LP+NLRV
Sbjct  720   DRSASVVTIPGLNGDAR-NLGDVKPRITDESNDKSKIWKLTEINEPSQCRSLRLPDNLRV  778

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
              KISRLIYTNSG+A+LALASNAIHLLWKWQR ERNSSGKATAN+ PQLWQPSSGILMTN+
Sbjct  779   NKISRLIYTNSGNAILALASNAIHLLWKWQRSERNSSGKATANVSPQLWQPSSGILMTNE  838

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             + D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  839   ITDTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  898

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDD+TIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+S
Sbjct  899   NNIIAIGMDDNTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNS  958

Query  857   DGWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQK++FL +PAGR +  QSDTRVQFHQDQI FLVVHETQLAIYEATKLECVKQWV 
Sbjct  959   DGWEKQKTRFLQVPAGRTTTGQSDTRVQFHQDQIQFLVVHETQLAIYEATKLECVKQWVT  1018

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             RE++APISHATFSCDSQLVYA FLDATVCVF+A NL LRCRI   +   P+  SS VHPL
Sbjct  1019  RESSAPISHATFSCDSQLVYACFLDATVCVFSAQNLRLRCRI-NPSSFLPANVSSNVHPL  1077

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             V+AAHPQ+ NQFALGLSDGGV VFEPLESEGKWGVPPP ENGS S+
Sbjct  1078  VIAAHPQESNQFALGLSDGGVHVFEPLESEGKWGVPPPAENGSASS  1123



>ref|XP_006492117.1| PREDICTED: protein TOPLESS-like isoform X2 [Citrus sinensis]
Length=1139

 Score =  1885 bits (4883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 972/1143 (85%), Positives = 1041/1143 (91%), Gaps = 20/1143 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN PTV+HPAVSGG IGL   SIPAA LKHPRTPPTNPSVDYPSGD
Sbjct  241   PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS----QAHSTLDDLPKNVARTLNQGSS  2649
             SDH+SKR R +GISDE+NLP+NVLPVSF GH HS    QA ST +DLPK V RTLNQGSS
Sbjct  301   SDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSHSHSQAFSTPEDLPKTVTRTLNQGSS  360

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
             PMSMDFHPVQQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL ACSMPLQ ALVKDPG
Sbjct  361   PMSMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPG  420

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
             VSVN + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNKQL
Sbjct  421   VSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQL  480

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CVITCGDDKTIKVWDATNGAKQY FEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLY
Sbjct  481   CVITCGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLY  540

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DN+GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRK
Sbjct  541   DNLGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRK  600

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             RS GVVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LTSIDADGGLPASPRIRFNKDG LLA
Sbjct  601   RSLGVVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTSIDADGGLPASPRIRFNKDGCLLA  660

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFA  1578
             VS N+NGIK+LA +DGIRLLRTFENL     A  +   SKP+++PIS    A+A++AG A
Sbjct  661   VSTNDNGIKILATSDGIRLLRTFENL--SYDASRTSENSKPTISPISAAAAAAATSAGLA  718

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R AS+V    MNGD R ++ DVKPRITEE+NDKSKVWKLTE++EP+ CR+L+LPENLR 
Sbjct  719   DRAASMVSIPGMNGDVR-SLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRA  777

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             TKISRLI+TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQP SGI+MTND
Sbjct  778   TKISRLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTND  837

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             V D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQD
Sbjct  838   VTDSNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQD  897

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDDS+IQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VWSS
Sbjct  898   NNIIAIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWSS  957

Query  857   DGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQK++FL +P GR  + QSDTRVQFHQDQIHFLVVHETQLAI+E TKLECVKQWV 
Sbjct  958   DGWEKQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVP  1017

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             RE++API+HATFSCDSQLVYA FLDATVCVF+AANL LRCRI   +   P+  SS VHPL
Sbjct  1018  RESSAPITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRI-NPSAYLPAGVSSNVHPL  1076

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN---TTPV----SDQ  342
             V+AAHPQ+PN+FALGLSDGGV VFEPLESEGKWGVPPPV+NGS S+   T PV    SDQ
Sbjct  1077  VIAAHPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGSDQ  1136

Query  341   PPR  333
               R
Sbjct  1137  AQR  1139



>emb|CDO98186.1| unnamed protein product [Coffea canephora]
Length=1130

 Score =  1884 bits (4881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 950/1114 (85%), Positives = 1032/1114 (93%), Gaps = 5/1114 (0%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRTKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRQNEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQ NGARAPSPA NPLLGSVPK GGFPPLG HGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQANGARAPSPAGNPLLGSVPKAGGFPPLGIHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VP  LAGWMSN P V+HPAVSGGPIG+    +PA LKHPRTPP   SVDYPSGDS
Sbjct  241   PTPAPVPAPLAGWMSNPPAVTHPAVSGGPIGIGAPPVPAVLKHPRTPPAT-SVDYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             D +SKR R + +++EVNLP+NVLPVSFPGHGHSQA S  DDLPK +ARTLNQGSSPMSMD
Sbjct  300   DQLSKRTRPISLTEEVNLPVNVLPVSFPGHGHSQAFSVPDDLPKTLARTLNQGSSPMSMD  359

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP+QQTLLLVGTNVGD  LWEVGSR++L+LRNFKVWDLSAC+MPLQ ALVKDP VSVN 
Sbjct  360   FHPIQQTLLLVGTNVGDTGLWEVGSRKRLILRNFKVWDLSACTMPLQAALVKDPHVSVNR  419

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHGNDD+RQHLEIDAHVGGVNDLAFSHP+KQLCVITC
Sbjct  420   VIWSPDGSLFGVAYSRHIVQIYSYHGNDDIRQHLEIDAHVGGVNDLAFSHPHKQLCVITC  479

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA +G+KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  480   GDDKTIKVWDAASGSKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGS  539

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS GV
Sbjct  540   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGV  599

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTT+NR+LAAGDDFS+KFWDMD+VQ+LT+IDADGGLPASPRIRFNK+G LLAVS NE
Sbjct  600   VQFDTTRNRFLAAGDDFSVKFWDMDNVQLLTTIDADGGLPASPRIRFNKEGILLAVSTNE  659

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN DG+RLLRTFENL     A  +E+A+KPS+NPI+ A+ +++G A+RVASVV 
Sbjct  660   NGIKILANNDGLRLLRTFENL--AYDASQAEAATKPSLNPIAAAATNSSGLADRVASVVS  717

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              S +NG++R N+GDVKPR+ EETNDKSK+WKLTEI+EPS CR+LKLPENLRVTKISRL+Y
Sbjct  718   ISAVNGESR-NLGDVKPRLNEETNDKSKIWKLTEISEPSQCRSLKLPENLRVTKISRLMY  776

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSGSA+LALASNAIHLLWKWQR +RNSSGKATA+  PQLWQP+SGILMTNDV D +PE+
Sbjct  777   TNSGSAILALASNAIHLLWKWQRNDRNSSGKATASTSPQLWQPASGILMTNDVIDSSPEE  836

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             A+ CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  837   AIHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  896

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+SDGWEKQK+
Sbjct  897   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSDGWEKQKA  956

Query  833   KFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             +FL +P+GR  + QSDTRVQFHQDQIHFLVVHETQLAIYE TKLECVKQW+ RE+ APIS
Sbjct  957   RFLQIPSGRTPMAQSDTRVQFHQDQIHFLVVHETQLAIYETTKLECVKQWLPRESGAPIS  1016

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDSQLVYASFLDA VCVFTA +L +RCRI+P AYL  S+S+S V PLV+AAHPQD
Sbjct  1017  HATFSCDSQLVYASFLDAAVCVFTATHLQMRCRISPPAYLPNSISNSNVQPLVIAAHPQD  1076

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             PNQFA+GLSDG V VFEPLES+G+WGVPP V+NG
Sbjct  1077  PNQFAIGLSDGAVHVFEPLESDGRWGVPPLVDNG  1110



>ref|XP_011044878.1| PREDICTED: topless-related protein 1 isoform X2 [Populus euphratica]
Length=1138

 Score =  1883 bits (4877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 966/1133 (85%), Positives = 1031/1133 (91%), Gaps = 10/1133 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLF DHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKAPRSNPDIKTLFFDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P QVP  LAGWMSN PTV+HPAVSGG  IGL   SIPAALKHPRTPP+NPSVDYPSGD
Sbjct  241   PTPAQVPAPLAGWMSNPPTVTHPAVSGGGAIGLGAPSIPAALKHPRTPPSNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS--QAHSTLDDLPKNVARTLNQGSSPM  2643
              DHV+KR R +GISDEVNLP+NVLP+ FPGHGH   Q  +  DDLPK V RTLNQGSSPM
Sbjct  301   PDHVAKRTRPMGISDEVNLPVNVLPMPFPGHGHGHGQTFNAPDDLPKAVVRTLNQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQT+LLVGTNVG+I LWEVGSRE+LVLRNFKVWDL+ACS PLQ ALVKDPGVS
Sbjct  361   SMDFHPVQQTILLVGTNVGEIGLWEVGSRERLVLRNFKVWDLNACSTPLQAALVKDPGVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFS PNKQLCV
Sbjct  421   VNRVIWSPDGNLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSTPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDK IKVWDA  GAK YTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKAIKVWDAATGAKLYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKR Y GFRK S
Sbjct  541   LGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRNYLGFRKHS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LT+IDADGGLPASPRIRFNK+GTLLAVS
Sbjct  601   LGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTTIDADGGLPASPRIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFAER  1572
             AN+NGIK+LAN+DGIRLLR+FENL    A+RASES +KP+VN IS    A+A+++G A+R
Sbjct  661   ANDNGIKILANSDGIRLLRSFENL-SYDASRASESVAKPTVNLISAAAAAAATSSGLADR  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              ASVV  + MNGDAR N+GDVKPRI EE NDKSK+WKLTEI EPS CR+L+LPENLR TK
Sbjct  720   GASVVAVAGMNGDAR-NLGDVKPRIAEELNDKSKIWKLTEINEPSQCRSLRLPENLRATK  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG+A+LALASNAIHLLWKWQR +RN+SGKATA + PQLWQPSSGILMTND+ 
Sbjct  779   ISRLIYTNSGNAILALASNAIHLLWKWQRSDRNASGKATAGVSPQLWQPSSGILMTNDIT  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLAFHPQDNN
Sbjct  839   DTNPEEAVACFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPTPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVL+VLVSSGADAQL VW+SDG
Sbjct  899   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLSVLVSSGADAQLCVWNSDG  958

Query  851   WEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQK++FL +P GR +  QSDTRVQFHQDQIHFLVVHETQLAIYE TKLECVKQW+ RE
Sbjct  959   WEKQKTRFLQVPTGRTTTAQSDTRVQFHQDQIHFLVVHETQLAIYETTKLECVKQWLPRE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++APISHA FSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P   SS VHPLV+
Sbjct  1019  SSAPISHAVFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSSYPPPNVSSNVHPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVSDQPP  336
             AAHPQ+PNQFALGLSDGGV VFEPLESEGKWGVPPP ENGS S+   +    P
Sbjct  1078  AAHPQEPNQFALGLSDGGVQVFEPLESEGKWGVPPPAENGSASSVAAIPSVGP  1130



>ref|XP_008372696.1| PREDICTED: protein TOPLESS [Malus domestica]
Length=1132

 Score =  1882 bits (4876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 962/1119 (86%), Positives = 1025/1119 (92%), Gaps = 5/1119 (0%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFP +GAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPQIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSGD  2817
             P    VP  LAGWMSN  TV+HPAVS G        SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTQAPVPIPLAGWMSNPSTVTHPAVSEGGGIGLGGPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +G+S EVNLP+N+LPV+F GHGHSQA +  DDLPKNV RTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGLSTEVNLPVNMLPVTFQGHGHSQALNAPDDLPKNVTRTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDLS+CSMPLQ ALVK+PGVSVN
Sbjct  361   DFHPSQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLSSCSMPLQAALVKEPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT
Sbjct  421   RVIWSPDGALFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDAT GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDATTGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRSFG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+ Q++T++DADGGLPASPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNTQLMTTVDADGGLPASPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVV  1557
             ENGIKVLAN DG+RLLRTFEN     A+R SE  +KP++ PI  A+AS+AG AER A+  
Sbjct  661   ENGIKVLANADGMRLLRTFENHLSYEASRTSEVVTKPAITPIQ-AAASSAGLAERSAAAA  719

Query  1556  GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLI  1377
               S MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI+EPS CR+L+LPEN+RVTKISRLI
Sbjct  720   ALSGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEISEPSQCRSLRLPENMRVTKISRLI  778

Query  1376  YTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPE  1197
             YTNSGSA+LALASNAIHLLWKWQR ERNS+ KATA++ PQLWQP+SGILMTND+ D +PE
Sbjct  779   YTNSGSAILALASNAIHLLWKWQRSERNSTSKATASVSPQLWQPTSGILMTNDITDTSPE  838

Query  1196  DAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIG  1017
             +AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG
Sbjct  839   EAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG  898

Query  1016  MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQK  837
             MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VWSSDGWEK K
Sbjct  899   MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWSSDGWEKLK  958

Query  836   SKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPI  660
             S+FL LPAGR +   SDTRVQFH DQ  FLVVHETQLAIYE TKLECVKQWV R++AAPI
Sbjct  959   SRFLQLPAGRTTASLSDTRVQFHHDQQQFLVVHETQLAIYETTKLECVKQWVPRDSAAPI  1018

Query  659   SHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQ  480
             SHATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  SS V PLV+AAHPQ
Sbjct  1019  SHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSAYLPANVSSNVQPLVIAAHPQ  1077

Query  479   DPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             + NQFALGLSDG V VFEPLESEGKWGV PPVENGS S+
Sbjct  1078  EANQFALGLSDGAVHVFEPLESEGKWGVAPPVENGSASS  1116



>ref|XP_006585625.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max]
 ref|XP_006585626.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max]
 ref|XP_006585627.1| PREDICTED: protein TOPLESS-like isoform X3 [Glycine max]
Length=1133

 Score =  1882 bits (4874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 964/1130 (85%), Positives = 1040/1130 (92%), Gaps = 8/1130 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG++PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN  TV+H AVSGG  IGL   S+PAALKHPRTPPTNPSVDYPSGD
Sbjct  241   PTPAPVPTPLAGWMSNPTTVAHAAVSGGGAIGLGAPSMPAALKHPRTPPTNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHG-HSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             SDHV+KR R +GISDEVNLP+NVL  +FPGHG HSQA +  DD+PK V RTLNQGSSPMS
Sbjct  301   SDHVAKRTRPMGISDEVNLPVNVLSATFPGHGQHSQAFNAPDDIPKTVVRTLNQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQ+LLLVGT+VGDIALWEVGSRE+LV RNFKVWDLSACSMP Q ALVKDPGVSV
Sbjct  361   MDFHPMQQSLLLVGTHVGDIALWEVGSRERLVSRNFKVWDLSACSMPFQAALVKDPGVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQIYSYHG D++RQHLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  421   NRVIWSPDGALFGVAYSRHIVQIYSYHGGDEIRQHLEIDAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA +GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAASGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVSA
Sbjct  601   GVVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAERVA  1566
             NENGIK+LAN DGIRLLRT EN +   A+RASE+ +KP++NPI  + A+A++A  AER +
Sbjct  661   NENGIKILANGDGIRLLRTLEN-SLYEASRASEALTKPTINPISAAAAAATSAALAERAS  719

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             SVV  + MNGD R N+GDVKPRI+EE+NDKSK+WKLTEI E S CR+LKLPEN+RVTKIS
Sbjct  720   SVVAIAGMNGDTR-NLGDVKPRISEESNDKSKIWKLTEINEQSQCRSLKLPENVRVTKIS  778

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG+A+LALASNAIHLLWKWQR ERNSSGKATA + PQLWQPSSGILMTND+AD 
Sbjct  779   RLIYTNSGNAILALASNAIHLLWKWQRNERNSSGKATATLQPQLWQPSSGILMTNDIADS  838

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  839   NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  898

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGWE
Sbjct  899   AIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGWE  958

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS+FL LP GR    QSDTRVQFHQDQI FLVVHETQLAIYEATKLE +KQW  R+++
Sbjct  959   KQKSRFLQLPPGRTPPAQSDTRVQFHQDQIQFLVVHETQLAIYEATKLEGLKQWFPRDSS  1018

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APIS+ATFSCDSQLV+ASFLDAT+CVF+A+NL LRCRI   +   P+  SS + PLV+AA
Sbjct  1019  APISYATFSCDSQLVFASFLDATICVFSASNLRLRCRI-NPSSYLPASVSSNIQPLVIAA  1077

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVSDQP  339
             HPQ+PNQFALGLSDGGV VFEPLESEGKWGVPPP+ENGS SN    S  P
Sbjct  1078  HPQEPNQFALGLSDGGVHVFEPLESEGKWGVPPPIENGSASNVAATSVGP  1127



>ref|XP_007135775.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
 ref|XP_007135776.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
 gb|ESW07769.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
 gb|ESW07770.1| hypothetical protein PHAVU_010G157700g [Phaseolus vulgaris]
Length=1137

 Score =  1877 bits (4861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 968/1141 (85%), Positives = 1040/1141 (91%), Gaps = 18/1141 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG++PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN  TV+H AVSGG  IGL   S+PAALKHPRTPPTNPS DYPSGD
Sbjct  241   PTPAPVPTPLAGWMSNPTTVAHAAVSGGGAIGLGAPSMPAALKHPRTPPTNPS-DYPSGD  299

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHG-HSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV+KR R +GISDEVNLP+NVL  +FPGHG HSQA +  DD+PK V RTLNQGSSPMS
Sbjct  300   SEHVAKRTRPIGISDEVNLPVNVLSATFPGHGQHSQAFNAPDDIPKAVVRTLNQGSSPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQ+LLLVGTNVGDIALWEVGSRE+LV RNFKVWDLSACSMP Q ALVKDPGVSV
Sbjct  360   MDFHPVQQSLLLVGTNVGDIALWEVGSRERLVSRNFKVWDLSACSMPFQAALVKDPGVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQIYSY G D++R HLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  420   NRVIWSPDGALFGVAYSRHIVQIYSYQGGDEIRHHLEIDAHVGGVNDLAFSHPNKQLCVI  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTI+VWDA +GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+
Sbjct  480   TCGDDKTIRVWDAASGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  540   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVSA
Sbjct  600   GVVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSA  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS------VASASNAGFA  1578
             NENGIK+LAN DGIRLLRT EN +   A+RASE+ +KP++NPIS       A+A++A  A
Sbjct  660   NENGIKILANGDGIRLLRTLEN-SLYDASRASEALTKPTINPISAAAAAAAAAATSAALA  718

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             ER +SVV  + MNGD R N+GDVKPRI+EE+NDKSKVWKLTEI E S CR+LKLPEN+RV
Sbjct  719   ERASSVVAIAGMNGDTR-NMGDVKPRISEESNDKSKVWKLTEINEQSQCRSLKLPENVRV  777

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             TKISRLIYTNSG+A+LALASNAIHLLWKWQR ERNSSGKATA + PQLWQPSSGILMTND
Sbjct  778   TKISRLIYTNSGNAILALASNAIHLLWKWQRNERNSSGKATATLQPQLWQPSSGILMTND  837

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             +AD NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  838   IADSNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  897

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++
Sbjct  898   NNIIAIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNT  957

Query  857   DGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQKS+FL LP GR    QSDTRVQFHQDQI FLVVHETQLAIYEATKLE +KQW  
Sbjct  958   DGWEKQKSRFLQLPPGRTPPAQSDTRVQFHQDQIQFLVVHETQLAIYEATKLEGLKQWCP  1017

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             R+++APISHATFSCDSQL+YASFLDAT+CVF+A+NL LRCRI   +   P+  SS V PL
Sbjct  1018  RDSSAPISHATFSCDSQLIYASFLDATICVFSASNLRLRCRI-NPSAYLPASVSSNVQPL  1076

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-----PVSDQPP  336
             V+AAHPQ+PNQFA+GLSDGGV VFEPLESEGKWGVPPP+ENGS SN       P SDQ  
Sbjct  1077  VIAAHPQEPNQFAVGLSDGGVHVFEPLESEGKWGVPPPIENGSASNVAATSVGPSSDQAQ  1136

Query  335   R  333
             R
Sbjct  1137  R  1137



>gb|AAN62336.1|AF506028_3 CTV.2 [Citrus trifoliata]
Length=1127

 Score =  1874 bits (4854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 963/1139 (85%), Positives = 1031/1139 (91%), Gaps = 24/1139 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNS        SLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNS--------SLN  172

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  173   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSLPKAGVFPPLGAHGPFQ  232

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN PTV+HPAVSGG IGL   SIPAA LKHPRTPPTNPSVDYPSGD
Sbjct  233   PTPAPVPTPLAGWMSNPPTVTHPAVSGGAIGLGSPSIPAAALKHPRTPPTNPSVDYPSGD  292

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDH+SKR R +GISDE+NLP+NVLPVSF GH HSQA S  +DLPK V RTLNQGSSPMSM
Sbjct  293   SDHLSKRTRPIGISDEINLPVNVLPVSFTGHSHSQAFSAPEDLPKTVTRTLNQGSSPMSM  352

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDL ACSMPLQ ALVKDPGVSVN
Sbjct  353   DFHPVQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSVN  412

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFSHPNKQLCVIT
Sbjct  413   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSHPNKQLCVIT  472

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDATNGAKQY FEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  473   CGDDKTIKVWDATNGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLG  532

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS G
Sbjct  533   SRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRSLG  592

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LTSIDADGGLPASPRIRFNKDG LLAVS N
Sbjct  593   VVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTSIDADGGLPASPRIRFNKDGCLLAVSTN  652

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFAERVA  1566
             +NGIK+LA +DGIRLLRTFENL     A  +   SKP+++PIS    A+A++AG A+R A
Sbjct  653   DNGIKILATSDGIRLLRTFENL--AYDASRTSENSKPTISPISAAAAAAATSAGLADRAA  710

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             S+V    MNGD R ++ DVKPRITEE+NDKSKVWKLTE++EP+ CR+L+LPENLR TKIS
Sbjct  711   SMVSIPGMNGDVR-SLADVKPRITEESNDKSKVWKLTELSEPNQCRSLRLPENLRATKIS  769

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLI+TNSG+A+LALASNAIHLLWKWQR ERNSSGKATA++ PQLWQP SGI+MTNDV D 
Sbjct  770   RLIFTNSGNAILALASNAIHLLWKWQRTERNSSGKATASVAPQLWQPPSGIMMTNDVTDS  829

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNII
Sbjct  830   NPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNII  889

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDS+IQIYNVRVDEVKSKLKGHSKRITGLAFSH LNVLVSSGAD+QL VW SDGWE
Sbjct  890   AIGMDDSSIQIYNVRVDEVKSKLKGHSKRITGLAFSHALNVLVSSGADSQLCVWGSDGWE  949

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQK++FL +P GR  + QSDTRVQFHQDQIHFLVVHETQLAI+E TKLECVKQWV RE++
Sbjct  950   KQKNRFLQIPTGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIFETTKLECVKQWVPRESS  1009

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             API+HATFSCDSQLVYA FLDATVCVF+AANL LRCRI   +   P+  SS VHPLV+AA
Sbjct  1010  APITHATFSCDSQLVYACFLDATVCVFSAANLKLRCRI-NPSAYLPAGVSSNVHPLVIAA  1068

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN---TTPV----SDQPPR  333
             HPQ+PN+FALGLSDGGV VFEPLESEGKWGVPPPV+NGS S+   T PV    SDQ  R
Sbjct  1069  HPQEPNEFALGLSDGGVHVFEPLESEGKWGVPPPVDNGSTSSMPATPPVGGSGSDQAQR  1127



>ref|XP_004165893.1| PREDICTED: LOW QUALITY PROTEIN: protein TOPLESS-like [Cucumis 
sativus]
Length=1139

 Score =  1872 bits (4850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 968/1141 (85%), Positives = 1042/1141 (91%), Gaps = 16/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF +FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFXTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPHLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P    VP  LAGWMSN   V+HPAVSGG  IGL   SIPAALKHPRTPPTNPSV+YPS D
Sbjct  241   PTAAPVPAPLAGWMSNPSAVTHPAVSGGGAIGLGAPSIPAALKHPRTPPTNPSVEYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKRP+ +G+SDEVNLP+NVLPVSF GHGH+Q  +  DDLPK V RTLNQGS+PMSM
Sbjct  301   SDHVSKRPKPMGMSDEVNLPVNVLPVSFTGHGHAQTFNAPDDLPKTVMRTLNQGSNPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGTNVG+I LWEVGSRE+LV +NFKVWDL+ACSMPLQ ALVK+P VSVN
Sbjct  361   DFHPIQQTLLLVGTNVGEIGLWEVGSRERLVSKNFKVWDLNACSMPLQAALVKEPDVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVNDLAFS+PNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDDMRQHLEIDAHVGGVNDLAFSNPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA NGA+QY FEGHEAPV+SVCPH+KEN+QFIFSTALDGKIKAWLYDNMG
Sbjct  481   CGDDKTIKVWDAGNGARQYIFEGHEAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDNMG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGFRKRS G
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVS N
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSGN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-----VASASNAGFAER  1572
             ENGIK+LAN DGIRLLRTFENL    AAR SE+ +KP++NPIS      A+A+    A+R
Sbjct  661   ENGIKILANVDGIRLLRTFENL-SYDAARTSEAGTKPTINPISAAAAVAAAAAAGSAADR  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              ASVV  S + GD+R ++GDVKPRI E++NDKSK+WKLTEI EPS CR+L+LPEN+RV K
Sbjct  720   GASVVTMSGVAGDSR-SLGDVKPRIPEDSNDKSKIWKLTEINEPSQCRSLRLPENVRVNK  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNAIHLLWKW R ERNS+GKATAN+ PQLWQPSSGILMTNDVA
Sbjct  779   ISRLIYTNSGSAILALASNAIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVA  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D + E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  839   DTSSEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH+LNVLVSSGADAQL VWSSD 
Sbjct  899   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHLLNVLVSSGADAQLCVWSSDV  958

Query  851   WEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQK++FL LP+GR  S QSDTRVQFHQDQ+HFLVVHETQ+AIYE TKLECVKQW  RE
Sbjct  959   WEKQKTRFLQLPSGRPPSSQSDTRVQFHQDQVHFLVVHETQIAIYETTKLECVKQWTPRE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             + APISHATFSCDSQ++YASFLDATVCVFT A+L LRCRI+PSAYL  S+S++ V PLV+
Sbjct  1019  SGAPISHATFSCDSQMIYASFLDATVCVFTVASLRLRCRISPSAYLPASVSNASVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN--TTPV-----SDQPP  336
             AAHPQ+ NQFALGLSDGGV VFEPLESEGKWGVPPPVENGS S+  TTP      S+Q P
Sbjct  1079  AAHPQEANQFALGLSDGGVHVFEPLESEGKWGVPPPVENGSASSVPTTPSVGASGSEQAP  1138

Query  335   R  333
             R
Sbjct  1139  R  1139



>gb|AES86542.2| topless-like protein [Medicago truncatula]
Length=1137

 Score =  1872 bits (4848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 959/1126 (85%), Positives = 1029/1126 (91%), Gaps = 5/1126 (0%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSG-GPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VPTQLAGWMSN  TV+H AVSG G IGL   S+P ALKHPRTPP NPSVDYPSGD
Sbjct  241   PNPAAVPTQLAGWMSNPTTVAHAAVSGAGAIGLGAPSMPGALKHPRTPPINPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLP--KNVARTLNQGSSPM  2643
             SDHV+KR R +GI+DEVNLP+NVL  +FPGHGHSQA +  DDLP  K V RTLNQGSSPM
Sbjct  301   SDHVAKRTRPMGITDEVNLPVNVLSGTFPGHGHSQAFNAPDDLPLPKTVTRTLNQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ+LLLVGTNVG IALWEVGSREKLV RNFKVWDLSACSMP Q ALVKDP VS
Sbjct  361   SMDFHPVQQSLLLVGTNVGGIALWEVGSREKLVSRNFKVWDLSACSMPFQAALVKDPSVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYSRHIVQIYSYH  DDVRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRVIWSPDGALFGVAYSRHIVQIYSYHTGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA +GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAVSGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDGTLLAVS
Sbjct  601   MGVVQFDTTKNRFLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             AN+NGIK++AN DGIRLLRT EN +   A+RASE A     +  S A+A++A  AER +S
Sbjct  661   ANDNGIKIVANADGIRLLRTLENNSMYDASRASEMAKPTINSMSSAAAATSAALAERASS  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             V   + MNGD R ++GDVKPRI+EE NDKSK+WKLTEI EPSHCR+LKLPEN+RV KISR
Sbjct  721   VAAIAGMNGDTR-SMGDVKPRISEEANDKSKIWKLTEINEPSHCRSLKLPENVRVNKISR  779

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKW R ERNSSGKA A++P QLWQPSSGILMTND+AD N
Sbjct  780   LIYTNSGNAILALASNAIHLLWKWPRNERNSSGKANASVPAQLWQPSSGILMTNDIADSN  839

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PED+VPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  840   PEDSVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  899

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGWEK
Sbjct  900   IGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGWEK  959

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             QK++FL LP GR  S QSDTRVQFHQDQI FLVVHETQLAI+EATKLEC+KQW  R+++A
Sbjct  960   QKTRFLQLPPGRTPSAQSDTRVQFHQDQIQFLVVHETQLAIFEATKLECLKQWAPRDSSA  1019

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDSQL+YASFLDATVCVF A+NL LRCRI P AYL  S+S+S V PLV+AAH
Sbjct  1020  PISHATFSCDSQLIYASFLDATVCVFNASNLRLRCRINPPAYLPASVSNSNVQPLVIAAH  1079

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             P + NQFA+GLSDGGV VFEPLESEGKWGVPPP ENGS SN   V+
Sbjct  1080  PHEANQFAVGLSDGGVHVFEPLESEGKWGVPPPNENGSSSNNVAVA  1125



>ref|XP_004152185.1| PREDICTED: protein TOPLESS-like [Cucumis sativus]
Length=1139

 Score =  1872 bits (4848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 968/1141 (85%), Positives = 1043/1141 (91%), Gaps = 16/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPHLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P    VP  LAGWMSN   V+HPAVSGG  IGL   SIPAALKHPRTPPTNPSV+YPS D
Sbjct  241   PTAAPVPAPLAGWMSNPSAVTHPAVSGGGAIGLGAPSIPAALKHPRTPPTNPSVEYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKRP+ +G+SDEVNLP+NVLPVSF GHGH+Q  +  DDLPK V RTLNQGS+PMSM
Sbjct  301   SDHVSKRPKPMGMSDEVNLPVNVLPVSFTGHGHAQNFNAPDDLPKTVMRTLNQGSNPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGT+VG+I LWEVGSRE+LV +NFKVWDL+ACSMPLQ ALVK+P VSVN
Sbjct  361   DFHPIQQTLLLVGTDVGEIGLWEVGSRERLVSKNFKVWDLNACSMPLQAALVKEPDVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVNDLAFS+PNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDDMRQHLEIDAHVGGVNDLAFSNPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA NGA+QY FEGHEAPV+SVCPH+KEN+QFIFSTALDGKIKAWLYDNMG
Sbjct  481   CGDDKTIKVWDAGNGARQYIFEGHEAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDNMG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGFRKRS G
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVS N
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSGN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-----VASASNAGFAER  1572
             ENGIK+LAN DGIRLLRTFENL    AAR SE+ +KP++NPIS      A+A+    A+R
Sbjct  661   ENGIKILANVDGIRLLRTFENL-SYDAARTSEAGTKPTINPISAAAAVAAAAAAGSAADR  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              ASVV  S + GD+R ++GDVKPRI E++NDKSK+WKLTEI EPS CR+L+LPEN+RV K
Sbjct  720   GASVVTMSGVAGDSR-SLGDVKPRIPEDSNDKSKIWKLTEINEPSQCRSLRLPENVRVNK  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNAIHLLWKW R ERNS+GKATAN+ PQLWQPSSGILMTNDVA
Sbjct  779   ISRLIYTNSGSAILALASNAIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVA  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D + E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  839   DTSSEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH+LNVLVSSGADAQL VWSSD 
Sbjct  899   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHLLNVLVSSGADAQLCVWSSDV  958

Query  851   WEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQK++FL LP+GR  S QSDTRVQFHQDQ+HFLVVHETQ+AIYE TKLECVKQW  RE
Sbjct  959   WEKQKTRFLQLPSGRPPSSQSDTRVQFHQDQVHFLVVHETQIAIYETTKLECVKQWTPRE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             + APISHATFSCDSQ++YASFLDATVCVFT A+L LRCRI+PSAYL  S+S++ V PLV+
Sbjct  1019  SGAPISHATFSCDSQMIYASFLDATVCVFTVASLRLRCRISPSAYLPASVSNASVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN--TTPV-----SDQPP  336
             AAHPQ+ NQFALGLSDGGV VFEPLESEGKWGVPPPVENGS S+  TTP      S+Q P
Sbjct  1079  AAHPQEANQFALGLSDGGVHVFEPLESEGKWGVPPPVENGSASSVPTTPSVGASGSEQAP  1138

Query  335   R  333
             R
Sbjct  1139  R  1139



>ref|XP_008454191.1| PREDICTED: protein TOPLESS [Cucumis melo]
 ref|XP_008454192.1| PREDICTED: protein TOPLESS [Cucumis melo]
 ref|XP_008454193.1| PREDICTED: protein TOPLESS [Cucumis melo]
Length=1139

 Score =  1870 bits (4845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 969/1141 (85%), Positives = 1042/1141 (91%), Gaps = 16/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPHLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P    VP  LAGWMSN   V+HPAVSGG  IGL   SIPAALKHPRTPPTNPSV+YPS D
Sbjct  241   PTAAPVPAPLAGWMSNPSAVTHPAVSGGGAIGLGAPSIPAALKHPRTPPTNPSVEYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKRP+ +G+SDEVNLP+NVLPVSF GHGH+Q  +  DDLPK V RTLNQGSSP SM
Sbjct  301   SDHVSKRPKPMGMSDEVNLPVNVLPVSFAGHGHAQTFNAPDDLPKTVMRTLNQGSSPKSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGT VG+I LWEVGSRE+LV +NFKVWDL+ACSMPLQ ALVK+P VSVN
Sbjct  361   DFHPIQQTLLLVGTIVGEIGLWEVGSRERLVSKNFKVWDLNACSMPLQAALVKEPDVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVNDLAFS+PNKQLCVIT
Sbjct  421   RVIWSPDGSLFGVAYSRHIVQIYSYHGGDDMRQHLEIDAHVGGVNDLAFSNPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA NGA+QYTFEGHEAPV+SVCPH+KEN+QFIFSTALDGKIKAWLYDNMG
Sbjct  481   CGDDKTIKVWDAGNGARQYTFEGHEAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDNMG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGFRKRS G
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFRKRSPG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVS N
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSGN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-----VASASNAGFAER  1572
             +NGIK+LAN DGIRLLRTFENL    AAR SE+ +KP++NPIS      A+A+    A+R
Sbjct  661   DNGIKILANVDGIRLLRTFENL-SYDAARTSEAGTKPTINPISAAAAVAAAAAAGSAADR  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              ASVV  S + GD+R ++GDVKPRI E++NDKSK+WKLTEI EPS CR+L+LPEN+RV K
Sbjct  720   GASVVTMSGVAGDSR-SLGDVKPRIPEDSNDKSKIWKLTEINEPSQCRSLRLPENVRVNK  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNAIHLLWKW R ERNS+GKATAN+ PQLWQPSSGILMTNDVA
Sbjct  779   ISRLIYTNSGSAILALASNAIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVA  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D + E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  839   DTSSEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH+LNVLVSSGADAQL VWSSD 
Sbjct  899   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHLLNVLVSSGADAQLCVWSSDV  958

Query  851   WEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQK++FL LP+GR  S QSDTRVQFHQDQ+HFLVVHETQ+AIYE TKLECVKQW  RE
Sbjct  959   WEKQKTRFLQLPSGRPPSSQSDTRVQFHQDQVHFLVVHETQIAIYETTKLECVKQWTPRE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             + APISHATFSCDSQ++YASFLDATVCVFT A+L LRCRI+PSAYL  S+S++ V PLV+
Sbjct  1019  SGAPISHATFSCDSQMIYASFLDATVCVFTVASLRLRCRISPSAYLPASVSNASVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN--TTPV-----SDQPP  336
             AAHPQ+ NQFALGLSDGGV VFEPLESEGKWGVPPPVENGS S+  TTP      SDQ P
Sbjct  1079  AAHPQEANQFALGLSDGGVHVFEPLESEGKWGVPPPVENGSASSVPTTPSVGASGSDQAP  1138

Query  335   R  333
             R
Sbjct  1139  R  1139



>ref|XP_008380984.1| PREDICTED: topless-related protein 1-like [Malus domestica]
Length=1134

 Score =  1868 bits (4839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 968/1137 (85%), Positives = 1029/1137 (91%), Gaps = 13/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFN+KYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNVKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNG RAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGTRAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+HPAVS G        SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTPAPVPIPLAGWMSNPSTVTHPAVSEGGGIGLGGPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +G+S EVNLP+N+LPV+FPGHGH Q  +  DDLPKNV  TLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGLSTEVNLPVNMLPVTFPGHGHGQPLNAPDDLPKNVTLTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQTLLLVGTNVGDI LWEVGS+E+LVLRNFKVWDLS+CSMPLQ ALVKDPGVSVN
Sbjct  361   DFHPSQQTLLLVGTNVGDIGLWEVGSKERLVLRNFKVWDLSSCSMPLQAALVKDPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVND+AFSHPNKQLCVIT
Sbjct  421   RVIWSPDGALFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDIAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDAT GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDATTGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRSFG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV--ASASNAGFAERVAS  1563
             ENGIKVLAN DG+RLLRTFEN     A+R SE  +KP++ PI V  A+AS AG AER AS
Sbjct  661   ENGIKVLANADGMRLLRTFENHLSYDASRPSEVVTKPAITPIQVAAAAASGAGLAERSAS  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
                 S MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI+EPS CR+L+LPEN+RVTKISR
Sbjct  721   AAAVSGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEISEPSQCRSLRLPENMRVTKISR  779

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSGSA+LALASNAIHLLWKWQR ERNSS KATA++ PQLWQPSSGILMTND+ D +
Sbjct  780   LIYTNSGSAILALASNAIHLLWKWQRSERNSS-KATASVSPQLWQPSSGILMTNDITDTS  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  839   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLN LVSSGADAQL VW+SDGWEK
Sbjct  899   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNALVSSGADAQLCVWNSDGWEK  958

Query  842   QKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
              KS+FL LPAGR +   SDTRVQFH +Q  FLVVHETQLAIYE TKLECVKQWV R++AA
Sbjct  959   LKSRFLQLPAGRTTASLSDTRVQFHHNQQQFLVVHETQLAIYETTKLECVKQWVPRDSAA  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  SS V PLV+AAH
Sbjct  1019  PISHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSAYLPANVSSNVQPLVIAAH  1077

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT------TPVSDQPPR  333
             PQ+ NQFALGLSDG V VFEPLESEGKWGV PPVENGS S+       T  SDQ  R
Sbjct  1078  PQEANQFALGLSDGAVHVFEPLESEGKWGVAPPVENGSASSAPATQVGTSGSDQAQR  1134



>ref|XP_003599718.1| WD repeat-containing protein, putative [Medicago truncatula]
 ref|XP_003604345.1| WD repeat-containing protein, putative [Medicago truncatula]
 gb|AGK62668.1| topless [Medicago truncatula]
Length=1138

 Score =  1867 bits (4837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 955/1127 (85%), Positives = 1026/1127 (91%), Gaps = 6/1127 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSG-GPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VPTQLAGWMSN  TV+H AVSG G IGL   S+P ALKHPRTPP NPSVDYPSGD
Sbjct  241   PNPAAVPTQLAGWMSNPTTVAHAAVSGAGAIGLGAPSMPGALKHPRTPPINPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLP--KNVARTLNQGSSPM  2643
             SDHV+KR R +GI+DEVNLP+NVL  +FPGHGHSQA +  DDLP  K V RTLNQGSSPM
Sbjct  301   SDHVAKRTRPMGITDEVNLPVNVLSGTFPGHGHSQAFNAPDDLPLPKTVTRTLNQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ+LLLVGTNVG IALWEVGSREKLV RNFKVWDLSACSMP Q ALVKDP VS
Sbjct  361   SMDFHPVQQSLLLVGTNVGGIALWEVGSREKLVSRNFKVWDLSACSMPFQAALVKDPSVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYSRHIVQIYSYH  DDVRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRVIWSPDGALFGVAYSRHIVQIYSYHTGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA +GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAVSGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDGTLLAVS
Sbjct  601   MGVVQFDTTKNRFLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             AN+NGIK++AN DGIRLLRT EN +   A+RASE A     +  S A+A++A  AER +S
Sbjct  661   ANDNGIKIVANADGIRLLRTLENNSMYDASRASEMAKPTINSMSSAAAATSAALAERASS  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             V   + MNGD R ++GDVKPRI+EE NDKSK+WKLTEI EPSHCR+LKLPEN+RV KISR
Sbjct  721   VAAIAGMNGDTR-SMGDVKPRISEEANDKSKIWKLTEINEPSHCRSLKLPENVRVNKISR  779

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKW R ERNSSGKA A++P QLWQPSSGILMTND+AD N
Sbjct  780   LIYTNSGNAILALASNAIHLLWKWPRNERNSSGKANASVPAQLWQPSSGILMTNDIADSN  839

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PED+VPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  840   PEDSVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  899

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGWEK
Sbjct  900   IGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGWEK  959

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             QK++FL LP GR  S QSDTRVQFHQDQI FLVVHETQLAI+EATKLEC+KQW  R+++A
Sbjct  960   QKTRFLQLPPGRTPSAQSDTRVQFHQDQIQFLVVHETQLAIFEATKLECLKQWAPRDSSA  1019

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIa-psaylspslssSGVHPLVVAA  489
             PISHATFSCDSQL+YASFLDATVCVF A+NL LRCRI  P+   +   S+S V PLV+AA
Sbjct  1020  PISHATFSCDSQLIYASFLDATVCVFNASNLRLRCRINPPAYLPASVSSNSNVQPLVIAA  1079

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             HP + NQFA+GLSDGGV VFEPLESEGKWGVPPP ENGS SN   V+
Sbjct  1080  HPHEANQFAVGLSDGGVHVFEPLESEGKWGVPPPNENGSSSNNVAVA  1126



>ref|XP_011011325.1| PREDICTED: protein TOPLESS-like [Populus euphratica]
Length=1134

 Score =  1867 bits (4836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 970/1132 (86%), Positives = 1030/1132 (91%), Gaps = 12/1132 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRS AVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSMAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLF DHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKAPRSNPDIKTLFFDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             PAP  VP  LAGWMS   TV+HPAVSGG  IGL   SIPAALKHPRTPPTNPSVDYPSGD
Sbjct  241   PAP--VPAPLAGWMSAPSTVTHPAVSGGGAIGLGAPSIPAALKHPRTPPTNPSVDYPSGD  298

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHV+KR R +GISDEVNLP+NVLPVSFPGHGH QA +  DDLPK VARTLNQGSSPMSM
Sbjct  299   SDHVAKRVRPMGISDEVNLPVNVLPVSFPGHGHGQAFNAPDDLPKTVARTLNQGSSPMSM  358

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+Q TLLLVGTNVGDI LWEVGSRE+LVLR FKVWDL+ACSMPLQ AL KDPGVSVN
Sbjct  359   DFHPLQLTLLLVGTNVGDIGLWEVGSRERLVLRIFKVWDLNACSMPLQAALAKDPGVSVN  418

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYHGND+VRQHLEIDAHVGGVNDLAFS PNKQLCVIT
Sbjct  419   RVIWSPDGSLFGVAYSRHIVQIYSYHGNDEVRQHLEIDAHVGGVNDLAFSTPNKQLCVIT  478

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  GAK YTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  479   CGDDKTIKVWDAATGAKLYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNLG  538

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S IVEWNESEGAVKRTY GFRK+S+G
Sbjct  539   SRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSSIVEWNESEGAVKRTYLGFRKQSWG  598

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LT+IDADGGLPASPRIRFNKDGTLLAVSAN
Sbjct  599   VVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTTIDADGGLPASPRIRFNKDGTLLAVSAN  658

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI----SVASASNAGFAERV  1569
             +NGIK+LANTDGIRLLRTFEN+    A RASES +KPSVNPI      A+A++AG A+R 
Sbjct  659   DNGIKILANTDGIRLLRTFENI-SFDATRASESIAKPSVNPISAAAVAAAATSAGHADRS  717

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
             A VV  + MNGDAR N+GDVKPR+TEE+NDKSK+W LTEI E S CR+L+LPENLRVTKI
Sbjct  718   APVVAIAGMNGDAR-NLGDVKPRLTEESNDKSKIWNLTEINEQSQCRSLRLPENLRVTKI  776

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG+A+LALASNAIHLLWKWQR +RN+SGKATA + PQLWQPSSGILMTND  D
Sbjct  777   SRLIYTNSGNAILALASNAIHLLWKWQRSDRNASGKATAGVSPQLWQPSSGILMTNDSTD  836

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPE+AVPCFALSKNDSYVMSASGG ISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  837   -NPEEAVPCFALSKNDSYVMSASGGNISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  895

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLN+LVSSGADAQL VW+SDGW
Sbjct  896   IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNMLVSSGADAQLCVWNSDGW  955

Query  848   EKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQK++FL +PAGR  + QSDTRVQFHQDQIHFLVVHETQLAIYE TKLECVKQWV RE+
Sbjct  956   EKQKARFLQVPAGRTPTAQSDTRVQFHQDQIHFLVVHETQLAIYETTKLECVKQWVLRES  1015

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
             +APISHA FSCDSQLVYASFLDATVCVF+A NL LRCRI           SS VHPLV+A
Sbjct  1016  SAPISHAVFSCDSQLVYASFLDATVCVFSAMNLRLRCRI-NPCTYLSPNVSSNVHPLVIA  1074

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVSDQPP  336
             AHPQ+PNQFALGLSDGGV VFEPLESEGKWG+PPP ENGS S+   +    P
Sbjct  1075  AHPQEPNQFALGLSDGGVHVFEPLESEGKWGMPPPAENGSASSVAAIPSVGP  1126



>ref|XP_011044877.1| PREDICTED: topless-related protein 1 isoform X1 [Populus euphratica]
Length=1172

 Score =  1867 bits (4836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 966/1167 (83%), Positives = 1031/1167 (88%), Gaps = 44/1167 (4%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLF DHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKAPRSNPDIKTLFFDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P QVP  LAGWMSN PTV+HPAVSGG  IGL   SIPAALKHPRTPP+NPSVDYPSGD
Sbjct  241   PTPAQVPAPLAGWMSNPPTVTHPAVSGGGAIGLGAPSIPAALKHPRTPPSNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS--QAHSTLDDLPKNVARTLNQGSSPM  2643
              DHV+KR R +GISDEVNLP+NVLP+ FPGHGH   Q  +  DDLPK V RTLNQGSSPM
Sbjct  301   PDHVAKRTRPMGISDEVNLPVNVLPMPFPGHGHGHGQTFNAPDDLPKAVVRTLNQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQT+LLVGTNVG+I LWEVGSRE+LVLRNFKVWDL+ACS PLQ ALVKDPGVS
Sbjct  361   SMDFHPVQQTILLVGTNVGEIGLWEVGSRERLVLRNFKVWDLNACSTPLQAALVKDPGVS  420

Query  2462  VNCITWSPDGSLFG----------------------------------VAYSRHIVQIYS  2385
             VN + WSPDG+LFG                                  VAYSRHIVQIYS
Sbjct  421   VNRVIWSPDGNLFGKLKSITIHGWIRNTHKILGVKRLFIDFSSLSTTGVAYSRHIVQIYS  480

Query  2384  YHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIKVWDATNGAKQYTFEGH  2205
             YHGNDDVRQHLEIDAHVGGVNDLAFS PNKQLCVITCGDDK IKVWDA  GAK YTFEGH
Sbjct  481   YHGNDDVRQHLEIDAHVGGVNDLAFSTPNKQLCVITCGDDKAIKVWDAATGAKLYTFEGH  540

Query  2204  EAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRL  2025
             EAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDN+GSRVDY+APGRWCTTMAYSADGTRL
Sbjct  541   EAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNLGSRVDYEAPGRWCTTMAYSADGTRL  600

Query  2024  FSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGVVQFDTTKNRYLAAGDDFSIKFWD  1845
             FSCGTSKDGESHIVEWNESEGAVKR Y GFRK S GVVQFDTTKNR+LAAGDDFSIKFWD
Sbjct  601   FSCGTSKDGESHIVEWNESEGAVKRNYLGFRKHSLGVVQFDTTKNRFLAAGDDFSIKFWD  660

Query  1844  MDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANENGIKVLANTDGIRLLRTFENLay  1665
             MDSVQ+LT+IDADGGLPASPRIRFNK+GTLLAVSAN+NGIK+LAN+DGIRLLR+FENL  
Sbjct  661   MDSVQLLTTIDADGGLPASPRIRFNKEGTLLAVSANDNGIKILANSDGIRLLRSFENL-S  719

Query  1664  daaarasesaskpSVNPIS---VASASNAGFAERVASVVGTSVMNGDARNNVGDVKPRIT  1494
               A+RASES +KP+VN IS    A+A+++G A+R ASVV  + MNGDAR N+GDVKPRI 
Sbjct  720   YDASRASESVAKPTVNLISAAAAAAATSSGLADRGASVVAVAGMNGDAR-NLGDVKPRIA  778

Query  1493  EETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWK  1314
             EE NDKSK+WKLTEI EPS CR+L+LPENLR TKISRLIYTNSG+A+LALASNAIHLLWK
Sbjct  779   EELNDKSKIWKLTEINEPSQCRSLRLPENLRATKISRLIYTNSGNAILALASNAIHLLWK  838

Query  1313  WQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGG  1134
             WQR +RN+SGKATA + PQLWQPSSGILMTND+ D NPE+AV CFALSKNDSYVMSASGG
Sbjct  839   WQRSDRNASGKATAGVSPQLWQPSSGILMTNDITDTNPEEAVACFALSKNDSYVMSASGG  898

Query  1133  KISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLK  954
             KISLFNMMTFKTMTTFMP PPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLK
Sbjct  899   KISLFNMMTFKTMTTFMPTPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLK  958

Query  953   GHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRASV-QSDTRVQ  777
             GHSKRITGLAFSHVL+VLVSSGADAQL VW+SDGWEKQK++FL +P GR +  QSDTRVQ
Sbjct  959   GHSKRITGLAFSHVLSVLVSSGADAQLCVWNSDGWEKQKTRFLQVPTGRTTTAQSDTRVQ  1018

Query  776   FHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATV  597
             FHQDQIHFLVVHETQLAIYE TKLECVKQW+ RE++APISHA FSCDSQLVYASFLDATV
Sbjct  1019  FHQDQIHFLVVHETQLAIYETTKLECVKQWLPRESSAPISHAVFSCDSQLVYASFLDATV  1078

Query  596   CVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLE  417
             CVF+AANL LRCRI   +   P   SS VHPLV+AAHPQ+PNQFALGLSDGGV VFEPLE
Sbjct  1079  CVFSAANLRLRCRI-NPSSYPPPNVSSNVHPLVIAAHPQEPNQFALGLSDGGVQVFEPLE  1137

Query  416   SEGKWGVPPPVENGSGSNTTPVSDQPP  336
             SEGKWGVPPP ENGS S+   +    P
Sbjct  1138  SEGKWGVPPPAENGSASSVAAIPSVGP  1164



>ref|XP_009338495.1| PREDICTED: protein TOPLESS [Pyrus x bretschneideri]
Length=1138

 Score =  1866 bits (4834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 959/1124 (85%), Positives = 1021/1124 (91%), Gaps = 9/1124 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+HPAVS G        SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTPAPVPIPLAGWMSNPSTVTHPAVSEGGGIGLGGPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +G+S EVNLP+N+LPV+F GHGH QA +  +DLPKNV RTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMGLSTEVNLPVNMLPVTFQGHGHGQALNAPEDLPKNVTRTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDLS+CSMPLQ ALVK+PGVSVN
Sbjct  361   DFHPSQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLSSCSMPLQAALVKEPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT
Sbjct  421   RVIWSPDGALFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTY GFRKRS G
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYHGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+ Q++T++DADGGLP SPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNTQLMTTVDADGGLPGSPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV-----ASASNAGFAER  1572
             ENGIK+LAN DG+RLLRTFEN     A+R SE   KP++ PI V     A+AS+AG AER
Sbjct  661   ENGIKILANADGMRLLRTFENHLSYEASRTSEVVMKPAITPIQVAAAAAAAASSAGLAER  720

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A+    S MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI+EPS CR+L+LPEN+RVTK
Sbjct  721   SAAAAALSGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEISEPSQCRSLRLPENMRVTK  779

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNAIHLLWKWQR ERNS+ KATA++ PQLWQP+SGILMTND+ 
Sbjct  780   ISRLIYTNSGSAILALASNAIHLLWKWQRSERNSTSKATASVSPQLWQPTSGILMTNDIT  839

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D +PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  840   DTSPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  899

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VWSSDG
Sbjct  900   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWSSDG  959

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEK KS+FL LPAGR +   SDTRVQFH DQ  FLVVHETQLAIYE TKLE VKQWV R+
Sbjct  960   WEKLKSRFLQLPAGRTTASLSDTRVQFHHDQQQFLVVHETQLAIYETTKLEIVKQWVPRD  1019

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             +AAPISHATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  SS V PLV+
Sbjct  1020  SAAPISHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSAYLPANVSSNVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             AAHPQ+ NQFALGLSDG V VFEPLESEGKWGV PPVENGS S+
Sbjct  1079  AAHPQEANQFALGLSDGAVHVFEPLESEGKWGVAPPVENGSASS  1122



>ref|XP_009348312.1| PREDICTED: protein TOPLESS-like [Pyrus x bretschneideri]
 ref|XP_009348320.1| PREDICTED: protein TOPLESS-like [Pyrus x bretschneideri]
Length=1138

 Score =  1863 bits (4827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 958/1124 (85%), Positives = 1020/1124 (91%), Gaps = 9/1124 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN  TV+HPAVS G        SI AALKHPRTPPTNPSV+YPSGD
Sbjct  241   PTPAPVPIPLAGWMSNPSTVTHPAVSEGGGIGLGGPSITAALKHPRTPPTNPSVEYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R + +S EVNLP+N+LPV+F GHGH QA +  +DLPKNV RTLNQGSSPMSM
Sbjct  301   SDHVSKRTRPMALSTEVNLPVNMLPVTFQGHGHGQALNAPEDLPKNVTRTLNQGSSPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQTLLLVGTNVGDI LWEVGSRE+LVLRNFKVWDLS+CSMPLQ ALVK+PGVSVN
Sbjct  361   DFHPSQQTLLLVGTNVGDIGLWEVGSRERLVLRNFKVWDLSSCSMPLQAALVKEPGVSVN  420

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT
Sbjct  421   RVIWSPDGALFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  480

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  481   CGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  540

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTY GFRKRS G
Sbjct  541   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYHGFRKRSLG  600

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+ Q++T++DADGGLP SPRIRFNKDGTLLAVSAN
Sbjct  601   VVQFDTTKNRFLAAGDDFSIKFWDMDNTQLMTTVDADGGLPGSPRIRFNKDGTLLAVSAN  660

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV-----ASASNAGFAER  1572
             ENGIK+LAN DG+RLLRTFEN     A+R SE   KP++ PI V     A+AS+AG AER
Sbjct  661   ENGIKILANADGMRLLRTFENHLSYEASRTSEVVMKPAITPIQVAAAAAAAASSAGLAER  720

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A+    S MNGDAR N+GDVKPRI EE+NDKSK+WKLTEI+EPS CR+L+LPEN+RVTK
Sbjct  721   SAAAAALSGMNGDAR-NLGDVKPRIAEESNDKSKIWKLTEISEPSQCRSLRLPENMRVTK  779

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNAIHLLWKWQR ERNSS KATA++ PQLWQP+SGILMTND+ 
Sbjct  780   ISRLIYTNSGSAILALASNAIHLLWKWQRSERNSSSKATASVSPQLWQPTSGILMTNDIT  839

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D +PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  840   DTSPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  899

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VWSSDG
Sbjct  900   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWSSDG  959

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEK KS+FL LP+GR +   SDTRVQFH DQ  FLVVHETQLAIYE TKLE VKQWV R+
Sbjct  960   WEKLKSRFLQLPSGRTTASLSDTRVQFHHDQQQFLVVHETQLAIYETTKLEIVKQWVPRD  1019

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             +AAPISHATFSCDSQLVYASFLDATVCVF+AANL LRCRI   +   P+  SS V PLV+
Sbjct  1020  SAAPISHATFSCDSQLVYASFLDATVCVFSAANLRLRCRI-NPSAYLPANVSSNVQPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             AAHPQ+ NQFALGLSDG V VFEPLESEGKWGV PPVENGS S+
Sbjct  1079  AAHPQEANQFALGLSDGAVHVFEPLESEGKWGVAPPVENGSASS  1122



>ref|XP_003597933.1| WD repeat-containing protein, putative [Medicago truncatula]
 gb|AES68184.1| topless-like protein [Medicago truncatula]
Length=1149

 Score =  1862 bits (4822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 951/1132 (84%), Positives = 1031/1132 (91%), Gaps = 6/1132 (1%)
 Frame = -3

Query  3746  FFSGFEGLVATMSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGN  3567
             F  GF+     MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGN
Sbjct  5     FTFGFQDKGVAMSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGN  64

Query  3566  WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNE  3387
             WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNE
Sbjct  65    WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNE  124

Query  3386  ELFKEITHLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNS  3207
             ELFKEIT LLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNS
Sbjct  125   ELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNS  184

Query  3206  RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGG  3027
             RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GG
Sbjct  185   RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGG  244

Query  3026  FPPLGAHGPFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS---SIPAALKHPRT  2856
             FPPLGAHGPFQP P  VP  LAGWMSN   V+HP+VSGG          S+PAALKHPRT
Sbjct  245   FPPLGAHGPFQPTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSMPAALKHPRT  304

Query  2855  PPTNPSVDYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNV  2676
             PPTNPSVDYPSGDSDH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V
Sbjct  305   PPTNPSVDYPSGDSDHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTV  364

Query  2675  ARTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPL  2496
              RTLNQGSSPMSMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP 
Sbjct  365   LRTLNQGSSPMSMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPF  424

Query  2495  QTALVKDPGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDL  2316
             Q ALVKDP VSVN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDL
Sbjct  425   QAALVKDPAVSVNRVTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDL  484

Query  2315  AFSHPNKQLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTAL  2136
             AFSHPNKQLCVITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTAL
Sbjct  485   AFSHPNKQLCVITCGDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTAL  544

Query  2135  DGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAV  1956
             DGKIKAWLYDN+GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAV
Sbjct  545   DGKIKAWLYDNLGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAV  604

Query  1955  KRTYQGFRKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIR  1776
             KRTYQGFRKRS GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIR
Sbjct  605   KRTYQGFRKRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIR  664

Query  1775  FNKDGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASA  1596
             FNK+G+LLAVSANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A
Sbjct  665   FNKEGSLLAVSANENGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATA  723

Query  1595  SNAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKL  1416
             + +   ER +SV   + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKL
Sbjct  724   ATSAALERASSVAAITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKL  782

Query  1415  PENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSG  1236
             PEN RVTKISRLIYTNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSG
Sbjct  783   PENARVTKISRLIYTNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSG  842

Query  1235  ILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatfl  1056
             ILMTND+ D N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFL
Sbjct  843   ILMTNDINDNNTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFL  902

Query  1055  aFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQ  876
             AFHPQDNNIIAIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q
Sbjct  903   AFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQ  962

Query  875   LFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLEC  699
             +FVW++DGWEKQK++FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC
Sbjct  963   IFVWNTDGWEKQKNRFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLEC  1022

Query  698   VKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslss  519
             +KQW  R+AAAPISHATFSCDS L++ASFLDAT+CVF+A+NL LRCRI PSAYLS ++SS
Sbjct  1023  LKQWFPRDAAAPISHATFSCDSNLIFASFLDATICVFSASNLRLRCRINPSAYLSANVSS  1082

Query  518   SGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             S + PLV+AAHP +PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN
Sbjct  1083  SNIQPLVIAAHPHEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASN  1134



>gb|KHG27106.1| Topless-related 1 -like protein [Gossypium arboreum]
Length=1133

 Score =  1860 bits (4817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 954/1121 (85%), Positives = 1023/1121 (91%), Gaps = 5/1121 (0%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
               P  VP  LAGWMS+   V+HPAVS G IGL  SSIPAALKHPRTPPTNPSVDYPS DS
Sbjct  241   ATPAPVPAPLAGWMSSPSAVTHPAVSAGAIGLGASSIPAALKHPRTPPTNPSVDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHVSKR R +GISDEVNLP+NVL V+FPGHGHSQ  +  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHVSKRARPMGISDEVNLPVNVLQVTFPGHGHSQTFNAPDDLPKAVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDIALWEVGSRE+LV +NFKVWDLS CSMPLQ ALVKDP VSVN 
Sbjct  361   FHPVQQTLLLVGTNVGDIALWEVGSRERLVSKNFKVWDLSVCSMPLQAALVKDPAVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVND+AFS PNKQLCVITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDIAFSLPNKQLCVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA+NG KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNMGS
Sbjct  481   GDDKTIKVWDASNGTKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNMGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKEGESFIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ LTS DA+GGLPASPRIRFNKDG+LLAVSAN+
Sbjct  601   VQFDTTKNRYLAAGDDFSIKFWDMDNVQPLTSYDAEGGLPASPRIRFNKDGSLLAVSAND  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVASVV  1557
             NGIK+LAN+DG+RLL T ENL     A  +  A KP++NPIS  A+A++A  A+R ASVV
Sbjct  661   NGIKILANSDGMRLLCTLENL--SYDASRTPEAPKPTINPISAAAAATSAVLADRSASVV  718

Query  1556  GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLI  1377
                 MNGDAR +  DVKPRITEE++DKSK+WKLTEI+E S CR+L+LPENLRVTKISRLI
Sbjct  719   AIPGMNGDAR-SFADVKPRITEESSDKSKIWKLTEISESSQCRSLRLPENLRVTKISRLI  777

Query  1376  YTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPE  1197
             +TNSG+A+LALASNAIHLLWKWQR +RNS+GKATA++ PQLWQPSSGILMTNDVAD NPE
Sbjct  778   FTNSGNAILALASNAIHLLWKWQRSDRNSNGKATASVSPQLWQPSSGILMTNDVADTNPE  837

Query  1196  DAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIG  1017
             +AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAIG
Sbjct  838   EAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIG  897

Query  1016  MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQK  837
             MDDSTIQIYNVRVDEVKSKL GHSKRITGLAFSH LNVLVSSGAD+QL VW++DGWEKQK
Sbjct  898   MDDSTIQIYNVRVDEVKSKLIGHSKRITGLAFSHALNVLVSSGADSQLCVWNTDGWEKQK  957

Query  836   SKFLPLPAG-RASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPI  660
             +KFL +P G   + QS+TRVQFHQDQI  LVVHETQLA+YE TKLEC KQWV RE+ API
Sbjct  958   TKFLQIPVGITPTAQSETRVQFHQDQIRLLVVHETQLALYETTKLECFKQWVPRESFAPI  1017

Query  659   SHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQ  480
             +HATFSCDSQLVYASFLDAT+CVF AANL  RCRI PSAYL  S+SSS VHPLV+AAHP 
Sbjct  1018  THATFSCDSQLVYASFLDATICVFVAANLRPRCRINPSAYLPASVSSSNVHPLVIAAHPS  1077

Query  479   DPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             +PN+FA+GLSDGGV VFEPLESE +WGVP P +NGS S+ T
Sbjct  1078  EPNEFAVGLSDGGVHVFEPLESENRWGVPQPADNGSASSIT  1118



>ref|XP_003597931.1| WD repeat-containing protein, putative [Medicago truncatula]
Length=1134

 Score =  1858 bits (4812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 948/1121 (85%), Positives = 1027/1121 (92%), Gaps = 6/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS---SIPAALKHPRTPPTNPSVDYPS  2823
             P P  VP  LAGWMSN   V+HP+VSGG          S+PAALKHPRTPPTNPSVDYPS
Sbjct  241   PTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSMPAALKHPRTPPTNPSVDYPS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             GDSDH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V RTLNQGSSPM
Sbjct  301   GDSDHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTVLRTLNQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q ALVKDP VS
Sbjct  361   SMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALVKDPAVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRVTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             ANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A+ +   ER +S
Sbjct  661   ANENGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATAATSAALERASS  719

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             V   + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKLPEN RVTKISR
Sbjct  720   VAAITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKLPENARVTKISR  778

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSGILMTND+ D N
Sbjct  779   LIYTNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSGILMTNDINDNN  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
              EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  839   TEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q+FVW++DGWEK
Sbjct  899   IGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQIFVWNTDGWEK  958

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             QK++FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC+KQW  R+AAA
Sbjct  959   QKNRFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLECLKQWFPRDAAA  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDS L++ASFLDAT+CVF+A+NL LRCRI PSAYLS ++SSS + PLV+AAH
Sbjct  1019  PISHATFSCDSNLIFASFLDATICVFSASNLRLRCRINPSAYLSANVSSSNIQPLVIAAH  1078

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             P +PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN
Sbjct  1079  PHEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASN  1119



>gb|AES68183.2| topless-like protein [Medicago truncatula]
Length=1148

 Score =  1857 bits (4810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 944/1132 (83%), Positives = 1024/1132 (90%), Gaps = 7/1132 (1%)
 Frame = -3

Query  3746  FFSGFEGLVATMSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGN  3567
             F  GF+     MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGN
Sbjct  5     FTFGFQDKGVAMSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGN  64

Query  3566  WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNE  3387
             WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNE
Sbjct  65    WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNE  124

Query  3386  ELFKEITHLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNS  3207
             ELFKEIT LLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNS
Sbjct  125   ELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNS  184

Query  3206  RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGG  3027
             RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GG
Sbjct  185   RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGG  244

Query  3026  FPPLGAHGPFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS---SIPAALKHPRT  2856
             FPPLGAHGPFQP P  VP  LAGWMSN   V+HP+VSGG          S+PAALKHPRT
Sbjct  245   FPPLGAHGPFQPTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSMPAALKHPRT  304

Query  2855  PPTNPSVDYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNV  2676
             PPTNPSVDYPSGDSDH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V
Sbjct  305   PPTNPSVDYPSGDSDHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTV  364

Query  2675  ARTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPL  2496
              RTLNQGSSPMSMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP 
Sbjct  365   LRTLNQGSSPMSMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPF  424

Query  2495  QTALVKDPGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDL  2316
             Q ALVKDP VSVN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDL
Sbjct  425   QAALVKDPAVSVNRVTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDL  484

Query  2315  AFSHPNKQLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTAL  2136
             AFSHPNKQLCVITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTAL
Sbjct  485   AFSHPNKQLCVITCGDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTAL  544

Query  2135  DGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAV  1956
             DGKIKAWLYDN+GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAV
Sbjct  545   DGKIKAWLYDNLGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAV  604

Query  1955  KRTYQGFRKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIR  1776
             KRTYQGFRKRS GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIR
Sbjct  605   KRTYQGFRKRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIR  664

Query  1775  FNKDGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASA  1596
             FNK+G+LLAVSANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A
Sbjct  665   FNKEGSLLAVSANENGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATA  723

Query  1595  SNAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKL  1416
             + +   ER +SV   + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKL
Sbjct  724   ATSAALERASSVAAITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKL  782

Query  1415  PENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSG  1236
             PEN RVTKISRLIYTNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSG
Sbjct  783   PENARVTKISRLIYTNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSG  842

Query  1235  ILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatfl  1056
             ILMTND+ D N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFL
Sbjct  843   ILMTNDINDNNTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFL  902

Query  1055  aFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQ  876
             AFHPQDNNIIAIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q
Sbjct  903   AFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQ  962

Query  875   LFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLEC  699
             +FVW++DGWEKQK++FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC
Sbjct  963   IFVWNTDGWEKQKNRFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLEC  1022

Query  698   VKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslss  519
             +KQW  R+AAAPISHATFSCDS L++ASFLDAT+CVF+A+NL LRCRI   +    +  S
Sbjct  1023  LKQWFPRDAAAPISHATFSCDSNLIFASFLDATICVFSASNLRLRCRI-NPSAYLSANVS  1081

Query  518   SGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             S + PLV+AAHP +PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN
Sbjct  1082  SNIQPLVIAAHPHEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASN  1133



>ref|XP_010250290.1| PREDICTED: protein TOPLESS-like isoform X4 [Nelumbo nucifera]
Length=1134

 Score =  1856 bits (4808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1121 (84%), Positives = 1020/1121 (91%), Gaps = 8/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKVGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  VPT LAGWMSN  TV+HPAVSGGPIGL   + PAA LKHPRTPPTN P+VDY SG
Sbjct  241   PTPAPVPTPLAGWMSNPSTVTHPAVSGGPIGLGAPTNPAAILKHPRTPPTNNPAVDYSSG  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             D DHVSKR R +G+SDEVNLP+N+LPV++PG  HSQA +  DDLPK VARTL QGS PMS
Sbjct  301   DPDHVSKRTRPIGLSDEVNLPVNILPVTYPGQSHSQAFNIPDDLPKTVARTLTQGSCPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQTLLLVGTNVGDI LWEVGSRE+L  RNFKVWDL ACSMPLQ ALVKDP VSV
Sbjct  361   MDFHPVQQTLLLVGTNVGDIGLWEVGSRERLAFRNFKVWDLGACSMPLQAALVKDPSVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDGSLFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  421   NRIIWSPDGSLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYDAPGHWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRSM  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGLPASPRIRFNK+GTLLAVSA
Sbjct  601   GVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLPASPRIRFNKEGTLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVAS  1563
             N+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ IS V +AS AG A+R A 
Sbjct  661   NDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQISAVTAASAAGHADRGAP  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV  + MNGDAR ++GDVKPRITE+ +DKSK+WKLTEI+E   CR+L+LP+NLR  KISR
Sbjct  721   VVSITGMNGDAR-SLGDVKPRITEDASDKSKIWKLTEISEQVQCRSLRLPDNLRTNKISR  779

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++ PQLWQP+SGILMTND+AD N
Sbjct  780   LIYTNSGTAILALASNAIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIADTN  839

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  840   PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  899

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+S+GWEK
Sbjct  900   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSEGWEK  959

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             QKS+FL +P+GR  +  SDTRVQFHQDQ+HFLVVHETQLAIYE  KLE VKQWV     A
Sbjct  960   QKSRFLQIPSGRTPTALSDTRVQFHQDQVHFLVVHETQLAIYETMKLEIVKQWV--STTA  1017

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDSQLVYASFLDATVC+F+AANL LRC I  S+   P   SS V+PLVVAAH
Sbjct  1018  PISHATFSCDSQLVYASFLDATVCIFSAANLRLRCHI-NSSAYLPVNVSSNVYPLVVAAH  1076

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             P +PNQFA+GL+DGGV VFEPLESEGKWG+PPPVENGS S+
Sbjct  1077  PSEPNQFAMGLTDGGVHVFEPLESEGKWGIPPPVENGSASS  1117



>ref|XP_010250289.1| PREDICTED: protein TOPLESS-like isoform X3 [Nelumbo nucifera]
Length=1135

 Score =  1854 bits (4802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1122 (84%), Positives = 1019/1122 (91%), Gaps = 9/1122 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKVGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIP--AALKHPRTPPTN-PSVDYPS  2823
             P P  VPT LAGWMSN  TV+HPAVSGGPIGL   + P  A LKHPRTPPTN P+VDY S
Sbjct  241   PTPAPVPTPLAGWMSNPSTVTHPAVSGGPIGLGAPTNPGTAILKHPRTPPTNNPAVDYSS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             GD DHVSKR R +G+SDEVNLP+N+LPV++PG  HSQA +  DDLPK VARTL QGS PM
Sbjct  301   GDPDHVSKRTRPIGLSDEVNLPVNILPVTYPGQSHSQAFNIPDDLPKTVARTLTQGSCPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LWEVGSRE+L  RNFKVWDL ACSMPLQ ALVKDP VS
Sbjct  361   SMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLAFRNFKVWDLGACSMPLQAALVKDPSVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDGSLFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRIIWSPDGSLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYDAPGHWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGLPASPRIRFNK+GTLLAVS
Sbjct  601   MGVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLPASPRIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVA  1566
             AN+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ IS V +AS AG A+R A
Sbjct  661   ANDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQISAVTAASAAGHADRGA  720

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
              VV  + MNGDAR ++GDVKPRITE+ +DKSK+WKLTEI+E   CR+L+LP+NLR  KIS
Sbjct  721   PVVSITGMNGDAR-SLGDVKPRITEDASDKSKIWKLTEISEQVQCRSLRLPDNLRTNKIS  779

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++ PQLWQP+SGILMTND+AD 
Sbjct  780   RLIYTNSGTAILALASNAIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIADT  839

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  840   NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  899

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+S+GWE
Sbjct  900   AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSEGWE  959

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS+FL +P+GR  +  SDTRVQFHQDQ+HFLVVHETQLAIYE  KLE VKQWV     
Sbjct  960   KQKSRFLQIPSGRTPTALSDTRVQFHQDQVHFLVVHETQLAIYETMKLEIVKQWV--STT  1017

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHATFSCDSQLVYASFLDATVC+F+AANL LRC I  S+   P   SS V+PLVVAA
Sbjct  1018  APISHATFSCDSQLVYASFLDATVCIFSAANLRLRCHI-NSSAYLPVNVSSNVYPLVVAA  1076

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             HP +PNQFA+GL+DGGV VFEPLESEGKWG+PPPVENGS S+
Sbjct  1077  HPSEPNQFAMGLTDGGVHVFEPLESEGKWGIPPPVENGSASS  1118



>ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [Cicer arietinum]
Length=1150

 Score =  1853 bits (4801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 960/1152 (83%), Positives = 1038/1152 (90%), Gaps = 27/1152 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANIPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLS-----VSSIPAALKHPRTPPTNPSVDY  2829
             P P  VP  LAGWMSN  TV+H +VSGG            SIPAALKHPRTPPTNPSVDY
Sbjct  241   PTPAPVPMPLAGWMSNPTTVAHASVSGGGAIGLGVGIGAPSIPAALKHPRTPPTNPSVDY  300

Query  2828  PSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSS  2649
             PSGDSDHVSKR R +G+SDE NLP+NVL  +FPGHGH QA ++ +DLPK V RTLNQGSS
Sbjct  301   PSGDSDHVSKRTRPIGMSDEANLPVNVLSATFPGHGHGQAFNSPEDLPKTVLRTLNQGSS  360

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
             P+SMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q ALVKDP 
Sbjct  361   PVSMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALVKDPA  420

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
             VSVN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQL
Sbjct  421   VSVNRVTWSPDGALFGVAYSRHIVQIYSYHGADEVRQHLEIDAHVGGVNDLAFSHPNKQL  480

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CVITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLY
Sbjct  481   CVITCGDDKTIKVWDAATGIKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLY  540

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DN+GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRK
Sbjct  541   DNLGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRK  600

Query  1928  -------------RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPAS  1788
                          RS GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPAS
Sbjct  601   RSLGVVQFDTTKNRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPAS  660

Query  1787  PRIRFNKDGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS  1608
             PRIRFNKDG+LLAVSANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP++NP+S
Sbjct  661   PRIRFNKDGSLLAVSANENGIKILANGDGIRLLRSLEN-SLYEASRTSEAMTKPTINPMS  719

Query  1607  V-ASASNAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHC  1431
             V  SA++A  AER +SV   + MNGDAR N+GD+KPRI+EE+NDKSK+WKLTEI EPS C
Sbjct  720   VATSATSAALAERASSVAAIAGMNGDAR-NLGDIKPRISEESNDKSKIWKLTEINEPSQC  778

Query  1430  RALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLW  1251
             R+LKLPEN+RVTKISRLIYTNSG+A+LAL SNAIHLLWKWQR +RNSSGKATA++PPQLW
Sbjct  779   RSLKLPENVRVTKISRLIYTNSGNAILALGSNAIHLLWKWQRNDRNSSGKATASVPPQLW  838

Query  1250  QPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmpppp  1071
             QPSSGILMTND+ D N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPP
Sbjct  839   QPSSGILMTNDINDSNTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPP  898

Query  1070  aatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSS  891
             AATFLAFHPQDNNIIAIGMDDS+IQIYNVR+DEV+SKLKGH+KRITGLAFSHVLNVLVSS
Sbjct  899   AATFLAFHPQDNNIIAIGMDDSSIQIYNVRIDEVRSKLKGHTKRITGLAFSHVLNVLVSS  958

Query  890   GADAQLFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEA  714
             GADAQ+ VW++DGWEKQK++FL  P GR    Q+DTRVQFHQDQ  FLVVHETQLAIYEA
Sbjct  959   GADAQICVWNTDGWEKQKTRFLQFPPGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEA  1018

Query  713   TKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsayls  534
             TKLEC+KQW  R++AAPISHATFSCDSQLV+ASFLDATVCVF+A+NL LRCRI PSAYLS
Sbjct  1019  TKLECLKQWFPRDSAAPISHATFSCDSQLVFASFLDATVCVFSASNLRLRCRINPSAYLS  1078

Query  533   pslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-  357
              ++SSS VH LV+AAHPQ+PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN   
Sbjct  1079  ANVSSSNVHSLVIAAHPQEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSTSNAVA  1138

Query  356   -PV---SDQPPR  333
              PV   SD+P R
Sbjct  1139  APVGASSDEPQR  1150



>gb|KEH39609.1| topless-like protein [Medicago truncatula]
Length=1133

 Score =  1853 bits (4799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 941/1121 (84%), Positives = 1020/1121 (91%), Gaps = 7/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS---SIPAALKHPRTPPTNPSVDYPS  2823
             P P  VP  LAGWMSN   V+HP+VSGG          S+PAALKHPRTPPTNPSVDYPS
Sbjct  241   PTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSMPAALKHPRTPPTNPSVDYPS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             GDSDH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V RTLNQGSSPM
Sbjct  301   GDSDHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTVLRTLNQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q ALVKDP VS
Sbjct  361   SMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALVKDPAVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRVTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             ANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A+ +   ER +S
Sbjct  661   ANENGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATAATSAALERASS  719

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             V   + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKLPEN RVTKISR
Sbjct  720   VAAITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKLPENARVTKISR  778

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSGILMTND+ D N
Sbjct  779   LIYTNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSGILMTNDINDNN  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
              EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  839   TEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q+FVW++DGWEK
Sbjct  899   IGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQIFVWNTDGWEK  958

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             QK++FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC+KQW  R+AAA
Sbjct  959   QKNRFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLECLKQWFPRDAAA  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDS L++ASFLDAT+CVF+A+NL LRCRI   +    +  SS + PLV+AAH
Sbjct  1019  PISHATFSCDSNLIFASFLDATICVFSASNLRLRCRI-NPSAYLSANVSSNIQPLVIAAH  1077

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             P +PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN
Sbjct  1078  PHEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASN  1118



>ref|XP_010250288.1| PREDICTED: protein TOPLESS-like isoform X2 [Nelumbo nucifera]
Length=1136

 Score =  1852 bits (4797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1123 (84%), Positives = 1020/1123 (91%), Gaps = 10/1123 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKVGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  VPT LAGWMSN  TV+HPAVSGGPIGL   + PAA LKHPRTPPTN P+VDY SG
Sbjct  241   PTPAPVPTPLAGWMSNPSTVTHPAVSGGPIGLGAPTNPAAILKHPRTPPTNNPAVDYSSG  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             D DHVSKR R +G+SDEVNLP+N+LPV++PG  HSQA +  DDLPK VARTL QGS PMS
Sbjct  301   DPDHVSKRTRPIGLSDEVNLPVNILPVTYPGQSHSQAFNIPDDLPKTVARTLTQGSCPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQTLLLVGTNVGDI LWEVGSRE+L  RNFKVWDL ACSMPLQ ALVKDP VSV
Sbjct  361   MDFHPVQQTLLLVGTNVGDIGLWEVGSRERLAFRNFKVWDLGACSMPLQAALVKDPSVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDGSLFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  421   NRIIWSPDGSLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYDAPGHWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRSM  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGLPASPRIRFNK+GTLLAVSA
Sbjct  601   GVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLPASPRIRFNKEGTLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVAS  1563
             N+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ IS V +AS AG A+R A 
Sbjct  661   NDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQISAVTAASAAGHADRGAP  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK--I  1389
             VV  + MNGDAR ++GDVKPRITE+ +DKSK+WKLTEI+E   CR+L+LP+NLR  K  I
Sbjct  721   VVSITGMNGDAR-SLGDVKPRITEDASDKSKIWKLTEISEQVQCRSLRLPDNLRTNKPQI  779

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++ PQLWQP+SGILMTND+AD
Sbjct  780   SRLIYTNSGTAILALASNAIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIAD  839

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  840   TNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  899

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+S+GW
Sbjct  900   IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSEGW  959

Query  848   EKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQKS+FL +P+GR  +  SDTRVQFHQDQ+HFLVVHETQLAIYE  KLE VKQWV    
Sbjct  960   EKQKSRFLQIPSGRTPTALSDTRVQFHQDQVHFLVVHETQLAIYETMKLEIVKQWV--ST  1017

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
              APISHATFSCDSQLVYASFLDATVC+F+AANL LRC I  S+   P   SS V+PLVVA
Sbjct  1018  TAPISHATFSCDSQLVYASFLDATVCIFSAANLRLRCHI-NSSAYLPVNVSSNVYPLVVA  1076

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             AHP +PNQFA+GL+DGGV VFEPLESEGKWG+PPPVENGS S+
Sbjct  1077  AHPSEPNQFAMGLTDGGVHVFEPLESEGKWGIPPPVENGSASS  1119



>gb|EYU21684.1| hypothetical protein MIMGU_mgv1a000459mg [Erythranthe guttata]
Length=1138

 Score =  1852 bits (4797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1121 (84%), Positives = 1011/1121 (90%), Gaps = 13/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNW+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF+SFNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFASFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS-VPKPGGFPPLGAHGPF  2997
             WQHQLCKNPRPNPDIKTLFVDHSCGQ NGARAPSPANNPLLG  V KPGGFPPLGAH   
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQQNGARAPSPANNPLLGGPVQKPGGFPPLGAHPFQ  240

Query  2996  QPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIP------AALKHPRTPPTNPSV  2835
                       LAGWMSN PT +H AVSG P+GL   ++P      +ALKHPRTPPTN SV
Sbjct  241   PAPAPVP-APLAGWMSNPPTATHAAVSGAPLGLGGPAMPGREFNISALKHPRTPPTNASV  299

Query  2834  DYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQG  2655
             D+PSGDS+H SKR R LG++DEVNLP+NV+PVSFP H HSQ+ +  DDLPK V R LNQG
Sbjct  300   DFPSGDSEHASKRTRPLGLTDEVNLPVNVMPVSFPAHAHSQSFNAPDDLPKTVGRVLNQG  359

Query  2654  SSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKD  2475
             SSPMSMDFHP+QQTLLLVGTNVGDI LWEVGSRE+LV RNFKVWDLSAC+MPLQ  LVKD
Sbjct  360   SSPMSMDFHPIQQTLLLVGTNVGDIGLWEVGSRERLVQRNFKVWDLSACTMPLQAGLVKD  419

Query  2474  PGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  2295
             PGVSVN + WSPDGSLFGVAYSRH++QIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK
Sbjct  420   PGVSVNRVIWSPDGSLFGVAYSRHLIQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  479

Query  2294  QLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAW  2115
             QL VITCGDDK IKVWDAT G KQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAW
Sbjct  480   QLSVITCGDDKLIKVWDATTGTKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAW  539

Query  2114  LYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  1935
             LYDN+GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF
Sbjct  540   LYDNLGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  599

Query  1934  RKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTL  1755
             RKRS GVVQFDTTKNR+LAAGDDFSIKFWDMD+ Q+LTS +ADGGLPASPRIRFNKDG+L
Sbjct  600   RKRSLGVVQFDTTKNRFLAAGDDFSIKFWDMDNTQLLTSSEADGGLPASPRIRFNKDGSL  659

Query  1754  LAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAE  1575
             LA+SANENGIKVLAN DG+RLLRTFEN+     A  +  A+KP+VNPIS + AS+AG  +
Sbjct  660   LAISANENGIKVLANNDGLRLLRTFENI--AFDASRTSEAAKPTVNPISASVASSAGLTD  717

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             RV S VG S MNGD R N+GDVKPRI EETNDKSK+WKL+EI EPS CR+LKLPENLRVT
Sbjct  718   RVPSSVGISAMNGDTR-NLGDVKPRIIEETNDKSKIWKLSEINEPSQCRSLKLPENLRVT  776

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             KISRLIYTNSG+A+LALASNA+HLLWKWQR +RNS+GKATA + PQLWQPSSGILMTNDV
Sbjct  777   KISRLIYTNSGNAILALASNAVHLLWKWQRSDRNSNGKATATVSPQLWQPSSGILMTNDV  836

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             AD +PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  837   ADTSPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  896

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+SD
Sbjct  897   NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSD  956

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQKS+FL LP+GR+   QS+TRVQFHQDQ+HFLVVHETQLAIYE TKLECVKQW  R
Sbjct  957   GWEKQKSRFLQLPSGRSPGAQSETRVQFHQDQLHFLVVHETQLAIYETTKLECVKQWAPR  1016

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             E+ APISHATFSCDSQLVYASFLD+TVCVFTAA L LRCRI   +       SS VHPLV
Sbjct  1017  ESTAPISHATFSCDSQLVYASFLDSTVCVFTAAQLRLRCRI-NPSAYLSPNISSNVHPLV  1075

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             +AAHPQ+PNQFALGLSDG V VFEPLESEGKWG+ PPVENG
Sbjct  1076  IAAHPQEPNQFALGLSDGSVHVFEPLESEGKWGLTPPVENG  1116



>ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44865.1| WD-repeat protein, putative [Ricinus communis]
Length=1115

 Score =  1851 bits (4794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 950/1119 (85%), Positives = 1018/1119 (91%), Gaps = 23/1119 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIML                  FP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIML------------------FPNLKNSRLRTLINQSLN  162

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  163   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  222

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VP  LAGWMSN   V+HPAVSGG  IGL   SIPAALKHPRTPPTNPSVDYPSGD
Sbjct  223   PTPAPVPAPLAGWMSNPSAVTHPAVSGGGAIGLGAPSIPAALKHPRTPPTNPSVDYPSGD  282

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHV+KR R +GISDEVNLP+NVLPVSFPGHGH Q  +  DDLPK V+RTLNQGSSPMSM
Sbjct  283   SDHVAKRTRPMGISDEVNLPVNVLPVSFPGHGHGQNFNAPDDLPKTVSRTLNQGSSPMSM  342

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP++QTLLLVGTNVGD+ALWEVGSRE+L+LRNFKVWD+S CSMPLQ ALVKDPGVSVN
Sbjct  343   DFHPLEQTLLLVGTNVGDVALWEVGSRERLMLRNFKVWDISTCSMPLQAALVKDPGVSVN  402

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDGSLFGVAYSRHIVQIYSYH  DDVRQHLEIDAHVGGVNDLAFS PNKQLCVIT
Sbjct  403   RVIWSPDGSLFGVAYSRHIVQIYSYHRGDDVRQHLEIDAHVGGVNDLAFSTPNKQLCVIT  462

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  G +QYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  463   CGDDKTIKVWDAATGTRQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLG  522

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEG VKR+YQGFRKRS G
Sbjct  523   SRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGNVKRSYQGFRKRSLG  582

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD++Q+LTSIDADGGLPASPRIRFNKDG+LLAVSAN
Sbjct  583   VVQFDTTKNRFLAAGDDFSIKFWDMDNLQLLTSIDADGGLPASPRIRFNKDGSLLAVSAN  642

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVV  1557
             ENGIK+LAN+DG RLLRTFENL    A+RASE+ +KP +NPIS A+A++AG A+R ASVV
Sbjct  643   ENGIKILANSDGHRLLRTFENL-SYDASRASEAVTKPIINPISAAAATSAGLADRTASVV  701

Query  1556  GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLI  1377
                 MNGDAR N+GDVKPRITEE+NDKSK+WKLTEI EP+ CR+L+LP+NLRV KISRLI
Sbjct  702   TIPGMNGDAR-NMGDVKPRITEESNDKSKIWKLTEINEPTQCRSLRLPDNLRVNKISRLI  760

Query  1376  YTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPE  1197
             YTNSG+A+LALASNAIHLLWKWQR ERNS+GKATAN+ PQLWQPSSGILMTND+ D NPE
Sbjct  761   YTNSGNAILALASNAIHLLWKWQRSERNSTGKATANVSPQLWQPSSGILMTNDITDTNPE  820

Query  1196  DAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIG  1017
             +AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG
Sbjct  821   EAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG  880

Query  1016  MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQK  837
             MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+SDGWEKQK
Sbjct  881   MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSDGWEKQK  940

Query  836   SKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPI  660
             ++FL +P GR +  QSDTRVQFHQDQI FLVVHETQLAIYEATKLEC KQWV RE++API
Sbjct  941   TRFLQVPPGRTTTGQSDTRVQFHQDQIQFLVVHETQLAIYEATKLECTKQWVTRESSAPI  1000

Query  659   SHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQ  480
             SHATFSCDSQLVYASFLDATVCVF+A NL LRCRI   +    +  SS +HPLV+AAHPQ
Sbjct  1001  SHATFSCDSQLVYASFLDATVCVFSAQNLRLRCRI-NPSSYLSANVSSSLHPLVIAAHPQ  1059

Query  479   DPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             +PNQFALGLSDGGV VFEPLESEGKWGVPPP ENGS S+
Sbjct  1060  EPNQFALGLSDGGVHVFEPLESEGKWGVPPPAENGSASS  1098



>ref|XP_010244894.1| PREDICTED: topless-related protein 1-like isoform X4 [Nelumbo 
nucifera]
Length=1135

 Score =  1850 bits (4791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 942/1122 (84%), Positives = 1017/1122 (91%), Gaps = 9/1122 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKAGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             PAP  VPT LAGWMSN   V+HPAVSGGPIGL   + PAA LKHPRTPPTN P+VDY SG
Sbjct  241   PAPAPVPTPLAGWMSNPSNVTHPAVSGGPIGLGAPTNPAAILKHPRTPPTNNPAVDYSSG  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             D DHVSKR R +GISDEVNLP+N+LPV++PG  HSQA +T DDLPK VARTL QGS PMS
Sbjct  301   DPDHVSKRTRPMGISDEVNLPVNILPVTYPGQSHSQAFNTPDDLPKTVARTLTQGSCPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQTLLLVGTNVGDI LWE+GSRE+LVLRNFKVWDL ACSMPLQ ALVKDPGVSV
Sbjct  361   MDFHPVQQTLLLVGTNVGDIGLWEIGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N ITWSPDG LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  421   NRITWSPDGCLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  GAKQYTFEGH+APV+SVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAATGAKQYTFEGHDAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APG WCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYEAPGHWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFRKRSM  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGL ASPRIRFNK+GTLLAVS 
Sbjct  601   GVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLQASPRIRFNKEGTLLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVAS  1563
             N+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ I+ V +AS  G A+R AS
Sbjct  661   NDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQITAVTAASATGHADRGAS  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPE-NLRVTKIS  1386
             VV  + MNGDAR N+GDVKPRITE+ N+KSK+WKLTEI+E + CR+ +LP+ NLR  KIS
Sbjct  721   VVAITAMNGDAR-NLGDVKPRITEDVNEKSKIWKLTEISEQAQCRSSRLPDNNLRTNKIS  779

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG+A+LALASNAIHLLWKWQR ERNS+GKATA++ PQLWQPSSGILMTND+ D 
Sbjct  780   RLIYTNSGTAILALASNAIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVDT  839

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  840   NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  899

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDSTIQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQL VW+S+GWE
Sbjct  900   AIGMDDSTIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQLCVWNSEGWE  959

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS+FL +PAGR  +  SDTRVQFHQDQIHFLVVHETQLAIYE  KLE VKQWV     
Sbjct  960   KQKSRFLQIPAGRTPTALSDTRVQFHQDQIHFLVVHETQLAIYETIKLEIVKQWV--PTT  1017

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHATFSCDSQL+YASFLDATVC+F+A NL LRCRI       P   S  V+PLV+AA
Sbjct  1018  APISHATFSCDSQLIYASFLDATVCIFSATNLRLRCRI-NPTAYLPVNVSPNVYPLVIAA  1076

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             HP + NQFALGL+DGGV VFEPLESEGKWGVPPPVENGS S+
Sbjct  1077  HPSEANQFALGLTDGGVHVFEPLESEGKWGVPPPVENGSASS  1118



>ref|XP_010250287.1| PREDICTED: protein TOPLESS-like isoform X1 [Nelumbo nucifera]
Length=1137

 Score =  1850 bits (4791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1124 (84%), Positives = 1019/1124 (91%), Gaps = 11/1124 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKVGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIP--AALKHPRTPPTN-PSVDYPS  2823
             P P  VPT LAGWMSN  TV+HPAVSGGPIGL   + P  A LKHPRTPPTN P+VDY S
Sbjct  241   PTPAPVPTPLAGWMSNPSTVTHPAVSGGPIGLGAPTNPGTAILKHPRTPPTNNPAVDYSS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             GD DHVSKR R +G+SDEVNLP+N+LPV++PG  HSQA +  DDLPK VARTL QGS PM
Sbjct  301   GDPDHVSKRTRPIGLSDEVNLPVNILPVTYPGQSHSQAFNIPDDLPKTVARTLTQGSCPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LWEVGSRE+L  RNFKVWDL ACSMPLQ ALVKDP VS
Sbjct  361   SMDFHPVQQTLLLVGTNVGDIGLWEVGSRERLAFRNFKVWDLGACSMPLQAALVKDPSVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDGSLFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRIIWSPDGSLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYDAPGHWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGLPASPRIRFNK+GTLLAVS
Sbjct  601   MGVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLPASPRIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVA  1566
             AN+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ IS V +AS AG A+R A
Sbjct  661   ANDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQISAVTAASAAGHADRGA  720

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK--  1392
              VV  + MNGDAR ++GDVKPRITE+ +DKSK+WKLTEI+E   CR+L+LP+NLR  K  
Sbjct  721   PVVSITGMNGDAR-SLGDVKPRITEDASDKSKIWKLTEISEQVQCRSLRLPDNLRTNKPQ  779

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++ PQLWQP+SGILMTND+A
Sbjct  780   ISRLIYTNSGTAILALASNAIHLLWKWQRNERNTSGKATASVTPQLWQPTSGILMTNDIA  839

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  840   DTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  899

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL VW+S+G
Sbjct  900   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLCVWNSEG  959

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQKS+FL +P+GR  +  SDTRVQFHQDQ+HFLVVHETQLAIYE  KLE VKQWV   
Sbjct  960   WEKQKSRFLQIPSGRTPTALSDTRVQFHQDQVHFLVVHETQLAIYETMKLEIVKQWV--S  1017

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
               APISHATFSCDSQLVYASFLDATVC+F+AANL LRC I  S+   P   SS V+PLVV
Sbjct  1018  TTAPISHATFSCDSQLVYASFLDATVCIFSAANLRLRCHI-NSSAYLPVNVSSNVYPLVV  1076

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             AAHP +PNQFA+GL+DGGV VFEPLESEGKWG+PPPVENGS S+
Sbjct  1077  AAHPSEPNQFAMGLTDGGVHVFEPLESEGKWGIPPPVENGSASS  1120



>ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [Cicer arietinum]
Length=1149

 Score =  1849 bits (4790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 953/1152 (83%), Positives = 1031/1152 (89%), Gaps = 28/1152 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANIPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLS-----VSSIPAALKHPRTPPTNPSVDY  2829
             P P  VP  LAGWMSN  TV+H +VSGG            SIPAALKHPRTPPTNPSVDY
Sbjct  241   PTPAPVPMPLAGWMSNPTTVAHASVSGGGAIGLGVGIGAPSIPAALKHPRTPPTNPSVDY  300

Query  2828  PSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSS  2649
             PSGDSDHVSKR R +G+SDE NLP+NVL  +FPGHGH QA ++ +DLPK V RTLNQGSS
Sbjct  301   PSGDSDHVSKRTRPIGMSDEANLPVNVLSATFPGHGHGQAFNSPEDLPKTVLRTLNQGSS  360

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
             P+SMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q ALVKDP 
Sbjct  361   PVSMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALVKDPA  420

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
             VSVN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQL
Sbjct  421   VSVNRVTWSPDGALFGVAYSRHIVQIYSYHGADEVRQHLEIDAHVGGVNDLAFSHPNKQL  480

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CVITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLY
Sbjct  481   CVITCGDDKTIKVWDAATGIKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLY  540

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DN+GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRK
Sbjct  541   DNLGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRK  600

Query  1928  -------------RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPAS  1788
                          RS GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPAS
Sbjct  601   RSLGVVQFDTTKNRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPAS  660

Query  1787  PRIRFNKDGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS  1608
             PRIRFNKDG+LLAVSANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP++NP+S
Sbjct  661   PRIRFNKDGSLLAVSANENGIKILANGDGIRLLRSLEN-SLYEASRTSEAMTKPTINPMS  719

Query  1607  V-ASASNAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHC  1431
             V  SA++A  AER +SV   + MNGDAR N+GD+KPRI+EE+NDKSK+WKLTEI EPS C
Sbjct  720   VATSATSAALAERASSVAAIAGMNGDAR-NLGDIKPRISEESNDKSKIWKLTEINEPSQC  778

Query  1430  RALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLW  1251
             R+LKLPEN+RVTKISRLIYTNSG+A+LAL SNAIHLLWKWQR +RNSSGKATA++PPQLW
Sbjct  779   RSLKLPENVRVTKISRLIYTNSGNAILALGSNAIHLLWKWQRNDRNSSGKATASVPPQLW  838

Query  1250  QPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmpppp  1071
             QPSSGILMTND+ D N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPP
Sbjct  839   QPSSGILMTNDINDSNTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPP  898

Query  1070  aatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSS  891
             AATFLAFHPQDNNIIAIGMDDS+IQIYNVR+DEV+SKLKGH+KRITGLAFSHVLNVLVSS
Sbjct  899   AATFLAFHPQDNNIIAIGMDDSSIQIYNVRIDEVRSKLKGHTKRITGLAFSHVLNVLVSS  958

Query  890   GADAQLFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEA  714
             GADAQ+ VW++DGWEKQK++FL  P GR    Q+DTRVQFHQDQ  FLVVHETQLAIYEA
Sbjct  959   GADAQICVWNTDGWEKQKTRFLQFPPGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEA  1018

Query  713   TKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsayls  534
             TKLEC+KQW  R++AAPISHATFSCDSQLV+ASFLDATVCVF+A+NL LRCRI   +   
Sbjct  1019  TKLECLKQWFPRDSAAPISHATFSCDSQLVFASFLDATVCVFSASNLRLRCRI-NPSAYL  1077

Query  533   pslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-  357
              +  SS VH LV+AAHPQ+PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN   
Sbjct  1078  SANVSSNVHSLVIAAHPQEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSTSNAVA  1137

Query  356   -PV---SDQPPR  333
              PV   SD+P R
Sbjct  1138  APVGASSDEPQR  1149



>ref|XP_010244893.1| PREDICTED: topless-related protein 1-like isoform X3 [Nelumbo 
nucifera]
Length=1136

 Score =  1847 bits (4783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 941/1123 (84%), Positives = 1016/1123 (90%), Gaps = 10/1123 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKAGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIP--AALKHPRTPPTN-PSVDYPS  2823
             PAP  VPT LAGWMSN   V+HPAVSGGPIGL   + P  A LKHPRTPPTN P+VDY S
Sbjct  241   PAPAPVPTPLAGWMSNPSNVTHPAVSGGPIGLGAPTNPGTAILKHPRTPPTNNPAVDYSS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             GD DHVSKR R +GISDEVNLP+N+LPV++PG  HSQA +T DDLPK VARTL QGS PM
Sbjct  301   GDPDHVSKRTRPMGISDEVNLPVNILPVTYPGQSHSQAFNTPDDLPKTVARTLTQGSCPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LWE+GSRE+LVLRNFKVWDL ACSMPLQ ALVKDPGVS
Sbjct  361   SMDFHPVQQTLLLVGTNVGDIGLWEIGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN ITWSPDG LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRITWSPDGCLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  GAKQYTFEGH+APV+SVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGAKQYTFEGHDAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDY+APG WCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYEAPGHWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGL ASPRIRFNK+GTLLAVS
Sbjct  601   MGVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLQASPRIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVA  1566
              N+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ I+ V +AS  G A+R A
Sbjct  661   TNDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQITAVTAASATGHADRGA  720

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPE-NLRVTKI  1389
             SVV  + MNGDAR N+GDVKPRITE+ N+KSK+WKLTEI+E + CR+ +LP+ NLR  KI
Sbjct  721   SVVAITAMNGDAR-NLGDVKPRITEDVNEKSKIWKLTEISEQAQCRSSRLPDNNLRTNKI  779

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG+A+LALASNAIHLLWKWQR ERNS+GKATA++ PQLWQPSSGILMTND+ D
Sbjct  780   SRLIYTNSGTAILALASNAIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVD  839

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  840   TNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  899

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDSTIQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQL VW+S+GW
Sbjct  900   IAIGMDDSTIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQLCVWNSEGW  959

Query  848   EKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQKS+FL +PAGR  +  SDTRVQFHQDQIHFLVVHETQLAIYE  KLE VKQWV    
Sbjct  960   EKQKSRFLQIPAGRTPTALSDTRVQFHQDQIHFLVVHETQLAIYETIKLEIVKQWV--PT  1017

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
              APISHATFSCDSQL+YASFLDATVC+F+A NL LRCRI       P   S  V+PLV+A
Sbjct  1018  TAPISHATFSCDSQLIYASFLDATVCIFSATNLRLRCRI-NPTAYLPVNVSPNVYPLVIA  1076

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN  363
             AHP + NQFALGL+DGGV VFEPLESEGKWGVPPPVENGS S+
Sbjct  1077  AHPSEANQFALGLTDGGVHVFEPLESEGKWGVPPPVENGSASS  1119



>ref|XP_010244892.1| PREDICTED: topless-related protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=1161

 Score =  1840 bits (4767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 944/1147 (82%), Positives = 1020/1147 (89%), Gaps = 33/1147 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKAGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             PAP  VPT LAGWMSN   V+HPAVSGGPIGL   + PAA LKHPRTPPTN P+VDY SG
Sbjct  241   PAPAPVPTPLAGWMSNPSNVTHPAVSGGPIGLGAPTNPAAILKHPRTPPTNNPAVDYSSG  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             D DHVSKR R +GISDEVNLP+N+LPV++PG  HSQA +T DDLPK VARTL QGS PMS
Sbjct  301   DPDHVSKRTRPMGISDEVNLPVNILPVTYPGQSHSQAFNTPDDLPKTVARTLTQGSCPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQTLLLVGTNVGDI LWE+GSRE+LVLRNFKVWDL ACSMPLQ ALVKDPGVSV
Sbjct  361   MDFHPVQQTLLLVGTNVGDIGLWEIGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N ITWSPDG LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  421   NRITWSPDGCLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  GAKQYTFEGH+APV+SVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAATGAKQYTFEGHDAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APG WCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYEAPGHWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFRKRSM  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGL ASPRIRFNK+GTLLAVS 
Sbjct  601   GVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLQASPRIRFNKEGTLLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVAS  1563
             N+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ I+ V +AS  G A+R AS
Sbjct  661   NDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQITAVTAASATGHADRGAS  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPE-NLRVTKIS  1386
             VV  + MNGDAR N+GDVKPRITE+ N+KSK+WKLTEI+E + CR+ +LP+ NLR  KIS
Sbjct  721   VVAITAMNGDAR-NLGDVKPRITEDVNEKSKIWKLTEISEQAQCRSSRLPDNNLRTNKIS  779

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG+A+LALASNAIHLLWKWQR ERNS+GKATA++ PQLWQPSSGILMTND+ D 
Sbjct  780   RLIYTNSGTAILALASNAIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVDT  839

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  840   NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  899

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDSTIQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQL VW+S+GWE
Sbjct  900   AIGMDDSTIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQLCVWNSEGWE  959

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS+FL +PAGR  +  SDTRVQFHQDQIHFLVVHETQLAIYE  KLE VKQWV     
Sbjct  960   KQKSRFLQIPAGRTPTALSDTRVQFHQDQIHFLVVHETQLAIYETIKLEIVKQWV--PTT  1017

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCR-----------------------  558
             APISHATFSCDSQL+YASFLDATVC+F+A NL LRCR                       
Sbjct  1018  APISHATFSCDSQLIYASFLDATVCIFSATNLRLRCRINPTAYLPVNVRGFCSKLEMQLG  1077

Query  557   --IapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPV  384
               I  +A LS    S  V+PLV+AAHP + NQFALGL+DGGV VFEPLESEGKWGVPPPV
Sbjct  1078  IFIMGNANLSAIKRSPNVYPLVIAAHPSEANQFALGLTDGGVHVFEPLESEGKWGVPPPV  1137

Query  383   ENGSGSN  363
             ENGS S+
Sbjct  1138  ENGSASS  1144



>ref|XP_010244887.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244888.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244889.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010244890.1| PREDICTED: topless-related protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=1162

 Score =  1838 bits (4761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 943/1148 (82%), Positives = 1019/1148 (89%), Gaps = 34/1148 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPANNPLLGSIPKAGGFPPLGGHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIP--AALKHPRTPPTN-PSVDYPS  2823
             PAP  VPT LAGWMSN   V+HPAVSGGPIGL   + P  A LKHPRTPPTN P+VDY S
Sbjct  241   PAPAPVPTPLAGWMSNPSNVTHPAVSGGPIGLGAPTNPGTAILKHPRTPPTNNPAVDYSS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             GD DHVSKR R +GISDEVNLP+N+LPV++PG  HSQA +T DDLPK VARTL QGS PM
Sbjct  301   GDPDHVSKRTRPMGISDEVNLPVNILPVTYPGQSHSQAFNTPDDLPKTVARTLTQGSCPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LWE+GSRE+LVLRNFKVWDL ACSMPLQ ALVKDPGVS
Sbjct  361   SMDFHPVQQTLLLVGTNVGDIGLWEIGSRERLVLRNFKVWDLGACSMPLQAALVKDPGVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN ITWSPDG LFGVAYSRHIVQIYSYHG DDVRQHLEIDAHVGGVNDLAFSHPNKQLCV
Sbjct  421   VNRITWSPDGCLFGVAYSRHIVQIYSYHGGDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  GAKQYTFEGH+APV+SVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGAKQYTFEGHDAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDY+APG WCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGFRKRS
Sbjct  541   LGSRVDYEAPGHWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFRKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NRYLAAGD+FSIKFWDMD+V +LT+IDADGGL ASPRIRFNK+GTLLAVS
Sbjct  601   MGVVQFDTTRNRYLAAGDEFSIKFWDMDNVNLLTTIDADGGLQASPRIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-VASASNAGFAERVA  1566
              N+NGIK+LAN DG+RLLRTFEN ++D     SE+ +KP+++ I+ V +AS  G A+R A
Sbjct  661   TNDNGIKILANADGLRLLRTFENRSFDGPRVVSETVTKPTISQITAVTAASATGHADRGA  720

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPE-NLRVTKI  1389
             SVV  + MNGDAR N+GDVKPRITE+ N+KSK+WKLTEI+E + CR+ +LP+ NLR  KI
Sbjct  721   SVVAITAMNGDAR-NLGDVKPRITEDVNEKSKIWKLTEISEQAQCRSSRLPDNNLRTNKI  779

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG+A+LALASNAIHLLWKWQR ERNS+GKATA++ PQLWQPSSGILMTND+ D
Sbjct  780   SRLIYTNSGTAILALASNAIHLLWKWQRNERNSTGKATASVAPQLWQPSSGILMTNDIVD  839

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  840   TNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  899

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDSTIQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQL VW+S+GW
Sbjct  900   IAIGMDDSTIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQLCVWNSEGW  959

Query  848   EKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQKS+FL +PAGR  +  SDTRVQFHQDQIHFLVVHETQLAIYE  KLE VKQWV    
Sbjct  960   EKQKSRFLQIPAGRTPTALSDTRVQFHQDQIHFLVVHETQLAIYETIKLEIVKQWV--PT  1017

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCR----------------------  558
              APISHATFSCDSQL+YASFLDATVC+F+A NL LRCR                      
Sbjct  1018  TAPISHATFSCDSQLIYASFLDATVCIFSATNLRLRCRINPTAYLPVNVRGFCSKLEMQL  1077

Query  557   ---IapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPP  387
                I  +A LS    S  V+PLV+AAHP + NQFALGL+DGGV VFEPLESEGKWGVPPP
Sbjct  1078  GIFIMGNANLSAIKRSPNVYPLVIAAHPSEANQFALGLTDGGVHVFEPLESEGKWGVPPP  1137

Query  386   VENGSGSN  363
             VENGS S+
Sbjct  1138  VENGSASS  1145



>gb|KHN22427.1| Topless-related protein 1 [Glycine soja]
Length=1128

 Score =  1835 bits (4754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 938/1127 (83%), Positives = 1014/1127 (90%), Gaps = 14/1127 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFE+ KQKYLEALDK DRSKAVEIL KDLKVF++FN+ELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEVMKQKYLEALDKHDRSKAVEILVKDLKVFATFNDELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKY DTKSARAIMLVELKKLIEANPLF DKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYCDTKSARAIMLVELKKLIEANPLFHDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQ NGA APSPANN LLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQLNGAPAPSPANNLLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P+P  VPT LAGWMSN  TV+HP VSGG IGL V SIPAALKHPRTPPTNPSV YPSGDS
Sbjct  241   PSPAPVPTPLAGWMSNPTTVAHPEVSGGAIGLGVPSIPAALKHPRTPPTNPSVAYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS--QAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +G+SDEVNLP+NVL  +FPGHGH   QA +  DDLPK   RTLNQGSSPMS
Sbjct  301   DHVSKRTRPMGMSDEVNLPVNVLSATFPGHGHGHGQAFNAPDDLPKTAMRTLNQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQTLLLVGTNVGDIALWEVGSRE+L++RNFKVWDLSACSMP Q ALVKDPGVSV
Sbjct  361   MDFHPVQQTLLLVGTNVGDIALWEVGSRERLLMRNFKVWDLSACSMPFQAALVKDPGVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
               + WSPDG+LFGVAYSRHIVQIYSYH  DDV+QHLEIDAHVGGVNDLAFSHPNKQLCVI
Sbjct  421   YRVIWSPDGALFGVAYSRHIVQIYSYHSGDDVQQHLEIDAHVGGVNDLAFSHPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKD ES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDAESSIVEWNESEGAVKRTYQGFRKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             G VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLP SPRIRFNKDG LLAVSA
Sbjct  601   GFVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPGSPRIRFNKDGALLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAERVA  1566
              ENGIK+LAN DGIRLLRT EN +    +R SE  +KP++NPI  + A+A++A   ER  
Sbjct  661   KENGIKILANADGIRLLRTLEN-SLYDTSRTSEVMTKPTINPISAAAAAATSAALGERAL  719

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             SV      NGDAR N+GDVKPRI+EE+ DKSK+WKLTEI EPS CR+LKLPEN+RV KIS
Sbjct  720   SV------NGDAR-NLGDVKPRISEESIDKSKIWKLTEINEPSQCRSLKLPENVRVNKIS  772

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG+A+LALASNAIHLLWKWQR +RNS+ KA+A++ PQLWQPSSGILMTND+ D 
Sbjct  773   RLIYTNSGNAILALASNAIHLLWKWQRNDRNSTVKASASVQPQLWQPSSGILMTNDITDS  832

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAA FLAFHPQDNNII
Sbjct  833   NTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAANFLAFHPQDNNII  892

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGWE
Sbjct  893   AIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGWE  952

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS+FL LPAGR    Q+DTRVQFHQDQI FLVVHETQLAIYEATKLEC+KQW  R+++
Sbjct  953   KQKSRFLQLPAGRTPPAQADTRVQFHQDQIRFLVVHETQLAIYEATKLECLKQWFPRDSS  1012

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHATFSCDSQL+YASFLDATVCVF+ +NL L+CRI   +    +  SS V PLV+AA
Sbjct  1013  APISHATFSCDSQLIYASFLDATVCVFSVSNLRLQCRI-NPSAYLSASVSSNVQPLVIAA  1071

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             HPQ+PNQFA+GLSDGGV VFEPLESEGKWGVPPP+ENGS SN    S
Sbjct  1072  HPQEPNQFAVGLSDGGVHVFEPLESEGKWGVPPPIENGSTSNMAATS  1118



>ref|XP_006595172.1| PREDICTED: protein TOPLESS-like isoform X3 [Glycine max]
Length=1110

 Score =  1833 bits (4747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 935/1125 (83%), Positives = 1010/1125 (90%), Gaps = 28/1125 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VPT LAGWMSN  TV+HPAVSGG IGL   SIP                      
Sbjct  241   PTPAPVPTPLAGWMSNPTTVAHPAVSGGAIGLGAPSIP----------------------  278

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DHVSKR R +G+SDEVNLP+NVL  +FPGHGH QA +  DDLPK   R+LNQGSSPMSMD
Sbjct  279   DHVSKRTRPIGMSDEVNLPVNVLSATFPGHGHGQAFNAPDDLPKTAMRSLNQGSSPMSMD  338

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNVGDIALWEVGSRE+L++RNFKVWDLSACSMP Q ALVKDPGVSVN 
Sbjct  339   FHPVQQTLLLVGTNVGDIALWEVGSRERLLMRNFKVWDLSACSMPFQAALVKDPGVSVNR  398

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDG+LFGVAYSRHIVQIYSYHG DDV QHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  399   VIWSPDGALFGVAYSRHIVQIYSYHGGDDVGQHLEIDAHVGGVNDLAFSHPNKQLCVITC  458

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  GAKQYTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  459   GDDKTIKVWDAATGAKQYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNLGS  518

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  519   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKEGESSIVEWNESEGAVKRTYQGFRKRSLGV  578

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNKDG LLAVSANE
Sbjct  579   VQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKDGALLAVSANE  638

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAERVASV  1560
             NGIK+LAN DGIRLLRT EN +    +R SE+ +KP++NPI  + A+A++A  AER +SV
Sbjct  639   NGIKILANADGIRLLRTLEN-SLYDTSRTSEAMTKPTINPISAAAAAATSAALAERASSV  697

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V  + MNGDAR N+GDVKPRI+EE+NDKSK+WKLTEI EPS CR+LKLPEN+RV KISRL
Sbjct  698   VAITAMNGDAR-NLGDVKPRISEESNDKSKIWKLTEINEPSQCRSLKLPENVRVNKISRL  756

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             IYTNSG+A+LALASNAIHLLWKWQR +RNS+GKATA++ PQLWQPSSGILMTND+ D N 
Sbjct  757   IYTNSGNAILALASNAIHLLWKWQRNDRNSTGKATASVQPQLWQPSSGILMTNDITDNNT  816

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAI
Sbjct  817   EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAI  876

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGWEKQ
Sbjct  877   GMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGWEKQ  936

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KS+FL LPAGR    Q+DTRVQFHQDQI FLVVHETQLAIYEATKLEC+KQW  R+++AP
Sbjct  937   KSRFLQLPAGRTPPAQADTRVQFHQDQIRFLVVHETQLAIYEATKLECLKQWFPRDSSAP  996

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             ISHATFSCDSQL+YASFLDATVCV + +NL LRCRI   +    +  SS V PLV+AAHP
Sbjct  997   ISHATFSCDSQLIYASFLDATVCVLSVSNLRLRCRI-NPSAYLSASVSSNVQPLVIAAHP  1055

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             Q+PNQFA+GLSDGGV VFEP ESEGKWGVPPP+ENGS SN    S
Sbjct  1056  QEPNQFAVGLSDGGVHVFEPHESEGKWGVPPPIENGSTSNMAATS  1100



>ref|XP_010497362.1| PREDICTED: protein TOPLESS [Camelina sativa]
Length=1132

 Score =  1829 bits (4738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 932/1138 (82%), Positives = 1017/1138 (89%), Gaps = 17/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS G I L   SIPAALKHPRTPPTN ++DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNAALDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGH---SQAHSTLDDLPKNVARTLNQGSSPM  2643
             +HVSKR R +GI+DEVNL +N+LP+SFPG GH   S A    DDLPK VARTL+QGSSPM
Sbjct  301   EHVSKRTRPMGITDEVNLGVNMLPMSFPGQGHGHTSAAFKAPDDLPKTVARTLSQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VS
Sbjct  361   SMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCV
Sbjct  421   VNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS
Sbjct  541   MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDD+SIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDYSIKFWDMDTVQLLTAIDGDGGLQASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             ANEN IKV+AN+DG+RLL TFEN+     +  S   +  S+   + A+A++AG A+R A+
Sbjct  661   ANENVIKVMANSDGLRLLHTFENI-----SSESSKPAINSIAAAAAAAATSAGHADRSAN  715

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISR
Sbjct  716   VVSIQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISR  774

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LI+TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTNDVA+ N
Sbjct  775   LIFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETN  834

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIA
Sbjct  835   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIA  894

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  895   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  954

Query  842   QKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+SK LPLP GR S   SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE+ A
Sbjct  955   QRSKVLPLPQGRPSTALSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLA  1014

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HATFSCDSQLVYASF+DATVCVF++ANL LRCRI PSAYL  SLS+S VHPLV+AAH
Sbjct  1015  PITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRINPSAYLPASLSNSNVHPLVIAAH  1074

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-------PVSDQPPR  333
             PQ+PN FA+GLSDGGV +F+PLESEGKWGV PP ENGS S          P SDQP R
Sbjct  1075  PQEPNMFAVGLSDGGVHIFDPLESEGKWGVAPPAENGSASGAVTASSAGAPASDQPQR  1132



>ref|XP_010476664.1| PREDICTED: protein TOPLESS-like [Camelina sativa]
 ref|XP_010476666.1| PREDICTED: protein TOPLESS-like [Camelina sativa]
Length=1132

 Score =  1827 bits (4732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 931/1138 (82%), Positives = 1019/1138 (90%), Gaps = 17/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS G I L   SIPAALKHPRTPPTN ++DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNAALDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQA-HSTLDDLPKNVARTLNQGSSPM  2643
             +HVSKR R +GI+DEVNL +N+LP+SFPG  HGH+QA     DDLPK VARTL+QGSSPM
Sbjct  301   EHVSKRTRPMGITDEVNLGVNMLPMSFPGQGHGHTQAAFKAPDDLPKTVARTLSQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VS
Sbjct  361   SMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPLVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCV
Sbjct  421   VNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS
Sbjct  541   MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDD+SIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDYSIKFWDMDTVQLLTAIDGDGGLQASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             ANEN IKV+AN+DG+RLL TFEN+     +  S   +  S+   + A+A++AG A+R A+
Sbjct  661   ANENVIKVMANSDGLRLLHTFENI-----SSESSKPAINSIAAAAAAAATSAGLADRSAN  715

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISR
Sbjct  716   VVSIQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISR  774

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LI+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDVA+ N
Sbjct  775   LIFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETN  834

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIA
Sbjct  835   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIA  894

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  895   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  954

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+SK LPLP GR  S  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE+ A
Sbjct  955   QRSKVLPLPQGRPNSASSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLA  1014

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HATFSCDSQLVYASF+DATVCVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAH
Sbjct  1015  PITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAH  1074

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-------PVSDQPPR  333
             PQ+PN FA+GLSDGGV +F+PLESEGKWGV PP ENGS S          P SDQP R
Sbjct  1075  PQEPNMFAVGLSDGGVHIFDPLESEGKWGVAPPAENGSASGAVTASSAGAPASDQPQR  1132



>ref|XP_006369294.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|ERP65863.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1153

 Score =  1827 bits (4732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 957/1142 (84%), Positives = 1020/1142 (89%), Gaps = 31/1142 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRS AVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSMAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRSNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             PAP  VP  LAGWMS   TV+H AVSGG  IGL   SIPAALKHPRTPPTN SVDYPSGD
Sbjct  241   PAPAPVPAPLAGWMSTPSTVTHSAVSGGGAIGLGAPSIPAALKHPRTPPTNLSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS----QAHSTLDDLPKNVARTLNQGSS  2649
             SDHV+KR R +GISDEVNLP+NVLPVSFPGHGH     QA +  DDLPK VARTLNQGSS
Sbjct  301   SDHVAKRVRPMGISDEVNLPVNVLPVSFPGHGHGHGHGQAFNAPDDLPKVVARTLNQGSS  360

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
             PMSMDFHP+Q TLLLVGTNVGDI LWEVGSRE+LVLR FKVWDL+ACSMPLQ AL KDPG
Sbjct  361   PMSMDFHPLQLTLLLVGTNVGDIGLWEVGSRERLVLRIFKVWDLNACSMPLQAALAKDPG  420

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
             VSVN + WSPDGSLFGVAYSRHIVQIYSYHGND+VRQHLEIDAHVGGVNDLAFS PNKQL
Sbjct  421   VSVNRVIWSPDGSLFGVAYSRHIVQIYSYHGNDEVRQHLEIDAHVGGVNDLAFSTPNKQL  480

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CVITCGDDKTIKVWDA+ GAK YTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLY
Sbjct  481   CVITCGDDKTIKVWDASTGAKLYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLY  540

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DN+GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S IVEWNESEGAVKRTY GFRK
Sbjct  541   DNLGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSFIVEWNESEGAVKRTYLGFRK  600

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             +S+GVVQFDTTKNR+LAAGDDFSIKFWDMDSVQ+LT+IDADGGLPASPRIRFNKDGTLLA
Sbjct  601   QSWGVVQFDTTKNRFLAAGDDFSIKFWDMDSVQLLTTIDADGGLPASPRIRFNKDGTLLA  660

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERV  1569
             VSAN+NGIK+LANTDGIRLLRTFENL++DA+  +   A       +S +  + AG     
Sbjct  661   VSANDNGIKILANTDGIRLLRTFENLSFDASRTSESIAKVT----LSASVVAIAGMVRWT  716

Query  1568  ASVVGTS-------------------VMNGDARNNVGDVKPRITEETNDKSKVWKLTEIT  1446
                + +S                   ++NGDAR N+GDVKPR+TEE+NDKSK+WKLTEI 
Sbjct  717   CLFIYSSIRILCSSNLHINYPSITQLIINGDAR-NLGDVKPRLTEESNDKSKIWKLTEIN  775

Query  1445  EPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANM  1266
             EPS CR+L+LPENLRVTKISRLIYTNSG+A+LALASNAIHLLWKWQR +RN+SGKATA +
Sbjct  776   EPSQCRSLRLPENLRVTKISRLIYTNSGNAILALASNAIHLLWKWQRSDRNASGKATAGV  835

Query  1265  PPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttf  1086
              PQLWQPSSGILMTND  D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTF
Sbjct  836   SPQLWQPSSGILMTNDSTDTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTF  895

Query  1085  mppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLN  906
             MPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLN
Sbjct  896   MPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLN  955

Query  905   VLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQL  729
             +LVSSGADAQL VW+SDGWEKQK++FL +PAGR  + QSDTRVQFHQDQIHFLVVHETQL
Sbjct  956   MLVSSGADAQLCVWNSDGWEKQKARFLQVPAGRTPTAQSDTRVQFHQDQIHFLVVHETQL  1015

Query  728   AIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIap  549
             AIYE TKLECVKQWV RE++APISHA FSCDS LVYASFLDATVCVF+A NL LRCRI  
Sbjct  1016  AIYETTKLECVKQWVLRESSAPISHAVFSCDSHLVYASFLDATVCVFSAMNLRLRCRI-N  1074

Query  548   saylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG  369
                      SS VHPLV+AAHPQ+PNQFALGLSDGGV VFEPLESEGKWGVPPP ENGS 
Sbjct  1075  PCTYLSPNVSSNVHPLVIAAHPQEPNQFALGLSDGGVHVFEPLESEGKWGVPPPAENGSA  1134

Query  368   SN  363
             S+
Sbjct  1135  SS  1136



>ref|XP_006597113.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max]
 ref|XP_006597114.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max]
Length=1130

 Score =  1827 bits (4732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 939/1129 (83%), Positives = 1015/1129 (90%), Gaps = 16/1129 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFE+ KQKYLEALDK DRSKAVEIL KDLKVF++FN+ELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEVMKQKYLEALDKHDRSKAVEILVKDLKVFATFNDELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKY DTKSARAIMLVELKKLIEANPLF DKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYCDTKSARAIMLVELKKLIEANPLFHDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQ NGA APSPANN LLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQLNGAPAPSPANNLLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P+P  VPT LAGWMSN  TV+HP VSGG IGL V SIPAALKHPRTPPT PSVDYPSGDS
Sbjct  241   PSPAPVPTPLAGWMSNPTTVAHPEVSGGAIGLGVPSIPAALKHPRTPPTYPSVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS----QAHSTLDDLPKNVARTLNQGSSP  2646
             DHVSKR R +G+SDEVNLP+NVL  +FPGHGH     QA +  DDLPK   RTLNQGSSP
Sbjct  301   DHVSKRTRPMGMSDEVNLPVNVLSATFPGHGHGHGHGQAFNAPDDLPKTAMRTLNQGSSP  360

Query  2645  MSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGV  2466
             MSMDFHPVQQTLLLVGTNVGDIALWEVGSRE+L++RNFKVWDLSACSMP Q ALVKDPGV
Sbjct  361   MSMDFHPVQQTLLLVGTNVGDIALWEVGSRERLLMRNFKVWDLSACSMPFQAALVKDPGV  420

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             SV  + WSPDG+LFGVAYSRHIVQIYSYH  DDV+QHLEIDAHVGGVNDLAFSHPNKQLC
Sbjct  421   SVYRVIWSPDGALFGVAYSRHIVQIYSYHSGDDVQQHLEIDAHVGGVNDLAFSHPNKQLC  480

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             VITCGDDKTIKVWDA  GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYD
Sbjct  481   VITCGDDKTIKVWDAATGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYD  540

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             N+GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKD ES IVEWNESEGAVKRTYQGFRKR
Sbjct  541   NLGSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDAESSIVEWNESEGAVKRTYQGFRKR  600

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S G VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLP SPRIRFNKDG LLAV
Sbjct  601   SLGFVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPGSPRIRFNKDGALLAV  660

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAER  1572
             SA ENGIK+LAN DGIRLLRT EN +    +R SE  +KP++NPI  + A+A++A   ER
Sbjct  661   SAKENGIKILANADGIRLLRTLEN-SLYDTSRTSEVMTKPTINPISAAAAAATSAALGER  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
               SV      NGDAR N+GDVKPRI+EE+NDKSK+WKLTEI EPS CR+LKLPEN+RV K
Sbjct  720   ALSV------NGDAR-NLGDVKPRISEESNDKSKIWKLTEINEPSQCRSLKLPENVRVNK  772

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG+A+LALASNAIHLLWKWQR +RNS+ KA+A++ PQLWQPSSGILMTND+ 
Sbjct  773   ISRLIYTNSGNAILALASNAIHLLWKWQRNDRNSTVKASASVQPQLWQPSSGILMTNDIT  832

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAA FLAFHPQDNN
Sbjct  833   DSNTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAANFLAFHPQDNN  892

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DG
Sbjct  893   IIAIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDG  952

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQKS+FL LPAGR    Q+DTRVQFHQDQI FLVVHETQLAIYEATKLEC+KQW  R+
Sbjct  953   WEKQKSRFLQLPAGRTPPAQADTRVQFHQDQIRFLVVHETQLAIYEATKLECLKQWFPRD  1012

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++APISHATFSCDSQL+YASFLDATVCVF+ +NL L+CRI   +    +  SS V PLV+
Sbjct  1013  SSAPISHATFSCDSQLIYASFLDATVCVFSVSNLRLQCRI-NPSAYLSASVSSNVQPLVI  1071

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             AAHPQ+PNQFA+GLSDGGV VFEPLESEGKWGVPPP+ENGS SN    S
Sbjct  1072  AAHPQEPNQFAVGLSDGGVHVFEPLESEGKWGVPPPIENGSTSNMAATS  1120



>ref|NP_563981.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_849672.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031050.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031051.1| protein TOPLESS [Arabidopsis thaliana]
 sp|Q94AI7.1|TPL_ARATH RecName: Full=Protein TOPLESS; AltName: Full=WUS-interacting 
protein 1 [Arabidopsis thaliana]
 gb|AAK76687.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13188.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29356.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29357.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29358.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29359.1| protein TOPLESS [Arabidopsis thaliana]
Length=1131

 Score =  1826 bits (4730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 934/1137 (82%), Positives = 1018/1137 (90%), Gaps = 16/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS G I L   SIPAALKHPRTPPTN S+DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNASLDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP+SF G  HGHS A    DDLPK VARTL+QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVI
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS 
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSG  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IK++AN+DG+RLL TFEN+     +  S   +  S+   + A+A++AG A+R A+V
Sbjct  661   NENVIKIMANSDGLRLLHTFENI-----SSESSKPAINSIAAAAAAAATSAGHADRSANV  715

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISRL
Sbjct  716   VSIQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRL  774

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  775   IFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNP  834

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  835   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  894

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  895   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  954

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK LPLP GR  S  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE+ AP
Sbjct  955   RSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLAP  1014

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQLVYASF+DATVCVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1015  ITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1074

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG--SGSNTTP-----VSDQPPR  333
             Q+PN FA+GLSDGGV +FEPLESEGKWGV PP ENG  SG+ T P      SDQP R
Sbjct  1075  QEPNMFAVGLSDGGVHIFEPLESEGKWGVAPPAENGSASGAPTAPSVGASASDQPQR  1131



>ref|XP_010532341.1| PREDICTED: protein TOPLESS [Tarenaya hassleriana]
Length=1119

 Score =  1825 bits (4727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/1121 (83%), Positives = 1020/1121 (91%), Gaps = 16/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  TV HPAVSGG I L   SIPAALKHPRTPPTN SVDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSTVPHPAVSGGAIALGAPSIPAALKHPRTPPTNSSVDYPSGDS  300

Query  2813  DHVSKRPRSL-GISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DHVSKR R + GISDEVNL +N+LP++FPG  HGH+QA    DDLPK VAR+L+QGSSPM
Sbjct  301   DHVSKRTRPMMGISDEVNLGVNMLPMTFPGQAHGHTQAFKAPDDLPKTVARSLSQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPV+QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDL+ CSMPLQ ALVKDP VS
Sbjct  361   SMDFHPVKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLNKCSMPLQAALVKDPVVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + W+PDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV
Sbjct  421   VNRVIWNPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS
Sbjct  541   MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDDFS+KFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDFSVKFWDMDNIQLLTAIDADGGLQASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
             ANEN IK+L+N+DG+RLL TFEN++ +++  A            S+A++++AG A+R AS
Sbjct  661   ANENVIKILSNSDGLRLLHTFENISAESSKPAIS----------SIAASASAGLADRSAS  710

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV    MNG++RN V DVKP ITEE+NDKSK+WKLTEI EPS CR+L+LPENLRVTKISR
Sbjct  711   VVSIPGMNGESRNMV-DVKPVITEESNDKSKIWKLTEINEPSQCRSLRLPENLRVTKISR  769

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LI+TNSG+A+LALASNAIHLLWKWQR +RNS+GKATA++PP  WQP+SGILMTNDVA+ N
Sbjct  770   LIFTNSGNAILALASNAIHLLWKWQRNDRNSTGKATASVPPHQWQPASGILMTNDVAETN  829

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIA
Sbjct  830   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIA  889

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS++LNVLVSSGADAQ+ VW++DGWEK
Sbjct  890   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNILNVLVSSGADAQICVWNTDGWEK  949

Query  842   QKSKFLPLPAGR--ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             QKSK L LP GR  A+  SDTRVQFHQDQIHFLVVHETQLAIYE TKLEC+KQWV RE++
Sbjct  950   QKSKLLQLPQGRTAAASPSDTRVQFHQDQIHFLVVHETQLAIYETTKLECMKQWVVRESS  1009

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             API+HATFSCDSQL+YASF+DATVCVF ++NL LRCR+ PSAYL  +LS+S VHPLV+ A
Sbjct  1010  APITHATFSCDSQLIYASFMDATVCVFGSSNLRLRCRVNPSAYLPANLSNSNVHPLVITA  1069

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS  366
             HPQ+PN FA+GLSDGGV +FEPL+SEGKWGV PP ENGS S
Sbjct  1070  HPQEPNMFAVGLSDGGVHIFEPLDSEGKWGVAPPAENGSAS  1110



>ref|XP_004506964.1| PREDICTED: protein TOPLESS-like [Cicer arietinum]
Length=1134

 Score =  1820 bits (4715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 940/1128 (83%), Positives = 1021/1128 (91%), Gaps = 12/1128 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFE+EV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQ-PNGARAPSPANNPLLGSVPKPGGFPPLGAHGPF  2997
             WQHQLCKNPRPNPDIKTLFVDHSCGQ PNGARAPSPAN+PLLGS+PK GGFPPLGAHGPF
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQQPNGARAPSPANSPLLGSLPKAGGFPPLGAHGPF  240

Query  2996  QPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             QP P  VPT +AGWM N  T++H AVS        +    ALKHPRTPPTNPS DYPSGD
Sbjct  241   QPTPAPVPTPIAGWMPNPTTIAHAAVS-----GGGAIGLGALKHPRTPPTNPSADYPSGD  295

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHS--QAHSTLDDLP--KNVARTLNQGSS  2649
             SDHV+KR R +GI+DEVNLP+NVL  +F GHGH   Q+ +  DDLP  K V RTLNQGSS
Sbjct  296   SDHVAKRTRPMGITDEVNLPVNVLSPTFQGHGHGHGQSFNAPDDLPLPKTVMRTLNQGSS  355

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
             PMSMDFHPVQQ+LLLVGTNVGDIALWEVGSRE+LV RNFKVWDLSACSMP Q +LVK+P 
Sbjct  356   PMSMDFHPVQQSLLLVGTNVGDIALWEVGSRERLVSRNFKVWDLSACSMPFQASLVKEPS  415

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
             VSVN + WSPDG+LFGVAYSRHIVQIYSYHG  +VRQHLEIDAHVGGVNDLAFSHPNKQL
Sbjct  416   VSVNRVIWSPDGALFGVAYSRHIVQIYSYHGGYEVRQHLEIDAHVGGVNDLAFSHPNKQL  475

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CVITCGDDKTIKVWDA +GAKQYTFEGHEAPVYSVCPH+KE++QFIFSTALDGKIKAWLY
Sbjct  476   CVITCGDDKTIKVWDAASGAKQYTFEGHEAPVYSVCPHYKESIQFIFSTALDGKIKAWLY  535

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DN+GSRVDYDAPGRW TTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRK
Sbjct  536   DNLGSRVDYDAPGRWRTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRK  595

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             +S GVVQFDTTKNR+LAAGDDFSIKFWDMD++Q+LT++DADGGL ASPRIRFNKDGTLLA
Sbjct  596   QSLGVVQFDTTKNRFLAAGDDFSIKFWDMDNIQLLTTVDADGGLAASPRIRFNKDGTLLA  655

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERV  1569
             VS+N+NGIK+LAN DGIRLLRT EN  YDA+  +   A     +  S ++A++A  AER 
Sbjct  656   VSSNDNGIKILANADGIRLLRTLENSIYDASRASEALAKPTINSISSASAATSAALAERA  715

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
             +S    + MNGDAR N+GDVKPRI+EE+NDKSK+WKLTEI EPSHCR+LKLPEN+RV KI
Sbjct  716   SSAAAIAGMNGDAR-NMGDVKPRISEESNDKSKIWKLTEINEPSHCRSLKLPENVRVNKI  774

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG+A+LALASNAIHLLWKW R ERNSSGKA A++ PQLWQPSSGILMTND+AD
Sbjct  775   SRLIYTNSGNAILALASNAIHLLWKWPRNERNSSGKANASVQPQLWQPSSGILMTNDIAD  834

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPED+VPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  835   SNPEDSVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  894

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGADAQ+ VW++DGW
Sbjct  895   IAIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADAQICVWNTDGW  954

Query  848   EKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQK++FL LP GR  S QSDTRVQFHQDQI FLVVHETQLAI+EATKLEC+KQW  R++
Sbjct  955   EKQKTRFLQLPPGRTPSAQSDTRVQFHQDQIQFLVVHETQLAIFEATKLECLKQWFPRDS  1014

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
             +APISHATFSCDSQL+YASFLDATVCVF A+NL LRCRI+PSAYL  S+S+S V PLV+A
Sbjct  1015  SAPISHATFSCDSQLIYASFLDATVCVFNASNLRLRCRISPSAYLPSSVSNSNVQPLVIA  1074

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS  348
             AHPQ+PNQFA+GLSDGGV VFEPLESEGKWGVPPPVENGS SN   V+
Sbjct  1075  AHPQEPNQFAIGLSDGGVHVFEPLESEGKWGVPPPVENGSTSNNVAVA  1122



>ref|XP_006306622.1| hypothetical protein CARUB_v10008139mg [Capsella rubella]
 gb|EOA39520.1| hypothetical protein CARUB_v10008139mg [Capsella rubella]
Length=1131

 Score =  1820 bits (4713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 928/1137 (82%), Positives = 1013/1137 (89%), Gaps = 16/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGTHEPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS G I L   SIPAALKHPRTPPTN ++DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNAALDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP+SFPG  HGHS A    DDLPK VARTL QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMSFPGQGHGHSPAFKAPDDLPKKVARTLTQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNK LCVI
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKLLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID +GGL ASPRIRFNK+G+LLAVS 
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTVQLLTAIDGEGGLQASPRIRFNKEGSLLAVSG  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IKV+AN+DG+RLL TFEN+     +  S   +  S+   + A+A++AG A+R A+V
Sbjct  661   NENVIKVMANSDGLRLLHTFENI-----SSESSKPAINSIAAAAAAAATSAGLADRSANV  715

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISRL
Sbjct  716   VSIQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRL  774

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  775   IFTNSGNAILALASNAIHLLWKWQRNERNASGKATASLPPQQWQPASGILMTNDVAETNP  834

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  835   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  894

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  895   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  954

Query  839   KSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK LPLP G+ +   SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE+ AP
Sbjct  955   RSKVLPLPQGKQNTGASDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLAP  1014

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQLVYASF+DATVCVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1015  ITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1074

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-------PVSDQPPR  333
             Q+PN FA+GLSDGGV +F+PLESEGKWGV PP ENGS S          P SDQP R
Sbjct  1075  QEPNMFAVGLSDGGVHIFDPLESEGKWGVAPPAENGSASGAVAAPSVGAPASDQPQR  1131



>ref|XP_006416884.1| hypothetical protein EUTSA_v10006622mg [Eutrema salsugineum]
 gb|ESQ35237.1| hypothetical protein EUTSA_v10006622mg [Eutrema salsugineum]
Length=1132

 Score =  1817 bits (4707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 926/1138 (81%), Positives = 1014/1138 (89%), Gaps = 17/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARA SP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARASSPVNNPLLGGLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS G I L   SIPAALKHPRTPPTN  +DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNAGLDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG---HGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             +HVSKR R +GISDEVNL +N+LP+SFPG   HGHS A    DDLPK VARTL QGSSPM
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMSFPGQAAHGHSPAFKAPDDLPKTVARTLTQGSSPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VS
Sbjct  361   SMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCV
Sbjct  421   VNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS
Sbjct  541   MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDFSIKFWDMDTVQLLTAIDGDGGLQASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
              NEN IKV+AN+DG+RLL TFEN+     +  +   +  S+   + A+A++AG A+R A+
Sbjct  661   GNENVIKVMANSDGLRLLHTFENI-----SSETSKPAINSIAAAAAAAATSAGLADRSAN  715

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISR
Sbjct  716   VVSMQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISR  774

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LI+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTND A+ N
Sbjct  775   LIFTNSGNAILALASNAIHLLWKWQRNDRNTTGKATASLPPQQWQPASGILMTNDAAETN  834

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIA
Sbjct  835   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIA  894

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  895   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  954

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+SK LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++A
Sbjct  955   QRSKVLPLPQGRPNAAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSA  1014

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAH
Sbjct  1015  PITHATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAH  1074

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTP-------VSDQPPR  333
             PQ+PN FA+GLSDGGV +FEP+ESEGKWGV PP ENGS S            SDQP R
Sbjct  1075  PQEPNMFAVGLSDGGVHIFEPVESEGKWGVAPPAENGSASGAVAAPSVGASASDQPQR  1132



>ref|XP_002892877.1| wus-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69136.1| wus-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=1132

 Score =  1816 bits (4705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 930/1138 (82%), Positives = 1016/1138 (89%), Gaps = 17/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS G I L   SIPAALKHPRTPPTN ++DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNAALDYPSADS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP+SF G  HGH+ A    DDLPK VARTL+QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHTPAFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVI
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS 
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSG  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IK++AN+DG+RLL TFEN+     +  S   +  S+   + A+A++AG A+R A+V
Sbjct  661   NENVIKIMANSDGLRLLHTFENI-----SSESSKPAINSIAAAAAAAATSAGHADRSANV  715

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISRL
Sbjct  716   VSIQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRL  774

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN-  1203
             I+TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTNDVA+ N 
Sbjct  775   IFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNT  834

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
              E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIA
Sbjct  835   TEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIA  894

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  895   IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  954

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+SK LPLP GR  S  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE+ A
Sbjct  955   QRSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLA  1014

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HATFSCDSQLVYASF+DATVCVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAH
Sbjct  1015  PITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAH  1074

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG--SGSNTTP-----VSDQPPR  333
             PQ+PN FA+GLSDGGV +FEPLESE KWGV PP ENG  SG+ T P      SDQP R
Sbjct  1075  PQEPNMFAVGLSDGGVHIFEPLESESKWGVAPPAENGSASGAATAPSVGASASDQPQR  1132



>emb|CDX67950.1| BnaA07g19900D [Brassica napus]
Length=1124

 Score =  1815 bits (4702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/1137 (82%), Positives = 1022/1137 (90%), Gaps = 23/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDL+VFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLRVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+QVPT LAGWMS++ +V HPAVSGG I L   SI AALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSQVPTPLAGWMSSSSSVPHPAVSGGAIALGSPSIQAALKHPRTPPSNSAVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP++FPG  HGH+QA    DDLPK VARTL+QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMTFPGQAHGHTQAFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLC  
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCFT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+ANTDG+RLL T +NL        S  +SKP++N I+VA  +    AER ASV
Sbjct  661   NDNMIKVMANTDGLRLLHTVDNL--------SSESSKPAINNIAVAERA----AERPASV  708

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  709   VSIPGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVGEPSQCRSLRLPENMRVTKISRL  767

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDV + N 
Sbjct  768   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVTEANS  827

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  828   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  887

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  888   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  947

Query  839   KSKFLPLPAGRAS-VQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  948   RSKVLQVPQGRSTGALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1007

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DAT+CVFT+ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1008  ITHATFSCDSQLIYASFMDATICVFTSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1067

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS--NTTP-----VSDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S   +TP      SDQP R
Sbjct  1068  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSSSALASTPSVGASASDQPQR  1124



>ref|XP_006389802.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
 gb|ESQ27088.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
Length=1116

 Score =  1815 bits (4702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 921/1133 (81%), Positives = 1012/1133 (89%), Gaps = 23/1133 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI AALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGAPSIQAALKHPRTPPSNSAVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMTFPGQGHGHTQTFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++Q LLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQALLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+ANTDG+RLL T ENL+ ++                S  + +N   AER ASV
Sbjct  661   NDNMIKVMANTDGLRLLHTVENLSSES----------------SKPAINNIAVAERPASV  704

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  705   VSIPGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVGEPSQCRSLRLPENMRVTKISRL  763

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDV + NP
Sbjct  764   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVTETNP  823

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  824   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  883

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  884   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  943

Query  839   KSKFLPLPAGRAS-VQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  944   KSKVLQIPQGRSTGALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1003

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DAT+CVF++ANL LRCRI PSAYL  SLS+S VHPLV+AAHP
Sbjct  1004  ITHATFSCDSQLIYASFMDATICVFSSANLRLRCRINPSAYLPASLSNSNVHPLVIAAHP  1063

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS---NTTPVSDQPPR  333
             Q+ N  A+GLSDGGV +FEPLESEGKWGV PP ENGS S   +T   SDQP R
Sbjct  1064  QESNMLAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVASTPSASDQPQR  1116



>ref|XP_010472918.1| PREDICTED: topless-related protein 1 isoform X3 [Camelina sativa]
Length=1120

 Score =  1811 bits (4691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 928/1137 (82%), Positives = 1012/1137 (89%), Gaps = 27/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI AALKHPRTPPTN  VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGSPSIQAALKHPRTPPTNSGVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +G+SDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  301   DHVSKRTRPMGMSDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  421   NRVIWSPDGALFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+ Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTTQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL        S  +SKP++N I V        AER ASV
Sbjct  661   NDNIIKVVANSDGLRLLHTVENL--------SSESSKPAINSIPV--------AERPASV  704

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  705   VSIPGMNGDSRNMV-DVKPVITEEANDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRL  763

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  764   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETNP  823

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  824   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  883

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  884   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  943

Query  839   KSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  944   KSKVLQIPQGRSTAALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1003

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1004  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1063

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T         SDQP R
Sbjct  1064  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASVVTATPSVGASASDQPQR  1120



>emb|CDX79383.1| BnaC06g19200D [Brassica napus]
Length=1120

 Score =  1811 bits (4691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1133 (81%), Positives = 1020/1133 (90%), Gaps = 19/1133 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFF+MKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFSMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDL+VFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLRVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+QVPT LAGWMS++ +V HPAVSGG I L   SI AALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSQVPTPLAGWMSSSSSVPHPAVSGGAIALGSPSIQAALKHPRTPPSNSAVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP++FPG  HGH+QA    DDLPK VARTL+QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMTFPGQAHGHTQAFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLC  
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCFT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+ANTDG+RLL T +NL        S  +SKP++N I+VA  +    AER ASV
Sbjct  661   NDNMIKVMANTDGLRLLHTVDNL--------SSESSKPAINNIAVAERA----AERPASV  708

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+R N+ DVKP ITEE+NDKSK+WKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  709   VSIPGMNGDSR-NMADVKPVITEESNDKSKIWKLTEVGEPSQCRSLRLPENMRVTKISRL  767

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDV + N 
Sbjct  768   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVTEANS  827

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+A+PCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  828   EEAIPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  887

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  888   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  947

Query  839   KSKFLPLPAGRAS-VQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  948   RSKVLQVPQGRSTGALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1007

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DAT+CVFT+ANL LR R+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1008  ITHATFSCDSQLIYASFMDATICVFTSANLRLRSRVNPSAYLPASLSNSNVHPLVIAAHP  1067

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS---NTTPVSDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S   +T   SDQP R
Sbjct  1068  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSSSALASTPSASDQPQR  1120



>ref|NP_849913.2| Topless-related protein 1 [Arabidopsis thaliana]
 sp|Q0WV90.3|TPR1_ARATH RecName: Full=Topless-related protein 1; AltName: Full=Protein 
MODIFIER OF SNC1 10 [Arabidopsis thaliana]
 gb|AEE36412.1| Topless-related protein 1 [Arabidopsis thaliana]
Length=1120

 Score =  1811 bits (4691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1137 (81%), Positives = 1010/1137 (89%), Gaps = 27/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+ SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRTSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK  GFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAEGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGGPI L   SI AALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGPIALGAPSIQAALKHPRTPPSNSAVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +GISDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  301   DHVSKRTRPMGISDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K+YTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL+ ++                S  + ++    ER ASV
Sbjct  661   NDNMIKVMANSDGLRLLHTVENLSSES----------------SKPAINSIPMVERPASV  704

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  705   VSIPGMNGDSRNMV-DVKPVITEESNDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRL  763

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  764   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETNP  823

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  824   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  883

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  884   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  943

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR+ S  SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE+AAP
Sbjct  944   KSKVLQIPQGRSTSSLSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESAAP  1003

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1004  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1063

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T         SDQP R
Sbjct  1064  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVTATPSVGASASDQPQR  1120



>ref|XP_002887825.1| hypothetical protein ARALYDRAFT_895943 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64084.1| hypothetical protein ARALYDRAFT_895943 [Arabidopsis lyrata subsp. 
lyrata]
Length=1120

 Score =  1810 bits (4689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1122 (82%), Positives = 1008/1122 (90%), Gaps = 20/1122 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI AALKHPRTPPTN +VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGAPSIQAALKHPRTPPTNSAVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +GISDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  301   DHVSKRTRPMGISDEVSLGVNMLPMTFPGQAHGHNQTFKVPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL        S  +SKP++N I V        AER ASV
Sbjct  661   NDNMIKVMANSDGLRLLHTVENL--------SSESSKPAINSIPV--------AERPASV  704

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSKVWKLTE+ EPS CR+L+LPEN+R TKISRL
Sbjct  705   VSIPGMNGDSRNMV-DVKPVITEESNDKSKVWKLTELGEPSQCRSLRLPENMRATKISRL  763

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDV + NP
Sbjct  764   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASVPPQQWQPASGILMTNDVVETNP  823

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  824   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  883

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  884   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  943

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR+ S  SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  944   KSKVLQIPQGRSTSALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1003

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1004  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1063

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T
Sbjct  1064  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVT  1105



>ref|XP_009104466.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 1 [Brassica 
rapa]
Length=1124

 Score =  1810 bits (4688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 924/1137 (81%), Positives = 1020/1137 (90%), Gaps = 23/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV++GNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHSGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDL+VFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLRVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+QVPT LAGWMS++ +V HPAVSGG I L   SI AALKHPRTPP+N +V+YPSGDS
Sbjct  241   PTPSQVPTPLAGWMSSSSSVPHPAVSGGAIALGSPSIQAALKHPRTPPSNSAVEYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP++FPG  HGH+QA    DDLPK VARTL+QGSSPMS
Sbjct  301   EHVSKRTRPMGISDEVNLGVNMLPMTFPGQAHGHTQAFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLC  
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCFT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+ANTDG+RLL T +NL        S  +SKP++N I+VA  +    AER ASV
Sbjct  661   NDNMIKVMANTDGLRLLHTVDNL--------SSESSKPAINNIAVAERA----AERPASV  708

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  709   VSIPGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVGEPSQCRSLRLPENMRVTKISRL  767

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDV + N 
Sbjct  768   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVTEANS  827

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  828   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  887

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  888   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  947

Query  839   KSKFLPLPAGRAS-VQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  948   RSKVLQVPQGRSTGALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1007

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DAT+CVFT+ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1008  ITHATFSCDSQLIYASFMDATICVFTSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1067

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS--NTTP-----VSDQPPR  333
             Q+ N FA+GLSDGGV +FEPLE EGKWG  PP ENGS S   +TP      SDQP R
Sbjct  1068  QESNMFAVGLSDGGVHIFEPLEXEGKWGAAPPPENGSSSALASTPSVGASASDQPQR  1124



>ref|XP_006389801.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
 gb|ESQ27087.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
Length=1115

 Score =  1808 bits (4683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 920/1133 (81%), Positives = 1011/1133 (89%), Gaps = 24/1133 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI  ALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGAPSI-QALKHPRTPPSNSAVDYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEVNL +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  300   EHVSKRTRPMGISDEVNLGVNMLPMTFPGQGHGHTQTFKAPDDLPKTVARTLSQGSSPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++Q LLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  360   MDFHPIKQALLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  420   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  480   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGF KRS 
Sbjct  540   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFHKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  600   GVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+ANTDG+RLL T ENL+ ++                S  + +N   AER ASV
Sbjct  660   NDNMIKVMANTDGLRLLHTVENLSSES----------------SKPAINNIAVAERPASV  703

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSK+WKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  704   VSIPGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVGEPSQCRSLRLPENMRVTKISRL  762

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDV + NP
Sbjct  763   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVTETNP  822

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  823   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  882

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  883   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  942

Query  839   KSKFLPLPAGRAS-VQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  943   KSKVLQIPQGRSTGALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1002

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DAT+CVF++ANL LRCRI PSAYL  SLS+S VHPLV+AAHP
Sbjct  1003  ITHATFSCDSQLIYASFMDATICVFSSANLRLRCRINPSAYLPASLSNSNVHPLVIAAHP  1062

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS---NTTPVSDQPPR  333
             Q+ N  A+GLSDGGV +FEPLESEGKWGV PP ENGS S   +T   SDQP R
Sbjct  1063  QESNMLAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVASTPSASDQPQR  1115



>ref|XP_010472916.1| PREDICTED: topless-related protein 1 isoform X1 [Camelina sativa]
Length=1152

 Score =  1807 bits (4681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 926/1153 (80%), Positives = 1016/1153 (88%), Gaps = 27/1153 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI AALKHPRTPPTN  VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGSPSIQAALKHPRTPPTNSGVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +G+SDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  301   DHVSKRTRPMGMSDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  421   NRVIWSPDGALFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+ Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTTQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpS---------------VNPISV  1605
             N+N IKV+AN+DG+RLL T ENL+ +++   +      S               ++ + V
Sbjct  661   NDNIIKVVANSDGLRLLHTVENLSSESSKVLNILLIGSSTSKLLTPRLKLFQHFISHLHV  720

Query  1604  ASASNA-GFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCR  1428
               A N+   AER ASVV    MNGD+RN V DVKP ITEE NDKSKVWKLTE+ EPS CR
Sbjct  721   QPAINSIPVAERPASVVSIPGMNGDSRNMV-DVKPVITEEANDKSKVWKLTEVGEPSQCR  779

Query  1427  ALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQ  1248
             +L+LPEN+RVTKISRLI+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQ
Sbjct  780   SLRLPENMRVTKISRLIFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQ  839

Query  1247  PSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppa  1068
             P+SGILMTNDVA+ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPA
Sbjct  840   PASGILMTNDVAETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPA  899

Query  1067  atflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSG  888
             ATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSG
Sbjct  900   ATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSG  959

Query  887   ADAQLFVWSSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEAT  711
             ADAQL VW++DGWEKQKSK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE T
Sbjct  960   ADAQLCVWNTDGWEKQKSKVLQIPQGRSTAALSDTRVQFHQDQVHFLVVHETQLAIYETT  1019

Query  710   KLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylsp  531
             KLEC+KQW  RE++API+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  
Sbjct  1020  KLECMKQWPVRESSAPITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPA  1079

Query  530   slssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS--NTT  357
             SLS+S VHPLV+AAHPQ+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S    T
Sbjct  1080  SLSNSNVHPLVIAAHPQESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASVVTAT  1139

Query  356   P-----VSDQPPR  333
             P      SDQP R
Sbjct  1140  PSVGASASDQPQR  1152



>ref|XP_010472920.1| PREDICTED: topless-related protein 1 isoform X4 [Camelina sativa]
Length=1119

 Score =  1805 bits (4676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/1137 (82%), Positives = 1011/1137 (89%), Gaps = 28/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI  ALKHPRTPPTN  VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGSPSI-QALKHPRTPPTNSGVDYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +G+SDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  300   DHVSKRTRPMGMSDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  360   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  420   NRVIWSPDGALFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  480   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  540   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+ Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  600   GVVQFDTTKNRYLAAGDDFSIKFWDMDTTQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL        S  +SKP++N I V        AER ASV
Sbjct  660   NDNIIKVVANSDGLRLLHTVENL--------SSESSKPAINSIPV--------AERPASV  703

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  704   VSIPGMNGDSRNMV-DVKPVITEEANDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRL  762

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  763   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETNP  822

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  823   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  882

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  883   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  942

Query  839   KSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  943   KSKVLQIPQGRSTAALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1002

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1003  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1062

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T         SDQP R
Sbjct  1063  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASVVTATPSVGASASDQPQR  1119



>ref|NP_178164.3| Topless-related protein 1 [Arabidopsis thaliana]
 gb|AEE36411.1| Topless-related protein 1 [Arabidopsis thaliana]
Length=1119

 Score =  1805 bits (4675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 921/1137 (81%), Positives = 1009/1137 (89%), Gaps = 28/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+ SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRTSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK  GFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAEGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGGPI L   SI  ALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGPIALGAPSI-QALKHPRTPPSNSAVDYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +GISDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  300   DHVSKRTRPMGISDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  360   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  420   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K+YTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  480   TCGDDKTIKVWDAATGVKRYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  540   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  600   GVVQFDTTKNRYLAAGDDFSIKFWDMDTIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL+ ++                S  + ++    ER ASV
Sbjct  660   NDNMIKVMANSDGLRLLHTVENLSSES----------------SKPAINSIPMVERPASV  703

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  704   VSIPGMNGDSRNMV-DVKPVITEESNDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRL  762

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  763   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETNP  822

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  823   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  882

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  883   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  942

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR+ S  SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE+AAP
Sbjct  943   KSKVLQIPQGRSTSSLSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESAAP  1002

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1003  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1062

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T         SDQP R
Sbjct  1063  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVTATPSVGASASDQPQR  1119



>dbj|BAE98958.1| hypothetical protein [Arabidopsis thaliana]
Length=1119

 Score =  1805 bits (4674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 920/1137 (81%), Positives = 1009/1137 (89%), Gaps = 28/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+ SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRTSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK  GFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAEGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGGPI L   SI  ALKHPRTPP+N +VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGPIALGAPSI-QALKHPRTPPSNSAVDYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +GISDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  300   DHVSKRTRPMGISDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  360   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  420   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K+YTFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  480   TCGDDKTIKVWDAATGVKRYTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  540   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  600   GVVQFDTTKNRYLAAGDDFSIKFWDMDTIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL+ ++                S  + ++    ER ASV
Sbjct  660   NDNMIKVMANSDGLRLLHTVENLSSES----------------SKPAINSIPMVERPASV  703

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  704   VSIPGMNGDSRNMV-DVKPVITEESNDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRL  762

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTND+A+ NP
Sbjct  763   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDMAETNP  822

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  823   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  882

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  883   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  942

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR+ S  SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE+AAP
Sbjct  943   KSKVLQIPQGRSTSSLSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESAAP  1002

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1003  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1062

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T         SDQP R
Sbjct  1063  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVTATPSVGASASDQPQR  1119



>ref|XP_009117812.1| PREDICTED: protein TOPLESS [Brassica rapa]
Length=1130

 Score =  1803 bits (4669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 924/1137 (81%), Positives = 1019/1137 (90%), Gaps = 17/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP +NPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVSNPLLGGLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VP  LAGWMS+  +V HPAVS GPI L   SIPAALKHPRTPPTNP++DYPS +S
Sbjct  241   PTASPVPPPLAGWMSSPSSVPHPAVSAGPIALGGPSIPAALKHPRTPPTNPALDYPSAES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GIS+EV+L +N+LP+SFPG  HGHS A    DDLPK VARTL QGSSPMS
Sbjct  301   EHVSKRTRPMGISEEVSLGVNMLPMSFPGQAHGHSPAFKAPDDLPKTVARTLTQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWD+S CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDISKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVI
Sbjct  421   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS 
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSG  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IKV+AN+DG+RLL TFEN++ +++  A  S +       + A+A+ +  A+R A+V
Sbjct  661   NENVIKVMANSDGLRLLHTFENVSSESSKPAINSLAA------AAAAAATSAAADRSANV  714

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGDARN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISRL
Sbjct  715   VSIQAMNGDARNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRL  773

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTND A+ NP
Sbjct  774   IFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDAAENNP  833

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  834   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  893

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  894   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  953

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  954   RSKVLPLPQGRPNTAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1013

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S V+PLV+AAHP
Sbjct  1014  ITHATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVNPLVIAAHP  1073

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTP-----VSDQPPR  333
             Q+PN FA+GLSDGGV +FEP+ESEGKWGV PP ENGS  G+   P      SDQP R
Sbjct  1074  QEPNMFAVGLSDGGVHIFEPVESEGKWGVAPPAENGSANGAVAAPSVGASASDQPQR  1130



>ref|XP_010537925.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
Length=1132

 Score =  1802 bits (4667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 929/1137 (82%), Positives = 1017/1137 (89%), Gaps = 15/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVH+LEQESGFFFNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHRLEQESGFFFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  TV HPAVSGG I L   SIPAALKH RTPP N SVDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSTVPHPAVSGGAIALGAPSIPAALKHSRTPPINSSVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +GISDEVN+ +N+LP++FPG  HGH  A    DDLPK V R+L+QGSSPMS
Sbjct  301   DHVSKRTRLMGISDEVNIGVNMLPMTFPGQAHGHVPALKAPDDLPKTVVRSLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDF+P++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDL+ CSMPLQ ALVKDP VSV
Sbjct  361   MDFNPMKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLNKCSMPLQAALVKDPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WS DGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCVI
Sbjct  421   NRVIWSLDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IK+LAN+DG+RLL   EN++ +++  A  S +  +    +VA+ SNAG  ER ASV
Sbjct  661   NENVIKILANSDGLRLLHMSENMSSESSKPAINSVAAAA----AVAAGSNAGLTERTASV  716

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNG++RN V DVKP I EE+NDKSK+WKLTEI EPS CR+L+L ENLRVTKISRL
Sbjct  717   VSIPGMNGESRNMV-DVKPVIAEESNDKSKIWKLTEINEPSQCRSLRLSENLRVTKISRL  775

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RNS+GKATA++PPQLWQP+SGILMTNDVA+ NP
Sbjct  776   IFTNSGNAILALASNAIHLLWKWQRNDRNSTGKATASIPPQLWQPASGILMTNDVAETNP  835

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  836   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  895

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLN LVSSGADAQL VW+ DGWEKQ
Sbjct  896   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNALVSSGADAQLCVWNMDGWEKQ  955

Query  839   KSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L LP GR AS  SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQWV RE++AP
Sbjct  956   KSKLLQLPQGRTASAPSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWVVRESSAP  1015

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DATVCVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1016  ITHATFSCDSQLIYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1075

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
             Q+PN FA+GLSDGGV +FEP+ESE KWGV PP E GS S+           SDQP R
Sbjct  1076  QEPNIFAVGLSDGGVHIFEPMESESKWGVAPPAEKGSASSIVATQSVGASASDQPQR  1132



>gb|AES68182.2| topless-like protein [Medicago truncatula]
Length=1126

 Score =  1801 bits (4666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 921/1131 (81%), Positives = 1001/1131 (89%), Gaps = 23/1131 (2%)
 Frame = -3

Query  3746  FFSGFEGLVATMSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGN  3567
             F  GF+     MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGN
Sbjct  5     FTFGFQDKGVAMSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGN  64

Query  3566  WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNE  3387
             WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNE
Sbjct  65    WDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNE  124

Query  3386  ELFKEITHLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNS  3207
             ELFKEIT LLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNS
Sbjct  125   ELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNS  184

Query  3206  RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGG  3027
             RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GG
Sbjct  185   RLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGG  244

Query  3026  FPPLGAHGPFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT  2847
             FPPLGAHGPFQP P  VP  LAGWMSN   V+HP+VSGG         P+          
Sbjct  245   FPPLGAHGPFQPTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSM---------  295

Query  2846  NPSVDYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVART  2667
                        DH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V RT
Sbjct  296   ----------PDHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTVLRT  345

Query  2666  LNQGSSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTA  2487
             LNQGSSPMSMDFHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q A
Sbjct  346   LNQGSSPMSMDFHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAA  405

Query  2486  LVKDPGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFS  2307
             LVKDP VSVN +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFS
Sbjct  406   LVKDPAVSVNRVTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDLAFS  465

Query  2306  HPNKQLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGK  2127
             HPNKQLCVITCGDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGK
Sbjct  466   HPNKQLCVITCGDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGK  525

Query  2126  IKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRT  1947
             IKAWLYDN+GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRT
Sbjct  526   IKAWLYDNLGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRT  585

Query  1946  YQGFRKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNK  1767
             YQGFRKRS GVVQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNK
Sbjct  586   YQGFRKRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNK  645

Query  1766  DGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNA  1587
             +G+LLAVSANENGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A+ +
Sbjct  646   EGSLLAVSANENGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATAATS  704

Query  1586  GFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
                ER +SV   + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKLPEN
Sbjct  705   AALERASSVAAITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKLPEN  763

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
              RVTKISRLIYTNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSGILM
Sbjct  764   ARVTKISRLIYTNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSGILM  823

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND+ D N EDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH
Sbjct  824   TNDINDNNTEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH  883

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNNIIAIGMDDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q+FV
Sbjct  884   PQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQIFV  943

Query  866   WSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             W++DGWEKQK++FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC+KQ
Sbjct  944   WNTDGWEKQKNRFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLECLKQ  1003

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             W  R+AAAPISHATFSCDS L++ASFLDAT+CVF+A+NL LRCRI   +    +  SS +
Sbjct  1004  WFPRDAAAPISHATFSCDSNLIFASFLDATICVFSASNLRLRCRI-NPSAYLSANVSSNI  1062

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
              PLV+AAHP +PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN  
Sbjct  1063  QPLVIAAHPHEPNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASNAV  1113



>ref|XP_003597932.1| WD repeat-containing protein, putative [Medicago truncatula]
Length=1112

 Score =  1801 bits (4666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 925/1120 (83%), Positives = 1004/1120 (90%), Gaps = 22/1120 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VP  LAGWMSN   V+HP+VSGG         P+                     
Sbjct  241   PTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSM-------------------P  281

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V RTLNQGSSPMSMD
Sbjct  282   DHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTVLRTLNQGSSPMSMD  341

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q ALVKDP VSVN 
Sbjct  342   FHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALVKDPAVSVNR  401

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  402   VTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  461

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  462   GDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGS  521

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  522   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRSLGV  581

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNK+G+LLAVSANE
Sbjct  582   VQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKEGSLLAVSANE  641

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A+ +   ER +SV  
Sbjct  642   NGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATAATSAALERASSVAA  700

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKLPEN RVTKISRLIY
Sbjct  701   ITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKLPENARVTKISRLIY  759

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSGILMTND+ D N ED
Sbjct  760   TNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSGILMTNDINDNNTED  819

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  820   AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  879

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q+FVW++DGWEKQK+
Sbjct  880   DDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQIFVWNTDGWEKQKN  939

Query  833   KFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             +FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC+KQW  R+AAAPIS
Sbjct  940   RFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLECLKQWFPRDAAAPIS  999

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDS L++ASFLDAT+CVF+A+NL LRCRI PSAYLS ++SSS + PLV+AAHP +
Sbjct  1000  HATFSCDSNLIFASFLDATICVFSASNLRLRCRINPSAYLSANVSSSNIQPLVIAAHPHE  1059

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN  
Sbjct  1060  PNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASNAV  1099



>ref|XP_008801888.1| PREDICTED: protein TOPLESS-like [Phoenix dactylifera]
Length=1135

 Score =  1799 bits (4659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 921/1138 (81%), Positives = 1020/1138 (90%), Gaps = 14/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK G FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKAGVFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
              AP  VP  LAGWMSN+  V+HPAVSGG IG+S  + PAA LKHPRTPPT NP+VDYPS 
Sbjct  241   TAPAPVPAPLAGWMSNSSGVTHPAVSGGAIGISAPTNPAAILKHPRTPPTANPAVDYPSA  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHVSKR R +GISDEVNLP+N+LPV++P   HSQA   LDDLPK VARTL+QGS+PMS
Sbjct  301   DSDHVSKRTRPIGISDEVNLPVNILPVTYP-QNHSQAMYMLDDLPKTVARTLSQGSTPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQTLLLVGTNVGDI LW+VGSRE+LVLRNFKVW+L AC M LQ +LVKDPGVSV
Sbjct  360   MDFHPIQQTLLLVGTNVGDIGLWDVGSRERLVLRNFKVWELGACPMSLQASLVKDPGVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDGSLFGVAYSRHIVQIYSYH  DD+RQHLEIDAHVGGVND+AF+HPNKQLC+I
Sbjct  420   NRIIWSPDGSLFGVAYSRHIVQIYSYHSGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCII  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDAT G +QYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  480   TCGDDKTIKVWDATTGTRQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  540   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGESFIVEWNESEGAVKRTYQGFRKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IKFWDMD   +LT++DA+GGLPASPRIRFNK+GTLLAVS 
Sbjct  600   GVVQFDTTRNRFLAAGDEFLIKFWDMDGTNLLTTVDAEGGLPASPRIRFNKEGTLLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS-ASNAGFAERVAS  1563
             ++NGIK+LAN DG+RLLRTFEN ++D +   SES +KP ++P+S A+ A+++G  ER A 
Sbjct  660   HDNGIKILANADGLRLLRTFENRSFDPSRAVSESVTKPIISPLSAAAVATSSGITERAAP  719

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
              V  +  NGD RN V DVKPR+T+E+ DKSK+WKLTEI+EP+ CR+L+L +NLR +KI R
Sbjct  720   AVAIAGTNGDNRNMV-DVKPRLTDESMDKSKIWKLTEISEPTQCRSLRLMDNLRTSKIVR  778

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTN++ D N
Sbjct  779   LIYTNSGVAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDTN  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  839   PEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQ+ VW +DGWEK
Sbjct  899   IGMDDSTIQIYNVRVDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQICVWGTDGWEK  958

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+S+FL +P+GR  S  SDTRVQFHQDQIHFLVVHETQ+AIYE  KLECV +WV  E +A
Sbjct  959   QRSRFLQIPSGRTPSTISDTRVQFHQDQIHFLVVHETQIAIYETAKLECVNKWVTHEGSA  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDSQL+Y SFLDAT+C+F+AANL LRCRI P+AYL  ++S++ VHPLVVAAH
Sbjct  1019  PISHATFSCDSQLIYVSFLDATICIFSAANLRLRCRILPAAYLPANVSTT-VHPLVVAAH  1077

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT-------TPVSDQPPR  333
             P +PNQFA+GL+DGGV V EPLESEGKWGV PP ENGS S         T  SDQP R
Sbjct  1078  PSEPNQFAVGLTDGGVHVLEPLESEGKWGVAPPAENGSASRMSTPPPAGTSSSDQPQR  1135



>ref|XP_009148962.1| PREDICTED: protein TOPLESS [Brassica rapa]
 ref|XP_009148963.1| PREDICTED: protein TOPLESS [Brassica rapa]
 ref|XP_009148965.1| PREDICTED: protein TOPLESS [Brassica rapa]
Length=1130

 Score =  1797 bits (4655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 923/1137 (81%), Positives = 1016/1137 (89%), Gaps = 17/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS GPI L   SI AALKHPRTPPT  ++DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGPIALGGPSISAALKHPRTPPT--ALDYPSADS  298

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             +HVSKR R +GISDEV+L +N+LP+SFPG  HGHS A    DDLPK VARTL QGSSPMS
Sbjct  299   EHVSKRTRPMGISDEVSLGVNMLPMSFPGQAHGHSPAFKAPDDLPKTVARTLTQGSSPMS  358

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWD+S CSMPLQ ALVK+P VSV
Sbjct  359   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDISKCSMPLQAALVKEPVVSV  418

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVI
Sbjct  419   NRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVI  478

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  479   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  538

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS 
Sbjct  539   GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRSL  598

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS 
Sbjct  599   GVVQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSG  658

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IKV+AN+DG+RLL TFEN++ +++  A  S +  +    + A+A++AG  +R A+V
Sbjct  659   NENVIKVMANSDGLRLLHTFENVSSESSKPAISSLAAAA----AAAAATSAGLTDRPANV  714

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE NDKSK+WKLTE++EPS CR+L+LPENLRV KISRL
Sbjct  715   VSIQGMNGDSRNMV-DVKPVITEEPNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRL  773

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTND A+ NP
Sbjct  774   IFTNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDAAENNP  833

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  834   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  893

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  894   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  953

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +SK LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  954   RSKVLPLPQGRPNTAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1013

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1014  ITHATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1073

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG-------SNTTPVSDQPPR  333
             Q+PN FA+GLSDGGV +FEP+ESEGKWGV PP ENGS        S     SDQP R
Sbjct  1074  QEPNMFAVGLSDGGVHIFEPVESEGKWGVAPPAENGSASGAAAAPSVGASASDQPQR  1130



>gb|KEH39610.1| topless-like protein [Medicago truncatula]
Length=1111

 Score =  1797 bits (4655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 918/1120 (82%), Positives = 997/1120 (89%), Gaps = 23/1120 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKE VHKLEQESGF+FNMKYFE+EV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKEAVHKLEQESGFYFNMKYFEEEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSK VEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKGVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANMPLLGSLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  VP  LAGWMSN   V+HP+VSGG         P+                     
Sbjct  241   PTPAPVPMPLAGWMSNPTPVAHPSVSGGGAIGLGVGGPSM-------------------P  281

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DH+SKR R +G+SDE NLP+NVL  +FPGHGH QA ++ DDLPK V RTLNQGSSPMSMD
Sbjct  282   DHISKRTRPIGMSDEGNLPVNVLSATFPGHGHGQAFNSPDDLPKTVLRTLNQGSSPMSMD  341

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHPVQQTLLLVGTNV DI LWE+GSRE+LVLRNFKVWDLSACSMP Q ALVKDP VSVN 
Sbjct  342   FHPVQQTLLLVGTNVADIGLWELGSRERLVLRNFKVWDLSACSMPFQAALVKDPAVSVNR  401

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             +TWSPDG+LFGVAYSRHIVQIYSYHG D+VRQHLEIDAHVGGVNDLAFSHPNKQLCVITC
Sbjct  402   VTWSPDGALFGVAYSRHIVQIYSYHGGDEVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  461

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+GS
Sbjct  462   GDDKTIKVWDAATGLKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGS  521

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS GV
Sbjct  522   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESSIVEWNESEGAVKRTYQGFRKRSLGV  581

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD++Q+LT++DADGGLPASPRIRFNK+G+LLAVSANE
Sbjct  582   VQFDTTKNRYLAAGDDFSIKFWDMDNIQLLTTVDADGGLPASPRIRFNKEGSLLAVSANE  641

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN DGIRLLR+ EN +   A+R SE+ +KP +NP+SVA+A+ +   ER +SV  
Sbjct  642   NGIKILANGDGIRLLRSLEN-SSYDASRTSEAMTKPIINPMSVATAATSAALERASSVAA  700

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              + MNGD R N+GD+KPRI+EE+NDKSK+WKLTEI EPSHCR+LKLPEN RVTKISRLIY
Sbjct  701   ITGMNGDVR-NLGDIKPRISEESNDKSKIWKLTEINEPSHCRSLKLPENARVTKISRLIY  759

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR +RNSSGKATA++PPQLWQPSSGILMTND+ D N ED
Sbjct  760   TNSGNAILALASNAIHLLWKWQRNDRNSSGKATASVPPQLWQPSSGILMTNDINDNNTED  819

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  820   AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  879

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDS+IQIYNVRVDEVKSKLKGH+KRITGLAFSHVLNVLVSSGAD Q+FVW++DGWEKQK+
Sbjct  880   DDSSIQIYNVRVDEVKSKLKGHTKRITGLAFSHVLNVLVSSGADGQIFVWNTDGWEKQKN  939

Query  833   KFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             +FL  PAGR    Q+DTRVQFHQDQ  FLVVHETQLAIYEATKLEC+KQW  R+AAAPIS
Sbjct  940   RFLQFPAGRTPPAQADTRVQFHQDQFRFLVVHETQLAIYEATKLECLKQWFPRDAAAPIS  999

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDS L++ASFLDAT+CVF+A+NL LRCRI   +    +  SS + PLV+AAHP +
Sbjct  1000  HATFSCDSNLIFASFLDATICVFSASNLRLRCRI-NPSAYLSANVSSNIQPLVIAAHPHE  1058

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             PNQFA+GLSDG V VFEPLESEGKWGVPPP+ENGS SN  
Sbjct  1059  PNQFAVGLSDGIVHVFEPLESEGKWGVPPPIENGSASNAV  1098



>ref|XP_010472917.1| PREDICTED: topless-related protein 1 isoform X2 [Camelina sativa]
Length=1150

 Score =  1796 bits (4653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 929/1167 (80%), Positives = 1014/1167 (87%), Gaps = 57/1167 (5%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P+ VPT LAGWMS+  +V HPAVSGG I L   SI AALKHPRTPPTN  VDYPSGDS
Sbjct  241   PTPSPVPTPLAGWMSSPSSVPHPAVSGGAIALGSPSIQAALKHPRTPPTNSGVDYPSGDS  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +G+SDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  301   DHVSKRTRPMGMSDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  361   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  421   NRVIWSPDGALFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  541   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+ Q+LT+IDADGGL ASPRIRFNK+G+LLAVSA
Sbjct  601   GVVQFDTTKNRYLAAGDDFSIKFWDMDTTQLLTAIDADGGLQASPRIRFNKEGSLLAVSA  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL        S  +SKP++N I V        AER ASV
Sbjct  661   NDNIIKVVANSDGLRLLHTVENL--------SSESSKPAINSIPV--------AERPASV  704

Query  1559  VGT------------------------------SVMNGDARNNVGDVKPRITEETNDKSK  1470
             V                                S+ NGD+RN V DVKP ITEE NDKSK
Sbjct  705   VSIPGMVRNGFFFPFSFSFYFLFASNYRRCHLRSLQNGDSRNMV-DVKPVITEEANDKSK  763

Query  1469  VWKLTEITEPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNS  1290
             VWKLTE+ EPS CR+L+LPEN+RVTKISRLI+TNSG+A+LALASNAIHLLWKWQR +RN+
Sbjct  764   VWKLTEVGEPSQCRSLRLPENMRVTKISRLIFTNSGNAILALASNAIHLLWKWQRNDRNA  823

Query  1289  SGKATANMPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmm  1110
             +GKATA++PPQ WQP+SGILMTNDVA+ NPE+AVPCFALSKNDSYVMSASGGKISLFNMM
Sbjct  824   TGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFALSKNDSYVMSASGGKISLFNMM  883

Query  1109  tfktmttfmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITG  930
             TFKTM TFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITG
Sbjct  884   TFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITG  943

Query  929   LAFSHVLNVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHF  753
             LAFS+VLNVLVSSGADAQL VW++DGWEKQKSK L +P GR++   SDTRVQFHQDQ+HF
Sbjct  944   LAFSNVLNVLVSSGADAQLCVWNTDGWEKQKSKVLQIPQGRSTAALSDTRVQFHQDQVHF  1003

Query  752   LVVHETQLAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANL  573
             LVVHETQLAIYE TKLEC+KQW  RE++API+HATFSCDSQL+Y SF+DAT+CVF++ANL
Sbjct  1004  LVVHETQLAIYETTKLECMKQWPVRESSAPITHATFSCDSQLIYTSFMDATICVFSSANL  1063

Query  572   CLRCRIapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVP  393
              LRCR+ PSAYL  SLS+S VHPLV+AAHPQ+ N FA+GLSDGGV +FEPLESEGKWGV 
Sbjct  1064  RLRCRVNPSAYLPASLSNSNVHPLVIAAHPQESNMFAVGLSDGGVHIFEPLESEGKWGVA  1123

Query  392   PPVENGSGS--NTTP-----VSDQPPR  333
             PP ENGS S    TP      SDQP R
Sbjct  1124  PPPENGSASVVTATPSVGASASDQPQR  1150



>gb|AAF82145.1|AC034256_9 Strong similarity to an unknown protein T21F11.18 gi|6730738 
from Arabidopsis thaliana BAC T21F11 gb|AC018849 and contains 
multiple WD PF|00400 domains. ESTs gb|Z34157, gb|AA006273, 
gb|AA605431, gb|W43588, gb|W43605, gb|Z34559, gb|R90037, gb|AI994125 
come from this gene [Arabidopsis thaliana]
Length=1153

 Score =  1794 bits (4647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 929/1159 (80%), Positives = 1014/1159 (87%), Gaps = 38/1159 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIP---------------------A  2877
             P  + VPT LAGWMS+  +V HPAVS G I L   SIP                     A
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPDTLCVIYAICLQWNSFPIFGIA  300

Query  2876  ALKHPRTPPTNPSVDYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHS  2703
             ALKHPRTPPTN S+DYPS DS+HVSKR R +GISDEVNL +N+LP+SF G  HGHS A  
Sbjct  301   ALKHPRTPPTNASLDYPSADSEHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFK  360

Query  2702  TLDDLPKNVARTLNQGSSPMSMDFHPVQQTLLL-VGTNVGDIALWEVGSREKLVLRNFKV  2526
               DDLPK VARTL+QGSSPMSMDFHP++QTLLL V   + DI LWEVGSRE+LV + FKV
Sbjct  361   APDDLPKTVARTLSQGSSPMSMDFHPIKQTLLLGVFLALCDIGLWEVGSRERLVQKTFKV  420

Query  2525  WDLSACSMPLQTALVKDPGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEI  2346
             WDLS CSMPLQ ALVK+P VSVN + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEI
Sbjct  421   WDLSKCSMPLQAALVKEPVVSVNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEI  480

Query  2345  DAHVGGVNDLAFSHPNKQLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKE  2166
             DAHVGGVND++FS PNKQLCVITCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KE
Sbjct  481   DAHVGGVNDISFSTPNKQLCVITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKE  540

Query  2165  NVQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHI  1986
             N+QFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES I
Sbjct  541   NIQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFI  600

Query  1985  VEWNESEGAVKRTYQGFRKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDAD  1806
             VEWNESEGAVKRTYQGF KRS GVVQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID D
Sbjct  601   VEWNESEGAVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGD  660

Query  1805  GGLPASPRIRFNKDGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp  1626
             GGL ASPRIRFNK+G+LLAVS NEN IK++AN+DG+RLL TFEN+     +  S   +  
Sbjct  661   GGLQASPRIRFNKEGSLLAVSGNENVIKIMANSDGLRLLHTFENI-----SSESSKPAIN  715

Query  1625  SVNPISVASASNAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEIT  1446
             S+   + A+A++AG A+R A+VV    MNGD+RN V DVKP ITEE+NDKSK+WKLTE++
Sbjct  716   SIAAAAAAAATSAGHADRSANVVSIQGMNGDSRNMV-DVKPVITEESNDKSKIWKLTEVS  774

Query  1445  EPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANM  1266
             EPS CR+L+LPENLRV KISRLI+TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++
Sbjct  775   EPSQCRSLRLPENLRVAKISRLIFTNSGNAILALASNAIHLLWKWQRNERNATGKATASL  834

Query  1265  PPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttf  1086
             PPQ WQP+SGILMTNDVA+ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TF
Sbjct  835   PPQQWQPASGILMTNDVAETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATF  894

Query  1085  mppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLN  906
             MPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLN
Sbjct  895   MPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLN  954

Query  905   VLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQL  729
             VLVSSGADAQL VW++DGWEKQ+SK LPLP GR  S  SDTRVQFHQDQ HFLVVHETQL
Sbjct  955   VLVSSGADAQLCVWNTDGWEKQRSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQL  1014

Query  728   AIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIap  549
             AIYE TKLEC+KQW  RE+ API+HATFSCDSQLVYASF+DATVCVF++ANL LRCR+ P
Sbjct  1015  AIYETTKLECMKQWAVRESLAPITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNP  1074

Query  548   saylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG--  375
             SAYL  SLS+S VHPLV+AAHPQ+PN FA+GLSDGGV +FEPLESEGKWGV PP ENG  
Sbjct  1075  SAYLPASLSNSNVHPLVIAAHPQEPNMFAVGLSDGGVHIFEPLESEGKWGVAPPAENGSA  1134

Query  374   SGSNTTP-----VSDQPPR  333
             SG+ T P      SDQP R
Sbjct  1135  SGAPTAPSVGASASDQPQR  1153



>emb|CDX81729.1| BnaC08g38720D [Brassica napus]
Length=1117

 Score =  1793 bits (4643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 922/1135 (81%), Positives = 1009/1135 (89%), Gaps = 26/1135 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP +NPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVSNPLLGGLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VP  LAGWMS+  +V HPAVS GPI L   SIPAALKHPRTPPTNP++DYPS +S
Sbjct  241   PTASPVPPPLAGWMSSPSSVPHPAVSAGPIALGGPSIPAALKHPRTPPTNPALDYPSAES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             +HVSKR R +GISDEVNL           HGHS A    DDLPK VARTL QGSSPMSMD
Sbjct  301   EHVSKRTRPMGISDEVNLG---------AHGHSPAFKAPDDLPKTVARTLTQGSSPMSMD  351

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP++QTLLLVGTNVGDI LWEVGSRE+ V + FKVWD+S CSMPLQ ALVK+P VSVN 
Sbjct  352   FHPIKQTLLLVGTNVGDIGLWEVGSRERFVQKTFKVWDISKCSMPLQAALVKEPVVSVNR  411

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVITC
Sbjct  412   VIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVITC  471

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNMGS
Sbjct  472   GDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNMGS  531

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS GV
Sbjct  532   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRSLGV  591

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS NE
Sbjct  592   VQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSGNE  651

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             N IKV+AN+DG+RLL TFEN+        S  +SKP++N ++ A+A+ +  A+R A+VV 
Sbjct  652   NVIKVMANSDGLRLLHTFENV--------SSESSKPAINSLATAAAATSAAADRSANVVS  703

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
                MNGDARN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISRLI+
Sbjct  704   IQAMNGDARNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIF  762

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTND A+ NPE+
Sbjct  763   TNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDAAENNPEE  822

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  823   AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGM  882

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ+S
Sbjct  883   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRS  942

Query  833   KFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             K LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++API+
Sbjct  943   KVLPLPQGRPNTAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSAPIT  1002

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHPQ+
Sbjct  1003  HATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQE  1062

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTP-----VSDQPPR  333
             PN FA+GLSDGGV +FEP ESEGKWGV PP ENGS  G+   P      SDQP R
Sbjct  1063  PNMFAVGLSDGGVHIFEPFESEGKWGVAPPAENGSANGAVAAPSVGASASDQPQR  1117



>ref|XP_010927352.1| PREDICTED: protein TOPLESS [Elaeis guineensis]
Length=1137

 Score =  1792 bits (4642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 910/1140 (80%), Positives = 1020/1140 (89%), Gaps = 16/1140 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLGS+PK GGFPPLG HGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSIPKAGGFPPLGTHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             P P  VP  LAGWMS+ P V+HPAVSGG IG++  + PAA LKHPRTPPT N +VDYPS 
Sbjct  241   PMPAPVPAPLAGWMSSPPAVTHPAVSGGAIGINTPTNPAAMLKHPRTPPTTNHAVDYPSA  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHVSKR R +GISDEVNLPIN+LPV++P   HSQA  TLDDLPK VAR L+QGS+PMS
Sbjct  301   DSDHVSKRTRPIGISDEVNLPINILPVTYP-QNHSQAMYTLDDLPKTVARMLSQGSTPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQT+LLVGTNVGDI LW+VG+RE+LVLRNFKVW+L ACS+ LQ +LVKDP VSV
Sbjct  360   MDFHPIQQTILLVGTNVGDIGLWDVGTRERLVLRNFKVWELGACSVSLQASLVKDPSVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WS DGSLFGVAYSR+I+QIYSYH  +D+RQHLEIDAHVGGVND+AF+HPNKQLC+I
Sbjct  420   NRVIWSSDGSLFGVAYSRYIIQIYSYHSGNDIRQHLEIDAHVGGVNDIAFAHPNKQLCII  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDAT G K YTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  480   TCGDDKTIKVWDATTGTKLYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  540   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGESFIVEWNESEGAVKRTYQGFRKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT++DADGGLPASPRIRFNK+GTLLAVS 
Sbjct  600   GVVQFDTTRNRFLAAGDEFLIKFWDMDNTNLLTTVDADGGLPASPRIRFNKEGTLLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS---VASASNAGFAERV  1569
             ++NGIK+LAN DG+RLLRTFEN +++ +   SES +KP ++P+S    A A+++G  ER 
Sbjct  660   HDNGIKILANADGLRLLRTFENRSFETSRAISESVTKPIISPLSAAAAAVATSSGITERA  719

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
             A  V  + MNGD RN V DVKPR+T+E+ DKSK+WKLTEI+EP+ CR+L+L +NLR +KI
Sbjct  720   APAVAIAGMNGDNRNLV-DVKPRLTDESMDKSKIWKLTEISEPTQCRSLRLIDNLRTSKI  778

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTN++ D
Sbjct  779   SRLIYTNSGVAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITD  838

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  839   TNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  898

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDSTIQIYNVRVDEVKSKLKGHSK++TGLAFS+VLNVLVSSGADAQ+ VW +DGW
Sbjct  899   IAIGMDDSTIQIYNVRVDEVKSKLKGHSKKVTGLAFSNVLNVLVSSGADAQICVWGTDGW  958

Query  848   EKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQKS+ L +P+GR +   SDTRV+FH DQIHFL VHETQ+A+YE T+LEC+KQWV RE 
Sbjct  959   EKQKSRLLQIPSGRTAFTISDTRVRFHHDQIHFLAVHETQIALYETTRLECLKQWVPREG  1018

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
             +APISHATFSCDSQ +YASFLDAT+C+F AAN  LRCRI P+AYL  ++S++ V+PLVVA
Sbjct  1019  SAPISHATFSCDSQFIYASFLDATICIFNAANFILRCRILPAAYLPANVSTT-VYPLVVA  1077

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
             AHP +PNQFALGL+DGGV V EPLESEGKWGV PP ENGS S+ +TP       SDQP R
Sbjct  1078  AHPSEPNQFALGLTDGGVHVLEPLESEGKWGVAPPAENGSASSMSTPPPAGASSSDQPQR  1137



>ref|XP_006301454.1| hypothetical protein CARUB_v10021876mg [Capsella rubella]
 gb|EOA34352.1| hypothetical protein CARUB_v10021876mg [Capsella rubella]
Length=1119

 Score =  1792 bits (4641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 928/1137 (82%), Positives = 1012/1137 (89%), Gaps = 28/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P PT VPT LAGWMS+  +V HPAVSGG I L   SI  ALKHPRTPPTN + DYPSGDS
Sbjct  241   PTPTPVPTPLAGWMSSPSSVPHPAVSGGAIALGAPSI-QALKHPRTPPTNSAADYPSGDS  299

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DHVSKR R +GISDEV+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMS
Sbjct  300   DHVSKRTRPMGISDEVSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKAVARTLSQGSSPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSV
Sbjct  360   MDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV 
Sbjct  420   NRVIWSPDGALFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVT  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  480   TCGDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDY+APGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS 
Sbjct  540   GSRVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGDDFSIKFWDMD+ Q+LT+IDA+GGL ASPRIRFNK+G+LLAVSA
Sbjct  600   GVVQFDTTKNRYLAAGDDFSIKFWDMDNTQLLTAIDAEGGLQASPRIRFNKEGSLLAVSA  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+N IKV+AN+DG+RLL T ENL        S  +SKP++N I V        AER ASV
Sbjct  660   NDNMIKVMANSDGLRLLHTVENL--------SSESSKPAINSIPV--------AERPASV  703

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
             V    MNGD+RN V DVKP ITEE+NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRL
Sbjct  704   VSIPGMNGDSRNMV-DVKPVITEESNDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRL  762

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             I+TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTNDVA+ NP
Sbjct  763   IFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQPWQPASGILMTNDVAETNP  822

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAI
Sbjct  823   EEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAI  882

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  883   GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  942

Query  839   KSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             KSK L +P GR++   SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++AP
Sbjct  943   KSKVLQIPQGRSTAALSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAP  1002

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHP
Sbjct  1003  ITHATFSCDSQLIYTSFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHP  1062

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT-------PVSDQPPR  333
             Q+ N FA+GLSDGGV +FEPLESEGKWGV PP ENGS S  T         SDQP R
Sbjct  1063  QESNMFAVGLSDGGVHIFEPLESEGKWGVAPPPENGSASAVTTAPSVGGSASDQPQR  1119



>ref|XP_010906011.1| PREDICTED: protein TOPLESS [Elaeis guineensis]
Length=1135

 Score =  1778 bits (4605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 916/1138 (80%), Positives = 1020/1138 (90%), Gaps = 14/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAP  V   LAGWMSN+  V+HPAVSGG IG+S  + PAA LKHPRTPPT NP++DYPS 
Sbjct  241   PAPAPVAAPLAGWMSNSVGVTHPAVSGGAIGISAPTNPAAILKHPRTPPTANPAIDYPSA  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHVSKR R +GISDEVNLPIN+LPV++P   HSQA  TLDDLPK V RTL+QGS+PMS
Sbjct  301   DSDHVSKRTRPIGISDEVNLPINILPVTYP-QNHSQAMYTLDDLPKTVTRTLSQGSTPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQTLLLVGTNVGDI LW+VG+RE+LVLR FKVW+L ACS+ LQ +LVK+P VSV
Sbjct  360   MDFHPIQQTLLLVGTNVGDIGLWDVGTRERLVLRTFKVWELGACSISLQASLVKEPVVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDGSLFGVAYSRHIVQIYSYH  DD+RQHLEIDAHVGGVND+AF+HPNKQLC+I
Sbjct  420   NRIIWSPDGSLFGVAYSRHIVQIYSYHSGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCMI  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDAT G +QY FEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  480   TCGDDKTIKVWDATTGTRQYAFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS 
Sbjct  540   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGESFIVEWNESEGAVKRTYQGFRKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT++DADGGLPASPRIRFNK+GTLLAVS 
Sbjct  600   GVVQFDTTRNRFLAAGDEFVIKFWDMDNTNLLTTVDADGGLPASPRIRFNKEGTLLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS-ASNAGFAERVAS  1563
             ++NGIK+LANTDG+RLLRTFEN ++D +   SES +KP  +P+S A+ A+++G  ER A 
Sbjct  660   HDNGIKILANTDGLRLLRTFENCSFDTSRAVSESVTKPIPSPLSAAAVATSSGITERAAP  719

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
              V  + MNGD RN V DVKPR+T+E+ DKSK+WKLTEI+EP+ CR+L+L +NLR +KI R
Sbjct  720   AVAIAGMNGDNRNMV-DVKPRLTDESMDKSKIWKLTEISEPTQCRSLRLMDNLRTSKIVR  778

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTN++ D N
Sbjct  779   LIYTNSGVAILALASNAIHLLWKWPRNERNSSGKATASVTPQLWQPPSGILMTNEITDAN  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
              E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  839   TEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQ+ VW +DGWEK
Sbjct  899   IGMDDSTIQIYNVRVDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQICVWGTDGWEK  958

Query  842   QKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+S+ L +P+GR S   SDTRVQFHQDQIHFL VHETQ+AIYE  KLECV +WV  + +A
Sbjct  959   QRSRILQIPSGRTSSSISDTRVQFHQDQIHFLAVHETQIAIYETAKLECVNKWVPHDGSA  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDSQL+YASFLDAT+C+ +AANL  RCRI P+AYL  ++S++ VHPLVVAAH
Sbjct  1019  PISHATFSCDSQLIYASFLDATICILSAANLRPRCRILPAAYLPANISTT-VHPLVVAAH  1077

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
             P +PNQFALGL+DGGV + EPLESEGKWGV PP ENGS S+ +TP       SDQP R
Sbjct  1078  PSEPNQFALGLTDGGVHILEPLESEGKWGVAPPAENGSASSMSTPPPAGASSSDQPQR  1135



>ref|XP_010417699.1| PREDICTED: topless-related protein 1-like, partial [Camelina 
sativa]
Length=1104

 Score =  1775 bits (4597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 913/1122 (81%), Positives = 997/1122 (89%), Gaps = 28/1122 (2%)
 Frame = -3

Query  3668  LDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGFTKVDDNRYSMKIFFE  3489
             LDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGFTKVDDNRYSMKIFFE
Sbjct  1     LDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGFTKVDDNRYSMKIFFE  60

Query  3488  IRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLTLENFRENEQLSKYGD  3309
             IRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLTLENFRENEQLSKYGD
Sbjct  61    IRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGD  120

Query  3308  TKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLNWQHQLCKNPRPNPDI  3129
             TKSARAIMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLNWQHQLCKNPRPNPDI
Sbjct  121   TKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLNWQHQLCKNPRPNPDI  180

Query  3128  KTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQPAPTQVPTQLAGWMS  2949
             KTLFVDHSC  PN ARAPSP NNPLLGS+PK GGFPPLGAHGPFQP P+ VPT LAGWMS
Sbjct  181   KTLFVDHSCRLPNDARAPSPVNNPLLGSLPKAGGFPPLGAHGPFQPTPSPVPTPLAGWMS  240

Query  2948  NTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDSDHVSKRPRSLGISDE  2769
             +  +V HPAVSGG I L   SI  ALKHPRTPPTN  VDYPSGDSDHVSKR R +G+SDE
Sbjct  241   SPSSVPHPAVSGGAIALGSPSI-QALKHPRTPPTNSGVDYPSGDSDHVSKRTRPMGMSDE  299

Query  2768  VNLPINVLPVSFPG--HGHSQAHSTLDDLPKNVARTLNQGSSPMSMDFHPVQQTLLLVGT  2595
             V+L +N+LP++FPG  HGH+Q     DDLPK VARTL+QGSSPMSMDFHP++QTLLLVGT
Sbjct  300   VSLGVNMLPMTFPGQAHGHNQTFKAPDDLPKTVARTLSQGSSPMSMDFHPIKQTLLLVGT  359

Query  2594  NVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNCITWSPDGSLFGVA  2415
             NVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVK+P VSVN + WSPDG+LFGVA
Sbjct  360   NVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSVNRVIWSPDGALFGVA  419

Query  2414  YSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIKVWDATN  2235
             YSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND+AFS PNKQLCV TCGDDKTIKVWDA  
Sbjct  420   YSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDIAFSTPNKQLCVTTCGDDKTIKVWDAAT  479

Query  2234  GAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTT  2055
             G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNMGSRVDY+APGRWCTT
Sbjct  480   GVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNMGSRVDYEAPGRWCTT  539

Query  2054  MAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGVVQFDTTKNRYLAA  1875
             MAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGF KRS GVVQFDTTKNRYLAA
Sbjct  540   MAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSLGVVQFDTTKNRYLAA  599

Query  1874  GDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANENGIKVLANTDGIR  1695
             GDDFSIKFWDMD+ Q+LT+IDADGGL ASPRIRFNK+G+LLAVSAN+N IKV+AN+DG+R
Sbjct  600   GDDFSIKFWDMDTTQLLTAIDADGGLQASPRIRFNKEGSLLAVSANDNIIKVVANSDGLR  659

Query  1694  LLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVGTSVMNGDARNNVG  1515
             LL T ENL        S  +SKP++N I V        AER ASVV    MNGD+RN V 
Sbjct  660   LLHTVENL--------SSESSKPAINSIPV--------AERPASVVSIPGMNGDSRNMV-  702

Query  1514  DVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIYTNsgsallalasn  1335
             DVKP ITEE NDKSKVWKLTE+ EPS CR+L+LPEN+RVTKISRLI+TNSG+A+LALASN
Sbjct  703   DVKPVITEEANDKSKVWKLTEVGEPSQCRSLRLPENMRVTKISRLIFTNSGNAILALASN  762

Query  1334  aihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSY  1155
             AIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTNDVA+ NPE+AVPCFALSKNDSY
Sbjct  763   AIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFALSKNDSY  822

Query  1154  VMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVD  975
             VMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVD
Sbjct  823   VMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVD  882

Query  974   EVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRASVQ  795
             EVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQKSK L +P GR++  
Sbjct  883   EVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQKSKVLQIPQGRSTAA  942

Query  794   -SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYA  618
              SDTRVQFHQDQ+HFLVVHETQLAIYE TKLEC+KQW  RE++API+HATFSCDSQL+Y 
Sbjct  943   LSDTRVQFHQDQVHFLVVHETQLAIYETTKLECMKQWPVRESSAPITHATFSCDSQLIYT  1002

Query  617   SFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGV  438
             SF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHPQ+ N FA+GLSDGGV
Sbjct  1003  SFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQESNMFAVGLSDGGV  1062

Query  437   LVFEPLESEGKWGVPPPVENGSGSNT--TP-----VSDQPPR  333
              +FEPLESEGKWGV PP ENGS S    TP      SDQP R
Sbjct  1063  HIFEPLESEGKWGVAPPPENGSASAVMATPSVGASASDQPQR  1104



>emb|CDY36584.1| BnaA06g10370D [Brassica napus]
Length=1118

 Score =  1775 bits (4597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 915/1135 (81%), Positives = 1005/1135 (89%), Gaps = 25/1135 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS GPI L   SI AALKHPRTPPT  ++DYPS DS
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGPIALGGPSISAALKHPRTPPT--ALDYPSADS  298

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             +HVSKR R +GISDEV+L           HGHS A    DDLPK VARTL QGSSPMSMD
Sbjct  299   EHVSKRTRPMGISDEVSLG---------AHGHSPAFKAPDDLPKTVARTLTQGSSPMSMD  349

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWD+S CSMPLQ ALVK+P VSVN 
Sbjct  350   FHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDISKCSMPLQAALVKEPVVSVNR  409

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVITC
Sbjct  410   VIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVITC  469

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNMGS
Sbjct  470   GDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNMGS  529

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS GV
Sbjct  530   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRSLGV  589

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS NE
Sbjct  590   VQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSGNE  649

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             N IK++AN+DG+RLL TFEN++ +++  A  S +       + A+A++AG  +R A+VV 
Sbjct  650   NVIKIMANSDGLRLLHTFENVSSESSKPAISSLAAA-----AAAAATSAGLTDRPANVVS  704

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
                MNGD+RN V DVKP ITEE NDKSK+WKLTE++EPS CR+L+LPENLRV KISRLI+
Sbjct  705   IQGMNGDSRNMV-DVKPVITEEPNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIF  763

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTND A+ NPE+
Sbjct  764   TNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDAAENNPEE  823

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  824   AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGM  883

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ+S
Sbjct  884   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRS  943

Query  833   KFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             K LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++API+
Sbjct  944   KVLPLPQGRPNTAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSAPIT  1003

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHPQ+
Sbjct  1004  HATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQE  1063

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG-------SNTTPVSDQPPR  333
             PN FA+GLSDGGV +FEP+ESEGKWGV PP ENGS        S     SDQP R
Sbjct  1064  PNMFAVGLSDGGVHIFEPVESEGKWGVAPPAENGSASGAAAAPSVGASASDQPQR  1118



>ref|XP_010063530.1| PREDICTED: protein TOPLESS isoform X1 [Eucalyptus grandis]
 ref|XP_010063531.1| PREDICTED: protein TOPLESS isoform X1 [Eucalyptus grandis]
Length=1137

 Score =  1770 bits (4584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 915/1119 (82%), Positives = 1006/1119 (90%), Gaps = 10/1119 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FN+++FEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNVRHFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELF+EIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILIKDLKVFSTFNEELFREITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDHSCGQPNGARAPSPAN+PLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRSNPDIKTLFVDHSCGQPNGARAPSPANSPLLGPLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTP-TVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSG  2820
             PAP  VPT LAGWMSN P TV+HP V GG +      SIPA LKHPRTPPTNPSVDYPSG
Sbjct  241   PAPAAVPTPLAGWMSNPPSTVTHPVVPGGGVIGLGGPSIPATLKHPRTPPTNPSVDYPSG  300

Query  2819  D-SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             D SD VSKR R LGI DEVNLP+NVLPV+FPGHGH+ A ++ DDLPK V R LN GSSPM
Sbjct  301   DASDPVSKRTRPLGIVDEVNLPVNVLPVTFPGHGHAPAFTS-DDLPKAVGRILNPGSSPM  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI+LW+V SRE+L+ +NFKVWDLS C+  LQ ALVKDPGVS
Sbjct  360   SMDFHPVQQTLLLVGTNVGDISLWDVVSRERLLSKNFKVWDLSCCTTTLQAALVKDPGVS  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDGSLFGVAYS H+VQ++S++ N++VRQHLEIDAHVGGVNDLAF+ PNKQLCV
Sbjct  420   VNRIMWSPDGSLFGVAYSLHVVQLFSFNVNNEVRQHLEIDAHVGGVNDLAFAQPNKQLCV  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH KEN+QFIFSTALDGKIKAWLYDN
Sbjct  480   ITCGDDKTIKVWDAVTGVKRHTFEGHEAPVYSVCPHSKENIQFIFSTALDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS
Sbjct  540   MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
             FGV+QFDTT+NRYLAAGDDFSIK WDMD+V +LT++DADGGL ASPR+RFNKDG+LLAVS
Sbjct  600   FGVIQFDTTRNRYLAAGDDFSIKVWDMDNVNLLTTLDADGGLTASPRVRFNKDGSLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASAS---NAGFAER  1572
              NENGIK+LAN+DG+RLLRTFEN      +R  E+  KP VNPI+  +A+   +AG A+R
Sbjct  660   INENGIKILANSDGMRLLRTFENF-SYDVSRTPETLVKPKVNPITATAATAPISAGLADR  718

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A  V TS MNGDAR  +GDVKPRITEE+N+KSK+WKLTEI+EPS CR+L+LPEN R  K
Sbjct  719   GAPAVVTSGMNGDAR-ILGDVKPRITEESNEKSKLWKLTEISEPSLCRSLRLPENQRANK  777

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNA+HLLWKWQR +RNS+GKATA++ PQ WQPSSGI+MTNDV 
Sbjct  778   ISRLIYTNSGSAILALASNAVHLLWKWQRNDRNSTGKATASVAPQQWQPSSGIVMTNDVN  837

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
               NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  838   KNNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  897

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             I+AIGMDDST+QIYNVRVDEVKSKLKGHSKRITGLAFS+ LNVLVSSGADAQ+ VWSSD 
Sbjct  898   ILAIGMDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFSNTLNVLVSSGADAQICVWSSDV  957

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQKS +L +P GR    QSDTRVQFHQDQ+HFL VH TQLA+YEATKLEC+KQWV  E
Sbjct  958   WEKQKSTYLQIPPGRTPGAQSDTRVQFHQDQMHFLAVHGTQLAVYEATKLECMKQWVPYE  1017

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++APISHATFSCDSQLVYASF DA++CVF AANL ++CRI PSAYL  ++S+S VHPLV+
Sbjct  1018  SSAPISHATFSCDSQLVYASFFDASICVFNAANLRMQCRINPSAYLPATVSNSNVHPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVEN  378
             AAHP +PNQFALGLSDGGV VFEPL+S  +WG+PPP EN
Sbjct  1078  AAHPHEPNQFALGLSDGGVHVFEPLDSHSRWGMPPPAEN  1116



>gb|KCW70758.1| hypothetical protein EUGRSUZ_F03923 [Eucalyptus grandis]
Length=1137

 Score =  1768 bits (4580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 914/1119 (82%), Positives = 1005/1119 (90%), Gaps = 10/1119 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FN+++FEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNVRHFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELF+EIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILIKDLKVFSTFNEELFREITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDHSCGQPNGARAPSPAN+PLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRSNPDIKTLFVDHSCGQPNGARAPSPANSPLLGPLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTP-TVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTNPSVDYPSG  2820
             PAP  VPT LAGWMSN P TV+HP V GG +      SIPA LKHPRTPPTNPSVDYPSG
Sbjct  241   PAPAAVPTPLAGWMSNPPSTVTHPVVPGGGVIGLGGPSIPATLKHPRTPPTNPSVDYPSG  300

Query  2819  D-SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             D SD VSKR R LGI DEVNLP+NVLPV+FPGHGH+ A ++ DDLPK V R LN GSSPM
Sbjct  301   DASDPVSKRTRPLGIVDEVNLPVNVLPVTFPGHGHAPAFTS-DDLPKAVGRILNPGSSPM  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI+LW+V SRE+L+ +NFKVWDLS C+  LQ  LVKDPGVS
Sbjct  360   SMDFHPVQQTLLLVGTNVGDISLWDVVSRERLLSKNFKVWDLSCCTTTLQATLVKDPGVS  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDGSLFGVAYS H+VQ++S++ N++VRQHLEIDAHVGGVNDLAF+ PNKQLCV
Sbjct  420   VNRIMWSPDGSLFGVAYSLHVVQLFSFNVNNEVRQHLEIDAHVGGVNDLAFAQPNKQLCV  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH KEN+QFIFSTALDGKIKAWLYDN
Sbjct  480   ITCGDDKTIKVWDAVTGVKRHTFEGHEAPVYSVCPHSKENIQFIFSTALDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRS
Sbjct  540   MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
             FGV+QFDTT+NRYLAAGDDFSIK WDMD+V +LT++DADGGL ASPR+RFNKDG+LLAVS
Sbjct  600   FGVIQFDTTRNRYLAAGDDFSIKVWDMDNVNLLTTLDADGGLTASPRVRFNKDGSLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASAS---NAGFAER  1572
              NENGIK+LAN+DG+RLLRTFEN      +R  E+  KP VNPI+  +A+   +AG A+R
Sbjct  660   INENGIKILANSDGMRLLRTFENF-SYDVSRTPETLVKPKVNPITATAATAPISAGLADR  718

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A  V TS MNGDAR  +GDVKPRITEE+N+KSK+WKLTEI+EPS CR+L+LPEN R  K
Sbjct  719   GAPAVVTSGMNGDAR-ILGDVKPRITEESNEKSKLWKLTEISEPSLCRSLRLPENQRANK  777

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNA+HLLWKWQR +RNS+GKATA++ PQ WQPSSGI+MTNDV 
Sbjct  778   ISRLIYTNSGSAILALASNAVHLLWKWQRNDRNSTGKATASVAPQQWQPSSGIVMTNDVN  837

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
               NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  838   KNNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  897

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             I+AIGMDDST+QIYNVRVDEVKSKLKGHSKRITGLAFS+ LNVLVSSGADAQ+ VWSSD 
Sbjct  898   ILAIGMDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFSNTLNVLVSSGADAQICVWSSDV  957

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQKS +L +P GR    QSDTRVQFHQDQ+HFL VH TQLA+YEATKLEC+KQWV  E
Sbjct  958   WEKQKSTYLQIPPGRTPGAQSDTRVQFHQDQMHFLAVHGTQLAVYEATKLECMKQWVPYE  1017

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++APISHATFSCDSQLVYASF DA++CVF AANL ++CRI PSAYL  ++S+S VHPLV+
Sbjct  1018  SSAPISHATFSCDSQLVYASFFDASICVFNAANLRMQCRINPSAYLPATVSNSNVHPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVEN  378
             AAHP +PNQFALGLSDGGV VFEPL+S  +WG+PPP EN
Sbjct  1078  AAHPHEPNQFALGLSDGGVHVFEPLDSHSRWGMPPPAEN  1116



>emb|CDY33387.1| BnaC05g11960D [Brassica napus]
Length=1118

 Score =  1765 bits (4572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 912/1135 (80%), Positives = 1002/1135 (88%), Gaps = 25/1135 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP NNPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + V T LAGWMS+  +V HPAVS G I L   SI AALKHPRTPPT  ++DYPS +S
Sbjct  241   PTASPVQTPLAGWMSSPSSVPHPAVSAGAIALGGPSISAALKHPRTPPT--ALDYPSAES  298

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             +HVSKR R +GISDEV+L           HGHS A    DDLPK VARTL QGSSPMSMD
Sbjct  299   EHVSKRTRPMGISDEVSLG---------AHGHSPAFKAPDDLPKTVARTLIQGSSPMSMD  349

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWD+S CSMPLQ ALVK+P VSVN 
Sbjct  350   FHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDISKCSMPLQAALVKEPVVSVNR  409

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGV YSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVITC
Sbjct  410   VIWSPDGSLFGVTYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVITC  469

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G K++TFEGHEAPVYS+CPH+KEN+QFIFSTALDGKIKAWLYDNMGS
Sbjct  470   GDDKTIKVWDAATGVKRHTFEGHEAPVYSICPHYKENIQFIFSTALDGKIKAWLYDNMGS  529

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS GV
Sbjct  530   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRSLGV  589

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS NE
Sbjct  590   VQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSGNE  649

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             N IKV+AN+DG+RLL TFEN++ +++  A  S +       + A+A++AG  +R A+VV 
Sbjct  650   NVIKVMANSDGLRLLHTFENVSSESSKPAISSLAAA-----AAAAATSAGLTDRPANVVS  704

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
                MNGD+RN V DVKP ITEE NDKSK+WKLTE++EPS CR+L+LPENLRV KISRLI+
Sbjct  705   IQGMNGDSRNMV-DVKPVITEEPNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIF  763

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR +RN++GKATA++PPQ WQP+SGILMTND A+ NPE+
Sbjct  764   TNSGNAILALASNAIHLLWKWQRNDRNATGKATASLPPQQWQPASGILMTNDAAENNPEE  823

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  824   AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGM  883

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ+S
Sbjct  884   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRS  943

Query  833   KFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             K LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++API+
Sbjct  944   KVLPLPQGRPNTAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSAPIT  1003

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHPQ+
Sbjct  1004  HATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQE  1063

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG-------SNTTPVSDQPPR  333
             PN FA+GLSDGGV +FEP+ESEGKWGV PP ENGS        S     SDQP R
Sbjct  1064  PNMFAVGLSDGGVHIFEPVESEGKWGVAPPAENGSASGAAAAPSVGASASDQPQR  1118



>ref|XP_009395915.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1133

 Score =  1761 bits (4562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 901/1139 (79%), Positives = 1012/1139 (89%), Gaps = 18/1139 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV+NGNWD VE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVHNGNWDNVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGA APSP NN LLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGALAPSPVNNSLLGSMPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAP  VP  LAGWMSN   V+HPAVSGG IGL+  + P A LKHPRTPPT NP ++Y S 
Sbjct  241   PAPAPVPMPLAGWMSNPSAVTHPAVSGGAIGLNAPTNPVAILKHPRTPPTANPGIEYASA  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHVSKR R +GISDEVNLP+N+LPVS+P   H+QA  TL+DLPK VARTL+QGS+PMS
Sbjct  301   DSDHVSKRTRPIGISDEVNLPVNILPVSYP-QSHNQATYTLEDLPKTVARTLSQGSNPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQT+LLVGTNVGDIALW+VG+RE+L+L+NFKVW+L +CSM LQ +LVKDP VSV
Sbjct  360   MDFHPVQQTILLVGTNVGDIALWDVGTRERLILKNFKVWELGSCSMSLQASLVKDPAVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDGSLFGVAYSRHIVQIYSYHG DD+RQHLEI+AHVGGVND+AF++P+KQL VI
Sbjct  420   NRIIWSPDGSLFGVAYSRHIVQIYSYHGGDDIRQHLEIEAHVGGVNDIAFAYPSKQLSVI  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDAT+G KQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+
Sbjct  480   TCGDDKTIKVWDATSGTKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GE+ IVEWNESEGAVKRTYQGFRKRS 
Sbjct  540   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGETFIVEWNESEGAVKRTYQGFRKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT++DADGGLPASPRIRFNK+GTLLA+S 
Sbjct  600   GVVQFDTTRNRFLAAGDEFLIKFWDMDNTNILTTVDADGGLPASPRIRFNKEGTLLAIST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSV--NPISVASASNAGFAERVA  1566
             ++NGIK+LANTDG+RLLRT EN ++DA+   SE+ +KP +     + ++A+++G      
Sbjct  660   HDNGIKILANTDGLRLLRTLENRSFDASRTVSETVTKPVISPLSAAASAATSSGIITPPM  719

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             ++ G   MNGD+RN V D KPRIT+E+ DKSK+WKLTE+ EP+ CR+L+L +NLR +KIS
Sbjct  720   AIAG---MNGDSRNLV-DAKPRITDESMDKSKIWKLTEVNEPTQCRSLRLVDNLRTSKIS  775

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTN++ D 
Sbjct  776   RLIYTNSGIAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDT  835

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQDNNII
Sbjct  836   NPEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHPQDNNII  895

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGM+DSTIQIYNVRVDEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL +W +DGWE
Sbjct  896   AIGMEDSTIQIYNVRVDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCLWGTDGWE  955

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             K +S+FL +P GR  +  SDTRVQFHQDQIHFL VHETQ+A+YE TKLECVKQW  RE +
Sbjct  956   KHRSRFLQIPPGRTPAAISDTRVQFHQDQIHFLAVHETQIALYETTKLECVKQWAPREGS  1015

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHATFSCDSQL+YASFLDAT+CVF A N  LRCRI P+AYL  S+S++ ++PLV+AA
Sbjct  1016  APISHATFSCDSQLIYASFLDATICVFNATNFRLRCRILPAAYLPASVSTT-LYPLVIAA  1074

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTPV------SDQPPR  333
             HP +PNQFALGL+DGGV V EPLESEGKWGV PP +NGS S+ + P+      SDQP R
Sbjct  1075  HPSEPNQFALGLTDGGVHVLEPLESEGKWGVNPPTDNGSASSISAPLPAGASNSDQPQR  1133



>ref|XP_010928279.1| PREDICTED: protein TOPLESS-like [Elaeis guineensis]
 ref|XP_010928280.1| PREDICTED: protein TOPLESS-like [Elaeis guineensis]
Length=1104

 Score =  1758 bits (4554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 893/1136 (79%), Positives = 982/1136 (86%), Gaps = 41/1136 (4%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV  GNWDEVE+YLS F
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVQRGNWDEVERYLSSF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAV++L KDLKVF+SFNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVDVLVKDLKVFASFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDK QFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKFQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLGS+PKPGGF PLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSMPKPGGFTPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
             PAP  +PT LAGWMSN PTV+HP VSGG IGL+  S PAA LKHPRTP  NP+VDYPS D
Sbjct  241   PAPAPIPTPLAGWMSNPPTVTHPTVSGGAIGLAAPSNPAAILKHPRTPTHNPAVDYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +GISDEVNLP+N+LPV++    HSQ+    DDLPK VARTLNQGS+PMS+
Sbjct  301   SDHVSKRTRPIGISDEVNLPVNILPVTY-LQNHSQSMYPPDDLPKTVARTLNQGSTPMSL  359

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQT+LLVGTNVGDI LW+VG+RE+LVL+NF+VW+L ACS+ LQTALVKDPGVS N
Sbjct  360   DFHPTQQTVLLVGTNVGDIGLWDVGTRERLVLKNFRVWELGACSVALQTALVKDPGVSAN  419

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSP+GSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAH+GGVNDLAFS P+K LCVIT
Sbjct  420   RVIWSPEGSLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHIGGVNDLAFSKPSKHLCVIT  479

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDAT+GAKQYTFEGHEAPVYSVCPHHKEN+QF FSTALDGKIKAWLYDNMG
Sbjct  480   CGDDKTIKVWDATSGAKQYTFEGHEAPVYSVCPHHKENIQFTFSTALDGKIKAWLYDNMG  539

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADG+RLFSCGTSKDGE+HIVEWNESEGAVKRTY GFRKRS G
Sbjct  540   SRVDYDAPGRWCTTMAYSADGSRLFSCGTSKDGETHIVEWNESEGAVKRTYLGFRKRSLG  599

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTT+NR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASPRIRFNK+GTLLAVS +
Sbjct  600   VVQFDTTRNRFLAAGDEFLIKFWDMDNTNLLTSIDAEGGLPASPRIRFNKEGTLLAVSTH  659

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVV  1557
             ENGIK+LAN DG+RLLRTFEN                S++P    S              
Sbjct  660   ENGIKILANADGLRLLRTFEN---------------RSLDPSRAVSE-------------  691

Query  1556  GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLI  1377
              T + NGD+RN V DVKPR+ +E+ +K K+WKLTEI EP+ C++L+L +N+R +KISRLI
Sbjct  692   -TVMKNGDSRNLV-DVKPRLVDESMEKLKIWKLTEINEPAQCQSLRLIDNMRTSKISRLI  749

Query  1376  YTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPE  1197
             YTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTND+ D NPE
Sbjct  750   YTNSGVAILALASNAIHLLWKWPRNERNSSGKATASVSPQLWQPPSGILMTNDITDANPE  809

Query  1196  DAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIG  1017
             +AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQDNNIIAIG
Sbjct  810   EAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMSPPPAATFLAFHPQDNNIIAIG  869

Query  1016  MDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQK  837
             MDDST+QIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVS+GADAQ+ VW +DGWEKQ+
Sbjct  870   MDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSTGADAQICVWGTDGWEKQR  929

Query  836   SKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPI  660
             S+FL  P GR  S  SDT VQFHQDQIHFL VHETQ+AI+E  KLECVKQWV  E+ API
Sbjct  930   SRFLQTPPGRTPSALSDTCVQFHQDQIHFLAVHETQIAIFETNKLECVKQWVLHESFAPI  989

Query  659   SHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQ  480
             +HATFSCDSQL+Y S LDATVCVF   NL +RCRI   A   P+  SS V+PLV+AAHP 
Sbjct  990   THATFSCDSQLIYVSLLDATVCVFNITNLRMRCRI-SPAAYLPANISSNVYPLVIAAHPS  1048

Query  479   DPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT-------TPVSDQPPR  333
             +PNQFALGL+DGGV V EPLESEGKWGVPPP ENGS S+           SDQP R
Sbjct  1049  EPNQFALGLTDGGVHVLEPLESEGKWGVPPPAENGSASSVSAAPPAGAAGSDQPQR  1104



>ref|XP_009407206.1| PREDICTED: protein TOPLESS-like [Musa acuminata subsp. malaccensis]
Length=1136

 Score =  1756 bits (4548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 894/1139 (78%), Positives = 1001/1139 (88%), Gaps = 15/1139 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQE+GF+FNMKYFEDEV+NGNWD VE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQEAGFYFNMKYFEDEVHNGNWDNVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGA APSPANNPLLGS+PK GGFPPLG H PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGALAPSPANNPLLGSMPKAGGFPPLGTHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             P P  VPT LAGWMSN   V+HP VSG  IGL+  + P A LKHPRTPPT NPS++Y S 
Sbjct  241   PVPAPVPTPLAGWMSNPSAVTHPVVSGAAIGLNAPTNPVAILKHPRTPPTANPSIEYSSA  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHVSKR R +GISDEVNLP+N+LPVS+P   H+QA  T++DLPK VARTL+QGS+PMS
Sbjct  301   DSDHVSKRTRPIGISDEVNLPVNILPVSYP-QNHNQATYTIEDLPKTVARTLSQGSNPMS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+Q+T+LLVGTNVGDIALW+VG+RE+L+ +NFKVW+L  CSM LQ +LVKDP VSV
Sbjct  360   MDFHPLQRTILLVGTNVGDIALWDVGTRERLIHKNFKVWELGTCSMSLQASLVKDPAVSV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I W+PDGSLFGVAYSRHIVQIYSYHG+DD+RQHLEIDAHVGGVND+AF+HP+KQL  I
Sbjct  420   NRIIWNPDGSLFGVAYSRHIVQIYSYHGSDDIRQHLEIDAHVGGVNDIAFAHPSKQLSFI  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDAT+G KQYTFEGH APVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+
Sbjct  480   TCGDDKTIKVWDATSGTKQYTFEGHGAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GE+ IVEWNE+EGAVKRTYQGFRKRS 
Sbjct  540   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGETFIVEWNETEGAVKRTYQGFRKRSL  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAVS 
Sbjct  600   GVVQFDTTRNRFLAAGDEFLIKFWDMDNTNLLTTIDADGGLPASPRIRFNKEGTLLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS-ASNAGFAERVAS  1563
             ++NGIK+LAN DGIRLLRT EN ++DA+   SE+ +KP ++P+S A+ A+ +G  +R A 
Sbjct  660   HDNGIKILANADGIRLLRTLENRSFDASRTVSETITKPMMSPLSAAAVATTSGITDRTAP  719

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
              +  S MNGD RN V DVKPRIT+E+ DKSK+WKLTEI EP+ CR+L+L +NLR +KISR
Sbjct  720   SMPISGMNGDGRNLV-DVKPRITDESMDKSKIWKLTEINEPTQCRSLRLMDNLRTSKISR  778

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG+A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTN++ D N
Sbjct  779   LIYTNSGAAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITDTN  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             P++ V CFALSKNDSYV+SASGGKISLFNMMTFKTMTTFMPPPP ATFLAFHP DNNIIA
Sbjct  839   PDEVVHCFALSKNDSYVVSASGGKISLFNMMTFKTMTTFMPPPPTATFLAFHPLDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVRVDEVK KL+GHSKRITGLAFS+ L+VLVSSGADAQL VW ++GWEK
Sbjct  899   IGMDDSTIQIYNVRVDEVKRKLRGHSKRITGLAFSNALHVLVSSGADAQLCVWGTEGWEK  958

Query  842   QKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+S+FL + + R  S  SDTRVQF QDQIHFL VHETQ+AIYE TKLECVKQW  RE +A
Sbjct  959   QRSRFLQIQSARTPSTISDTRVQFDQDQIHFLAVHETQIAIYETTKLECVKQWSPREGSA  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PISHATFSCDSQ +YASFLDATVC+F AANL LRCRI   A   P+  S+ VHPLV+AAH
Sbjct  1019  PISHATFSCDSQSIYASFLDATVCIFNAANLKLRCRI-LPAAYLPASVSTNVHPLVIAAH  1077

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTP--------VSDQPPR  333
             P +PNQFALGL+DGGV V +PLESEGKWGV PP ENGS S+ +          SDQP R
Sbjct  1078  PSEPNQFALGLTDGGVHVVKPLESEGKWGVNPPAENGSASSLSAPPTTAGPSSSDQPQR  1136



>ref|XP_008813124.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813126.1| PREDICTED: protein TOPLESS-like isoform X2 [Phoenix dactylifera]
 ref|XP_008813127.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813128.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813129.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
Length=1136

 Score =  1753 bits (4541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 903/1140 (79%), Positives = 1011/1140 (89%), Gaps = 17/1140 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRGKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIML+ELKKLIEANPLFRDKLQFP LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLIELKKLIEANPLFRDKLQFPGLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGA-HGPF  2997
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLG++PK GGFPPLG  H PF
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGTIPKAGGFPPLGGTHVPF  240

Query  2996  QPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPP-TNPSVDYPS  2823
             QP P  VP  LAGWMS+ P V+HPAVSGG IG++    PAA LKHPRTPP TN +VDY S
Sbjct  241   QPVPAPVPAPLAGWMSSPPAVTHPAVSGGAIGINTPINPAAILKHPRTPPTTNHAVDYTS  300

Query  2822  GDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
              DSDHVSKR R +GISDEVNLP+N+LPV++    HSQA  TLDDLPK VARTL+Q S+PM
Sbjct  301   ADSDHVSKRTRPIGISDEVNLPVNILPVTY-TQNHSQAMYTLDDLPKTVARTLSQLSTPM  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQT+LLVGTNVG+I LW+VG+ E L+ R+F+VW+L AC+M LQ +LVKDP VS
Sbjct  360   SMDFHPIQQTILLVGTNVGNIGLWDVGTGESLIQRHFQVWELKACTMSLQASLVKDPSVS  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGSLFGVAYSRHIVQIYSYH  DD+R+HLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  420   VNRVIWSPDGSLFGVAYSRHIVQIYSYHSGDDMRKHLEIDAHVGGVNDIAFAHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDAT G K YTFEGHEAPVYSVCPH+KE++QFIFSTALDGKIKAWLYDN
Sbjct  480   ITCGDDKTIKVWDAT-GTKLYTFEGHEAPVYSVCPHYKESIQFIFSTALDGKIKAWLYDN  538

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMA SADG+RLFSCGTSK+GES IVEWNESEGAVKRTYQGFRKRS
Sbjct  539   LGSRVDYDAPGHWCTTMACSADGSRLFSCGTSKEGESFIVEWNESEGAVKRTYQGFRKRS  598

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT++DA+GGLPASPRIRFNK+GTLLAVS
Sbjct  599   LGVVQFDTTRNRFLAAGDEFLIKFWDMDNTNLLTTVDAEGGLPASPRIRFNKEGTLLAVS  658

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS--VASASNAGFAERV  1569
              ++NGIK+LAN DG+RLLRTFEN ++D +  ASES +KP ++P+S   A A+++G  ER 
Sbjct  659   THDNGIKILANADGLRLLRTFENRSFDTSRAASESVTKPIISPLSAVAAVATSSGIMERA  718

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
                V  + MNGD RN V DVKPR+T+E+ DKSK+WKLTEI+EP+ CR+L+L +NLR +KI
Sbjct  719   PPAVAIAGMNGDNRNLV-DVKPRVTDESMDKSKIWKLTEISEPTQCRSLRLIDNLRTSKI  777

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTN++ D
Sbjct  778   SRLIYTNSGVAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNEITD  837

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  838   ANPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  897

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQ+ VW +DGW
Sbjct  898   IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQICVWGTDGW  957

Query  848   EKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQ+S+FL +P+GR  S  SD RVQFHQDQI+FL VHETQ+A+YE T+LEC+KQWV RE 
Sbjct  958   EKQRSRFLQIPSGRITSTISDMRVQFHQDQIYFLAVHETQIALYETTRLECLKQWVPREG  1017

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
             +APISHATFSCDSQL+YASFLDAT+C+F AANL LRCRI P AYL  S+S++ V+PLVVA
Sbjct  1018  SAPISHATFSCDSQLIYASFLDATICIFNAANLTLRCRILPVAYLPASVSTT-VYPLVVA  1076

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT-------TPVSDQPPR  333
             AHP +PNQFALGL+DGGV V EPLESEGKWGV PP ENGS S+        T  SDQP R
Sbjct  1077  AHPSEPNQFALGLTDGGVHVLEPLESEGKWGVAPPAENGSASSMSTPPPAGTSSSDQPQR  1136



>ref|XP_010539522.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
 ref|XP_010539523.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
 ref|XP_010539524.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
Length=1120

 Score =  1753 bits (4539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 905/1137 (80%), Positives = 1000/1137 (88%), Gaps = 27/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNM+YFE+EV +GNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMRYFEEEVQSGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELFKEIT+L+T
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILMKDLKVFSTFNEELFKEITNLMT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKL FPSL+NSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARGIMLVELKKLIEANPLFRDKLLFPSLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG  NG RAPSP NNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPQNGTRAPSPVNNPLLGSLPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTV-SHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P+ VPT LAGWMS   TV  HPAVSGG I L   SIPA+LKHPRTP TN SVDYPSGD
Sbjct  241   PMPSTVPTPLAGWMSGPSTVPHHPAVSGGFIALGSPSIPASLKHPRTPTTNSSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHG--HSQAHSTLDDLPKNVARTLNQGSSPM  2643
             SDHVSKR RS+GISDEVNL +N+LP++FPG    H+ A    +DLPK VAR+L+ GS PM
Sbjct  301   SDHVSKRTRSMGISDEVNLGVNMLPMTFPGQAPVHTPAFKASEDLPKTVARSLSHGSCPM  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP++QTLLLVGTNVGDI LWEVGSRE+LV + FKVWDLS CSMPLQ ALVKDP VS
Sbjct  361   SMDFHPLRQTLLLVGTNVGDIGLWEVGSRERLVHKTFKVWDLSKCSMPLQAALVKDPAVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGSLFGVAYSRHIVQIYSY G DD+RQHLE+DAH GGVND+AFS PNKQLCV
Sbjct  421   VNRVVWSPDGSLFGVAYSRHIVQIYSYQGGDDMRQHLEMDAHAGGVNDIAFSTPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVWDAT GAK+Y FEGHEAPVYS+CPH+KE +QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKTIKVWDATTGAKRYMFEGHEAPVYSICPHYKETIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPGRWCTTM+YSADGTRLFSCGTSK+GES+IVEWNESEGAVKRTYQGF KRS
Sbjct  541   MGSRVDYDAPGRWCTTMSYSADGTRLFSCGTSKEGESYIVEWNESEGAVKRTYQGFNKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQ+LT+IDADGGL ASPRIRFNK+G+LLAVS
Sbjct  601   LGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQLLTAIDADGGLQASPRIRFNKEGSLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAERV  1569
             ANEN IK+LAN+DG+RLL+TFE         +S  +SK ++N I  + A+ ++A   ER 
Sbjct  661   ANENVIKILANSDGLRLLQTFEK--------SSAESSKAAINSIAATTAATTSAVLTERS  712

Query  1568  ASVVGTSVM---NGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             ASVV    M   NG++RN V D+ P   EE+NDKSK +KLTEI EPS CR+L+LPENLRV
Sbjct  713   ASVVSIPGMVRENGESRNMV-DMNPMNVEESNDKSKKFKLTEINEPSQCRSLRLPENLRV  771

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             TKISRLI+TNSG+A+LAL+SNAIHLLW+WQR E N++GKATA++PP  WQP SG LMTN 
Sbjct  772   TKISRLIFTNSGNAILALSSNAIHLLWRWQRSEHNTTGKATASVPPLQWQPPSGNLMTNV  831

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             V++ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQD
Sbjct  832   VSETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQD  891

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDD+TIQIYNVRVDEVKSKL+GHSKRITGLAFS+VLNVLVSSGAD+Q+ VW++
Sbjct  892   NNIIAIGMDDNTIQIYNVRVDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADSQICVWNT  951

Query  857   DGWEKQKSKFLPLPAGR--ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWV  684
             DGWEKQKSK L LP GR  A+  SDT VQFHQD +HFLVVHETQLAIYE TKLECVKQWV
Sbjct  952   DGWEKQKSKVLQLPLGRTVATAPSDTCVQFHQDHVHFLVVHETQLAIYETTKLECVKQWV  1011

Query  683   QREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHP  504
               E++API+HATFSCDSQL+YASF DATVCVFT++NL LRCR+ PSAYL  +LS+S VHP
Sbjct  1012  VSESSAPITHATFSCDSQLIYASFKDATVCVFTSSNLRLRCRVNPSAYLPSNLSNSNVHP  1071

Query  503   LVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVSDQPPR  333
             +V+AAHPQ+PN FA GLSDGGV +FEPLESEG WGV PP ENG        SDQP R
Sbjct  1072  VVIAAHPQEPNMFAEGLSDGGVHIFEPLESEGGWGVAPPAENG--------SDQPQR  1120



>ref|XP_008788792.1| PREDICTED: topless-related protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=1159

 Score =  1752 bits (4537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/1163 (77%), Positives = 989/1163 (85%), Gaps = 40/1163 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV  GNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVQRGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFSSFNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSSFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNG R PSPANNPLLGS+PKPGGFPPLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGVRTPSPANNPLLGSIPKPGGFPPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
              AP  +   LAGWMSN PTV+HP VSGGPIGL   S PAA LKHPRTP  N + DYPS D
Sbjct  241   TAPAPIHAPLAGWMSNPPTVTHPTVSGGPIGLVAPSNPAAILKHPRTPTNNLAADYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +GIS EVNLP+N+LPV++     SQ+   LDDLPK VAR LNQGS+PMSM
Sbjct  301   SDHVSKRTRPIGISHEVNLPVNILPVTY-LQNRSQSMYPLDDLPKTVARALNQGSTPMSM  359

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQT+LLVGTNVGDI LW+VG+RE+LVL+NF+VW+ +AC M LQTALVKD GVSVN
Sbjct  360   DFHPTQQTVLLVGTNVGDIGLWDVGTRERLVLKNFRVWEPAACPMALQTALVKDSGVSVN  419

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSP+GSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVNDLAFS+PNKQLCVIT
Sbjct  420   RVIWSPEGSLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDLAFSNPNKQLCVIT  479

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDK IKVWDAT GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  480   CGDDKKIKVWDATTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLG  539

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGE++IVEWNESEGAVKRT+ G +KRS G
Sbjct  540   SRVDYDAPGCWCTTMAYSADGSRLFSCGTSKDGETYIVEWNESEGAVKRTFLGLQKRSLG  599

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTT+NR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASPRIRFNK+GTLLAVS +
Sbjct  600   VVQFDTTRNRFLAAGDEFLIKFWDMDNTNLLTSIDAEGGLPASPRIRFNKEGTLLAVSTH  659

Query  1736  ENGIKVLANTDGIRLLRTFEN----------------------LaydaaarasesaskpS  1623
             +NGIK+LAN DG+RLLRTFEN                      +     A          
Sbjct  660   DNGIKILANADGLRLLRTFENRLLDTSRVVSETVMKVFPYANLIVLINNANNIMLCFLSM  719

Query  1622  VNPI-----SVASASNAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKL  1458
             ++PI     +VA  +++G  ++ A  V    MNGD R+ V DVKPR+ +E+ DK K+WKL
Sbjct  720   MHPIISLLCAVAIGTSSG-TDKAAPTVSVVGMNGDNRSLV-DVKPRLVDESMDKLKIWKL  777

Query  1457  TEITEPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKA  1278
             TEI E   C++L+L +N+R +KISRLIYTNSG A+LALASNAIHLLWKW R ERNSSGKA
Sbjct  778   TEINELVQCQSLRLVDNMRTSKISRLIYTNSGVAILALASNAIHLLWKWPRNERNSSGKA  837

Query  1277  TANMPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfkt  1098
             TA++ PQLWQP SGILMTND+ D NPE+ VPCFALSKNDSYVMSASGGKISLFNMMTFKT
Sbjct  838   TASVSPQLWQPPSGILMTNDITDANPEEVVPCFALSKNDSYVMSASGGKISLFNMMTFKT  897

Query  1097  mttfmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS  918
             MTTFM PPPAATFLAFHPQDNNIIAIGMDDST+QIYNVRVDEVKSKLKGHSKRITGLAFS
Sbjct  898   MTTFMSPPPAATFLAFHPQDNNIIAIGMDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFS  957

Query  917   HVLNVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVH  741
             HVLNVLVSSGADAQ+ VW +DGWEKQ+S+FL +  GR  S  SDT VQFHQDQIHFL  H
Sbjct  958   HVLNVLVSSGADAQICVWGTDGWEKQRSRFLQILPGRTPSALSDTCVQFHQDQIHFLAAH  1017

Query  740   ETQLAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRC  561
             ETQ+AI+E  KLECVKQWV RE++API+HATFSCDSQL+Y SFLDATVC+F+ ANL +RC
Sbjct  1018  ETQIAIFETNKLECVKQWVPRESSAPITHATFSCDSQLIYVSFLDATVCIFSVANLRMRC  1077

Query  560   RIapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVE  381
             RI   A   P+  SS V+PLVVAAHP +PNQFALGL+DGGV VFEPLESEGKWGVPPP E
Sbjct  1078  RI-SPAAYLPANISSNVYPLVVAAHPSEPNQFALGLTDGGVHVFEPLESEGKWGVPPPAE  1136

Query  380   NGSGSNTTPV-------SDQPPR  333
             NGSGS+ +         SDQP R
Sbjct  1137  NGSGSSMSTAPPAGASGSDQPQR  1159



>ref|XP_004984974.1| PREDICTED: protein TOPLESS-like isoform X3 [Setaria italica]
Length=1129

 Score =  1748 bits (4528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 894/1137 (79%), Positives = 1003/1137 (88%), Gaps = 18/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P V+HPAVSGG IG    + PAAL KHPRTP T NPS+DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFGTPTNPAALLKHPRTPTTANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFP-GHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDHVSKR R +G+++EVNLP+N+LPV++P  H + Q     +D  K VARTLNQGS+PM
Sbjct  300   DSDHVSKRSRPVGMAEEVNLPVNMLPVTYPQSHNYQQ-----EDFHKTVARTLNQGSAPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQTLLLVGTNVGDI LW+VG++++L LRNFKVW+L  CSM LQ +LVKDP VS
Sbjct  355   SMDFHPLQQTLLLVGTNVGDIGLWDVGTKDRLALRNFKVWELGKCSMTLQASLVKDPAVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+GAKQ++FEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGAKQFSFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F +K WDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFMVKIWDMDNTGLLTTIDADGGLPASPRIRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NG+K+LAN DG+RLLRT EN ++DA+  A+E+ +KP +NP++ A+ + A  +    +
Sbjct  655   TLDNGVKILANADGLRLLRTLENRSFDASRNATETVTKPLINPLTAAANAAAASSSGTPA  714

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
                 + MNGD R  V DVKPRIT+E+ DKSKVWKL EITE + CR++KL +N+R +KISR
Sbjct  715   PAAITAMNGDTRGLV-DVKPRITDESLDKSKVWKLMEITESTQCRSIKLADNMRASKISR  773

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LAL ++A+HLLWKW R +RNSSGKATA++ PQLWQP SGI MTND+ D N
Sbjct  774   LIYTNSGVAILALTASAVHLLWKWPRSDRNSSGKATASVSPQLWQPPSGIFMTNDMTDNN  833

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  834   PEDAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  893

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVR+DEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  894   IGMDDSTIQIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  953

Query  842   QKSKFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             QK++FL +P+GR S   DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  RE + P
Sbjct  954   QKNRFLQIPSGRPSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPP  1013

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DATV +F A++L L+CRI   A   P   SS VHP+VVAAHP
Sbjct  1014  ITHATFSCDSQLIYASFMDATVGIFNASSLRLQCRI-LPASYLPPSISSSVHPVVVAAHP  1072

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
              + +QFALGL+DGGV V EPLESE KWG PPP ENGS SN +TP       SDQP R
Sbjct  1073  SEASQFALGLTDGGVYVLEPLESERKWGNPPPAENGSTSNLSTPPPNGASSSDQPER  1129



>ref|NP_001049587.1| Os03g0254700 [Oryza sativa Japonica Group]
 gb|ABF95023.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11501.1| Os03g0254700 [Oryza sativa Japonica Group]
 dbj|BAL44267.1| ASPR1 protein [Oryza sativa Japonica Group]
Length=1133

 Score =  1747 bits (4524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1142 (79%), Positives = 1009/1142 (88%), Gaps = 24/1142 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P V+HPAVSGG IG    + PAA LKHPRTP T NPS+DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAILKHPRTPTTANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHST-LDDLPKNVARTLNQGSSPM  2643
             DSDHVSKR R +G+S+EVNLP+N+LPV++P     Q+HS   DD  KNVARTL+QGS+PM
Sbjct  300   DSDHVSKRTRPVGMSEEVNLPVNMLPVTYP-----QSHSYPQDDFHKNVARTLSQGSTPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LW+VG++E+LVLRNFKVWDL+ CSM LQ +LVKDP VS
Sbjct  355   SMDFHPVQQTLLLVGTNVGDIGLWDVGTKERLVLRNFKVWDLTKCSMALQASLVKDPTVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+GAKQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGAKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMD+  +LT+IDADGGLPASPR+RFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFLIKIWDMDNTSLLTTIDADGGLPASPRVRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-----VASASNAGFA  1578
              +ENGIK+LAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++      ASA+ AG +
Sbjct  655   THENGIKILANADGVRLLRTLENRSFDASRSASETVTKPLMNPLTAAAAAAASAAAAGTS  714

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
                A+    + +NGD+R+ V DVKPRI +E  DKSKVWKL EITE S CR+LKL +N+R 
Sbjct  715   SGNAAPPAITALNGDSRSLV-DVKPRIADEPLDKSKVWKLMEITESSQCRSLKLTDNMRT  773

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             +KISRLIYTNSG A+LALASNA+HLLWKW R +RNSSGKATA++ PQLWQP SGILMTND
Sbjct  774   SKISRLIYTNSGVAILALASNAVHLLWKWPRNDRNSSGKATASVSPQLWQPPSGILMTND  833

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             + D NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  834   ITD-NPEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  892

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDDSTIQIYNVR+DEVKSKL+GHSK+ITGLAFS+VLNVLVSSGADAQ+ VWS+
Sbjct  893   NNIIAIGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNVLNVLVSSGADAQICVWST  952

Query  857   DGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGW+K KS+ L +P+ R +S+  DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  
Sbjct  953   DGWDKLKSRMLQIPSSRPSSIILDTRVQFHQDQLHFLVVHETQIAIYETTKLEPVKQWPV  1012

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             RE ++PI+HA FSCDSQL+YASFLDATVC+F A++L L+CRI   A   P   SS V+P+
Sbjct  1013  RENSSPITHAMFSCDSQLIYASFLDATVCIFNASSLRLQCRI-LPASYLPQNISSNVYPV  1071

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGS------NTTPVSDQP  339
             VVAAHP + NQFALGL+DGGV V EPLESE KWG PPP ENGS S      N    SDQP
Sbjct  1072  VVAAHPSEANQFALGLTDGGVYVLEPLESERKWGNPPPAENGSTSALSTPPNGASSSDQP  1131

Query  338   PR  333
              R
Sbjct  1132  ER  1133



>ref|XP_008788791.1| PREDICTED: topless-related protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=1104

 Score =  1746 bits (4523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 892/1137 (78%), Positives = 978/1137 (86%), Gaps = 43/1137 (4%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV  GNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVQRGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFSSFNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSSFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNG R PSPANNPLLGS+PKPGGFPPLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGVRTPSPANNPLLGSIPKPGGFPPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTNPSVDYPSGD  2817
              AP  +   LAGWMSN PTV+HP VSGGPIGL   S PAA LKHPRTP  N + DYPS D
Sbjct  241   TAPAPIHAPLAGWMSNPPTVTHPTVSGGPIGLVAPSNPAAILKHPRTPTNNLAADYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKR R +GIS EVNLP+N+LPV++     SQ+   LDDLPK VAR LNQGS+PMSM
Sbjct  301   SDHVSKRTRPIGISHEVNLPVNILPVTY-LQNRSQSMYPLDDLPKTVARALNQGSTPMSM  359

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP QQT+LLVGTNVGDI LW+VG+RE+LVL+NF+VW+ +AC M LQTALVKD GVSVN
Sbjct  360   DFHPTQQTVLLVGTNVGDIGLWDVGTRERLVLKNFRVWEPAACPMALQTALVKDSGVSVN  419

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSP+GSLFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVNDLAFS+PNKQLCVIT
Sbjct  420   RVIWSPEGSLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDLAFSNPNKQLCVIT  479

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDK IKVWDAT GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+G
Sbjct  480   CGDDKKIKVWDATTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLG  539

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGE++IVEWNESEGAVKRT+ G +KRS G
Sbjct  540   SRVDYDAPGCWCTTMAYSADGSRLFSCGTSKDGETYIVEWNESEGAVKRTFLGLQKRSLG  599

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTT+NR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASPRIRFNK+GTLLAVS +
Sbjct  600   VVQFDTTRNRFLAAGDEFLIKFWDMDNTNLLTSIDAEGGLPASPRIRFNKEGTLLAVSTH  659

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVV  1557
             +NGIK+LAN DG+RLLRTFEN   D                               + VV
Sbjct  660   DNGIKILANADGLRLLRTFENRLLD------------------------------TSRVV  689

Query  1556  GTSVM-NGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
               +VM NGD R+ V DVKPR+ +E+ DK K+WKLTEI E   C++L+L +N+R +KISRL
Sbjct  690   SETVMKNGDNRSLV-DVKPRLVDESMDKLKIWKLTEINELVQCQSLRLVDNMRTSKISRL  748

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             IYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTND+ D NP
Sbjct  749   IYTNSGVAILALASNAIHLLWKWPRNERNSSGKATASVSPQLWQPPSGILMTNDITDANP  808

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+ VPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQDNNIIAI
Sbjct  809   EEVVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMSPPPAATFLAFHPQDNNIIAI  868

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDST+QIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQ+ VW +DGWEKQ
Sbjct  869   GMDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQICVWGTDGWEKQ  928

Query  839   KSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             +S+FL +  GR  S  SDT VQFHQDQIHFL  HETQ+AI+E  KLECVKQWV RE++AP
Sbjct  929   RSRFLQILPGRTPSALSDTCVQFHQDQIHFLAAHETQIAIFETNKLECVKQWVPRESSAP  988

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+Y SFLDATVC+F+ ANL +RCRI   A   P+  SS V+PLVVAAHP
Sbjct  989   ITHATFSCDSQLIYVSFLDATVCIFSVANLRMRCRI-SPAAYLPANISSNVYPLVVAAHP  1047

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV-------SDQPPR  333
              +PNQFALGL+DGGV VFEPLESEGKWGVPPP ENGSGS+ +         SDQP R
Sbjct  1048  SEPNQFALGLTDGGVHVFEPLESEGKWGVPPPAENGSGSSMSTAPPAGASGSDQPQR  1104



>ref|XP_009405763.1| PREDICTED: protein TOPLESS-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1130

 Score =  1746 bits (4522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 900/1140 (79%), Positives = 1009/1140 (89%), Gaps = 23/1140 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQ+SGF+FNMKYFEDEV+NGNWD VE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQDSGFYFNMKYFEDEVHNGNWDNVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQ P+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQLPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGA APSPAN+PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGALAPSPANSPLLGSMPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAP  VPT LAGWMSN P     AV+GG IGLS  + P A LKHPRTPPT NPS++Y  G
Sbjct  241   PAPAPVPTPLAGWMSNPP-----AVAGGAIGLSAPTNPVAILKHPRTPPTANPSIEY--G  293

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHV KR R LGISDEVNLP+N+LPVS+P   H+QA  TL+DLPK VARTL+QGS+PMS
Sbjct  294   DSDHVPKRTRPLGISDEVNLPVNILPVSYP-QNHNQAMYTLEDLPKMVARTLSQGSNPMS  352

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQT+LLVGTNVGDIALW+VGSRE+L+L NFKVW++ +CSM LQ +LVKDP VSV
Sbjct  353   MDFHPIQQTILLVGTNVGDIALWDVGSRERLILTNFKVWEIGSCSMSLQASLVKDPAVSV  412

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDGSLFGVAYSRHIVQI+SYHG DD+RQHLEIDAH GGVND+AF+HPNKQL +I
Sbjct  413   NRIIWSPDGSLFGVAYSRHIVQIFSYHGADDIRQHLEIDAHTGGVNDVAFAHPNKQLSII  472

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVWDAT+G K YTFEGHE+PVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+
Sbjct  473   TCGDDKTIKVWDATSGTKHYTFEGHESPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNL  532

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GE+ IVEWNESEGAVKRTYQGFRKRS 
Sbjct  533   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGETFIVEWNESEGAVKRTYQGFRKRSL  592

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAVS 
Sbjct  593   GVVQFDTTRNRFLAAGDEFLIKFWDMDNTSLLTTIDADGGLPASPRIRFNKEGTLLAVST  652

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS-ASNAGFAERVA-  1566
             ++NGIK+LAN+DG+RLLRT EN ++D +   SE+ +KP ++P+S A+ A+ +G  +R A 
Sbjct  653   HDNGIKILANSDGLRLLRTLENHSFDTSRTVSETVTKPIISPLSAAAVATTSGITDRTAL  712

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
               +  + M+GD RN V DVKP+I +E+ DKSK+W L+E+ EP+ CR+L+L +NLR +KIS
Sbjct  713   PPMAIAGMSGDCRNLV-DVKPKIADESMDKSKIWILSELNEPTQCRSLRLVDNLRTSKIS  771

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTND+ D 
Sbjct  772   RLIYTNSGFAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNDITDT  831

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPE+ V CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  832   NPEEPVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  891

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDSTIQ YNVRVDEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW +DGWE
Sbjct  892   AIGMDDSTIQTYNVRVDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWGTDGWE  951

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQ+S+FL +P+G   S  SDTRVQFHQDQ HFLVVHETQ+AI+E TKLEC+KQW  R+ +
Sbjct  952   KQRSRFLQIPSGYTPSTISDTRVQFHQDQKHFLVVHETQIAIFETTKLECMKQWAPRDGS  1011

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHAT SCDSQL+Y SFLDATVC+F A NL LRCRI P+AYL PS+S++ V+P+V+AA
Sbjct  1012  APISHATLSCDSQLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSVSTT-VYPVVIAA  1070

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP-------VSDQPPR  333
             HP +PNQFALGL+DGGV V EPLESEGKWGV PP ENGS SN +TP        SDQP R
Sbjct  1071  HPSEPNQFALGLTDGGVHVLEPLESEGKWGVSPPAENGSASNMSTPPPAGAASSSDQPQR  1130



>ref|XP_004984972.1| PREDICTED: protein TOPLESS-like isoform X1 [Setaria italica]
 ref|XP_004984973.1| PREDICTED: protein TOPLESS-like isoform X2 [Setaria italica]
Length=1130

 Score =  1744 bits (4517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 894/1138 (79%), Positives = 1003/1138 (88%), Gaps = 19/1138 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P V+HPAVSGG IG    + PAAL KHPRTP T NPS+DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFGTPTNPAALLKHPRTPTTANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDE-VNLPINVLPVSFP-GHGHSQAHSTLDDLPKNVARTLNQGSSP  2646
             DSDHVSKR R +G+++E VNLP+N+LPV++P  H + Q     +D  K VARTLNQGS+P
Sbjct  300   DSDHVSKRSRPVGMAEEQVNLPVNMLPVTYPQSHNYQQ-----EDFHKTVARTLNQGSAP  354

Query  2645  MSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGV  2466
             MSMDFHP+QQTLLLVGTNVGDI LW+VG++++L LRNFKVW+L  CSM LQ +LVKDP V
Sbjct  355   MSMDFHPLQQTLLLVGTNVGDIGLWDVGTKDRLALRNFKVWELGKCSMTLQASLVKDPAV  414

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             SVN I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQHLEIDAHVGGVND+AF+HPNKQLC
Sbjct  415   SVNRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLC  474

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             +ITCGDDKTIKVW+AT+GAKQ++FEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYD
Sbjct  475   IITCGDDKTIKVWEATSGAKQFSFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYD  534

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             N+GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GESH+VEWNESEGAVKRTYQGFRKR
Sbjct  535   NLGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGESHLVEWNESEGAVKRTYQGFRKR  594

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTT+NR+LAAGD+F +K WDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAV
Sbjct  595   SMGVVQFDTTRNRFLAAGDEFMVKIWDMDNTGLLTTIDADGGLPASPRIRFNKEGTLLAV  654

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVA  1566
             S  +NG+K+LAN DG+RLLRT EN ++DA+  A+E+ +KP +NP++ A+ + A  +    
Sbjct  655   STLDNGVKILANADGLRLLRTLENRSFDASRNATETVTKPLINPLTAAANAAAASSSGTP  714

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             +    + MNGD R  V DVKPRIT+E+ DKSKVWKL EITE + CR++KL +N+R +KIS
Sbjct  715   APAAITAMNGDTRGLV-DVKPRITDESLDKSKVWKLMEITESTQCRSIKLADNMRASKIS  773

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG A+LAL ++A+HLLWKW R +RNSSGKATA++ PQLWQP SGI MTND+ D 
Sbjct  774   RLIYTNSGVAILALTASAVHLLWKWPRSDRNSSGKATASVSPQLWQPPSGIFMTNDMTDN  833

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  834   NPEDAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  893

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDSTIQIYNVR+DEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWE
Sbjct  894   AIGMDDSTIQIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWE  953

Query  845   KQKSKFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             KQK++FL +P+GR S   DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  RE + 
Sbjct  954   KQKNRFLQIPSGRPSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSP  1013

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HATFSCDSQL+YASF+DATV +F A++L L+CRI   A   P   SS VHP+VVAAH
Sbjct  1014  PITHATFSCDSQLIYASFMDATVGIFNASSLRLQCRI-LPASYLPPSISSSVHPVVVAAH  1072

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
             P + +QFALGL+DGGV V EPLESE KWG PPP ENGS SN +TP       SDQP R
Sbjct  1073  PSEASQFALGLTDGGVYVLEPLESERKWGNPPPAENGSTSNLSTPPPNGASSSDQPER  1130



>gb|EEC74885.1| hypothetical protein OsI_10796 [Oryza sativa Indica Group]
 gb|EEE57834.1| hypothetical protein OsJ_08437 [Oryza sativa Japonica Group]
Length=1151

 Score =  1743 bits (4515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 906/1160 (78%), Positives = 1007/1160 (87%), Gaps = 42/1160 (4%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P V+HPAVSGG IG    + PAA LKHPRTP T NPS+DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAILKHPRTPTTANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHST-LDDLPKNVARTLNQGSSPM  2643
             DSDHVSKR R +G+S+EVNLP+N+LPV++P     Q+HS   DD  KNVARTL+QGS+PM
Sbjct  300   DSDHVSKRTRPVGMSEEVNLPVNMLPVTYP-----QSHSYPQDDFHKNVARTLSQGSTPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LW+VG++E+LVLRNFKVWDL+ CSM LQ +LVKDP VS
Sbjct  355   SMDFHPVQQTLLLVGTNVGDIGLWDVGTKERLVLRNFKVWDLTKCSMALQASLVKDPTVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+GAKQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGAKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMD+  +LT+IDADGGLPASPR+RFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFLIKIWDMDNTSLLTTIDADGGLPASPRVRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISV------------AS  1599
              +ENGIK+LAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++              S
Sbjct  655   THENGIKILANADGVRLLRTLENRSFDASRSASETVTKPLMNPLTAAAAAAASAAAAGTS  714

Query  1598  ASNAGFAERVA-----------SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTE  1452
             + NA      A            ++G  + NGD+R+ V DVKPRI +E  DKSKVWKL E
Sbjct  715   SGNAAPPAITALKTFYSDPTNLYILGKILQNGDSRSLV-DVKPRIADEPLDKSKVWKLME  773

Query  1451  ITEPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATA  1272
             ITE S CR+LKL +N+R +KISRLIYTNSG A+LALASNA+HLLWKW R +RNSSGKATA
Sbjct  774   ITESSQCRSLKLTDNMRTSKISRLIYTNSGVAILALASNAVHLLWKWPRNDRNSSGKATA  833

Query  1271  NMPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmt  1092
             ++ PQLWQP SGILMTND+ D NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMT
Sbjct  834   SVSPQLWQPPSGILMTNDITD-NPEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMT  892

Query  1091  tfmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHV  912
             TFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVR+DEVKSKL+GHSK+ITGLAFS+V
Sbjct  893   TFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNV  952

Query  911   LNVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHET  735
             LNVLVSSGADAQ+ VWS+DGW+K KS+ L +P+ R +S+  DTRVQFHQDQ+HFLVVHET
Sbjct  953   LNVLVSSGADAQICVWSTDGWDKLKSRMLQIPSSRPSSIILDTRVQFHQDQLHFLVVHET  1012

Query  734   QLAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRI  555
             Q+AIYE TKLE VKQW  RE ++PI+HA FSCDSQL+YASFLDATVC+F A++L L+CRI
Sbjct  1013  QIAIYETTKLEPVKQWPVRENSSPITHAMFSCDSQLIYASFLDATVCIFNASSLRLQCRI  1072

Query  554   apsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
                A   P   SS V+P+VVAAHP + NQFALGL+DGGV V EPLESE KWG PPP ENG
Sbjct  1073  -LPASYLPQNISSNVYPVVVAAHPSEANQFALGLTDGGVYVLEPLESERKWGNPPPAENG  1131

Query  374   SGS------NTTPVSDQPPR  333
             S S      N    SDQP R
Sbjct  1132  STSALSTPPNGASSSDQPER  1151



>gb|EPS69099.1| hypothetical protein M569_05666, partial [Genlisea aurea]
Length=1107

 Score =  1741 bits (4508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 897/1115 (80%), Positives = 984/1115 (88%), Gaps = 14/1115 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLI QFLDEEK+KETVHKLEQESGFFFNMKYFEDEV NGNW+EVE+YLSGF
Sbjct  1     MSSLSRELVFLISQFLDEEKYKETVHKLEQESGFFFNMKYFEDEVQNGNWEEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DRSKAVEIL KDLKVF+SFN++LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDRSKAVEILVKDLKVFASFNDDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG-SVPKPGGFPPLGAHGPF  2997
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG +V KPGGF PLG H PF
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGGAVLKPGGFHPLGVHVPF  240

Query  2996  QPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             QPAP+ VPT LAGWMSN PT +HP++SGGPI L    + AALK PR+PP N SVD+PS D
Sbjct  241   QPAPSPVPTPLAGWMSNPPTGTHPSISGGPIVLGAPPMQAALKRPRSPPGN-SVDFPSAD  299

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             S+H  KR R L IS+E N P+NVLPV FPGHG+SQ  ST D+L + VART NQGSSP+SM
Sbjct  300   SEH--KRVRPLAISEEANHPVNVLPVPFPGHGNSQNFSTPDELTRTVARTFNQGSSPVSM  357

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQTLLLVGTNVGDI LWEVG RE+LV +NFKVWDLSACSMPLQ +LVKDP VSVN
Sbjct  358   DFHPVQQTLLLVGTNVGDIGLWEVGLRERLVQKNFKVWDLSACSMPLQASLVKDPAVSVN  417

Query  2456  CITWSPDGSLFGV-AYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
              + WSPDGSLFG+ AYSRH++QIYSYHGNDD+R  LEIDAH+GGVND+AFS PNKQL VI
Sbjct  418   RVIWSPDGSLFGIFAYSRHLIQIYSYHGNDDLRTRLEIDAHMGGVNDIAFSLPNKQLSVI  477

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDK IKVWDAT GAKQYTFEGHE PVYS+CPHHKEN+QFIFSTALDGKIKAWLYDN 
Sbjct  478   TCGDDKLIKVWDATTGAKQYTFEGHEHPVYSICPHHKENIQFIFSTALDGKIKAWLYDNQ  537

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPGR CT MAYS DGTRLFSCGTSKDGESHIVEWNESEGAVKR+YQGFRKRS 
Sbjct  538   GSRVDYDAPGRSCTRMAYSTDGTRLFSCGTSKDGESHIVEWNESEGAVKRSYQGFRKRST  597

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNRYLAAGD+F IKFWDMD+VQ+LTS DADGGLPASP IRFNKDG LLAVSA
Sbjct  598   GVVQFDTTKNRYLAAGDEFCIKFWDMDNVQLLTSTDADGGLPASPCIRFNKDGNLLAVSA  657

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             NEN IK+LANTDG+RLLRT+ENL   A    +  A+KP+VNPIS    S+ G AER++S 
Sbjct  658   NENVIKILANTDGLRLLRTYENL---AFDARASEAAKPAVNPISAPVPSSGGLAERISS-  713

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
                S  NGD+R N+ DVKPR+ EET+DK K+WKLTEI E S CR+LKLPENLRV KISRL
Sbjct  714   AAISATNGDSR-NLSDVKPRVAEETSDKGKIWKLTEINEQSQCRSLKLPENLRVAKISRL  772

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             IYTNSG+A+LALASNA+HLLWKWQR +RNSSGKATA++PPQ WQPSSGILMTND AD NP
Sbjct  773   IYTNSGNAVLALASNAVHLLWKWQRNDRNSSGKATASVPPQFWQPSSGILMTNDTADSNP  832

Query  1199  -EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
              E+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN+IA
Sbjct  833   GEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNVIA  892

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVK KLKGH KRITGLAFSHVL++LVSSGADAQ+ +W+SDGWEK
Sbjct  893   IGMDDSSIQIYNVRVDEVKVKLKGHVKRITGLAFSHVLSILVSSGADAQICIWNSDGWEK  952

Query  842   QKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+S+FL LP GR+    S+TRVQFHQDQIHFLVVHETQLAIY+A+KLEC+KQW  RE+ +
Sbjct  953   QRSRFLELPPGRSQAAISETRVQFHQDQIHFLVVHETQLAIYDASKLECMKQWPPRESCS  1012

Query  665   -PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIa-psaylspslssSGVHPLVVA  492
              PI++ATFSCDSQL+YA F DATVC+FTA++L LRCRI   +   S       VHP+VVA
Sbjct  1013  VPITNATFSCDSQLIYAGFADATVCIFTASHLRLRCRINPSAYLPSNPRQVPNVHPVVVA  1072

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPP  387
             AHPQ+PNQFALGLSDG V VFEPLESE KWG PPP
Sbjct  1073  AHPQEPNQFALGLSDGSVHVFEPLESETKWGQPPP  1107



>ref|XP_004984975.1| PREDICTED: protein TOPLESS-like isoform X4 [Setaria italica]
Length=1124

 Score =  1740 bits (4506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 892/1137 (78%), Positives = 1001/1137 (88%), Gaps = 23/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT-NPSVDYPSGD  2817
             PAPT VP  LAGWMSN P V+HPAVSGG IG +     A LKHPRTP T NPS+DYPSGD
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFA-----ALLKHPRTPTTANPSMDYPSGD  294

Query  2816  SDHVSKRPRSLGISDE-VNLPINVLPVSFP-GHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             SDHVSKR R +G+++E VNLP+N+LPV++P  H + Q     +D  K VARTLNQGS+PM
Sbjct  295   SDHVSKRSRPVGMAEEQVNLPVNMLPVTYPQSHNYQQ-----EDFHKTVARTLNQGSAPM  349

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQTLLLVGTNVGDI LW+VG++++L LRNFKVW+L  CSM LQ +LVKDP VS
Sbjct  350   SMDFHPLQQTLLLVGTNVGDIGLWDVGTKDRLALRNFKVWELGKCSMTLQASLVKDPAVS  409

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  410   VNRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  469

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+GAKQ++FEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  470   ITCGDDKTIKVWEATSGAKQFSFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  529

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  530   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGESHLVEWNESEGAVKRTYQGFRKRS  589

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F +K WDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAVS
Sbjct  590   MGVVQFDTTRNRFLAAGDEFMVKIWDMDNTGLLTTIDADGGLPASPRIRFNKEGTLLAVS  649

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NG+K+LAN DG+RLLRT EN ++DA+  A+E+ +KP +NP++ A+ + A  +    +
Sbjct  650   TLDNGVKILANADGLRLLRTLENRSFDASRNATETVTKPLINPLTAAANAAAASSSGTPA  709

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
                 + MNGD R  V DVKPRIT+E+ DKSKVWKL EITE + CR++KL +N+R +KISR
Sbjct  710   PAAITAMNGDTRGLV-DVKPRITDESLDKSKVWKLMEITESTQCRSIKLADNMRASKISR  768

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LAL ++A+HLLWKW R +RNSSGKATA++ PQLWQP SGI MTND+ D N
Sbjct  769   LIYTNSGVAILALTASAVHLLWKWPRSDRNSSGKATASVSPQLWQPPSGIFMTNDMTDNN  828

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  829   PEDAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  888

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVR+DEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  889   IGMDDSTIQIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  948

Query  842   QKSKFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             QK++FL +P+GR S   DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  RE + P
Sbjct  949   QKNRFLQIPSGRPSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPP  1008

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DATV +F A++L L+CRI   A   P   SS VHP+VVAAHP
Sbjct  1009  ITHATFSCDSQLIYASFMDATVGIFNASSLRLQCRI-LPASYLPPSISSSVHPVVVAAHP  1067

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
              + +QFALGL+DGGV V EPLESE KWG PPP ENGS SN +TP       SDQP R
Sbjct  1068  SEASQFALGLTDGGVYVLEPLESERKWGNPPPAENGSTSNLSTPPPNGASSSDQPER  1124



>emb|CDY53312.1| BnaA09g56690D [Brassica napus]
Length=1096

 Score =  1735 bits (4494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 900/1135 (79%), Positives = 990/1135 (87%), Gaps = 47/1135 (4%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFE+EV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR+IMLVELKKLIEANPLFRDKLQFP+L+NSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARSIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCG PNGARAPSP +NPLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVSNPLLGGLPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P  + VPT LAGWMS+  +V HPAVS GPI L   SIPAALKHPRTPPTNP++DYPS +S
Sbjct  241   PTASPVPTPLAGWMSSPSSVPHPAVSAGPIALGGPSIPAALKHPRTPPTNPALDYPSAES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             +HVSKR R +GIS+EV+L           HGHS A    DDLPK                
Sbjct  301   EHVSKRTRPMGISEEVSLG---------AHGHSPAFKAPDDLPKT---------------  336

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
                   TLLLVGTNVGDI LWEVGSRE+LV + FKVWD+S CSMPLQ ALVK+P VSVN 
Sbjct  337   ------TLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDISKCSMPLQAALVKEPVVSVNR  390

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQ+YSYHG +D+RQHLEIDAHVGGVND++FS PNKQLCVITC
Sbjct  391   VIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVITC  450

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDA  G K++TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNMGS
Sbjct  451   GDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNMGS  510

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTYQGF KRS GV
Sbjct  511   RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYQGFHKRSLGV  570

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNRYLAAGDDFSIKFWDMD+VQ+LT+ID DGGL ASPRIRFNK+G+LLAVS NE
Sbjct  571   VQFDTTKNRYLAAGDDFSIKFWDMDNVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSGNE  630

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             N IKV+AN+DG+RLL TFEN++ +++  A  S         + A+A+ +  A+R A+VV 
Sbjct  631   NVIKVMANSDGLRLLHTFENVSSESSKPAINSL--------AAAAAATSAAADRSANVVS  682

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
                MNGDARN V DVKP ITEE+NDKSK+WKLTE++EPS CR+L+LPENLRV KISRLI+
Sbjct  683   IQAMNGDARNMV-DVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIF  741

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR ERN++GKATA++PPQ WQP+SGILMTND A+ NPE+
Sbjct  742   TNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDAAENNPEE  801

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AVPCFALSKNDSYVMSASGGKISLFNMMTFKTM TFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  802   AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGM  861

Query  1013  DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKS  834
             DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ+S
Sbjct  862   DDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRS  921

Query  833   KFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPIS  657
             K LPLP GR  +  SDTRVQFHQDQ HFLVVHETQLAIYE TKLEC+KQW  RE++API+
Sbjct  922   KVLPLPQGRPNTAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWPVRESSAPIT  981

Query  656   HATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQD  477
             HATFSCDSQLVYASF+DAT+CVF++ANL LRCR+ PSAYL  SLS+S VHPLV+AAHPQ+
Sbjct  982   HATFSCDSQLVYASFMDATICVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQE  1041

Query  476   PNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS--GSNTTP-----VSDQPPR  333
             PN FA+GLSDGGV +FEP+ESEGKWGV PP ENGS  G+  TP      S+QP R
Sbjct  1042  PNMFAVGLSDGGVHIFEPVESEGKWGVAPPAENGSANGAVATPSVGASASEQPQR  1096



>ref|XP_002465540.1| hypothetical protein SORBIDRAFT_01g040800 [Sorghum bicolor]
 gb|EER92538.1| hypothetical protein SORBIDRAFT_01g040800 [Sorghum bicolor]
Length=1125

 Score =  1734 bits (4490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 893/1137 (79%), Positives = 1000/1137 (88%), Gaps = 22/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSMPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P V+HPAVSGG IG    + PAAL KHPRTP T NP +DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFGTPTNPAALLKHPRTPTTANPGMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFP-GHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDH+SKR R +G+S+EVNLP+N+LPV++P  H + Q     DD  K VARTL QGS+PM
Sbjct  300   DSDHISKRTRPVGMSEEVNLPVNMLPVTYPQSHNYQQ-----DDFHKTVARTLTQGSTPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQTLLLVGTNVGDI LW+VG++E+LV+RNFKVWDLS C+M LQ +LVKDP VS
Sbjct  355   SMDFHPLQQTLLLVGTNVGDIGLWDVGTKERLVVRNFKVWDLSKCTMTLQASLVKDPAVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQHLEIDAH+GGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDLRQHLEIDAHIGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+G KQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGTKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMDS  +LT+IDADGGLPASPRIRFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFMIKIWDMDSTGLLTTIDADGGLPASPRIRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NGIK+LAN DG+RLLRT EN ++DA+  A+E+ +KP +   + A+A+++  A   ++
Sbjct  655   TLDNGIKILANADGLRLLRTLENRSFDASRNATETVTKPLILTAANAAAASSSVAAAPSA  714

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             +   + MNGD+R+ V DVKPRI +E+ DKSKVWKL EITE + CR++KL +N+R +KISR
Sbjct  715   I---TAMNGDSRSLV-DVKPRIADESLDKSKVWKLMEITESTQCRSIKLADNMRTSKISR  770

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LAL S+A+HLLWKW R +RN SGKATA++ P LWQP SGI MTND  D N
Sbjct  771   LIYTNSGLAILALTSSAVHLLWKWPRSDRN-SGKATASVSPTLWQPPSGIFMTNDTTDNN  829

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLAFHPQDNNIIA
Sbjct  830   PEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLAFHPQDNNIIA  889

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVR+DEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  890   IGMDDSTIQIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  949

Query  842   QKSKFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             QK++FL +P+GR S   DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  RE + P
Sbjct  950   QKTRFLQIPSGRQSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPP  1009

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DATV +F A++L L+CRI   A   P   S  VHP+VVAAHP
Sbjct  1010  ITHATFSCDSQLIYASFMDATVGIFNASSLRLQCRI-LPASYLPPNISPSVHPVVVAAHP  1068

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
              + +QFALGL+DGGV V EPLESE KWG PPPVENGS SN +TP       SDQP R
Sbjct  1069  SEASQFALGLTDGGVFVLEPLESERKWGNPPPVENGSASNLSTPPPNGASSSDQPER  1125



>gb|ACN26165.1| unknown [Zea mays]
 tpg|DAA44433.1| TPA: hypothetical protein ZEAMMB73_624785 [Zea mays]
 tpg|DAA44434.1| TPA: hypothetical protein ZEAMMB73_624785 [Zea mays]
Length=1128

 Score =  1732 bits (4487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1137 (78%), Positives = 995/1137 (88%), Gaps = 19/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLEQESGF+FN+KYFEDEV NGNWDEVE+YL GF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNIKYFEDEVLNGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLK SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARQIMLAELKKLIEANPLFRDKLQFPSLKTSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSMPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P ++HPAVSGG IG    + PA L KHPRTP T NP +DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAITHPAVSGGAIGFGTPTNPAVLLKHPRTPTTGNPGMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFP-GHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDH+SKR R +G+S+E+NLP+N+LPV++P  H + Q     DD  K VARTL+QGS+PM
Sbjct  300   DSDHISKRTRPVGMSEEMNLPVNMLPVTYPQSHNYQQ-----DDFHKAVARTLSQGSAPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQTLLLVGTNVGDI LW+VG++E+LV+RNFKVWDL  C+M LQ ALVKDP VS
Sbjct  355   SMDFHPLQQTLLLVGTNVGDIGLWDVGTKERLVVRNFKVWDLGKCTMTLQAALVKDPAVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+GAKQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGAKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMDS  +LT+IDADGGL ASPRIRFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFMIKIWDMDSTGLLTTIDADGGLTASPRIRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NGIK+LAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++ A+ + A  +    +
Sbjct  655   TADNGIKILANADGLRLLRTLENRSFDASRNASEAVTKPLINPLTAAANAAAASSSGAGA  714

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
                 + MNGD+R+ V DVKPRI +E+ DKSKVWKL EITE S CR++KL +N+R +KISR
Sbjct  715   PSAITAMNGDSRSLV-DVKPRIADESLDKSKVWKLMEITESSQCRSIKLADNMRTSKISR  773

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LAL S+A+HLLWKW R +RN SGKATA++ P LWQP SGILMTND  D N
Sbjct  774   LIYTNSGLAILALTSSAVHLLWKWPRSDRN-SGKATASVSPTLWQPPSGILMTNDTTDNN  832

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLAFHPQDNNIIA
Sbjct  833   PEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLAFHPQDNNIIA  892

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVR+DEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEK
Sbjct  893   IGMDDSTIQIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEK  952

Query  842   QKSKFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAP  663
             QK++FL +P+GR S   DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  RE + P
Sbjct  953   QKNRFLQIPSGRQSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPP  1012

Query  662   ISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHP  483
             I+HATFSCDSQL+YASF+DATV +F  ++L L+CRI   A   P   S  VHP+VVAAHP
Sbjct  1013  ITHATFSCDSQLIYASFMDATVGIFNGSSLRLQCRI-LPASYLPPNISPSVHPVVVAAHP  1071

Query  482   QDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
              + +QFALGL+DGGV V EPLESE KWG PPPVENGS SN +TP       SDQP R
Sbjct  1072  SEASQFALGLTDGGVFVLEPLESERKWGNPPPVENGSASNLSTPPPNGASSSDQPER  1128



>ref|XP_006649759.1| PREDICTED: protein TOPLESS-like [Oryza brachyantha]
Length=1132

 Score =  1732 bits (4487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 900/1141 (79%), Positives = 1006/1141 (88%), Gaps = 23/1141 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPL+GS+PKPGGFPPLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLIGSIPKPGGFPPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P V+HPAVSGG IG    + PAA LKHPRTP T NPS+DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAILKHPRTPTTANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHST-LDDLPKNVARTLNQGSSPM  2643
             DSDHVSKR R +G+S+EVNLP+N+LPV++P     Q+HS   DD  K VARTL+QGS+PM
Sbjct  300   DSDHVSKRTRPVGMSEEVNLPMNMLPVTYP-----QSHSYPQDDFHKTVARTLSQGSAPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LW+VG++E+LVLRNFKVWD++ CSM LQ +LVKDP VS
Sbjct  355   SMDFHPVQQTLLLVGTNVGDIGLWDVGTKERLVLRNFKVWDVTKCSMALQASLVKDPTVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQ LEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDIRQLLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+GAKQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGAKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMD+  +LT+IDADGGLPASPR+RFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFLIKIWDMDNTSLLTTIDADGGLPASPRVRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
              ++NGIK+LAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++ A+A  +  A   +S
Sbjct  655   THDNGIKILANADGVRLLRTLENRSFDASRSASETVTKPLMNPLTAAAAVASAAAAGTSS  714

Query  1562  VV----GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
                     + +NGD+R+ V DVKPRI EE  DKSKVWKL EITE S CR+LKL +N+R +
Sbjct  715   ANAAPPAITALNGDSRSLV-DVKPRIAEEPLDKSKVWKLMEITESSQCRSLKLTDNMRTS  773

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             KISRLIYTNSG A+LALASNA+HLLWKW R +RNS+GKATA++ PQLWQP SGILMTND+
Sbjct  774   KISRLIYTNSGVAILALASNAVHLLWKWPRNDRNSTGKATASVSPQLWQPPSGILMTNDI  833

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
              D NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  834   TD-NPEEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  892

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGMDDSTIQIYNVR+DEVKSKL+GHSK+ITGLAFS+VLNVLVSSGADAQ+ VWS+D
Sbjct  893   NIIAIGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNVLNVLVSSGADAQICVWSTD  952

Query  854   GWEKQKSKFLPLPAGRASVQS-DTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GW+K K++ L +P+GR +    DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  R
Sbjct  953   GWDKLKNRMLQIPSGRPTSNILDTRVQFHQDQLHFLVVHETQIAIYETTKLEPVKQWPVR  1012

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             E + PI+HA FSCDSQL+YASFLDATVC+F A++L L+CRI   A   P   SS V+P+V
Sbjct  1013  ENSPPITHAMFSCDSQLIYASFLDATVCIFNASSLRLQCRI-LPASYLPQNISSSVYPVV  1071

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP-----VSDQPP  336
             VAAHP +PNQ ALGL+DGGV V EPLESE KWG PPP ENGS SN +TP      SDQP 
Sbjct  1072  VAAHPSEPNQVALGLTDGGVYVLEPLESERKWGNPPPAENGSTSNLSTPPNGASSSDQPE  1131

Query  335   R  333
             R
Sbjct  1132  R  1132



>ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda]
 gb|ERN16630.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda]
Length=1138

 Score =  1729 bits (4477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 866/1141 (76%), Positives = 982/1141 (86%), Gaps = 17/1141 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFED V+NG WDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDAVHNGEWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLE+LDK+DR+KAVEIL KDLKVFSSFNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLESLDKQDRAKAVEILVKDLKVFSSFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKL FPSLK SRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLLFPSLKTSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSPA N L+G++PK  GFPPLGAH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPAGNTLMGAIPKAAGFPPLGAHAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPTN-PSVDYPSG  2820
             P PT +PT LAGWM+N+  V HPAVSGGPIGL  ++ PAAL K PRTPPTN P+VDY + 
Sbjct  241   PTPTPLPTGLAGWMANSAQVPHPAVSGGPIGLGAATNPAALLKRPRTPPTNNPAVDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DS+HV KR R +G+SDEVNLP+N++PV++P   H+Q+  + +DLPK VARTLNQGSS MS
Sbjct  301   DSEHVLKRGRPMGVSDEVNLPVNIMPVTYPSQNHTQSAYSQEDLPKTVARTLNQGSSVMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQT+LLVGTNVGD+ +WEVG+REKL  + FKVWDL ACSM LQ ALVKDP VSV
Sbjct  361   MDFHPVQQTVLLVGTNVGDLGIWEVGTREKLASKGFKVWDLGACSMQLQAALVKDPSVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV  Y YHG DD+R HLEIDAH GGVNDLAFSHPNKQLC+I
Sbjct  421   NRVMWSPDGTLFGVAYSKHIVHTYYYHGGDDLRPHLEIDAHNGGVNDLAFSHPNKQLCII  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDK+IKVWDA  G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTA+DGKIKAWLYDN+
Sbjct  481   TCGDDKSIKVWDAATGNKQYTFEGHEAPVYSVCPHYKENIQFIFSTAVDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAY+ADGTRLFSCGTSKDG+S++VEWNESEG VKRTY GFRKRS 
Sbjct  541   GSRVDYDAPGHWCTTMAYNADGTRLFSCGTSKDGDSYLVEWNESEGVVKRTYAGFRKRSL  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F++KFWDMD+V  L S+DA+GGLPASPRIRFNK+G LLA S 
Sbjct  601   GVVQFDTTKNRFLAAGDEFAVKFWDMDNVNPLISVDAEGGLPASPRIRFNKEGMLLAAS-  659

Query  1739  NENGIKVLANTDGIRLLRTFEN----LaydaaarasesaskpSVNPISVASASNAGFAER  1572
              +NGIK+LAN DG+RLL T EN     +   +   ++S +  S+  +S A  ++ G  +R
Sbjct  660   TDNGIKILANADGLRLLHTLENRSFDASRVNSEAVAKSPTINSLTSVSAAGGTSMGVGDR  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
             VA VV    +NGD R +VGDVKPRIT+E+ +KSK+WKLTEI EPS CR+L+LP+NL   K
Sbjct  720   VAPVVAMVGLNGDNR-SVGDVKPRITDESMEKSKIWKLTEINEPSQCRSLRLPDNLLQIK  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRLIYTNSG A+LALA+NA+H LWKWQR +RN++GKATA++ PQLWQPSSGILMTN+ A
Sbjct  779   VSRLIYTNSGVAILALAANAVHKLWKWQRNDRNTTGKATASVAPQLWQPSSGILMTNENA  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             + NPE+A+PCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQDNN
Sbjct  839   ETNPEEALPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDS+IQIYNVR+DEVKSKLKGH KRITGLAFSH LNVLVSSGADAQL VWS+DG
Sbjct  899   IIAIGMDDSSIQIYNVRIDEVKSKLKGHQKRITGLAFSHALNVLVSSGADAQLCVWSTDG  958

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ  KFL +P GR  +  ++TRVQFHQDQIHFL VHETQ+AIYEA+KLEC+KQWV RE
Sbjct  959   WEKQAGKFLQIPTGRVPASHAETRVQFHQDQIHFLAVHETQIAIYEASKLECLKQWVPRE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++API+HAT+SCDSQL+Y SF+D +V VF+AA L LRCRI       P+  SS  +PLV+
Sbjct  1019  SSAPITHATYSCDSQLIYTSFVDGSVGVFSAATLRLRCRI-NPTAYLPANLSSNTYPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG-------SNTTPVSDQPP  336
             AAHP +PNQFALGL+DGGV V EPLESEGKWG  PP ENG G       S   P S+QPP
Sbjct  1078  AAHPSEPNQFALGLTDGGVHVLEPLESEGKWGTVPPAENGPGPSIPSGPSAAPPQSEQPP  1137

Query  335   R  333
             R
Sbjct  1138  R  1138



>gb|EMT24067.1| hypothetical protein F775_25939 [Aegilops tauschii]
Length=1140

 Score =  1727 bits (4473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 898/1148 (78%), Positives = 1004/1148 (87%), Gaps = 29/1148 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFP LGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPQLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTP-PTNPSVDYPSG  2820
             PAPT V   LAGWMSN P V+HPAVSGG IG    + PAA LKHPRTP   NPS+DYPSG
Sbjct  241   PAPTPV-APLAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAMLKHPRTPSAANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHST-LDDLPKNVARTLNQGSSPM  2643
             DSDHVSKRPR +G+S+EVNLP+N++PV++P     Q+HS   DD  K VARTL+QGS+PM
Sbjct  300   DSDHVSKRPRPVGLSEEVNLPVNMMPVTYP-----QSHSYPQDDFHKAVARTLSQGSAPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LW+VG++E+LV+RNFKVW+L  CSM LQ ALVKDP VS
Sbjct  355   SMDFHPVQQTLLLVGTNVGDIGLWDVGTKERLVVRNFKVWELGKCSMALQAALVKDPTVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+G KQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGTKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMD+  +LT+I+ADGGLPASPRIRFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFVIKIWDMDNTSLLTTIEADGGLPASPRIRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NGIKVLAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++ A+A  A      A+
Sbjct  655   TVDNGIKVLANADGVRLLRTLENRSFDASRSASETVTKPLINPLTAAAAWPAAAGCPPAA  714

Query  1562  VV----------GTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLP  1413
                           + MNGD R+ V DVKPRI +E+ DKSKVWKL EIT+ + CR+LKL 
Sbjct  715   AAATSSGTAAPSSITAMNGDNRSMV-DVKPRIADESMDKSKVWKLMEITDTAQCRSLKLG  773

Query  1412  ENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGI  1233
             +++R  KISRLIYTNSG A+LALASNA+HLLWKW R ERNS+GKATA++ PQLWQP SGI
Sbjct  774   DSIRTAKISRLIYTNSGVAILALASNAVHLLWKWPRNERNSTGKATASVSPQLWQPPSGI  833

Query  1232  LMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatfla  1053
             LMTND  D +P++AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLA
Sbjct  834   LMTNDTIDNSPDEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLA  893

Query  1052  FHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL  873
             FHPQDNNIIAIGMDDSTIQIYNVR+DEVKSKL+GHSK+ITGLAFS+VLNVLVSSGADAQ+
Sbjct  894   FHPQDNNIIAIGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNVLNVLVSSGADAQI  953

Query  872   FVWSSDGWEKQKSKFLPLPAGRASVQS-DTRVQFHQDQIHFLVVHETQLAIYEATKLECV  696
              VW++DGWE+Q+S+FL +P+GR +    DTRVQFHQDQ H LVVHETQ+AIY+A+KLE V
Sbjct  954   CVWNTDGWERQRSRFLQIPSGRPTSNILDTRVQFHQDQQHCLVVHETQIAIYDASKLEPV  1013

Query  695   KQWVQREAAA-PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslss  519
             KQW  RE +A PI+HATFSCDSQL+YASFLDATVC+F+A++L L+CRI   A   P   S
Sbjct  1014  KQWPPRETSAPPITHATFSCDSQLIYASFLDATVCIFSASSLRLQCRI-LPASYLPQNIS  1072

Query  518   SGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP----  354
             S VHP+VVAAHP + NQFALGL+DG V V EPLESE KWG+PPP ENGS SN +TP    
Sbjct  1073  SNVHPVVVAAHPSEANQFALGLTDGSVYVMEPLESERKWGIPPPAENGSTSNMSTPPNGA  1132

Query  353   -VSDQPPR  333
               SDQP R
Sbjct  1133  SSSDQPER  1140



>ref|XP_009405760.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1169

 Score =  1726 bits (4470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 900/1179 (76%), Positives = 1009/1179 (86%), Gaps = 62/1179 (5%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQ+SGF+FNMKYFEDEV+NGNWD VE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQDSGFYFNMKYFEDEVHNGNWDNVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLFRDKLQ P+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLFRDKLQLPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGA APSPAN+PLLGS+PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGALAPSPANSPLLGSMPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAP  VPT LAGWMSN P     AV+GG IGLS  + P A LKHPRTPPT NPS++Y  G
Sbjct  241   PAPAPVPTPLAGWMSNPP-----AVAGGAIGLSAPTNPVAILKHPRTPPTANPSIEY--G  293

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDHV KR R LGISDEVNLP+N+LPVS+P   H+QA  TL+DLPK VARTL+QGS+PMS
Sbjct  294   DSDHVPKRTRPLGISDEVNLPVNILPVSYP-QNHNQAMYTLEDLPKMVARTLSQGSNPMS  352

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQT+LLVGTNVGDIALW+VGSRE+L+L NFKVW++ +CSM LQ +LVKDP VSV
Sbjct  353   MDFHPIQQTILLVGTNVGDIALWDVGSRERLILTNFKVWEIGSCSMSLQASLVKDPAVSV  412

Query  2459  NCITWSPDGSLFG---------------------------------------VAYSRHIV  2397
             N I WSPDGSLFG                                       VAYSRHIV
Sbjct  413   NRIIWSPDGSLFGKLVKTSIFCFVSYILIPCTKKIEDYQGLVTVILPQHCVGVAYSRHIV  472

Query  2396  QIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIKVWDATNGAKQYT  2217
             QI+SYHG DD+RQHLEIDAH GGVND+AF+HPNKQL +ITCGDDKTIKVWDAT+G K YT
Sbjct  473   QIFSYHGADDIRQHLEIDAHTGGVNDVAFAHPNKQLSIITCGDDKTIKVWDATSGTKHYT  532

Query  2216  FEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSAD  2037
             FEGHE+PVYSVCPHHKEN+QFIFSTALDGKIKAWLYDN+GSRVDYDAPG WCTTMAYSAD
Sbjct  533   FEGHESPVYSVCPHHKENIQFIFSTALDGKIKAWLYDNLGSRVDYDAPGHWCTTMAYSAD  592

Query  2036  GTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGVVQFDTTKNRYLAAGDDFSI  1857
             G+RLFSCGTSK+GE+ IVEWNESEGAVKRTYQGFRKRS GVVQFDTT+NR+LAAGD+F I
Sbjct  593   GSRLFSCGTSKEGETFIVEWNESEGAVKRTYQGFRKRSLGVVQFDTTRNRFLAAGDEFLI  652

Query  1856  KFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANENGIKVLANTDGIRLLRTFE  1677
             KFWDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAVS ++NGIK+LAN+DG+RLLRT E
Sbjct  653   KFWDMDNTSLLTTIDADGGLPASPRIRFNKEGTLLAVSTHDNGIKILANSDGLRLLRTLE  712

Query  1676  NLaydaaarasesaskpSVNPISVAS-ASNAGFAERVA-SVVGTSVMNGDARNNVGDVKP  1503
             N ++D +   SE+ +KP ++P+S A+ A+ +G  +R A   +  + M+GD RN V DVKP
Sbjct  713   NHSFDTSRTVSETVTKPIISPLSAAAVATTSGITDRTALPPMAIAGMSGDCRNLV-DVKP  771

Query  1502  RITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihl  1323
             +I +E+ DKSK+W L+E+ EP+ CR+L+L +NLR +KISRLIYTNSG A+LALASNAIHL
Sbjct  772   KIADESMDKSKIWILSELNEPTQCRSLRLVDNLRTSKISRLIYTNSGFAILALASNAIHL  831

Query  1322  LWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSA  1143
             LWKW R ERNSSGKATA++ PQLWQP SGILMTND+ D NPE+ V CFALSKNDSYVMSA
Sbjct  832   LWKWPRNERNSSGKATASVAPQLWQPPSGILMTNDITDTNPEEPVHCFALSKNDSYVMSA  891

Query  1142  SGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKS  963
             SGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQ YNVRVDEVKS
Sbjct  892   SGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQTYNVRVDEVKS  951

Query  962   KLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGRA-SVQSDT  786
             KL+GHSKRITGLAFS+VLNVLVSSGADAQL VW +DGWEKQ+S+FL +P+G   S  SDT
Sbjct  952   KLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWGTDGWEKQRSRFLQIPSGYTPSTISDT  1011

Query  785   RVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLD  606
             RVQFHQDQ HFLVVHETQ+AI+E TKLEC+KQW  R+ +APISHAT SCDSQL+Y SFLD
Sbjct  1012  RVQFHQDQKHFLVVHETQIAIFETTKLECMKQWAPRDGSAPISHATLSCDSQLIYVSFLD  1071

Query  605   ATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFE  426
             ATVC+F A NL LRCRI P+AYL PS+S++ V+P+V+AAHP +PNQFALGL+DGGV V E
Sbjct  1072  ATVCIFNAMNLRLRCRILPAAYLPPSVSTT-VYPVVIAAHPSEPNQFALGLTDGGVHVLE  1130

Query  425   PLESEGKWGVPPPVENGSGSN-TTP-------VSDQPPR  333
             PLESEGKWGV PP ENGS SN +TP        SDQP R
Sbjct  1131  PLESEGKWGVSPPAENGSASNMSTPPPAGAASSSDQPQR  1169



>gb|EMS49891.1| Topless-related protein 1 [Triticum urartu]
Length=1101

 Score =  1721 bits (4456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 890/1138 (78%), Positives = 987/1138 (87%), Gaps = 48/1138 (4%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFP LGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPQLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTP-PTNPSVDYPSG  2820
             PAPT V   LAGWMSN P V+HPAVSGG IG    + PAA LKHPRTP   NPS+DYPSG
Sbjct  241   PAPTPV-APLAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAMLKHPRTPSAANPSMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHST-LDDLPKNVARTLNQGSSPM  2643
             DSDHVSKRPR +G+S+EVNLP+N++PV++P     Q+HS   DD  K VARTL+QGS+PM
Sbjct  300   DSDHVSKRPRPVGLSEEVNLPVNMMPVTYP-----QSHSYPQDDFHKAVARTLSQGSAPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTNVGDI LW+VG++E+LV+RNFKVW+L  CSM LQ ALVKDP VS
Sbjct  355   SMDFHPVQQTLLLVGTNVGDIGLWDVGTKERLVVRNFKVWELGKCSMALQAALVKDPTVS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYSRHIVQIYSYHG DD+RQHLEIDAHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSRHIVQIYSYHGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+G KQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGTKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMD+  +LT+I+ADGGLPASPRIRFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFVIKIWDMDNTSLLTTIEADGGLPASPRIRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NGIKVLAN DG+RLLRT EN ++D                           A R AS
Sbjct  655   TVDNGIKVLANADGVRLLRTLENRSFD---------------------------ASRSAS  687

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
                T   NGD R+ V DVKPRI +E+ DKSKVWKL EIT+ + CR+LKL +++R  KISR
Sbjct  688   --ETVTKNGDNRSMV-DVKPRIADESMDKSKVWKLMEITDTAQCRSLKLGDSIRTAKISR  744

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LALASNA+HLLWKW R ERNS+GKATA++ PQLWQP SGILMTND  D +
Sbjct  745   LIYTNSGVAILALASNAVHLLWKWPRNERNSTGKATASVSPQLWQPPSGILMTNDTIDNS  804

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             P++AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  805   PDEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  864

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDSTIQIYNVR+DEVKSKL+GHSK+ITGLAFS+VLNVLVSSGADAQ+ VW++DGWE+
Sbjct  865   IGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNVLNVLVSSGADAQICVWNTDGWER  924

Query  842   QKSKFLPLPAGRASVQS-DTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q+S+FL +P+GR +    DTRVQFHQDQ H LVVHETQ+AIY+A+KLE VKQW  RE +A
Sbjct  925   QRSRFLQIPSGRPTSNILDTRVQFHQDQQHCLVVHETQIAIYDASKLEPVKQWPPRETSA  984

Query  665   -PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
              PI+HATFSCDSQL+YASFLDATVC+F+A++L L+CRI   A   P   SS VHP+VVAA
Sbjct  985   PPITHATFSCDSQLIYASFLDATVCIFSASSLRLQCRI-LPASYLPQNISSNVHPVVVAA  1043

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP-----VSDQPPR  333
             HP + NQFALGL+DG V V EPLESE KWG+PPP ENGS SN +TP      SDQP R
Sbjct  1044  HPSEANQFALGLTDGSVYVMEPLESERKWGIPPPAENGSTSNMSTPPNGASSSDQPER  1101



>ref|XP_003558327.1| PREDICTED: topless-related protein 1-like [Brachypodium distachyon]
Length=1134

 Score =  1720 bits (4455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 887/1142 (78%), Positives = 1006/1142 (88%), Gaps = 23/1142 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FNMKYFEDEV NGNWDEVE+YL GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFP LGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPQLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAPT V   LAGWMSN P V+HPAVSGG IG    + PAA LKHPRTP T NP++DYP G
Sbjct  241   PAPTPV-APLAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAMLKHPRTPSTANPAMDYPPG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFP-GHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDH+SKRPR +G+S+EVNLP+N++PV++P  H + Q     +D  K VARTL+QGS+PM
Sbjct  300   DSDHLSKRPRPIGLSEEVNLPVNMMPVTYPQNHSYPQ-----EDFHKAVARTLSQGSTPM  354

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQTLLLVGTNVG+I LW+VGS+E+LV+R FKVW+++ CSMPLQ ALVK+P +S
Sbjct  355   SMDFHPIQQTLLLVGTNVGEIGLWDVGSKERLVVRAFKVWEVAKCSMPLQAALVKEPSIS  414

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN I WSPDG+LFGVAYS+HIVQIY+Y G DD+RQHLEI+AHVGGVND+AF+HPNKQLC+
Sbjct  415   VNRIIWSPDGTLFGVAYSKHIVQIYAYQGGDDIRQHLEIEAHVGGVNDIAFAHPNKQLCI  474

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDKTIKVW+AT+G KQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  475   ITCGDDKTIKVWEATSGVKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  534

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG WCTTM+YSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS
Sbjct  535   LGSRVDYDAPGHWCTTMSYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRS  594

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTT+NR+LAAGD+F IK WDMD+  +LT+IDA+GGLPASPRIRFNK+GTLLAVS
Sbjct  595   MGVVQFDTTRNRFLAAGDEFVIKIWDMDNTSLLTTIDAEGGLPASPRIRFNKEGTLLAVS  654

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NGIKVLAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++ A+ ++A  A    S
Sbjct  655   TADNGIKVLANADGVRLLRTLENRSFDASRSASETVTKPLINPLTAAAVASAAAAAAATS  714

Query  1562  V-----VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
                      + MNGD+R+ V DVKPRI +E+ DKSKVWKL EI + + CR+LKL +++R 
Sbjct  715   SGTAAPAAITAMNGDSRSLV-DVKPRIADESMDKSKVWKLIEIADTTQCRSLKLSDSVRT  773

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             TKISRLIYTNSG A+LALASNA+HLLWKW R +RNSSGKATA++ PQLWQP SGILMTND
Sbjct  774   TKISRLIYTNSGVAILALASNAVHLLWKWPRNDRNSSGKATASVSPQLWQPPSGILMTND  833

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
               D +PEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  834   PHDNSPEDAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  893

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGMDDSTIQIYNVR+DEVKSKL+GHSK+ITGLAFS+VLNVLVSSGADAQ+ VW++
Sbjct  894   NNIIAIGMDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNVLNVLVSSGADAQICVWNT  953

Query  857   DGWEKQKSKFLPLPAGRASVQS-DTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWE+Q+S+FL +P+GR +    DTRVQFHQDQ+H LVVHETQ+AIY+A+KLE +KQW  
Sbjct  954   DGWERQRSRFLQIPSGRTTSNILDTRVQFHQDQLHCLVVHETQIAIYDASKLEPMKQWPV  1013

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             RE +API+HATFSCDSQL+YASFLDATVC+F+A++L L+CRI   A   P   SS VHP+
Sbjct  1014  RENSAPITHATFSCDSQLIYASFLDATVCIFSASSLRLQCRI-LPASYLPPNISSSVHPV  1072

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP-----VSDQP  339
             VVAAHP + NQFALGL+DG V V EPLESE KWG PPPVENGS SN +TP      SDQP
Sbjct  1073  VVAAHPSEANQFALGLTDGTVYVMEPLESERKWGNPPPVENGSTSNLSTPPNGASSSDQP  1132

Query  338   PR  333
              R
Sbjct  1133  ER  1134



>ref|XP_010063532.1| PREDICTED: protein TOPLESS isoform X2 [Eucalyptus grandis]
 gb|KCW70754.1| hypothetical protein EUGRSUZ_F03923 [Eucalyptus grandis]
Length=1118

 Score =  1719 bits (4451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 893/1117 (80%), Positives = 984/1117 (88%), Gaps = 25/1117 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FN+++FEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNVRHFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELF+EIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILIKDLKVFSTFNEELFREITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDHSCGQPNGARAPSPAN+PLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRSNPDIKTLFVDHSCGQPNGARAPSPANSPLLGPLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTP-TVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             PAP  VPT LAGWMSN P TV+HP V GG +                         P   
Sbjct  241   PAPAAVPTPLAGWMSNPPSTVTHPVVPGGGVIGLGGP-----------------SIPGDA  283

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SD VSKR R LGI DEVNLP+NVLPV+FPGHGH+ A ++ DDLPK V R LN GSSPMSM
Sbjct  284   SDPVSKRTRPLGIVDEVNLPVNVLPVTFPGHGHAPAFTS-DDLPKAVGRILNPGSSPMSM  342

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQTLLLVGTNVGDI+LW+V SRE+L+ +NFKVWDLS C+  LQ ALVKDPGVSVN
Sbjct  343   DFHPVQQTLLLVGTNVGDISLWDVVSRERLLSKNFKVWDLSCCTTTLQAALVKDPGVSVN  402

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              I WSPDGSLFGVAYS H+VQ++S++ N++VRQHLEIDAHVGGVNDLAF+ PNKQLCVIT
Sbjct  403   RIMWSPDGSLFGVAYSLHVVQLFSFNVNNEVRQHLEIDAHVGGVNDLAFAQPNKQLCVIT  462

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH KEN+QFIFSTALDGKIKAWLYDNMG
Sbjct  463   CGDDKTIKVWDAVTGVKRHTFEGHEAPVYSVCPHSKENIQFIFSTALDGKIKAWLYDNMG  522

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  523   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRSFG  582

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             V+QFDTT+NRYLAAGDDFSIK WDMD+V +LT++DADGGL ASPR+RFNKDG+LLAVS N
Sbjct  583   VIQFDTTRNRYLAAGDDFSIKVWDMDNVNLLTTLDADGGLTASPRVRFNKDGSLLAVSIN  642

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASAS---NAGFAERVA  1566
             ENGIK+LAN+DG+RLLRTFEN      +R  E+  KP VNPI+  +A+   +AG A+R A
Sbjct  643   ENGIKILANSDGMRLLRTFENF-SYDVSRTPETLVKPKVNPITATAATAPISAGLADRGA  701

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
               V TS MNGDAR  +GDVKPRITEE+N+KSK+WKLTEI+EPS CR+L+LPEN R  KIS
Sbjct  702   PAVVTSGMNGDAR-ILGDVKPRITEESNEKSKLWKLTEISEPSLCRSLRLPENQRANKIS  760

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSGSA+LALASNA+HLLWKWQR +RNS+GKATA++ PQ WQPSSGI+MTNDV   
Sbjct  761   RLIYTNSGSAILALASNAVHLLWKWQRNDRNSTGKATASVAPQQWQPSSGIVMTNDVNKN  820

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI+
Sbjct  821   NPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIL  880

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDST+QIYNVRVDEVKSKLKGHSKRITGLAFS+ LNVLVSSGADAQ+ VWSSD WE
Sbjct  881   AIGMDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFSNTLNVLVSSGADAQICVWSSDVWE  940

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS +L +P GR    QSDTRVQFHQDQ+HFL VH TQLA+YEATKLEC+KQWV  E++
Sbjct  941   KQKSTYLQIPPGRTPGAQSDTRVQFHQDQMHFLAVHGTQLAVYEATKLECMKQWVPYESS  1000

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHATFSCDSQLVYASF DA++CVF AANL ++CRI PSAYL  ++S+S VHPLV+AA
Sbjct  1001  APISHATFSCDSQLVYASFFDASICVFNAANLRMQCRINPSAYLPATVSNSNVHPLVIAA  1060

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVEN  378
             HP +PNQFALGLSDGGV VFEPL+S  +WG+PPP EN
Sbjct  1061  HPHEPNQFALGLSDGGVHVFEPLDSHSRWGMPPPAEN  1097



>gb|KCW70755.1| hypothetical protein EUGRSUZ_F03923 [Eucalyptus grandis]
 gb|KCW70756.1| hypothetical protein EUGRSUZ_F03923 [Eucalyptus grandis]
 gb|KCW70757.1| hypothetical protein EUGRSUZ_F03923 [Eucalyptus grandis]
Length=1118

 Score =  1717 bits (4447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 892/1117 (80%), Positives = 983/1117 (88%), Gaps = 25/1117 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGF+FN+++FEDEV+NGNWDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNVRHFEDEVHNGNWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELF+EIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILIKDLKVFSTFNEELFREITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDHSCGQPNGARAPSPAN+PLLG +PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRSNPDIKTLFVDHSCGQPNGARAPSPANSPLLGPLPKVGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTP-TVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             PAP  VPT LAGWMSN P TV+HP V GG +                         P   
Sbjct  241   PAPAAVPTPLAGWMSNPPSTVTHPVVPGGGVIGLGGP-----------------SIPGDA  283

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SD VSKR R LGI DEVNLP+NVLPV+FPGHGH+ A ++ DDLPK V R LN GSSPMSM
Sbjct  284   SDPVSKRTRPLGIVDEVNLPVNVLPVTFPGHGHAPAFTS-DDLPKAVGRILNPGSSPMSM  342

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQTLLLVGTNVGDI+LW+V SRE+L+ +NFKVWDLS C+  LQ  LVKDPGVSVN
Sbjct  343   DFHPVQQTLLLVGTNVGDISLWDVVSRERLLSKNFKVWDLSCCTTTLQATLVKDPGVSVN  402

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              I WSPDGSLFGVAYS H+VQ++S++ N++VRQHLEIDAHVGGVNDLAF+ PNKQLCVIT
Sbjct  403   RIMWSPDGSLFGVAYSLHVVQLFSFNVNNEVRQHLEIDAHVGGVNDLAFAQPNKQLCVIT  462

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDDKTIKVWDA  G K++TFEGHEAPVYSVCPH KEN+QFIFSTALDGKIKAWLYDNMG
Sbjct  463   CGDDKTIKVWDAVTGVKRHTFEGHEAPVYSVCPHSKENIQFIFSTALDGKIKAWLYDNMG  522

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGES IVEWNESEGAVKRTYQGFRKRSFG
Sbjct  523   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFRKRSFG  582

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             V+QFDTT+NRYLAAGDDFSIK WDMD+V +LT++DADGGL ASPR+RFNKDG+LLAVS N
Sbjct  583   VIQFDTTRNRYLAAGDDFSIKVWDMDNVNLLTTLDADGGLTASPRVRFNKDGSLLAVSIN  642

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASAS---NAGFAERVA  1566
             ENGIK+LAN+DG+RLLRTFEN      +R  E+  KP VNPI+  +A+   +AG A+R A
Sbjct  643   ENGIKILANSDGMRLLRTFENF-SYDVSRTPETLVKPKVNPITATAATAPISAGLADRGA  701

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
               V TS MNGDAR  +GDVKPRITEE+N+KSK+WKLTEI+EPS CR+L+LPEN R  KIS
Sbjct  702   PAVVTSGMNGDAR-ILGDVKPRITEESNEKSKLWKLTEISEPSLCRSLRLPENQRANKIS  760

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSGSA+LALASNA+HLLWKWQR +RNS+GKATA++ PQ WQPSSGI+MTNDV   
Sbjct  761   RLIYTNSGSAILALASNAVHLLWKWQRNDRNSTGKATASVAPQQWQPSSGIVMTNDVNKN  820

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI+
Sbjct  821   NPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIL  880

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDST+QIYNVRVDEVKSKLKGHSKRITGLAFS+ LNVLVSSGADAQ+ VWSSD WE
Sbjct  881   AIGMDDSTVQIYNVRVDEVKSKLKGHSKRITGLAFSNTLNVLVSSGADAQICVWSSDVWE  940

Query  845   KQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQKS +L +P GR    QSDTRVQFHQDQ+HFL VH TQLA+YEATKLEC+KQWV  E++
Sbjct  941   KQKSTYLQIPPGRTPGAQSDTRVQFHQDQMHFLAVHGTQLAVYEATKLECMKQWVPYESS  1000

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
             APISHATFSCDSQLVYASF DA++CVF AANL ++CRI PSAYL  ++S+S VHPLV+AA
Sbjct  1001  APISHATFSCDSQLVYASFFDASICVFNAANLRMQCRINPSAYLPATVSNSNVHPLVIAA  1060

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVEN  378
             HP +PNQFALGLSDGGV VFEPL+S  +WG+PPP EN
Sbjct  1061  HPHEPNQFALGLSDGGVHVFEPLDSHSRWGMPPPAEN  1097



>gb|KGN52925.1| hypothetical protein Csa_4G006320 [Cucumis sativus]
Length=1085

 Score =  1706 bits (4419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 910/1141 (80%), Positives = 984/1141 (86%), Gaps = 70/1141 (6%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVDILVKDLKVFSTFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPHLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSLPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P    VP  LAGWMSN   V+HPAVSGG  IGL   SIPAALKHPRTPPTNPSV+YPS D
Sbjct  241   PTAAPVPAPLAGWMSNPSAVTHPAVSGGGAIGLGAPSIPAALKHPRTPPTNPSVEYPSAD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             SDHVSKRP+ +G+SDEVNLP+NVLPVSF GHGH+Q  +  DDLPK V RTLNQGS+PMSM
Sbjct  301   SDHVSKRPKPMGMSDEVNLPVNVLPVSFTGHGHAQNFNAPDDLPKTVMRTLNQGSNPMSM  360

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHP+QQTLLLVGTNVG+I LWEVGSRE+LV +NFKVWDL+ACSMPLQ ALVK+      
Sbjct  361   DFHPIQQTLLLVGTNVGEIGLWEVGSRERLVSKNFKVWDLNACSMPLQAALVKE------  414

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
                  PD S+  V +S                                   P+  L   T
Sbjct  415   -----PDVSVNRVIWS-----------------------------------PDGSLFGKT  434

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
                     VWDA NGA+QY FEGHEAPV+SVCPH+KEN+QFIFSTALDGKIKAWLYDNMG
Sbjct  435   --------VWDAGNGARQYIFEGHEAPVFSVCPHYKENIQFIFSTALDGKIKAWLYDNMG  486

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDG+S+IVEWNESEGAVKRTYQGFRKRS G
Sbjct  487   SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGDSYIVEWNESEGAVKRTYQGFRKRSLG  546

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVS N
Sbjct  547   VVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSGN  606

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPIS-----VASASNAGFAER  1572
             ENGIK+LAN DGIRLLRTFENL    AAR SE+ +KP++NPIS      A+A+    A+R
Sbjct  607   ENGIKILANVDGIRLLRTFENL-SYDAARTSEAGTKPTINPISAAAAVAAAAAAGSAADR  665

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              ASVV  S + GD+R ++GDVKPRI E++NDKSK+WKLTEI EPS CR+L+LPEN+RV K
Sbjct  666   GASVVTMSGVAGDSR-SLGDVKPRIPEDSNDKSKIWKLTEINEPSQCRSLRLPENVRVNK  724

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSGSA+LALASNAIHLLWKW R ERNS+GKATAN+ PQLWQPSSGILMTNDVA
Sbjct  725   ISRLIYTNSGSAILALASNAIHLLWKWTRSERNSTGKATANVLPQLWQPSSGILMTNDVA  784

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D + E+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  785   DTSSEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  844

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSH+LNVLVSSGADAQL VWSSD 
Sbjct  845   IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHLLNVLVSSGADAQLCVWSSDV  904

Query  851   WEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQK++FL LP+GR  S QSDTRVQFHQDQ+HFLVVHETQ+AIYE TKLECVKQW  RE
Sbjct  905   WEKQKTRFLQLPSGRPPSSQSDTRVQFHQDQVHFLVVHETQIAIYETTKLECVKQWTPRE  964

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             + APISHATFSCDSQ++YASFLDATVCVFT A+L LRCRI+PSAYL  S+S++ V PLV+
Sbjct  965   SGAPISHATFSCDSQMIYASFLDATVCVFTVASLRLRCRISPSAYLPASVSNASVQPLVI  1024

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN--TTPV-----SDQPP  336
             AAHPQ+ NQFALGLSDGGV VFEPLESEGKWGVPPPVENGS S+  TTP      S+Q P
Sbjct  1025  AAHPQEANQFALGLSDGGVHVFEPLESEGKWGVPPPVENGSASSVPTTPSVGASGSEQAP  1084

Query  335   R  333
             R
Sbjct  1085  R  1085



>tpg|DAA44432.1| TPA: hypothetical protein ZEAMMB73_624785 [Zea mays]
Length=1114

 Score =  1706 bits (4418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 881/1136 (78%), Positives = 982/1136 (86%), Gaps = 31/1136 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLEQESGF+FN+KYFEDEV NGNWDEVE+YL GF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNIKYFEDEVLNGNWDEVERYLGGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLK SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARQIMLAELKKLIEANPLFRDKLQFPSLKTSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN+PLLGS+PKPGGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANSPLLGSMPKPGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPT-NPSVDYPSG  2820
             PAPT VP  LAGWMSN P ++HPAVSGG IG    + PA L KHPRTP T NP +DYPSG
Sbjct  241   PAPTPVPP-LAGWMSNPPAITHPAVSGGAIGFGTPTNPAVLLKHPRTPTTGNPGMDYPSG  299

Query  2819  DSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             DSDH+SKR R +G+S+E              H + Q     DD  K VARTL+QGS+PMS
Sbjct  300   DSDHISKRTRPVGMSEE-------------SHNYQQ-----DDFHKAVARTLSQGSAPMS  341

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQTLLLVGTNVGDI LW+VG++E+LV+RNFKVWDL  C+M LQ ALVKDP VSV
Sbjct  342   MDFHPLQQTLLLVGTNVGDIGLWDVGTKERLVVRNFKVWDLGKCTMTLQAALVKDPAVSV  401

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N I WSPDG+LFGVAYSRHIVQIYSY+G DD+RQHLEIDAHVGGVND+AF+HPNKQLC+I
Sbjct  402   NRIIWSPDGTLFGVAYSRHIVQIYSYNGGDDIRQHLEIDAHVGGVNDIAFAHPNKQLCII  461

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDKTIKVW+AT+GAKQ+TFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  462   TCGDDKTIKVWEATSGAKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  521

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG WCTTMAYSADG+RLFSCGTSKDGESH+VEWNESEGAVKRTYQGFRKRS 
Sbjct  522   GSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRSM  581

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTT+NR+LAAGD+F IK WDMDS  +LT+IDADGGL ASPRIRFNK+GTLLAVS 
Sbjct  582   GVVQFDTTRNRFLAAGDEFMIKIWDMDSTGLLTTIDADGGLTASPRIRFNKEGTLLAVST  641

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
              +NGIK+LAN DG+RLLRT EN ++DA+  ASE+ +KP +NP++ A+ + A  +    + 
Sbjct  642   ADNGIKILANADGLRLLRTLENRSFDASRNASEAVTKPLINPLTAAANAAAASSSGAGAP  701

Query  1559  VGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRL  1380
                + MNGD+R+ V DVKPRI +E+ DKSKVWKL EITE S CR++KL +N+R +KISRL
Sbjct  702   SAITAMNGDSRSLV-DVKPRIADESLDKSKVWKLMEITESSQCRSIKLADNMRTSKISRL  760

Query  1379  IYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNP  1200
             IYTNSG A+LAL S+A+HLLWKW R +RN SGKATA++ P LWQP SGILMTND  D NP
Sbjct  761   IYTNSGLAILALTSSAVHLLWKWPRSDRN-SGKATASVSPTLWQPPSGILMTNDTTDNNP  819

Query  1199  EDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAI  1020
             E+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLAFHPQDNNIIAI
Sbjct  820   EEAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLAFHPQDNNIIAI  879

Query  1019  GMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEKQ  840
             GMDDSTIQIYNVR+DEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW++DGWEKQ
Sbjct  880   GMDDSTIQIYNVRIDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQ  939

Query  839   KSKFLPLPAGRASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAAPI  660
             K++FL +P+GR S   DTRVQFHQDQ+HFLVVHETQ+AIYE TKLE VKQW  RE + PI
Sbjct  940   KNRFLQIPSGRQSNILDTRVQFHQDQMHFLVVHETQIAIYETTKLEPVKQWPVRENSPPI  999

Query  659   SHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAHPQ  480
             +HATFSCDSQL+YASF+DATV +F  ++L L+CRI   A   P   S  VHP+VVAAHP 
Sbjct  1000  THATFSCDSQLIYASFMDATVGIFNGSSLRLQCRI-LPASYLPPNISPSVHPVVVAAHPS  1058

Query  479   DPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP------VSDQPPR  333
             + +QFALGL+DGGV V EPLESE KWG PPPVENGS SN +TP       SDQP R
Sbjct  1059  EASQFALGLTDGGVFVLEPLESERKWGNPPPVENGSASNLSTPPPNGASSSDQPER  1114



>ref|XP_008456966.1| PREDICTED: topless-related protein 4-like isoform X2 [Cucumis 
melo]
Length=1135

 Score =  1655 bits (4287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 843/1138 (74%), Positives = 962/1138 (85%), Gaps = 14/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK   FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAAAFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S  PIGL+V++  A LK PRTPPTN P++DY + D
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAAPIGLNVANNAAILKRPRTPPTNNPTMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDE-VNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R  G+S+E  NLP+N+LPV +   GH Q+  + DDLPKNV  TL+QGS   S
Sbjct  301   SEHVLKRSRPFGLSEEGTNLPVNILPVGYGNQGHGQSSYSSDDLPKNVVTTLSQGSIVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP QQT+LLVGTNVGD+ +WEVG RE++ +RNFKVWDLSACS+PLQ +L  D   S+
Sbjct  361   MDFHPQQQTILLVGTNVGDVMIWEVGGRERIAIRNFKVWDLSACSVPLQASLASDYTASI  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV IYSY   D++R HLEI+AHVG VNDLAFS+PNKQLC++
Sbjct  421   NRVMWSPDGTLFGVAYSKHIVHIYSYQAGDELRNHLEIEAHVGSVNDLAFSYPNKQLCLV  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  G KQ+TFEGH+APVYS+CPHHKEN+QFIFSTA DGKIKAWLYDNM
Sbjct  481   TCGEDRVIKVWDAVTGVKQFTFEGHDAPVYSICPHHKENIQFIFSTAADGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRTYQG  KRS 
Sbjct  541   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTYQGLGKRSV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFS+KFWDMDSV +LTSIDADGGLPASP IRFNKDG LLAVS 
Sbjct  601   GVVQFDTTKNRFLAAGDDFSVKFWDMDSVNILTSIDADGGLPASPCIRFNKDGVLLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAER  1572
             N+NGIK+LAN +GIR+LRT EN  +DA+  AS +  K     S  P +V+   + G  +R
Sbjct  661   NDNGIKILANAEGIRMLRTVENRTFDASRVASAAVVKAPPIGSFGPPAVSVGMSIG--DR  718

Query  1571  VASVVGTSV-MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
                V    V +N D+R ++ DVKPRI +E+ DKS++WKLTEI EP+ CR+L+LP+NL  +
Sbjct  719   TPPVAAAMVGINNDSR-SLADVKPRIADESVDKSRIWKLTEINEPTQCRSLRLPDNLTAS  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             ++SRLIYTNSG A+LALASNA+H LW+WQR +RN + KATA++ PQLWQP SGILMTND+
Sbjct  778   RVSRLIYTNSGLAILALASNAVHKLWRWQRNDRNVTVKATASVAPQLWQPPSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEV++KLKGH KRITGLAFS+ LNVLVSSGAD+QL VWS+D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVRTKLKGHQKRITGLAFSNQLNVLVSSGADSQLCVWSTD  957

Query  854   GWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQ +KFL +P+ R +   +DTRVQFH DQIH L +HETQ+AIYEA KLEC+KQWV R
Sbjct  958   GWEKQVNKFLQVPSSRTTAPLADTRVQFHIDQIHLLAIHETQIAIYEAPKLECLKQWVPR  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             EA+ PI+HATFSCDSQ +Y SF D +V V TA+ L LRCRI P+AYL  + SS  VHPLV
Sbjct  1018  EASGPITHATFSCDSQSIYVSFEDGSVGVLTASTLRLRCRINPNAYLPSNPSSLRVHPLV  1077

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS---DQPPR  333
             +AAHP +PNQFALGLSDGGV V EP ESEGKWG  PPVENG+G +T   +   DQP R
Sbjct  1078  IAAHPSEPNQFALGLSDGGVHVLEPSESEGKWGTSPPVENGAGPSTATGAAGPDQPQR  1135



>ref|XP_009405761.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1132

 Score =  1654 bits (4282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 865/1142 (76%), Positives = 972/1142 (85%), Gaps = 62/1142 (5%)
 Frame = -3

Query  3602  MKYFEDEVNNGNWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEIL  3423
             MKYFEDEV+NGNWD VE+YLSGFTKVDDNRYSMKIFFEIRKQKYLEALDK DR+KAVEIL
Sbjct  1     MKYFEDEVHNGNWDNVERYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRAKAVEIL  60

Query  3422  TKDLKVFSSFNEELFKEITHLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLF  3243
              KDLKVF+SFNEELFKEIT LLTLENFRENEQLSKYGDTKSAR IMLVELKKLIEANPLF
Sbjct  61    VKDLKVFASFNEELFKEITQLLTLENFRENEQLSKYGDTKSARTIMLVELKKLIEANPLF  120

Query  3242  RDKLQFPSLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPAN  3063
             RDKLQ P+LK+SRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGA APSPAN
Sbjct  121   RDKLQLPNLKSSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGALAPSPAN  180

Query  3062  NPLLGSVPKPGGFPPLGAHGPFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSI  2883
             +PLLGS+PK GGFPPLGAHGPFQPAP  VPT LAGWMSN P     AV+GG IGLS  + 
Sbjct  181   SPLLGSMPKAGGFPPLGAHGPFQPAPAPVPTPLAGWMSNPP-----AVAGGAIGLSAPTN  235

Query  2882  PAA-LKHPRTPPT-NPSVDYPSGDSDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQA  2709
             P A LKHPRTPPT NPS++Y  GDSDHV KR R LGISDEVNLP+N+LPVS+P   H+QA
Sbjct  236   PVAILKHPRTPPTANPSIEY--GDSDHVPKRTRPLGISDEVNLPVNILPVSYP-QNHNQA  292

Query  2708  HSTLDDLPKNVARTLNQGSSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFK  2529
               TL+DLPK VARTL+QGS+PMSMDFHP+QQT+LLVGTNVGDIALW+VGSRE+L+L NFK
Sbjct  293   MYTLEDLPKMVARTLSQGSNPMSMDFHPIQQTILLVGTNVGDIALWDVGSRERLILTNFK  352

Query  2528  VWDLSACSMPLQTALVKDPGVSVNCITWSPDGSLFG------------------------  2421
             VW++ +CSM LQ +LVKDP VSVN I WSPDGSLFG                        
Sbjct  353   VWEIGSCSMSLQASLVKDPAVSVNRIIWSPDGSLFGKLVKTSIFCFVSYILIPCTKKIED  412

Query  2420  ---------------VAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
                            VAYSRHIVQI+SYHG DD+RQHLEIDAH GGVND+AF+HPNKQL 
Sbjct  413   YQGLVTVILPQHCVGVAYSRHIVQIFSYHGADDIRQHLEIDAHTGGVNDVAFAHPNKQLS  472

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             +ITCGDDKTIKVWDAT+G K YTFEGHE+PVYSVCPHHKEN+QFIFSTALDGKIKAWLYD
Sbjct  473   IITCGDDKTIKVWDATSGTKHYTFEGHESPVYSVCPHHKENIQFIFSTALDGKIKAWLYD  532

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             N+GSRVDYDAPG WCTTMAYSADG+RLFSCGTSK+GE+ IVEWNESEGAVKRTYQGFRKR
Sbjct  533   NLGSRVDYDAPGHWCTTMAYSADGSRLFSCGTSKEGETFIVEWNESEGAVKRTYQGFRKR  592

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTT+NR+LAAGD+F IKFWDMD+  +LT+IDADGGLPASPRIRFNK+GTLLAV
Sbjct  593   SLGVVQFDTTRNRFLAAGDEFLIKFWDMDNTSLLTTIDADGGLPASPRIRFNKEGTLLAV  652

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS-ASNAGFAERV  1569
             S ++NGIK+LAN+DG+RLLRT EN ++D +   SE+ +KP ++P+S A+ A+ +G  +R 
Sbjct  653   STHDNGIKILANSDGLRLLRTLENHSFDTSRTVSETVTKPIISPLSAAAVATTSGITDRT  712

Query  1568  A-SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
             A   +  + M+GD RN V DVKP+I +E+ DKSK+W L+E+ EP+ CR+L+L +NLR +K
Sbjct  713   ALPPMAIAGMSGDCRNLV-DVKPKIADESMDKSKIWILSELNEPTQCRSLRLVDNLRTSK  771

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG A+LALASNAIHLLWKW R ERNSSGKATA++ PQLWQP SGILMTND+ 
Sbjct  772   ISRLIYTNSGFAILALASNAIHLLWKWPRNERNSSGKATASVAPQLWQPPSGILMTNDIT  831

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPE+ V CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  832   DTNPEEPVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  891

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDSTIQ YNVRVDEVKSKL+GHSKRITGLAFS+VLNVLVSSGADAQL VW +DG
Sbjct  892   IIAIGMDDSTIQTYNVRVDEVKSKLRGHSKRITGLAFSNVLNVLVSSGADAQLCVWGTDG  951

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ+S+FL +P+G   S  SDTRVQFHQDQ HFLVVHETQ+AI+E TKLEC+KQW  R+
Sbjct  952   WEKQRSRFLQIPSGYTPSTISDTRVQFHQDQKHFLVVHETQIAIFETTKLECMKQWAPRD  1011

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
              +APISHAT SCDSQL+Y SFLDATVC+F A NL LRCRI P+AYL PS+S++ V+P+V+
Sbjct  1012  GSAPISHATLSCDSQLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSVSTT-VYPVVI  1070

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSN-TTP-------VSDQP  339
             AAHP +PNQFALGL+DGGV V EPLESEGKWGV PP ENGS SN +TP        SDQP
Sbjct  1071  AAHPSEPNQFALGLTDGGVHVLEPLESEGKWGVSPPAENGSASNMSTPPPAGAASSSDQP  1130

Query  338   PR  333
              R
Sbjct  1131  QR  1132



>ref|XP_008456943.1| PREDICTED: topless-related protein 4-like isoform X1 [Cucumis 
melo]
 ref|XP_008456951.1| PREDICTED: topless-related protein 4-like isoform X1 [Cucumis 
melo]
 ref|XP_008456959.1| PREDICTED: topless-related protein 4-like isoform X1 [Cucumis 
melo]
Length=1136

 Score =  1653 bits (4280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 844/1139 (74%), Positives = 963/1139 (85%), Gaps = 15/1139 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK   FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAAAFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HP+ S  PIGL+V++  AA LK PRTPPTN P++DY + 
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAAPIGLNVANNAAAILKRPRTPPTNNPTMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDE-VNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+S+E  NLP+N+LPV +   GH Q+  + DDLPKNV  TL+QGS   
Sbjct  301   DSEHVLKRSRPFGLSEEGTNLPVNILPVGYGNQGHGQSSYSSDDLPKNVVTTLSQGSIVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP QQT+LLVGTNVGD+ +WEVG RE++ +RNFKVWDLSACS+PLQ +L  D   S
Sbjct  361   SMDFHPQQQTILLVGTNVGDVMIWEVGGRERIAIRNFKVWDLSACSVPLQASLASDYTAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             +N + WSPDG+LFGVAYS+HIV IYSY   D++R HLEI+AHVG VNDLAFS+PNKQLC+
Sbjct  421   INRVMWSPDGTLFGVAYSKHIVHIYSYQAGDELRNHLEIEAHVGSVNDLAFSYPNKQLCL  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  G KQ+TFEGH+APVYS+CPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRVIKVWDAVTGVKQFTFEGHDAPVYSICPHHKENIQFIFSTAADGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRTYQG  KRS
Sbjct  541   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTYQGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGDDFS+KFWDMDSV +LTSIDADGGLPASP IRFNKDG LLAVS
Sbjct  601   VGVVQFDTTKNRFLAAGDDFSVKFWDMDSVNILTSIDADGGLPASPCIRFNKDGVLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAE  1575
              N+NGIK+LAN +GIR+LRT EN  +DA+  AS +  K     S  P +V+   + G  +
Sbjct  661   TNDNGIKILANAEGIRMLRTVENRTFDASRVASAAVVKAPPIGSFGPPAVSVGMSIG--D  718

Query  1574  RVASVVGTSV-MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             R   V    V +N D+R ++ DVKPRI +E+ DKS++WKLTEI EP+ CR+L+LP+NL  
Sbjct  719   RTPPVAAAMVGINNDSR-SLADVKPRIADESVDKSRIWKLTEINEPTQCRSLRLPDNLTA  777

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             +++SRLIYTNSG A+LALASNA+H LW+WQR +RN + KATA++ PQLWQP SGILMTND
Sbjct  778   SRVSRLIYTNSGLAILALASNAVHKLWRWQRNDRNVTVKATASVAPQLWQPPSGILMTND  837

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  838   ISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  897

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DS+IQIYNVRVDEV++KLKGH KRITGLAFS+ LNVLVSSGAD+QL VWS+
Sbjct  898   NNIIAIGMEDSSIQIYNVRVDEVRTKLKGHQKRITGLAFSNQLNVLVSSGADSQLCVWST  957

Query  857   DGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQ +KFL +P+ R +   +DTRVQFH DQIH L +HETQ+AIYEA KLEC+KQWV 
Sbjct  958   DGWEKQVNKFLQVPSSRTTAPLADTRVQFHIDQIHLLAIHETQIAIYEAPKLECLKQWVP  1017

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             REA+ PI+HATFSCDSQ +Y SF D +V V TA+ L LRCRI P+AYL  + SS  VHPL
Sbjct  1018  REASGPITHATFSCDSQSIYVSFEDGSVGVLTASTLRLRCRINPNAYLPSNPSSLRVHPL  1077

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS---DQPPR  333
             V+AAHP +PNQFALGLSDGGV V EP ESEGKWG  PPVENG+G +T   +   DQP R
Sbjct  1078  VIAAHPSEPNQFALGLSDGGVHVLEPSESEGKWGTSPPVENGAGPSTATGAAGPDQPQR  1136



>ref|XP_008456978.1| PREDICTED: topless-related protein 4-like isoform X4 [Cucumis 
melo]
Length=1134

 Score =  1650 bits (4274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 842/1138 (74%), Positives = 961/1138 (84%), Gaps = 15/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK   FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAAAFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S  PIGL+V++  A LK PRTPPTN P++DY + D
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAAPIGLNVANNAAILKRPRTPPTNNPTMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDE-VNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R  G+S+E  NLP+N+LPV +   GH Q+  + DDLPKNV  TL+QGS   S
Sbjct  301   SEHVLKRSRPFGLSEEGTNLPVNILPVGYGNQGHGQSSYSSDDLPKNVVTTLSQGSIVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP QQT+LLVGTNVGD+ +WEVG RE++ +RNFKVWDLSACS+PLQ +L  D   S+
Sbjct  361   MDFHPQQQTILLVGTNVGDVMIWEVGGRERIAIRNFKVWDLSACSVPLQASLASDYTASI  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV IYSY   D++R HLEI+AHVG VNDLAFS+PNKQLC++
Sbjct  421   NRVMWSPDGTLFGVAYSKHIVHIYSYQAGDELRNHLEIEAHVGSVNDLAFSYPNKQLCLV  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  G KQ+TFEGH+APVYS+CPHHKEN+QFIFSTA DGKIKAWLYDNM
Sbjct  481   TCGEDRVIKVWDAVTGVKQFTFEGHDAPVYSICPHHKENIQFIFSTAADGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRTYQG  KRS 
Sbjct  541   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTYQGLGKRSV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFS+KFWDMDSV +LTSIDADGGLPASP IRFNKDG LLAVS 
Sbjct  601   GVVQFDTTKNRFLAAGDDFSVKFWDMDSVNILTSIDADGGLPASPCIRFNKDGVLLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAER  1572
             N+NGIK+LAN +GIR+LRT EN  +DA+  AS +  K     S  P +V+   + G  +R
Sbjct  661   NDNGIKILANAEGIRMLRTVENRTFDASRVASAAVVKAPPIGSFGPPAVSVGMSIG--DR  718

Query  1571  VASVVGTSV-MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
                V    V +N D+R ++ DVKPRI +E+ DKS++WKLTEI EP+ CR+L+LP+NL  +
Sbjct  719   TPPVAAAMVGINNDSR-SLADVKPRIADESVDKSRIWKLTEINEPTQCRSLRLPDNLTAS  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             ++SRLIYTNSG A+LALASNA+H LW+WQR +RN + KATA++ PQLWQP SGILMTND+
Sbjct  778   RVSRLIYTNSGLAILALASNAVHKLWRWQRNDRNVTVKATASVAPQLWQPPSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEV++KLKGH KRITGLAFS+ LNVLVSSGAD+QL VWS+D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVRTKLKGHQKRITGLAFSNQLNVLVSSGADSQLCVWSTD  957

Query  854   GWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQ +KFL +P+ R +   +DTRVQFH DQIH L +HETQ+AIYEA KLEC+KQWV R
Sbjct  958   GWEKQVNKFLQVPSSRTTAPLADTRVQFHIDQIHLLAIHETQIAIYEAPKLECLKQWVPR  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             EA+ PI+HATFSCDSQ +Y SF D +V V TA+ L LRCRI P+AYL  + S   VHPLV
Sbjct  1018  EASGPITHATFSCDSQSIYVSFEDGSVGVLTASTLRLRCRINPNAYLPSNPSLR-VHPLV  1076

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS---DQPPR  333
             +AAHP +PNQFALGLSDGGV V EP ESEGKWG  PPVENG+G +T   +   DQP R
Sbjct  1077  IAAHPSEPNQFALGLSDGGVHVLEPSESEGKWGTSPPVENGAGPSTATGAAGPDQPQR  1134



>ref|XP_008456972.1| PREDICTED: topless-related protein 4-like isoform X3 [Cucumis 
melo]
Length=1135

 Score =  1648 bits (4268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 843/1139 (74%), Positives = 962/1139 (84%), Gaps = 16/1139 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK   FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAAAFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HP+ S  PIGL+V++  AA LK PRTPPTN P++DY + 
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAAPIGLNVANNAAAILKRPRTPPTNNPTMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDE-VNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+S+E  NLP+N+LPV +   GH Q+  + DDLPKNV  TL+QGS   
Sbjct  301   DSEHVLKRSRPFGLSEEGTNLPVNILPVGYGNQGHGQSSYSSDDLPKNVVTTLSQGSIVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP QQT+LLVGTNVGD+ +WEVG RE++ +RNFKVWDLSACS+PLQ +L  D   S
Sbjct  361   SMDFHPQQQTILLVGTNVGDVMIWEVGGRERIAIRNFKVWDLSACSVPLQASLASDYTAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             +N + WSPDG+LFGVAYS+HIV IYSY   D++R HLEI+AHVG VNDLAFS+PNKQLC+
Sbjct  421   INRVMWSPDGTLFGVAYSKHIVHIYSYQAGDELRNHLEIEAHVGSVNDLAFSYPNKQLCL  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  G KQ+TFEGH+APVYS+CPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRVIKVWDAVTGVKQFTFEGHDAPVYSICPHHKENIQFIFSTAADGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRTYQG  KRS
Sbjct  541   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTYQGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGDDFS+KFWDMDSV +LTSIDADGGLPASP IRFNKDG LLAVS
Sbjct  601   VGVVQFDTTKNRFLAAGDDFSVKFWDMDSVNILTSIDADGGLPASPCIRFNKDGVLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAE  1575
              N+NGIK+LAN +GIR+LRT EN  +DA+  AS +  K     S  P +V+   + G  +
Sbjct  661   TNDNGIKILANAEGIRMLRTVENRTFDASRVASAAVVKAPPIGSFGPPAVSVGMSIG--D  718

Query  1574  RVASVVGTSV-MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             R   V    V +N D+R ++ DVKPRI +E+ DKS++WKLTEI EP+ CR+L+LP+NL  
Sbjct  719   RTPPVAAAMVGINNDSR-SLADVKPRIADESVDKSRIWKLTEINEPTQCRSLRLPDNLTA  777

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
             +++SRLIYTNSG A+LALASNA+H LW+WQR +RN + KATA++ PQLWQP SGILMTND
Sbjct  778   SRVSRLIYTNSGLAILALASNAVHKLWRWQRNDRNVTVKATASVAPQLWQPPSGILMTND  837

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  838   ISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  897

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DS+IQIYNVRVDEV++KLKGH KRITGLAFS+ LNVLVSSGAD+QL VWS+
Sbjct  898   NNIIAIGMEDSSIQIYNVRVDEVRTKLKGHQKRITGLAFSNQLNVLVSSGADSQLCVWST  957

Query  857   DGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQ +KFL +P+ R +   +DTRVQFH DQIH L +HETQ+AIYEA KLEC+KQWV 
Sbjct  958   DGWEKQVNKFLQVPSSRTTAPLADTRVQFHIDQIHLLAIHETQIAIYEAPKLECLKQWVP  1017

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             REA+ PI+HATFSCDSQ +Y SF D +V V TA+ L LRCRI P+AYL  + S   VHPL
Sbjct  1018  REASGPITHATFSCDSQSIYVSFEDGSVGVLTASTLRLRCRINPNAYLPSNPSLR-VHPL  1076

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS---DQPPR  333
             V+AAHP +PNQFALGLSDGGV V EP ESEGKWG  PPVENG+G +T   +   DQP R
Sbjct  1077  VIAAHPSEPNQFALGLSDGGVHVLEPSESEGKWGTSPPVENGAGPSTATGAAGPDQPQR  1135



>ref|XP_010250163.1| PREDICTED: protein TOPLESS-like [Nelumbo nucifera]
 ref|XP_010250164.1| PREDICTED: protein TOPLESS-like [Nelumbo nucifera]
Length=1128

 Score =  1648 bits (4267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 841/1134 (74%), Positives = 955/1134 (84%), Gaps = 13/1134 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVHKLEQESGFFFNMKYFED V NG WDEVE+YLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHKLEQESGFFFNMKYFEDAVTNGEWDEVERYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DR KAVEIL KDLKVF++FN+ELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVEILVKDLKVFAAFNDELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSP  NPL+G++PK GGFP L  HGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPVTNPLMGAIPKAGGFPALATHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAP  + + LAGWM+N   V HPAVS GP+GL+  +  A LK PRTP TN P++DY + D
Sbjct  241   PAPASLQSSLAGWMANPSPVPHPAVSAGPMGLTAPNNAAILKRPRTPTTNNPAMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R LG+SDEVN LP+N++PV++    HSQ+  + DDLPK V  TLNQGS+  S
Sbjct  301   SEHVLKRSRPLGMSDEVNNLPVNIMPVTYASQSHSQSLYSSDDLPKIVVMTLNQGSAVRS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             +DFHPV QTLLLVGT+VGD+ +WEV SR++L LR+FKVWD SACS+PLQ ALVK+  +SV
Sbjct  361   LDFHPVHQTLLLVGTHVGDVMVWEVASRDRLALRSFKVWDPSACSVPLQAALVKETPISV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N +TWSPDGSLFGVAYS+HIV ++SYHG DD+R HLEIDAH GGVNDLAFSHPNKQLC +
Sbjct  421   NRVTWSPDGSLFGVAYSKHIVHVFSYHGGDDLRHHLEIDAHNGGVNDLAFSHPNKQLCFV  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDK IKVWDA +G KQYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN+
Sbjct  481   TCGDDKLIKVWDAVSGTKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNL  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG +CT MAYSADGTRLFSCGTSKDGES+IVEWNESEGAVKRTY G  KRS 
Sbjct  541   GSRVDYDAPGHYCTRMAYSADGTRLFSCGTSKDGESYIVEWNESEGAVKRTYHGCGKRSV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+  IKFWDMD+V +LT+ +ADGGLP SP IRF+K+G LLAVS 
Sbjct  601   GVVQFDTTKNRFLAAGDESVIKFWDMDNVNLLTTTEADGGLPPSPYIRFSKEGILLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENL-aydaaarasesaskpSVNPISVASASNA---GFAER  1572
             N+NG+K+LAN DG+RL+   E+     +   +  +   P++NP S  +A+     G A+R
Sbjct  661   NDNGVKILANADGLRLIHAIESRPFDASRVASGSAMKGPTLNPFSAVTATTGTSMGVADR  720

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A V     +NG+ R ++ DVKPRI +E+ +KSK+WKLTEI+EPSHCR+L+L +NL   K
Sbjct  721   SAPVTAMVGLNGEGR-SLADVKPRIVDESIEKSKIWKLTEISEPSHCRSLRLSDNLSAAK  779

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             ISRLIYTNSG A+LALASNA+H LWKWQR ERN  GKATA +PPQLWQP+SGILMTN++ 
Sbjct  780   ISRLIYTNSGVAILALASNAVHKLWKWQRNERN-IGKATATVPPQLWQPASGILMTNEIN  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  839   DTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGM+DS+IQIYNVRVDEVKSKLKGH KRITGLAFS+VLNVLVSSGADAQL +WS+D 
Sbjct  899   IIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRITGLAFSNVLNVLVSSGADAQLCIWSTDK  958

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL +P GR     ++TRVQFHQDQIH L VHETQ+AIY+ +KLEC+KQW  RE
Sbjct  959   WEKQGSKFLQIPTGRVPAPLAETRVQFHQDQIHLLTVHETQIAIYDVSKLECLKQWFARE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
                 I+HAT+SCDSQ +Y SF D ++ VFT+  L LRCRI P+AYL  + S   V PLV+
Sbjct  1019  PNGQITHATYSCDSQSIYTSFEDGSIGVFTSTTLRLRCRINPTAYLPSNPSLR-VCPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVSDQPPR  333
             AAHP +PNQFA+GLSDGGV V EPLESEGKWG  PP ENGSG      SDQP R
Sbjct  1078  AAHPSEPNQFAVGLSDGGVHVLEPLESEGKWGAAPPPENGSGMAG---SDQPSR  1128



>emb|CDP10439.1| unnamed protein product [Coffea canephora]
Length=1136

 Score =  1640 bits (4248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 836/1140 (73%), Positives = 961/1140 (84%), Gaps = 17/1140 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+TVH+LEQESGFFFNM++FE+ V NG+WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDTVHRLEQESGFFFNMRHFEEMVTNGDWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD++DR+KAV+IL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRKDRAKAVDILVKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKL FP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLTELKKLIEANPLFRDKLTFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCG--QPNGARAPSPANNPLLGSVPKPGGFPPLG-AHG  3003
             WQHQLCKNP+PNPDIKTLFVDHSCG  QPNGARAPSP  NPL+G+VPKPG FPPLG AHG
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHSCGPSQPNGARAPSPVTNPLMGAVPKPGAFPPLGTAHG  240

Query  3002  PFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPTN-PSVDY  2829
             PFQP P  +PT +AGWM+N   V HP+ S GPIG +  + PAAL K PRTPP N P++DY
Sbjct  241   PFQPTPAPMPTSIAGWMANPSPVPHPSASAGPIGFNPPNNPAALLKRPRTPPANNPAMDY  300

Query  2828  PSGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGS  2652
              + DSDHV KR R  GISDE N +P+N+LPV F G  H Q+  + DDLPK V  +LNQGS
Sbjct  301   QTADSDHVLKRSRPFGISDEANNMPVNILPVGFSGQSHGQSSYSSDDLPKAVVLSLNQGS  360

Query  2651  SPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDP  2472
             +  SMDFHPVQQ LLLVGTN G++ +WE+ SRE+L  R+FKVWDL ACSM LQT+L  D 
Sbjct  361   AVKSMDFHPVQQILLLVGTNTGEVMVWELASRERLAHRSFKVWDLGACSMALQTSLASDY  420

Query  2471  GVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQ  2292
               SVN + WSPDG+LFGVAYS+HIV IYSYHG DD+R HLEI+AHVG VNDLAFS+PNKQ
Sbjct  421   TASVNRVIWSPDGTLFGVAYSKHIVHIYSYHGADDLRNHLEIEAHVGSVNDLAFSYPNKQ  480

Query  2291  LCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWL  2112
             LC++TCG+DK IKVWDA  G KQYTFEGHEAPVYS+CPHHKE++QFIFSTA DGKIKAWL
Sbjct  481   LCIVTCGEDKLIKVWDAVTGNKQYTFEGHEAPVYSICPHHKESIQFIFSTATDGKIKAWL  540

Query  2111  YDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFR  1932
             YDN+GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRTY G  
Sbjct  541   YDNIGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTYIGLG  600

Query  1931  KRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLL  1752
             KR+ G+VQFDTTKNR+LAAGD+F IKFWDMD+V  LTS DADGGLPASP IRFNK+G LL
Sbjct  601   KRASGIVQFDTTKNRFLAAGDEFIIKFWDMDNVNSLTSTDADGGLPASPCIRFNKEGILL  660

Query  1751  AVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----  1584
             AVS NENGIK+LAN DG++LLR+ EN  +DA+   S S  KP   P+   +A +A     
Sbjct  661   AVSTNENGIKILANGDGLKLLRSMENRPFDASRVPSASIVKPP--PLGTFAAGSAAVGSS  718

Query  1583  FAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENL  1404
               ERVA +     MNGD R N+GDVKPRI +E+ DKS++WK+TEI EPS CR+L+LP++L
Sbjct  719   IVERVAPIAAMVSMNGDTR-NLGDVKPRIADESADKSRIWKMTEINEPSQCRSLRLPDSL  777

Query  1403  RVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMT  1224
                ++SRLIYTNSG A+LALA+NA+H LWKW R +RN +GKATA + PQLWQP+SGILMT
Sbjct  778   AAMRVSRLIYTNSGLAILALAANAVHKLWKWPRNDRNPTGKATAGVVPQLWQPASGILMT  837

Query  1223  NDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHP  1044
             ND++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHP
Sbjct  838   NDISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHP  897

Query  1043  QDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVW  864
             QDNNIIAIGM+DS+IQIYNVRVDEVK+KL+GH KRITGLAFS+  NVLVSSGAD+QL VW
Sbjct  898   QDNNIIAIGMEDSSIQIYNVRVDEVKTKLRGHQKRITGLAFSNAFNVLVSSGADSQLCVW  957

Query  863   SSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW  687
             S+D WEKQ SK+L +PAGRA+   +DTRVQFHQD  H L VHETQ+AIYEA KLEC+KQW
Sbjct  958   STDAWEKQTSKYLQIPAGRAAAPLADTRVQFHQDHTHLLAVHETQIAIYEAPKLECLKQW  1017

Query  686   VQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVH  507
             V REA+ PI+HAT+SCDSQ +Y SF D +V V TA++L LRCRI P+AYL  + +   VH
Sbjct  1018  VPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASSLRLRCRINPAAYLPTNPNLR-VH  1076

Query  506   PLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV--SDQPPR  333
             PLV+AAHP +PNQFALGL+DGG+ VFEPLESEGKWG  PP+ENG+G +T+    SDQP R
Sbjct  1077  PLVIAAHPSEPNQFALGLTDGGIQVFEPLESEGKWGTLPPIENGTGPSTSGAASSDQPQR  1136



>ref|XP_004139298.1| PREDICTED: topless-related protein 4-like [Cucumis sativus]
Length=1134

 Score =  1640 bits (4248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 839/1138 (74%), Positives = 957/1138 (84%), Gaps = 15/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK   FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAAAFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S  PIGL+ ++  A LK PRTPPTN P++DY + D
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAAPIGLNAANNAAILKRPRTPPTNNPTMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R  G+S+EV NLP+N+LPV +   GH Q+  + DDLPKNV  TL+QGS   S
Sbjct  301   SEHVLKRSRPFGLSEEVTNLPVNILPVGYGNQGHGQSSYSSDDLPKNVVTTLSQGSVVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP QQT+LLVGTNVGD+ +WEVG RE++ +RNFKVWDL+A S+ LQ +L  D   S+
Sbjct  361   MDFHPQQQTILLVGTNVGDVMIWEVGGRERIAIRNFKVWDLAARSVALQASLASDYTASI  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV IYSY   D++R HLEI+AHVG VNDLAF + NKQLC++
Sbjct  421   NRVMWSPDGTLFGVAYSKHIVHIYSYQAGDELRNHLEIEAHVGSVNDLAFLYANKQLCLV  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  G KQ+TFEGH+APVYS+CPHHKEN+QFIFSTA DGKIKAWLYDNM
Sbjct  481   TCGEDRVIKVWDAVTGVKQFTFEGHDAPVYSICPHHKENIQFIFSTAADGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+KDGES++VEWNESEGAVKRTYQG  KRS 
Sbjct  541   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKDGESYLVEWNESEGAVKRTYQGLGKRSV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFS+KFWDMDSV +LTSIDADGGLPASP IRFNKDG LLAVS 
Sbjct  601   GVVQFDTTKNRFLAAGDDFSVKFWDMDSVNILTSIDADGGLPASPCIRFNKDGVLLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAER  1572
             N+NGIK+LAN +G R+LRT EN  +DA+  AS +  K     S  P +V+   + G  +R
Sbjct  661   NDNGIKILANAEGFRMLRTVENRTFDASRVASAAVVKAPPIGSFGPPAVSVGMSIG--DR  718

Query  1571  VASVVGTSV-MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
                V    V +N D+R ++ DVKPRI +E+ DKS++WKLTEI EP+ CR+L+LP+NL  +
Sbjct  719   TPPVAAAMVGINNDSR-SLADVKPRIADESVDKSRIWKLTEINEPTQCRSLRLPDNLTAS  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             ++SRLIYTNSG A+LALASNA+H LW+WQR +RN + KATA++ PQLWQP SGILMTND+
Sbjct  778   RVSRLIYTNSGLAILALASNAVHKLWRWQRNDRNVTVKATASVAPQLWQPPSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFS+ LNVLVSSGAD+QL VWS+D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSNQLNVLVSSGADSQLCVWSTD  957

Query  854   GWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQ +KFL +P+ R +   +DTRVQFH DQIH L +HETQ+AIYEA KLEC+KQWV R
Sbjct  958   GWEKQVNKFLQVPSSRTTAPLADTRVQFHIDQIHLLAIHETQIAIYEAPKLECLKQWVPR  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             EA+ PI+HATFSCDSQ +Y SF D +V V TA+ L LRCRI P+AYLS + S   VHPLV
Sbjct  1018  EASGPITHATFSCDSQSIYVSFEDGSVGVLTASTLRLRCRINPNAYLSSNPSLR-VHPLV  1076

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVS---DQPPR  333
             +AAHP +PNQFALGLSDGGV V EP ESEGKWG  PPVENG+G +T   +   DQP R
Sbjct  1077  IAAHPSEPNQFALGLSDGGVHVLEPSESEGKWGTSPPVENGAGPSTATGAAGPDQPQR  1134



>ref|XP_007013506.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
 gb|EOY31125.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
Length=1137

 Score =  1639 bits (4244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 834/1134 (74%), Positives = 950/1134 (84%), Gaps = 31/1134 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+TVHKLEQESGFFFN++YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDTVHKLEQESGFFFNLRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEITHLLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITHLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMSAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HPA S GPIGL+  +  AA LK PRTPPTN P++DY S 
Sbjct  241   PTPAALPTSLAGWMANPTPVPHPAASAGPIGLTAPNNAAAILKRPRTPPTNNPAMDYQSA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+ DEVN LP+N+LPV + G  H Q+  + DDLPK V  TL+QGS+  
Sbjct  301   DSEHVLKRSRPFGMPDEVNNLPVNILPVPYAGQSHGQSSYSPDDLPKTVVMTLSQGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP  Q LLLVGTN GDI +WEVGS E++  + FKVWDLSACSMPLQ +L  D  VS
Sbjct  361   SMDFHPKTQILLLVGTNTGDIMVWEVGSGERIAHKTFKVWDLSACSMPLQASLANDYTVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             +N + WSPDG+LFGVAYS+HIV +YSYHG DD+R  LEI+AHVG VNDLAFS+PNKQLC+
Sbjct  421   INRVMWSPDGNLFGVAYSKHIVHVYSYHGGDDLRNRLEIEAHVGSVNDLAFSYPNKQLCI  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA +GAKQ+ FEGHEAPVYS+CPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRIIKVWDAVSGAKQHIFEGHEAPVYSICPHHKENIQFIFSTATDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDY+APG+  TTMAYSADGTRLFSCGT+KDGES++VEWNESEGAVKRTY G  KRS
Sbjct  541   VGSRVDYNAPGQSSTTMAYSADGTRLFSCGTNKDGESYLVEWNESEGAVKRTYFGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTK+R+LAAGD+FS+KFWDMD+V +LTS  ADGGLP +P IRFNK+GTLLAVS
Sbjct  601   AGVVQFDTTKSRFLAAGDEFSVKFWDMDNVNLLTSTPADGGLPHAPCIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGF------  1581
               +NG+K+LAN+DGIR LRT EN           S     V P ++  A N G       
Sbjct  661   TEDNGVKILANSDGIRFLRTVEN----------RSFDASRVAPAAMVKAPNMGAFGSNNA  710

Query  1580  ---------AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCR  1428
                      A  VA++VG S+ + D R ++ DVKPRI +E+ +KS++WKLTEI EP+ CR
Sbjct  711   TIGTTIGDRAAPVAAMVGMSLQSSDGR-SLADVKPRIADESVEKSRIWKLTEINEPTQCR  769

Query  1427  ALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQ  1248
             +L+L +NL   ++SRLIYTNSG A+LAL+SNA+H LWKWQR +RN +GKAT ++ PQLWQ
Sbjct  770   SLRLSDNLTAMRVSRLIYTNSGLAILALSSNAVHKLWKWQRNDRNLTGKATTSVAPQLWQ  829

Query  1247  PSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppa  1068
             PSSGILMTND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPA
Sbjct  830   PSSGILMTNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPA  889

Query  1067  atflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSG  888
             ATFLAFHPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSG
Sbjct  890   ATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTLNVLVSSG  949

Query  887   ADAQLFVWSSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEAT  711
             AD+QL VWS+DGWEKQ SK+L +P GR AS  +DTRVQFH DQIH L VHETQ+AIYEA 
Sbjct  950   ADSQLCVWSTDGWEKQASKYLQIPNGRAASPHADTRVQFHLDQIHLLAVHETQIAIYEAP  1009

Query  710   KLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylsp  531
              LEC+KQ+V REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P
Sbjct  1010  NLECLKQFVPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP  1069

Query  530   slssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG  369
             + S   V+PLV+AAHP DPNQFALGL+DGGV + EPLESEGKWG  PPVENG+G
Sbjct  1070  NPSLR-VYPLVIAAHPSDPNQFALGLTDGGVHILEPLESEGKWGTSPPVENGAG  1122



>ref|XP_007013508.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 ref|XP_007013511.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31127.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31130.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
Length=1135

 Score =  1638 bits (4241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 834/1132 (74%), Positives = 952/1132 (84%), Gaps = 29/1132 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+TVHKLEQESGFFFN++YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDTVHKLEQESGFFFNLRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEITHLLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITHLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMSAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HPA S GPIGL+  +  AA LK PRTPPTN P++DY S 
Sbjct  241   PTPAALPTSLAGWMANPTPVPHPAASAGPIGLTAPNNAAAILKRPRTPPTNNPAMDYQSA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+ DEVN LP+N+LPV + G  H Q+  + DDLPK V  TL+QGS+  
Sbjct  301   DSEHVLKRSRPFGMPDEVNNLPVNILPVPYAGQSHGQSSYSPDDLPKTVVMTLSQGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP  Q LLLVGTN GDI +WEVGS E++  + FKVWDLSACSMPLQ +L  D  VS
Sbjct  361   SMDFHPKTQILLLVGTNTGDIMVWEVGSGERIAHKTFKVWDLSACSMPLQASLANDYTVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             +N + WSPDG+LFGVAYS+HIV +YSYHG DD+R  LEI+AHVG VNDLAFS+PNKQLC+
Sbjct  421   INRVMWSPDGNLFGVAYSKHIVHVYSYHGGDDLRNRLEIEAHVGSVNDLAFSYPNKQLCI  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA +GAKQ+ FEGHEAPVYS+CPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRIIKVWDAVSGAKQHIFEGHEAPVYSICPHHKENIQFIFSTATDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDY+APG+  TTMAYSADGTRLFSCGT+KDGES++VEWNESEGAVKRTY G  KRS
Sbjct  541   VGSRVDYNAPGQSSTTMAYSADGTRLFSCGTNKDGESYLVEWNESEGAVKRTYFGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTK+R+LAAGD+FS+KFWDMD+V +LTS  ADGGLP +P IRFNK+GTLLAVS
Sbjct  601   AGVVQFDTTKSRFLAAGDEFSVKFWDMDNVNLLTSTPADGGLPHAPCIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVA------SASNAGF  1581
               +NG+K+LAN+DGIR LRT EN           S     V P ++A       ++NA  
Sbjct  661   TEDNGVKILANSDGIRFLRTVEN----------RSFDASRVAPAAMAPNMGAFGSNNATI  710

Query  1580  -------AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRAL  1422
                    A  VA++VG S+ + D R ++ DVKPRI +E+ +KS++WKLTEI EP+ CR+L
Sbjct  711   GTTIGDRAAPVAAMVGMSLQSSDGR-SLADVKPRIADESVEKSRIWKLTEINEPTQCRSL  769

Query  1421  KLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPS  1242
             +L +NL   ++SRLIYTNSG A+LAL+SNA+H LWKWQR +RN +GKAT ++ PQLWQPS
Sbjct  770   RLSDNLTAMRVSRLIYTNSGLAILALSSNAVHKLWKWQRNDRNLTGKATTSVAPQLWQPS  829

Query  1241  SGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaat  1062
             SGILMTND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAAT
Sbjct  830   SGILMTNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAAT  889

Query  1061  flaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGAD  882
             FLAFHPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD
Sbjct  890   FLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTLNVLVSSGAD  949

Query  881   AQLFVWSSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKL  705
             +QL VWS+DGWEKQ SK+L +P GR AS  +DTRVQFH DQIH L VHETQ+AIYEA  L
Sbjct  950   SQLCVWSTDGWEKQASKYLQIPNGRAASPHADTRVQFHLDQIHLLAVHETQIAIYEAPNL  1009

Query  704   ECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspsl  525
             EC+KQ+V REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P+ 
Sbjct  1010  ECLKQFVPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPPNP  1069

Query  524   ssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG  369
             S   V+PLV+AAHP DPNQFALGL+DGGV + EPLESEGKWG  PPVENG+G
Sbjct  1070  SLR-VYPLVIAAHPSDPNQFALGLTDGGVHILEPLESEGKWGTSPPVENGAG  1120



>ref|XP_010656454.1| PREDICTED: topless-related protein 4 isoform X4 [Vitis vinifera]
Length=1132

 Score =  1635 bits (4234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 836/1137 (74%), Positives = 966/1137 (85%), Gaps = 15/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFE+ V NG WD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEETVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+ NPDIKTLFVDH+CGQPNGARAPSP  NPL+G+VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPKANPDIKTLFVDHTCGQPNGARAPSPVTNPLMGTVPKAGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT-NPSVDYPSGD  2817
             PAP  +PT LAGWM+N   V HP+ S GP+GL+ ++  A LK PRTPPT NP++DY + D
Sbjct  241   PAPAPLPTSLAGWMANPSPVPHPSASAGPMGLATANNAAILKRPRTPPTNNPAMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KRPR  GISDEV NLP+N+LPV++ G  H Q+  + DDLPK V  +L QGS+  S
Sbjct  301   SEHVLKRPRPFGISDEVNNLPVNILPVAYTGQSHGQSSYSSDDLPKTVVMSLPQGSTVRS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQ LLLVGTN+GDI +W++GSRE+L ++NFKVW+L++CSM LQT+L  D   SV
Sbjct  361   MDFHPVQQILLLVGTNMGDIMVWDLGSRERLAIKNFKVWELASCSMALQTSLANDYLASV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV +YSYH  DD+R HLEI+AHVG VNDLAFS+PNK LCV+
Sbjct  421   NRVMWSPDGTLFGVAYSKHIVHLYSYHNGDDLRNHLEIEAHVGSVNDLAFSYPNK-LCVV  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  G+KQYTFEGHEAPVYSVCPHHKEN+QFIFSTA+DGKIKAWLYDNM
Sbjct  480   TCGEDRFIKVWDANTGSKQYTFEGHEAPVYSVCPHHKENIQFIFSTAIDGKIKAWLYDNM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S+IVEWNESEGAVKRTY G  KRS 
Sbjct  540   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYIVEWNESEGAVKRTYHGLGKRSV  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F +KFWDMD+V +L + DA+GGLPASP IRFNK+G LLAVS 
Sbjct  600   GVVQFDTTKNRFLAAGDEFLVKFWDMDNVNLLMTTDAEGGLPASPCIRFNKEGILLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAER  1572
             NENGIK+LAN +GIRLLRT EN ++DA+  AS +  K     +  P + A  ++ G  +R
Sbjct  660   NENGIKILANQEGIRLLRTMENRSFDASRVASAAVVKAPAIGTFPPANPAVGTSIG--DR  717

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A V     MN D R+ V DVKPRI +E+ +KS++WKLTEI E S CR+L+LP+NL   +
Sbjct  718   AAPVAAMVGMNSDNRSLV-DVKPRIADESGEKSRIWKLTEINEQSQCRSLRLPDNLTAMR  776

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRL+YTNSG A+LALASNA+H LWKWQR +RN + KATA++ PQLWQPSSGILMTN+++
Sbjct  777   VSRLMYTNSGFAILALASNAVHKLWKWQRNDRNITTKATASVAPQLWQPSSGILMTNEIS  836

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAVPCFALSKNDSYVMSASGGK+SLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  837   DTNPEDAVPCFALSKNDSYVMSASGGKVSLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  896

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGM+DS+IQIYNVRVDEVK+KLKGH KR+TGLAFS VLNVLVSSGAD+QL VW++DG
Sbjct  897   IIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRVTGLAFSPVLNVLVSSGADSQLCVWNTDG  956

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL +  G+A+   +DTRVQFH DQIH L VHETQ+AI+EA+KLEC++QWV RE
Sbjct  957   WEKQASKFLQVSPGQAAAPLADTRVQFHHDQIHLLAVHETQIAIFEASKLECLRQWVPRE  1016

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             A+  I+HAT+SCDSQ ++ SF D +V V TA+ L  RCRI P+AYL P+ S   V+PLVV
Sbjct  1017  ASGSITHATYSCDSQSIFVSFEDGSVGVLTASTLRSRCRINPTAYLPPNPSLR-VYPLVV  1075

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AAHP +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G ++T     SDQP R
Sbjct  1076  AAHPSEPNQFALGLTDGGVCVLEPLESEGKWGTSPPLENGAGPSSTSGAAGSDQPQR  1132



>ref|XP_010103710.1| Topless-related protein 4 [Morus notabilis]
 gb|EXB96852.1| Topless-related protein 4 [Morus notabilis]
Length=1130

 Score =  1634 bits (4232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 838/1139 (74%), Positives = 959/1139 (84%), Gaps = 21/1139 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V +G W+EVEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTSGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLK F++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKAFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPKPGGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKPGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAPT     LAGWM+N   V HP+ S GPIGL+ ++  A LK PRTPPTN P++DY + D
Sbjct  241   PAPTA----LAGWMANPSPVPHPSASAGPIGLAAANNAAILKRPRTPPTNNPAMDYQTAD  296

Query  2816  SDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R  GIS+E N L +N+LPV +P   H Q+  + DDLP++V  TLN GS   S
Sbjct  297   SEHVLKRSRPFGISEEANNLAVNLLPVPYPNQSHGQSSYSSDDLPRSVVMTLNLGSVVKS  356

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQ LLLVGTN+GD+ ++E+ S E++ +RNFKVW+L ACSMPLQ +L  D   SV
Sbjct  357   MDFHPVQQILLLVGTNMGDVMVYELPSHERIAVRNFKVWELGACSMPLQASLANDYSASV  416

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV IY+Y G DD+R HLEI+AHVG VNDLAFS+PNKQLCV+
Sbjct  417   NRVMWSPDGTLFGVAYSKHIVHIYAYQGGDDLRNHLEIEAHVGSVNDLAFSYPNKQLCVV  476

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  GAKQY FEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDNM
Sbjct  477   TCGEDRVIKVWDAVTGAKQYIFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDNM  536

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S++VEWNESEGAVKRTY G  KRS 
Sbjct  537   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYLVEWNESEGAVKRTYHGLGKRSV  596

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             G+VQFDTTKNR+LAAGD+F +KFWDMD+V +LTS+DADGGLPASP IRFNK+G LLAVS 
Sbjct  597   GIVQFDTTKNRFLAAGDEFMVKFWDMDNVNLLTSLDADGGLPASPCIRFNKEGILLAVST  656

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFA------  1578
             N+NG+K+L N+DGIRLLRT EN  +DA+  AS +A K    P+++ +  +A  +      
Sbjct  657   NDNGVKILGNSDGIRLLRTMENRTFDASRVASAAAVK---QPLAIGAFGSANISVGTSIG  713

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R   V     +N D+R  V DVKPRI +E+ DKS++WKLTEI EPS CR+LKLP+NL  
Sbjct  714   DRTTPVAAMVGLNNDSRGLV-DVKPRIADESLDKSRIWKLTEINEPSQCRSLKLPDNLTA  772

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
              ++SRLIYTNSG A+LALASNA+H LWKWQR +RN +GKAT ++ PQLWQP+SGILMTND
Sbjct  773   MRVSRLIYTNSGLAILALASNAVHKLWKWQRNDRNVAGKATTSVVPQLWQPTSGILMTND  832

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  833   ISDTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  892

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DSTIQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VW++
Sbjct  893   NNIIAIGMEDSTIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVWNT  952

Query  857   DGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQ SKFL +PAGR A+  +DTRVQFHQDQIH L VHETQ+AIYEA KLEC+KQW  
Sbjct  953   DGWEKQASKFLQIPAGRTAAPAADTRVQFHQDQIHLLAVHETQIAIYEAPKLECLKQWFP  1012

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             REA  PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P+ S   V+PL
Sbjct  1013  REATGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRINPTAYLPPNPSLR-VYPL  1071

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQPPR  333
             V+AAHP + NQFALGL+DGGV V EPLE EGKWG  PP ENG+G +T      S+QP R
Sbjct  1072  VIAAHPSEANQFALGLTDGGVHVLEPLELEGKWGTSPPTENGAGPSTAAGAAGSEQPQR  1130



>ref|XP_007013509.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
 gb|EOY31128.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
Length=1132

 Score =  1634 bits (4232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 830/1119 (74%), Positives = 948/1119 (85%), Gaps = 6/1119 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+TVHKLEQESGFFFN++YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDTVHKLEQESGFFFNLRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEITHLLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITHLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMSAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HPA S GPIGL+  +  AA LK PRTPPTN P++DY S 
Sbjct  241   PTPAALPTSLAGWMANPTPVPHPAASAGPIGLTAPNNAAAILKRPRTPPTNNPAMDYQSA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+ DEVN LP+N+LPV + G  H Q+  + DDLPK V  TL+QGS+  
Sbjct  301   DSEHVLKRSRPFGMPDEVNNLPVNILPVPYAGQSHGQSSYSPDDLPKTVVMTLSQGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP  Q LLLVGTN GDI +WEVGS E++  + FKVWDLSACSMPLQ +L  D  VS
Sbjct  361   SMDFHPKTQILLLVGTNTGDIMVWEVGSGERIAHKTFKVWDLSACSMPLQASLANDYTVS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             +N + WSPDG+LFGVAYS+HIV +YSYHG DD+R  LEI+AHVG VNDLAFS+PNKQLC+
Sbjct  421   INRVMWSPDGNLFGVAYSKHIVHVYSYHGGDDLRNRLEIEAHVGSVNDLAFSYPNKQLCI  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA +GAKQ+ FEGHEAPVYS+CPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRIIKVWDAVSGAKQHIFEGHEAPVYSICPHHKENIQFIFSTATDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDY+APG+  TTMAYSADGTRLFSCGT+KDGES++VEWNESEGAVKRTY G  KRS
Sbjct  541   VGSRVDYNAPGQSSTTMAYSADGTRLFSCGTNKDGESYLVEWNESEGAVKRTYFGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTK+R+LAAGD+FS+KFWDMD+V +LTS  ADGGLP +P IRFNK+GTLLAVS
Sbjct  601   AGVVQFDTTKSRFLAAGDEFSVKFWDMDNVNLLTSTPADGGLPHAPCIRFNKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
               +NG+K+LAN+DGIR LRT EN ++DA+  A  + +       S  +       +R A 
Sbjct  661   TEDNGVKILANSDGIRFLRTVENRSFDASRVAPAAMAPNMGAFGSNNATIGTTIGDRAAP  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             V     M+ D R ++ DVKPRI +E+ +KS++WKLTEI EP+ CR+L+L +NL   ++SR
Sbjct  721   VAAMVGMSSDGR-SLADVKPRIADESVEKSRIWKLTEINEPTQCRSLRLSDNLTAMRVSR  779

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LAL+SNA+H LWKWQR +RN +GKAT ++ PQLWQPSSGILMTND+ D N
Sbjct  780   LIYTNSGLAILALSSNAVHKLWKWQRNDRNLTGKATTSVAPQLWQPSSGILMTNDITDTN  839

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  840   PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  899

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VWS+DGWEK
Sbjct  900   IGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTLNVLVSSGADSQLCVWSTDGWEK  959

Query  842   QKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q SK+L +P GR AS  +DTRVQFH DQIH L VHETQ+AIYEA  LEC+KQ+V REA+ 
Sbjct  960   QASKYLQIPNGRAASPHADTRVQFHLDQIHLLAVHETQIAIYEAPNLECLKQFVPREASG  1019

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P+ S   V+PLV+AAH
Sbjct  1020  PITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPPNPSLR-VYPLVIAAH  1078

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG  369
             P DPNQFALGL+DGGV + EPLESEGKWG  PPVENG+G
Sbjct  1079  PSDPNQFALGLTDGGVHILEPLESEGKWGTSPPVENGAG  1117



>gb|AES91574.2| topless-like protein [Medicago truncatula]
Length=1134

 Score =  1634 bits (4231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 830/1140 (73%), Positives = 949/1140 (83%), Gaps = 19/1140 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VH+LEQESGFFFNM+YFE+ V NG WDEVEKYL+GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHRLEQESGFFFNMRYFEEMVTNGEWDEVEKYLTGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKGDRSKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LDNFRQNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+  VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMAGVPKVGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG--PIGLSVSSIPAALKHPRTPPTNPSVDYPSG  2820
             P P  +PT LAGWM+ +P V HP+ S G  PIGL+ ++ PA LK PRTPP NP++DY + 
Sbjct  241   PTPNALPTSLAGWMAASPQVQHPSASAGVGPIGLAQANNPALLKRPRTPPNNPAMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDHV KR R  GISDEVN LP+N+LPV++    H Q+  + DDLPK    TLNQGS+  
Sbjct  301   DSDHVMKRTRPFGISDEVNNLPVNLLPVAYSSQSHGQSSYSSDDLPKTAVMTLNQGSTVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  R+FKVWDL  CS+ LQ +L  +   S
Sbjct  361   SMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHRSFKVWDLQVCSVALQASLSNEYSAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLCV
Sbjct  421   VNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTM+YSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  KRS
Sbjct  541   MGSRVDYDAPGHSSTTMSYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F +KFWDMDS  +LTS DADGGL ASP IRFNK+G LLAVS
Sbjct  601   TGVVQFDTTKNRFLAAGDEFMVKFWDMDSTNLLTSFDADGGLLASPCIRFNKEGILLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------ASNAGF  1581
              ++NG+K+LAN +GIRLLRT EN     A  AS +AS  +V P ++ +      A     
Sbjct  661   TSDNGVKILANAEGIRLLRTVEN----RAFDASRAASAANVKPPTIGAFPSTNVAVGTSL  716

Query  1580  AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLR  1401
             A+R   V     +N D+R ++ DVKPRI +E  +KS++WKLTEI E S CR+LKLP+ L 
Sbjct  717   ADRTPPVAAMVGLNNDSR-SLADVKPRIVDEAVEKSRIWKLTEINEQSQCRSLKLPDGLS  775

Query  1400  VTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTN  1221
               ++SRLIYTN G A+LALA+NA+H LWKWQ+ +RN+SGKATA++ PQLWQPSSGILMTN
Sbjct  776   SMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTSGKATASLQPQLWQPSSGILMTN  835

Query  1220  DVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQ  1041
             ++ D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQ
Sbjct  836   EIGDTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQ  895

Query  1040  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWS  861
             DNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLN+LVSSGAD+QL VWS
Sbjct  896   DNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNILVSSGADSQLCVWS  955

Query  860   SDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWV  684
             +DGWEKQ +KFL +P GRA +  +DTRVQFH DQ H L VHETQ+AIYEA KLEC+KQWV
Sbjct  956   TDGWEKQTNKFLQMPNGRALAPLADTRVQFHLDQTHLLAVHETQIAIYEAPKLECLKQWV  1015

Query  683   QREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHP  504
              REA+ PI+HAT+SCDSQ +Y SF D ++ V TA+ L LRCRI  +AYL+P+ S   V+P
Sbjct  1016  PREASGPITHATYSCDSQSIYVSFEDGSIGVLTASTLRLRCRINQTAYLNPNPSLR-VYP  1074

Query  503   LVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQPPR  333
             LV+AAHP + NQFALGL+DGGV V EPLESEG+WG PPP ENG G +T     VS+QP R
Sbjct  1075  LVIAAHPSESNQFALGLTDGGVHVLEPLESEGRWGSPPPTENGVGPSTPSGASVSEQPQR  1134



>ref|XP_007013510.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
 gb|EOY31129.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
Length=1136

 Score =  1634 bits (4230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 835/1133 (74%), Positives = 952/1133 (84%), Gaps = 30/1133 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+TVHKLEQESGFFFN++YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDTVHKLEQESGFFFNLRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEITHLLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITHLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMSAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             P P  +PT LAGWM+N   V HPA S GPIGL+  +  AA LK PRTPPT NP++DY S 
Sbjct  241   PTPAALPTSLAGWMANPTPVPHPAASAGPIGLTAPNNAAAILKRPRTPPTNNPAMDYQSA  300

Query  2819  DSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+ DEV NLP+N+LPV + G  H Q+  + DDLPK V  TL+QGS+  
Sbjct  301   DSEHVLKRSRPFGMPDEVNNLPVNILPVPYAGQSHGQSSYSPDDLPKTVVMTLSQGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTA-LVKDPGV  2466
             SMDFHP  Q LLLVGTN GDI +WEVGS E++  + FKVWDLSACSMPLQ A L  D  V
Sbjct  361   SMDFHPKTQILLLVGTNTGDIMVWEVGSGERIAHKTFKVWDLSACSMPLQQASLANDYTV  420

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             S+N + WSPDG+LFGVAYS+HIV +YSYHG DD+R  LEI+AHVG VNDLAFS+PNKQLC
Sbjct  421   SINRVMWSPDGNLFGVAYSKHIVHVYSYHGGDDLRNRLEIEAHVGSVNDLAFSYPNKQLC  480

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             ++TCG+D+ IKVWDA +GAKQ+ FEGHEAPVYS+CPHHKEN+QFIFSTA DGKIKAWLYD
Sbjct  481   IVTCGEDRIIKVWDAVSGAKQHIFEGHEAPVYSICPHHKENIQFIFSTATDGKIKAWLYD  540

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             N+GSRVDY+APG+  TTMAYSADGTRLFSCGT+KDGES++VEWNESEGAVKRTY G  KR
Sbjct  541   NVGSRVDYNAPGQSSTTMAYSADGTRLFSCGTNKDGESYLVEWNESEGAVKRTYFGLGKR  600

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTTK+R+LAAGD+FS+KFWDMD+V +LTS  ADGGLP +P IRFNK+GTLLAV
Sbjct  601   SAGVVQFDTTKSRFLAAGDEFSVKFWDMDNVNLLTSTPADGGLPHAPCIRFNKEGTLLAV  660

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVA------SASNAG  1584
             S  +NG+K+LAN+DGIR LRT EN           S     V P ++A       ++NA 
Sbjct  661   STEDNGVKILANSDGIRFLRTVEN----------RSFDASRVAPAAMAPNMGAFGSNNAT  710

Query  1583  F-------AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRA  1425
                     A  VA++VG S+ + D R ++ DVKPRI +E+ +KS++WKLTEI EP+ CR+
Sbjct  711   IGTTIGDRAAPVAAMVGMSLQSSDGR-SLADVKPRIADESVEKSRIWKLTEINEPTQCRS  769

Query  1424  LKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQP  1245
             L+L +NL   ++SRLIYTNSG A+LAL+SNA+H LWKWQR +RN +GKAT ++ PQLWQP
Sbjct  770   LRLSDNLTAMRVSRLIYTNSGLAILALSSNAVHKLWKWQRNDRNLTGKATTSVAPQLWQP  829

Query  1244  SSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaa  1065
             SSGILMTND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAA
Sbjct  830   SSGILMTNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAA  889

Query  1064  tflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGA  885
             TFLAFHPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGA
Sbjct  890   TFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTLNVLVSSGA  949

Query  884   DAQLFVWSSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATK  708
             D+QL VWS+DGWEKQ SK+L +P GR AS  +DTRVQFH DQIH L VHETQ+AIYEA  
Sbjct  950   DSQLCVWSTDGWEKQASKYLQIPNGRAASPHADTRVQFHLDQIHLLAVHETQIAIYEAPN  1009

Query  707   LECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylsps  528
             LEC+KQ+V REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P+
Sbjct  1010  LECLKQFVPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPPN  1069

Query  527   lssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSG  369
              S   V+PLV+AAHP DPNQFALGL+DGGV + EPLESEGKWG  PPVENG+G
Sbjct  1070  PSLR-VYPLVIAAHPSDPNQFALGLTDGGVHILEPLESEGKWGTSPPVENGAG  1121



>ref|XP_010241551.1| PREDICTED: topless-related protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=1134

 Score =  1632 bits (4227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/1136 (73%), Positives = 950/1136 (84%), Gaps = 11/1136 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEK KETVHKLEQESGFFFNMKYFED V NG+WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKCKETVHKLEQESGFFFNMKYFEDAVTNGDWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKNDRSKAVEILVKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIML ELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLAELKKLIEANPLFRDKLQFPTLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSP  NPL+G++PK GGFP L  HGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPVTNPLMGAIPKAGGFPALATHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAP  + + LAGW++N   V HP VS GP+ L+  +  A LK PRTP TN P+VDY + D
Sbjct  241   PAPASLQSSLAGWVANPSQVPHPTVSAGPMSLTAPNNAAILKRPRTPSTNSPAVDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR + LG+SDEVN L +N++PV++    H Q+  + DDLPK V  TL+QG +  S
Sbjct  301   SEHVLKRSKPLGVSDEVNNLSVNIMPVTYANQSHIQSLYSSDDLPKTVVMTLHQGHAVRS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQTLLLVGT +GD+ +WEV S+E+L +R FKVWD SACSM LQ AL K+  +SV
Sbjct  361   MDFHPVQQTLLLVGTFIGDVLVWEVASKERLAMRTFKVWDPSACSMTLQAALAKETQLSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG++ GVAYS+HIV +YSYHG DD+R HLEIDAH GGVND+AFSHPNKQLC+I
Sbjct  421   NRVMWSPDGNICGVAYSKHIVHVYSYHGGDDLRHHLEIDAHNGGVNDIAFSHPNKQLCII  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDDK+IKVWDA  GA+QYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDNM
Sbjct  481   TCGDDKSIKVWDAVTGARQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG +CT MAYSADGTRLFSCGTSKDGE++IVEWNESEGAVKR+Y G  KRS 
Sbjct  541   GSRVDYDAPGHYCTRMAYSADGTRLFSCGTSKDGEAYIVEWNESEGAVKRSYHGCGKRSV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+L AGD+  IKFWDMD+V +L + DA+GGLP SP IRFNK+G LLAVS 
Sbjct  601   GVVQFDTTKNRFLVAGDESVIKFWDMDNVNLLMTTDAEGGLPPSPFIRFNKEGILLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNP---ISVASASNAGFAERV  1569
             N+NGIK+LAN DG+RLL T E+    +   +      P+V+P   + V + ++ G A+R 
Sbjct  661   NDNGIKILANADGLRLLHTIESRFDASKVASGSVMKGPTVSPFVAVPVTTGTSVGVADRG  720

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
             A V     +NGD R N+ DVKPRI +E+ +KSK+WKLTEI EPS CR+L+LP+NL   K+
Sbjct  721   APVTAMVGLNGDTR-NLADVKPRIVDESVEKSKIWKLTEINEPSQCRSLRLPDNLPAAKV  779

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIY NSG A+LALASNA+H LWKWQR +RN + KATA++PPQLWQPSSGILMTN+++D
Sbjct  780   SRLIYANSGIAILALASNAVHKLWKWQRNDRNITVKATASIPPQLWQPSSGILMTNEISD  839

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  840   TNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  899

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGM+DS+IQIYNVRVDEVKSKLKGH KRITGLAFS+VLNVLVSSGADAQL +WS+D W
Sbjct  900   IAIGMEDSSIQIYNVRVDEVKSKLKGHQKRITGLAFSNVLNVLVSSGADAQLCIWSTDKW  959

Query  848   EKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQ SKFL + AG+  S   +TRVQFHQDQIH L VHETQ+A+Y+ +KLEC+KQWV RE 
Sbjct  960   EKQGSKFLQIAAGKVTSPLVETRVQFHQDQIHLLAVHETQIAMYDISKLECLKQWVAREP  1019

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
                I+HAT+S DSQ +Y SF D +V VFTA  L LRCRI P+AYL  + S   V+PLV+A
Sbjct  1020  NGQITHATYSSDSQSIYTSFEDGSVGVFTATTLRLRCRINPTAYLPSNPSVR-VYPLVIA  1078

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AHP +PNQFA+GL+DGGV V EPLESEGKWG  PP ENGSG + T     SDQP R
Sbjct  1079  AHPSEPNQFAVGLTDGGVYVLEPLESEGKWGTSPPPENGSGPSITSGIAGSDQPSR  1134



>ref|XP_002285341.2| PREDICTED: topless-related protein 4 isoform X3 [Vitis vinifera]
 emb|CBI28228.3| unnamed protein product [Vitis vinifera]
Length=1133

 Score =  1632 bits (4227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 837/1138 (74%), Positives = 967/1138 (85%), Gaps = 16/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFE+ V NG WD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEETVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+ NPDIKTLFVDH+CGQPNGARAPSP  NPL+G+VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPKANPDIKTLFVDHTCGQPNGARAPSPVTNPLMGTVPKAGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAP  +PT LAGWM+N   V HP+ S GP+GL+ ++  AA LK PRTPPT NP++DY + 
Sbjct  241   PAPAPLPTSLAGWMANPSPVPHPSASAGPMGLATANNAAAILKRPRTPPTNNPAMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  GISDEV NLP+N+LPV++ G  H Q+  + DDLPK V  +L QGS+  
Sbjct  301   DSEHVLKRPRPFGISDEVNNLPVNILPVAYTGQSHGQSSYSSDDLPKTVVMSLPQGSTVR  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ LLLVGTN+GDI +W++GSRE+L ++NFKVW+L++CSM LQT+L  D   S
Sbjct  361   SMDFHPVQQILLLVGTNMGDIMVWDLGSRERLAIKNFKVWELASCSMALQTSLANDYLAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYS+HIV +YSYH  DD+R HLEI+AHVG VNDLAFS+PNK LCV
Sbjct  421   VNRVMWSPDGTLFGVAYSKHIVHLYSYHNGDDLRNHLEIEAHVGSVNDLAFSYPNK-LCV  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  G+KQYTFEGHEAPVYSVCPHHKEN+QFIFSTA+DGKIKAWLYDN
Sbjct  480   VTCGEDRFIKVWDANTGSKQYTFEGHEAPVYSVCPHHKENIQFIFSTAIDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S+IVEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYIVEWNESEGAVKRTYHGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F +KFWDMD+V +L + DA+GGLPASP IRFNK+G LLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFLVKFWDMDNVNLLMTTDAEGGLPASPCIRFNKEGILLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAE  1575
              NENGIK+LAN +GIRLLRT EN ++DA+  AS +  K     +  P + A  ++ G  +
Sbjct  660   TNENGIKILANQEGIRLLRTMENRSFDASRVASAAVVKAPAIGTFPPANPAVGTSIG--D  717

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     MN D R+ V DVKPRI +E+ +KS++WKLTEI E S CR+L+LP+NL   
Sbjct  718   RAAPVAAMVGMNSDNRSLV-DVKPRIADESGEKSRIWKLTEINEQSQCRSLRLPDNLTAM  776

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             ++SRL+YTNSG A+LALASNA+H LWKWQR +RN + KATA++ PQLWQPSSGILMTN++
Sbjct  777   RVSRLMYTNSGFAILALASNAVHKLWKWQRNDRNITTKATASVAPQLWQPSSGILMTNEI  836

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPEDAVPCFALSKNDSYVMSASGGK+SLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  837   SDTNPEDAVPCFALSKNDSYVMSASGGKVSLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  896

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVK+KLKGH KR+TGLAFS VLNVLVSSGAD+QL VW++D
Sbjct  897   NIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRVTGLAFSPVLNVLVSSGADSQLCVWNTD  956

Query  854   GWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQ SKFL +  G+A+   +DTRVQFH DQIH L VHETQ+AI+EA+KLEC++QWV R
Sbjct  957   GWEKQASKFLQVSPGQAAAPLADTRVQFHHDQIHLLAVHETQIAIFEASKLECLRQWVPR  1016

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             EA+  I+HAT+SCDSQ ++ SF D +V V TA+ L  RCRI P+AYL P+ S   V+PLV
Sbjct  1017  EASGSITHATYSCDSQSIFVSFEDGSVGVLTASTLRSRCRINPTAYLPPNPSLR-VYPLV  1075

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             VAAHP +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G ++T     SDQP R
Sbjct  1076  VAAHPSEPNQFALGLTDGGVCVLEPLESEGKWGTSPPLENGAGPSSTSGAAGSDQPQR  1133



>ref|XP_006594237.1| PREDICTED: topless-related protein 4-like isoform X2 [Glycine 
max]
Length=1132

 Score =  1632 bits (4227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 835/1137 (73%), Positives = 950/1137 (84%), Gaps = 15/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRHNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S GPIGL+ ++  A LK PRTPPTN P++DY + D
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAGPIGLAAANNAAILKRPRTPPTNNPAMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             SDHV KR R  G+SDEV NLP+N+LPV++ G  H Q+  + DDLPK +  TLNQGS   S
Sbjct  301   SDHVLKRTRPFGLSDEVSNLPVNLLPVAYSGQSHGQSSYSSDDLPKTIVMTLNQGSIVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQ LLLVGTN+GD+ +W++GSRE++  RNFKVW+L +CS+ LQ +L  D   SV
Sbjct  361   MDFHPLQQILLLVGTNMGDVMVWDIGSRERIAQRNFKVWELGSCSVALQASLSNDYSASV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+L  VAYS+HIV IYSY G DD+R HLEI+AH G VNDLAFS+PNKQLCV+
Sbjct  421   NRVVWSPDGTLCSVAYSKHIVHIYSYQGGDDLRNHLEIEAHAGSVNDLAFSYPNKQLCVV  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAWLYDNM
Sbjct  481   TCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  KRS 
Sbjct  541   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGKRSV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F IKFWDMD+  MLTS++ADGGL ASP IRFNKDG LLAVS 
Sbjct  601   GVVQFDTTKNRFLAAGDEFMIKFWDMDNTNMLTSVEADGGLLASPCIRFNKDGILLAVST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNA----GFAER  1572
             N++G+K+LAN +GIRLLRT EN  +DA+  AS +  K     I    ++N       A+R
Sbjct  661   NDSGVKILANAEGIRLLRTVENRTFDASRVASAAVVKAPT--IGAFPSTNVTVGTSLADR  718

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
                V     +N D R N+ DVKPRI +E  +KS++WKLTEI EPS CR+LKLP++L   +
Sbjct  719   APPVAAMVGINNDTR-NLADVKPRIVDEAVEKSRIWKLTEINEPSQCRSLKLPDSLSSMR  777

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRLIYTN G A+LALA+NA+H LWKWQR ERN++GKATA++ PQLWQPSSGILMTND++
Sbjct  778   VSRLIYTNQGVAILALAANAVHKLWKWQRNERNTTGKATASIQPQLWQPSSGILMTNDIS  837

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  838   DTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  897

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VWS+DG
Sbjct  898   IIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWSTDG  957

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL +P+GR     +DTRVQFH DQ H L VHETQ+A+YEA KLEC+KQ+  RE
Sbjct  958   WEKQASKFLQMPSGRPPAPLADTRVQFHLDQTHLLAVHETQIALYEAPKLECIKQFSPRE  1017

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
              A PI+HAT+SCDSQ +Y SF D ++ + T   L LRCRI  SAYL P+ S   VHPLV+
Sbjct  1018  -ANPITHATYSCDSQSIYVSFEDGSIGILTVPALRLRCRINQSAYLHPNPSLR-VHPLVI  1075

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AAHP +PNQFALGL+DGGV V EPLE+EGKWG PPP ENG+G +TT    VS+Q  R
Sbjct  1076  AAHPSEPNQFALGLTDGGVHVLEPLEAEGKWGTPPPNENGAGPSTTSGAAVSEQTQR  1132



>ref|XP_007013507.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
 gb|EOY31126.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
Length=1144

 Score =  1632 bits (4227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 834/1141 (73%), Positives = 952/1141 (83%), Gaps = 38/1141 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+TVHKLEQESGFFFN++YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDTVHKLEQESGFFFNLRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVFS+FNEELFKEITHLLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFSAFNEELFKEITHLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRENEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMSAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HPA S GPIGL+  +  AA LK PRTPPTN P++DY S 
Sbjct  241   PTPAALPTSLAGWMANPTPVPHPAASAGPIGLTAPNNAAAILKRPRTPPTNNPAMDYQSA  300

Query  2819  DSDHVSKRPRSLGISDEV----------NLPINVLPVSFPGHGHSQAHSTLDDLPKNVAR  2670
             DS+HV KR R  G+ DEV          NLP+N+LPV + G  H Q+  + DDLPK V  
Sbjct  301   DSEHVLKRSRPFGMPDEVPNQLILHQVNNLPVNILPVPYAGQSHGQSSYSPDDLPKTVVM  360

Query  2669  TLNQGSSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQT  2490
             TL+QGS+  SMDFHP  Q LLLVGTN GDI +WEVGS E++  + FKVWDLSACSMPLQ 
Sbjct  361   TLSQGSAVKSMDFHPKTQILLLVGTNTGDIMVWEVGSGERIAHKTFKVWDLSACSMPLQA  420

Query  2489  ALVKDPGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAF  2310
             +L  D  VS+N + WSPDG+LFGVAYS+HIV +YSYHG DD+R  LEI+AHVG VNDLAF
Sbjct  421   SLANDYTVSINRVMWSPDGNLFGVAYSKHIVHVYSYHGGDDLRNRLEIEAHVGSVNDLAF  480

Query  2309  SHPNKQLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDG  2130
             S+PNKQLC++TCG+D+ IKVWDA +GAKQ+ FEGHEAPVYS+CPHHKEN+QFIFSTA DG
Sbjct  481   SYPNKQLCIVTCGEDRIIKVWDAVSGAKQHIFEGHEAPVYSICPHHKENIQFIFSTATDG  540

Query  2129  KIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKR  1950
             KIKAWLYDN+GSRVDY+APG+  TTMAYSADGTRLFSCGT+KDGES++VEWNESEGAVKR
Sbjct  541   KIKAWLYDNVGSRVDYNAPGQSSTTMAYSADGTRLFSCGTNKDGESYLVEWNESEGAVKR  600

Query  1949  TYQGFRKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFN  1770
             TY G  KRS GVVQFDTTK+R+LAAGD+FS+KFWDMD+V +LTS  ADGGLP +P IRFN
Sbjct  601   TYFGLGKRSAGVVQFDTTKSRFLAAGDEFSVKFWDMDNVNLLTSTPADGGLPHAPCIRFN  660

Query  1769  KDGTLLAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVA----  1602
             K+GTLLAVS  +NG+K+LAN+DGIR LRT EN           S     V P ++A    
Sbjct  661   KEGTLLAVSTEDNGVKILANSDGIRFLRTVEN----------RSFDASRVAPAAMAPNMG  710

Query  1601  --SASNAGF-------AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEI  1449
                ++NA         A  VA++VG S+ + D R ++ DVKPRI +E+ +KS++WKLTEI
Sbjct  711   AFGSNNATIGTTIGDRAAPVAAMVGMSLQSSDGR-SLADVKPRIADESVEKSRIWKLTEI  769

Query  1448  TEPSHCRALKLPENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATAN  1269
              EP+ CR+L+L +NL   ++SRLIYTNSG A+LAL+SNA+H LWKWQR +RN +GKAT +
Sbjct  770   NEPTQCRSLRLSDNLTAMRVSRLIYTNSGLAILALSSNAVHKLWKWQRNDRNLTGKATTS  829

Query  1268  MPPQLWQPSSGILMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmtt  1089
             + PQLWQPSSGILMTND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTT
Sbjct  830   VAPQLWQPSSGILMTNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTT  889

Query  1088  fmppppaatflaFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVL  909
             FMPPPPAATFLAFHPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH L
Sbjct  890   FMPPPPAATFLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTL  949

Query  908   NVLVSSGADAQLFVWSSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQ  732
             NVLVSSGAD+QL VWS+DGWEKQ SK+L +P GR AS  +DTRVQFH DQIH L VHETQ
Sbjct  950   NVLVSSGADSQLCVWSTDGWEKQASKYLQIPNGRAASPHADTRVQFHLDQIHLLAVHETQ  1009

Query  731   LAIYEATKLECVKQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIa  552
             +AIYEA  LEC+KQ+V REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI 
Sbjct  1010  IAIYEAPNLECLKQFVPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRIG  1069

Query  551   psaylspslssSGVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGS  372
             P+AYL P+ S   V+PLV+AAHP DPNQFALGL+DGGV + EPLESEGKWG  PPVENG+
Sbjct  1070  PAAYLPPNPSLR-VYPLVIAAHPSDPNQFALGLTDGGVHILEPLESEGKWGTSPPVENGA  1128

Query  371   G  369
             G
Sbjct  1129  G  1129



>ref|XP_010656453.1| PREDICTED: topless-related protein 4 isoform X2 [Vitis vinifera]
Length=1133

 Score =  1632 bits (4226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 835/1138 (73%), Positives = 965/1138 (85%), Gaps = 16/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFE+ V NG WD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEETVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+ NPDIKTLFVDH+CGQPNGARAPSP  NPL+G+VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPKANPDIKTLFVDHTCGQPNGARAPSPVTNPLMGTVPKAGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT-NPSVDYPSGD  2817
             PAP  +PT LAGWM+N   V HP+ S GP+GL+ ++  A LK PRTPPT NP++DY + D
Sbjct  241   PAPAPLPTSLAGWMANPSPVPHPSASAGPMGLATANNAAILKRPRTPPTNNPAMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEV--NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             S+HV KRPR  GISDE   NLP+N+LPV++ G  H Q+  + DDLPK V  +L QGS+  
Sbjct  301   SEHVLKRPRPFGISDEQVNNLPVNILPVAYTGQSHGQSSYSSDDLPKTVVMSLPQGSTVR  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ LLLVGTN+GDI +W++GSRE+L ++NFKVW+L++CSM LQT+L  D   S
Sbjct  361   SMDFHPVQQILLLVGTNMGDIMVWDLGSRERLAIKNFKVWELASCSMALQTSLANDYLAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYS+HIV +YSYH  DD+R HLEI+AHVG VNDLAFS+PNK LCV
Sbjct  421   VNRVMWSPDGTLFGVAYSKHIVHLYSYHNGDDLRNHLEIEAHVGSVNDLAFSYPNK-LCV  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  G+KQYTFEGHEAPVYSVCPHHKEN+QFIFSTA+DGKIKAWLYDN
Sbjct  480   VTCGEDRFIKVWDANTGSKQYTFEGHEAPVYSVCPHHKENIQFIFSTAIDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S+IVEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYIVEWNESEGAVKRTYHGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F +KFWDMD+V +L + DA+GGLPASP IRFNK+G LLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFLVKFWDMDNVNLLMTTDAEGGLPASPCIRFNKEGILLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFAE  1575
              NENGIK+LAN +GIRLLRT EN ++DA+  AS +  K     +  P + A  ++ G  +
Sbjct  660   TNENGIKILANQEGIRLLRTMENRSFDASRVASAAVVKAPAIGTFPPANPAVGTSIG--D  717

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     MN D R+ V DVKPRI +E+ +KS++WKLTEI E S CR+L+LP+NL   
Sbjct  718   RAAPVAAMVGMNSDNRSLV-DVKPRIADESGEKSRIWKLTEINEQSQCRSLRLPDNLTAM  776

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             ++SRL+YTNSG A+LALASNA+H LWKWQR +RN + KATA++ PQLWQPSSGILMTN++
Sbjct  777   RVSRLMYTNSGFAILALASNAVHKLWKWQRNDRNITTKATASVAPQLWQPSSGILMTNEI  836

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPEDAVPCFALSKNDSYVMSASGGK+SLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  837   SDTNPEDAVPCFALSKNDSYVMSASGGKVSLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  896

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVK+KLKGH KR+TGLAFS VLNVLVSSGAD+QL VW++D
Sbjct  897   NIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRVTGLAFSPVLNVLVSSGADSQLCVWNTD  956

Query  854   GWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQ SKFL +  G+A+   +DTRVQFH DQIH L VHETQ+AI+EA+KLEC++QWV R
Sbjct  957   GWEKQASKFLQVSPGQAAAPLADTRVQFHHDQIHLLAVHETQIAIFEASKLECLRQWVPR  1016

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             EA+  I+HAT+SCDSQ ++ SF D +V V TA+ L  RCRI P+AYL P+ S   V+PLV
Sbjct  1017  EASGSITHATYSCDSQSIFVSFEDGSVGVLTASTLRSRCRINPTAYLPPNPSLR-VYPLV  1075

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             VAAHP +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G ++T     SDQP R
Sbjct  1076  VAAHPSEPNQFALGLTDGGVCVLEPLESEGKWGTSPPLENGAGPSSTSGAAGSDQPQR  1133



>ref|XP_004508472.1| PREDICTED: topless-related protein 4-like isoform X2 [Cicer arietinum]
Length=1137

 Score =  1632 bits (4226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/1143 (73%), Positives = 955/1143 (84%), Gaps = 22/1143 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VH+LEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHRLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LDNFRHNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG--PIGLSVSSIPAALKHPRTPPTN---PSVDY  2829
             P P  +PT LAGWM+N   V HP+ S G  PIGL+ ++  A LK PRTPP+N   P++DY
Sbjct  241   PTPGALPTSLAGWMANPSPVPHPSASAGVGPIGLTTANNAAILKRPRTPPSNSNNPAMDY  300

Query  2828  PSGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGS  2652
              + DSDHV KR R  GISDEVN LP+N+LPV++    H Q+  + DDLPK    TLNQGS
Sbjct  301   QTADSDHVMKRTRPFGISDEVNNLPVNLLPVAYSSQNHGQSSYSSDDLPKTPVMTLNQGS  360

Query  2651  SPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDP  2472
                SMDFHP+QQ LLLVGT++GD+ +W++GSRE++  RNFKVW+L ACS+ LQ +L  + 
Sbjct  361   IVKSMDFHPLQQILLLVGTSMGDVMVWDIGSRERIAHRNFKVWELGACSVALQASLSNEY  420

Query  2471  GVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQ  2292
               SVN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQ
Sbjct  421   TASVNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNKQ  480

Query  2291  LCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWL  2112
             LCV+TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAWL
Sbjct  481   LCVVTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAWL  540

Query  2111  YDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFR  1932
             YDNMGSRVDYDAPG   TTM+YSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  
Sbjct  541   YDNMGSRVDYDAPGHSSTTMSYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLG  600

Query  1931  KRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLL  1752
             KRS GVVQFDTTKNR+LAAGD+F +KFWDMD+  +LTSIDADGGL ASP IRFNK+G LL
Sbjct  601   KRSVGVVQFDTTKNRFLAAGDEFMVKFWDMDNTSLLTSIDADGGLLASPCIRFNKEGILL  660

Query  1751  AVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp------SVNPISVASASN  1590
             A++ ++NG+K+LANT+GIRLLRT EN  +DA+  AS +  K         N ++V ++  
Sbjct  661   AIATSDNGVKILANTEGIRLLRTVENRTFDASRVASAAVVKAPSIGAFPSNNVTVGTS--  718

Query  1589  AGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPE  1410
                A+R   V     +N DAR ++ DVKPRI +E+ DKS++WKLTEI+EPS CR+LKLP+
Sbjct  719   --LADRTPPVAAMVGINNDAR-SLADVKPRIVDESLDKSRIWKLTEISEPSQCRSLKLPD  775

Query  1409  NLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGIL  1230
              L   ++SRLIYTN G A+LALA+NA+H LWKWQ+ +RN+SGKATA++ PQLWQPSSGIL
Sbjct  776   GLSSMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTSGKATASLQPQLWQPSSGIL  835

Query  1229  MTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaF  1050
             MTND+ D NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAF
Sbjct  836   MTNDIGDTNPEEAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAF  895

Query  1049  HPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLF  870
             HPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL 
Sbjct  896   HPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLC  955

Query  869   VWSSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVK  693
             VWS+DGWE+Q SKFL +P+GRA    +DTRVQFH DQ H L VHETQ+AIYEA KLEC+K
Sbjct  956   VWSTDGWERQASKFLQMPSGRAPAPLADTRVQFHLDQTHLLAVHETQIAIYEAPKLECLK  1015

Query  692   QWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSG  513
             QWV REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI  +AYL P+ S   
Sbjct  1016  QWVPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRINQTAYLHPNPSLR-  1074

Query  512   VHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQ  342
             V+PLV+AAHP + NQFALGL+DGGV V EPLESEG+WG PPP ENG+G +T     VS+Q
Sbjct  1075  VYPLVIAAHPSESNQFALGLTDGGVHVLEPLESEGRWGSPPPTENGAGPSTPSGASVSEQ  1134

Query  341   PPR  333
             P R
Sbjct  1135  PQR  1137



>ref|XP_003549747.1| PREDICTED: topless-related protein 4-like isoform X1 [Glycine 
max]
 gb|KHN15071.1| Topless-related protein 4 [Glycine soja]
Length=1134

 Score =  1632 bits (4226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 836/1139 (73%), Positives = 953/1139 (84%), Gaps = 17/1139 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRHNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQ--PNGARAPSPANNPLLGSVPKPGGFPPLGAHGP  3000
             WQHQLCKNPRPNPDIKTLFVDHSCGQ  PNGARAPSP  NPL+G+VPK GGFPPLGAHGP
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQVQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGP  240

Query  2999  FQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPS  2823
             FQP P  +PT LAGWM+N   V HP+ S GPIGL+ ++  A LK PRTPP+N P++DY +
Sbjct  241   FQPTPAALPTSLAGWMANPSPVPHPSASAGPIGLAAANNAAILKRPRTPPSNNPAMDYQT  300

Query  2822  GDSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSP  2646
              DSDHV KR R  G+SDEV NLP+N+LPV++ G  H Q+  + DDLPK V  TLNQGS  
Sbjct  301   ADSDHVLKRTRPFGLSDEVSNLPVNLLPVAYSGQSHGQSSYSSDDLPKTVVMTLNQGSIV  360

Query  2645  MSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGV  2466
              SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  RNFKVW+L ACS+ LQ +L  D   
Sbjct  361   KSMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAQRNFKVWELGACSVALQASLSNDYSA  420

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             S+N + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLC
Sbjct  421   SINRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNKQLC  480

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             V+TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAWLYD
Sbjct  481   VVTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAWLYD  540

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             NMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  KR
Sbjct  541   NMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGKR  600

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTTKNR+LAAGD+F+IKFWDMD+  MLTS++A+GGL ASP IRFNKDG LLAV
Sbjct  601   SVGVVQFDTTKNRFLAAGDEFTIKFWDMDNTNMLTSVEAEGGLLASPCIRFNKDGILLAV  660

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNA----GFA  1578
             S N+NG+K+LAN +GIRLLRT EN  +DA+  AS +  K     I    ++N       A
Sbjct  661   STNDNGVKILANAEGIRLLRTVENRTFDASRVASAAVVKAPT--IGAFPSTNVTVGTSLA  718

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R   V     +N D R N+ DVKPRI +E+ +KS++WKLTEI EPS CR+LKLP++L  
Sbjct  719   DRAPPVAAMVGINNDTR-NLADVKPRIVDESVEKSRIWKLTEINEPSQCRSLKLPDSLSS  777

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
              ++SRLIYTN G A+LALA+NA+H LWKWQR ERN++GKATA++ PQLWQPSSGILMTND
Sbjct  778   MRVSRLIYTNQGVAILALAANAVHKLWKWQRNERNTTGKATASIQPQLWQPSSGILMTND  837

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  838   ISDTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQD  897

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VWS+
Sbjct  898   NNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWST  957

Query  857   DGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQ SKFL +P+GR     +DTRVQFH DQ H L VHETQ+A+YEA KLEC+KQ+  
Sbjct  958   DGWEKQASKFLQMPSGRPPAPLADTRVQFHLDQTHLLAVHETQIALYEAPKLECIKQFSP  1017

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             RE A PI+HAT+SCDSQ +Y SF D ++ + T   L LRCRI  SAYL P+ S   VHPL
Sbjct  1018  RE-ANPITHATYSCDSQSIYVSFEDGSIGILTVPALRLRCRINQSAYLHPNPSLR-VHPL  1075

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQPPR  333
             V+AAHP +PNQFALGL+DGGV V EPLE+EGKWG PPP ENG+G +T     VS+QP R
Sbjct  1076  VIAAHPSEPNQFALGLTDGGVHVLEPLEAEGKWGTPPPNENGAGPSTASGAAVSEQPQR  1134



>ref|XP_008242803.1| PREDICTED: topless-related protein 4-like [Prunus mume]
Length=1131

 Score =  1631 bits (4224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 835/1135 (74%), Positives = 963/1135 (85%), Gaps = 12/1135 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK++VHKLEQESGFFFNM+YF+D V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDSVHKLEQESGFFFNMRYFDDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  N L+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNHLMGAVPKTGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             PAP  +PT LAGWM+N   V HP+ S GPIGL+ ++  AA LK PRTPPTN P++DY + 
Sbjct  241   PAPAALPTSLAGWMANPSPVPHPSASAGPIGLAAANNAAAMLKRPRTPPTNNPTMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  GI+DE N LP+N+LPV+FP   H Q+  + DDLP++V  TL+ GS+  
Sbjct  301   DSEHVLKRSRPFGITDEANNLPVNMLPVAFPNQSHGQSSYSSDDLPRSVVMTLSPGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ +LLVGTN+GD+ ++E+ S EK+ ++NFKVWDL  CS+PLQ +L  D   S
Sbjct  361   SMDFHPVQQIILLVGTNMGDVMIYELPSHEKIAIKNFKVWDLGECSVPLQASLASDYTAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             +N + WSPDG+LFGVAYS+HIV IYSY G DD+R HLEI+AHVG VNDLAFS+PNKQLCV
Sbjct  421   INRVMWSPDGTLFGVAYSKHIVHIYSYQGGDDIRNHLEIEAHVGSVNDLAFSYPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCGDD+ IKVWDA  G K YTFEGHEAPV SVCPHHKEN+QFIFSTA DGKIKAWLYD 
Sbjct  481   VTCGDDRVIKVWDAVTGTKHYTFEGHEAPVCSVCPHHKENIQFIFSTATDGKIKAWLYDT  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S++VEWNESEGAVKRTY G  KR+
Sbjct  541   VGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYLVEWNESEGAVKRTYHGLAKRT  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F++KFWDMD+V +L S DADGGLPASP IRFNK+G LLA S
Sbjct  601   VGVVQFDTTKNRFLAAGDEFTVKFWDMDNVNLLISTDADGGLPASPTIRFNKEGILLAAS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp-SVNPISVASASNAGFAERVA  1566
              N+NGIK+LAN+DGIRLLRT E+  +DA+  AS +A K   +     +S       ER A
Sbjct  661   TNDNGIKILANSDGIRLLRTVESRTFDASRAASAAAVKAPPLGTFGSSSIVGTSIGERAA  720

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
              VV    +N D+R+ V DVKPRI +E+ +KS++WKLTEI EPS CR+L+LP++L  T++S
Sbjct  721   PVVAMVGLNSDSRSLV-DVKPRIADESVEKSRIWKLTEINEPSQCRSLRLPDSLTATRVS  779

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTNSG A+LAL+SNA+H LWKWQR ERN++ KATA+  PQLWQP+SGILMTND++D 
Sbjct  780   RLIYTNSGLAVLALSSNAVHKLWKWQRNERNTT-KATASTVPQLWQPASGILMTNDISDT  838

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAAT+LAFHPQDNNII
Sbjct  839   NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATYLAFHPQDNNII  898

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VW++DGWE
Sbjct  899   AIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWNTDGWE  958

Query  845   KQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQ SKFL +P+GRA+   +DTRVQFH DQ   L VHETQ+AIYEA KLEC+KQWV REA+
Sbjct  959   KQASKFLQIPSGRAAAPLADTRVQFHLDQTLLLAVHETQIAIYEAPKLECLKQWVPREAS  1018

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
              PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P+ S   VHPLVVAA
Sbjct  1019  GPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRILPTAYLPPNPSF--VHPLVVAA  1076

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             HP +PNQFALGLSDGGV V EPLESEG+WG  PP+ENG+G +TT     SDQP R
Sbjct  1077  HPSEPNQFALGLSDGGVHVLEPLESEGRWGTSPPIENGAGPSTTSGAAGSDQPQR  1131



>ref|XP_007155032.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27026.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1128

 Score =  1631 bits (4223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/1142 (73%), Positives = 943/1142 (83%), Gaps = 29/1142 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRNNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S GP+GL  +   A LK PRTPPTN P++DY + D
Sbjct  241   PTPA-LPTSLAGWMANPSPVPHPSASAGPMGLPGAPAAAILKRPRTPPTNNPAMDYQTAD  299

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             SDHV KR R  GISDEV NLP+N+LPV++    H Q+  + DDLPK V  TL+QGS   S
Sbjct  300   SDHVLKRTRPFGISDEVSNLPVNLLPVAYSSQSHGQSSYSSDDLPKTVVMTLSQGSIVKS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQ LLLVGTN+GD+ +W++GSRE++  +NFKVW+L AC++ LQ +L  D   SV
Sbjct  360   MDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHKNFKVWELGACTVALQASLSSDYSASV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLCV+
Sbjct  420   NRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHTGSVNDLAFSYPNKQLCVV  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD+M
Sbjct  480   TCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDDM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRT+ G  KRS 
Sbjct  540   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTFHGLGKRSV  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F +KFWDMD+  MLT +DADGGL ASP IRFNKDG LLAVS 
Sbjct  600   GVVQFDTTKNRFLAAGDEFMVKFWDMDNTNMLTGVDADGGLLASPCIRFNKDGILLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             N+NG+K+LANT+GIRLLRT EN           +     V   +V  A   G        
Sbjct  660   NDNGVKILANTEGIRLLRTVEN----------RTFDASRVASAAVVKAPTLGSFPSTNVT  709

Query  1559  VGTSV---------MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
             VGTS+         MN D R ++ DVKPRI +E  DKS++WKLTEI EPS CR+LKLP++
Sbjct  710   VGTSLADRAPPVVAMNNDTR-SLADVKPRIVDEAVDKSRIWKLTEINEPSQCRSLKLPDS  768

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             L   ++SRLIYTN G A+LALA+NA+H LWKWQR ERN S KAT N+ PQLWQPSSG+LM
Sbjct  769   LSSMRVSRLIYTNQGVAILALATNAVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLM  828

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND++D NPEDAV CFALSKNDSYV+SASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH
Sbjct  829   TNDISDTNPEDAVSCFALSKNDSYVLSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH  888

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL V
Sbjct  889   PQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCV  948

Query  866   WSSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             WS+DGWEKQ SKFL +P GR     +DTRVQFHQDQ H L VHETQ+A+YEA KLEC+KQ
Sbjct  949   WSTDGWEKQASKFLQIPGGRPPAPLADTRVQFHQDQTHLLAVHETQIALYEAPKLECIKQ  1008

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             +  RE   PI+HAT+SCDSQ +Y SF D +V + T   L LRCRI+ +AYL P+ S   V
Sbjct  1009  FSSRE-NNPITHATYSCDSQSIYVSFEDGSVGILTVPALRLRCRISQTAYLHPNPSMR-V  1066

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQP  339
             +P+V+AAHP +PNQFALGL+DGGVLV EPLE+EGKWG PPP ENG+G ++T    VS+QP
Sbjct  1067  YPVVIAAHPSEPNQFALGLTDGGVLVLEPLETEGKWGTPPPNENGAGPSSTSGAAVSEQP  1126

Query  338   PR  333
              R
Sbjct  1127  QR  1128



>ref|XP_010241550.1| PREDICTED: topless-related protein 4-like isoform X1 [Nelumbo 
nucifera]
Length=1135

 Score =  1630 bits (4221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/1137 (73%), Positives = 951/1137 (84%), Gaps = 12/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEK KETVHKLEQESGFFFNMKYFED V NG+WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKCKETVHKLEQESGFFFNMKYFEDAVTNGDWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKNDRSKAVEILVKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIML ELKKLIEANPLFRDKLQFP+LK+SRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLAELKKLIEANPLFRDKLQFPTLKSSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDH+CGQPNGARAPSP  NPL+G++PK GGFP L  HGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHTCGQPNGARAPSPVTNPLMGAIPKAGGFPALATHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             PAP  + + LAGW++N   V HP VS GP+ L+  +  AA LK PRTP TN P+VDY + 
Sbjct  241   PAPASLQSSLAGWVANPSQVPHPTVSAGPMSLTAPNNAAAILKRPRTPSTNSPAVDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR + LG+SDEVN L +N++PV++    H Q+  + DDLPK V  TL+QG +  
Sbjct  301   DSEHVLKRSKPLGVSDEVNNLSVNIMPVTYANQSHIQSLYSSDDLPKTVVMTLHQGHAVR  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGT +GD+ +WEV S+E+L +R FKVWD SACSM LQ AL K+  +S
Sbjct  361   SMDFHPVQQTLLLVGTFIGDVLVWEVASKERLAMRTFKVWDPSACSMTLQAALAKETQLS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG++ GVAYS+HIV +YSYHG DD+R HLEIDAH GGVND+AFSHPNKQLC+
Sbjct  421   VNRVMWSPDGNICGVAYSKHIVHVYSYHGGDDLRHHLEIDAHNGGVNDIAFSHPNKQLCI  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDK+IKVWDA  GA+QYTFEGHEAPVYSVCPH+KEN+QFIFSTALDGKIKAWLYDN
Sbjct  481   ITCGDDKSIKVWDAVTGARQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG +CT MAYSADGTRLFSCGTSKDGE++IVEWNESEGAVKR+Y G  KRS
Sbjct  541   MGSRVDYDAPGHYCTRMAYSADGTRLFSCGTSKDGEAYIVEWNESEGAVKRSYHGCGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+L AGD+  IKFWDMD+V +L + DA+GGLP SP IRFNK+G LLAVS
Sbjct  601   VGVVQFDTTKNRFLVAGDESVIKFWDMDNVNLLMTTDAEGGLPPSPFIRFNKEGILLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNP---ISVASASNAGFAER  1572
              N+NGIK+LAN DG+RLL T E+    +   +      P+V+P   + V + ++ G A+R
Sbjct  661   TNDNGIKILANADGLRLLHTIESRFDASKVASGSVMKGPTVSPFVAVPVTTGTSVGVADR  720

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A V     +NGD R N+ DVKPRI +E+ +KSK+WKLTEI EPS CR+L+LP+NL   K
Sbjct  721   GAPVTAMVGLNGDTR-NLADVKPRIVDESVEKSKIWKLTEINEPSQCRSLRLPDNLPAAK  779

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRLIY NSG A+LALASNA+H LWKWQR +RN + KATA++PPQLWQPSSGILMTN+++
Sbjct  780   VSRLIYANSGIAILALASNAVHKLWKWQRNDRNITVKATASIPPQLWQPSSGILMTNEIS  839

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  840   DTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  899

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGM+DS+IQIYNVRVDEVKSKLKGH KRITGLAFS+VLNVLVSSGADAQL +WS+D 
Sbjct  900   IIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRITGLAFSNVLNVLVSSGADAQLCIWSTDK  959

Query  851   WEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL + AG+  S   +TRVQFHQDQIH L VHETQ+A+Y+ +KLEC+KQWV RE
Sbjct  960   WEKQGSKFLQIAAGKVTSPLVETRVQFHQDQIHLLAVHETQIAMYDISKLECLKQWVARE  1019

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
                 I+HAT+S DSQ +Y SF D +V VFTA  L LRCRI P+AYL  + S   V+PLV+
Sbjct  1020  PNGQITHATYSSDSQSIYTSFEDGSVGVFTATTLRLRCRINPTAYLPSNPSVR-VYPLVI  1078

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AAHP +PNQFA+GL+DGGV V EPLESEGKWG  PP ENGSG + T     SDQP R
Sbjct  1079  AAHPSEPNQFAVGLTDGGVYVLEPLESEGKWGTSPPPENGSGPSITSGIAGSDQPSR  1135



>ref|XP_007155034.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27028.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1131

 Score =  1630 bits (4221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 833/1135 (73%), Positives = 948/1135 (84%), Gaps = 12/1135 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRNNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S GP+GL  +   A LK PRTPPTN P++DY + D
Sbjct  241   PTPA-LPTSLAGWMANPSPVPHPSASAGPMGLPGAPAAAILKRPRTPPTNNPAMDYQTAD  299

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             SDHV KR R  GISDEV NLP+N+LPV++    H Q+  + DDLPK V  TL+QGS   S
Sbjct  300   SDHVLKRTRPFGISDEVSNLPVNLLPVAYSSQSHGQSSYSSDDLPKTVVMTLSQGSIVKS  359

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQ LLLVGTN+GD+ +W++GSRE++  +NFKVW+L AC++ LQ +L  D   SV
Sbjct  360   MDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHKNFKVWELGACTVALQASLSSDYSASV  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLCV+
Sbjct  420   NRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHTGSVNDLAFSYPNKQLCVV  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD+M
Sbjct  480   TCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDDM  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRT+ G  KRS 
Sbjct  540   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTFHGLGKRSV  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F +KFWDMD+  MLT +DADGGL ASP IRFNKDG LLAVS 
Sbjct  600   GVVQFDTTKNRFLAAGDEFMVKFWDMDNTNMLTGVDADGGLLASPCIRFNKDGILLAVST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG--FAERVA  1566
             N+NG+K+LANT+GIRLLRT EN  +DA+  AS +  K        ++    G   A+R  
Sbjct  660   NDNGVKILANTEGIRLLRTVENRTFDASRVASAAVVKAPTLGSFPSTNVTVGTSLADRAP  719

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
              VV    +N D R ++ DVKPRI +E  DKS++WKLTEI EPS CR+LKLP++L   ++S
Sbjct  720   PVVAMVGINNDTR-SLADVKPRIVDEAVDKSRIWKLTEINEPSQCRSLKLPDSLSSMRVS  778

Query  1385  RLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADK  1206
             RLIYTN G A+LALA+NA+H LWKWQR ERN S KAT N+ PQLWQPSSG+LMTND++D 
Sbjct  779   RLIYTNQGVAILALATNAVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLMTNDISDT  838

Query  1205  NPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNII  1026
             NPEDAV CFALSKNDSYV+SASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII
Sbjct  839   NPEDAVSCFALSKNDSYVLSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNII  898

Query  1025  AIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWE  846
             AIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VWS+DGWE
Sbjct  899   AIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWSTDGWE  958

Query  845   KQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAA  669
             KQ SKFL +P GR     +DTRVQFHQDQ H L VHETQ+A+YEA KLEC+KQ+  RE  
Sbjct  959   KQASKFLQIPGGRPPAPLADTRVQFHQDQTHLLAVHETQIALYEAPKLECIKQFSSRE-N  1017

Query  668   APISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAA  489
              PI+HAT+SCDSQ +Y SF D +V + T   L LRCRI+ +AYL P+ S   V+P+V+AA
Sbjct  1018  NPITHATYSCDSQSIYVSFEDGSVGILTVPALRLRCRISQTAYLHPNPSMR-VYPVVIAA  1076

Query  488   HPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             HP +PNQFALGL+DGGVLV EPLE+EGKWG PPP ENG+G ++T    VS+QP R
Sbjct  1077  HPSEPNQFALGLTDGGVLVLEPLETEGKWGTPPPNENGAGPSSTSGAAVSEQPQR  1131



>ref|XP_010656452.1| PREDICTED: topless-related protein 4 isoform X1 [Vitis vinifera]
Length=1134

 Score =  1629 bits (4219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 836/1139 (73%), Positives = 966/1139 (85%), Gaps = 17/1139 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFE+ V NG WD+VEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEETVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFSAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+ NPDIKTLFVDH+CGQPNGARAPSP  NPL+G+VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPKANPDIKTLFVDHTCGQPNGARAPSPVTNPLMGTVPKAGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPT-NPSVDYPSG  2820
             PAP  +PT LAGWM+N   V HP+ S GP+GL+ ++  AA LK PRTPPT NP++DY + 
Sbjct  241   PAPAPLPTSLAGWMANPSPVPHPSASAGPMGLATANNAAAILKRPRTPPTNNPAMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEV--NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSP  2646
             DS+HV KRPR  GISDE   NLP+N+LPV++ G  H Q+  + DDLPK V  +L QGS+ 
Sbjct  301   DSEHVLKRPRPFGISDEQVNNLPVNILPVAYTGQSHGQSSYSSDDLPKTVVMSLPQGSTV  360

Query  2645  MSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGV  2466
              SMDFHPVQQ LLLVGTN+GDI +W++GSRE+L ++NFKVW+L++CSM LQT+L  D   
Sbjct  361   RSMDFHPVQQILLLVGTNMGDIMVWDLGSRERLAIKNFKVWELASCSMALQTSLANDYLA  420

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             SVN + WSPDG+LFGVAYS+HIV +YSYH  DD+R HLEI+AHVG VNDLAFS+PNK LC
Sbjct  421   SVNRVMWSPDGTLFGVAYSKHIVHLYSYHNGDDLRNHLEIEAHVGSVNDLAFSYPNK-LC  479

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             V+TCG+D+ IKVWDA  G+KQYTFEGHEAPVYSVCPHHKEN+QFIFSTA+DGKIKAWLYD
Sbjct  480   VVTCGEDRFIKVWDANTGSKQYTFEGHEAPVYSVCPHHKENIQFIFSTAIDGKIKAWLYD  539

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             NMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S+IVEWNESEGAVKRTY G  KR
Sbjct  540   NMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYIVEWNESEGAVKRTYHGLGKR  599

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTTKNR+LAAGD+F +KFWDMD+V +L + DA+GGLPASP IRFNK+G LLAV
Sbjct  600   SVGVVQFDTTKNRFLAAGDEFLVKFWDMDNVNLLMTTDAEGGLPASPCIRFNKEGILLAV  659

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp----SVNPISVASASNAGFA  1578
             S NENGIK+LAN +GIRLLRT EN ++DA+  AS +  K     +  P + A  ++ G  
Sbjct  660   STNENGIKILANQEGIRLLRTMENRSFDASRVASAAVVKAPAIGTFPPANPAVGTSIG--  717

Query  1577  ERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
             +R A V     MN D R+ V DVKPRI +E+ +KS++WKLTEI E S CR+L+LP+NL  
Sbjct  718   DRAAPVAAMVGMNSDNRSLV-DVKPRIADESGEKSRIWKLTEINEQSQCRSLRLPDNLTA  776

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
              ++SRL+YTNSG A+LALASNA+H LWKWQR +RN + KATA++ PQLWQPSSGILMTN+
Sbjct  777   MRVSRLMYTNSGFAILALASNAVHKLWKWQRNDRNITTKATASVAPQLWQPSSGILMTNE  836

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPEDAVPCFALSKNDSYVMSASGGK+SLFNMMTFKTMTTFMPPPPAATFLAFHPQD
Sbjct  837   ISDTNPEDAVPCFALSKNDSYVMSASGGKVSLFNMMTFKTMTTFMPPPPAATFLAFHPQD  896

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KR+TGLAFS VLNVLVSSGAD+QL VW++
Sbjct  897   NNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRVTGLAFSPVLNVLVSSGADSQLCVWNT  956

Query  857   DGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             DGWEKQ SKFL +  G+A+   +DTRVQFH DQIH L VHETQ+AI+EA+KLEC++QWV 
Sbjct  957   DGWEKQASKFLQVSPGQAAAPLADTRVQFHHDQIHLLAVHETQIAIFEASKLECLRQWVP  1016

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             REA+  I+HAT+SCDSQ ++ SF D +V V TA+ L  RCRI P+AYL P+ S   V+PL
Sbjct  1017  REASGSITHATYSCDSQSIFVSFEDGSVGVLTASTLRSRCRINPTAYLPPNPSLR-VYPL  1075

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             VVAAHP +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G ++T     SDQP R
Sbjct  1076  VVAAHPSEPNQFALGLTDGGVCVLEPLESEGKWGTSPPLENGAGPSSTSGAAGSDQPQR  1134



>ref|XP_004508471.1| PREDICTED: topless-related protein 4-like isoform X1 [Cicer arietinum]
Length=1138

 Score =  1629 bits (4219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 833/1144 (73%), Positives = 956/1144 (84%), Gaps = 23/1144 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VH+LEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHRLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LDNFRHNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGGVPKAGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG--PIGLSVSSIPAA-LKHPRTPPTN---PSVD  2832
             P P  +PT LAGWM+N   V HP+ S G  PIGL+ ++  AA LK PRTPP+N   P++D
Sbjct  241   PTPGALPTSLAGWMANPSPVPHPSASAGVGPIGLTTANNAAAILKRPRTPPSNSNNPAMD  300

Query  2831  YPSGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQG  2655
             Y + DSDHV KR R  GISDEVN LP+N+LPV++    H Q+  + DDLPK    TLNQG
Sbjct  301   YQTADSDHVMKRTRPFGISDEVNNLPVNLLPVAYSSQNHGQSSYSSDDLPKTPVMTLNQG  360

Query  2654  SSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKD  2475
             S   SMDFHP+QQ LLLVGT++GD+ +W++GSRE++  RNFKVW+L ACS+ LQ +L  +
Sbjct  361   SIVKSMDFHPLQQILLLVGTSMGDVMVWDIGSRERIAHRNFKVWELGACSVALQASLSNE  420

Query  2474  PGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  2295
                SVN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNK
Sbjct  421   YTASVNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNK  480

Query  2294  QLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAW  2115
             QLCV+TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAW
Sbjct  481   QLCVVTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAW  540

Query  2114  LYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  1935
             LYDNMGSRVDYDAPG   TTM+YSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G 
Sbjct  541   LYDNMGSRVDYDAPGHSSTTMSYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGL  600

Query  1934  RKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTL  1755
              KRS GVVQFDTTKNR+LAAGD+F +KFWDMD+  +LTSIDADGGL ASP IRFNK+G L
Sbjct  601   GKRSVGVVQFDTTKNRFLAAGDEFMVKFWDMDNTSLLTSIDADGGLLASPCIRFNKEGIL  660

Query  1754  LAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskp------SVNPISVASAS  1593
             LA++ ++NG+K+LANT+GIRLLRT EN  +DA+  AS +  K         N ++V ++ 
Sbjct  661   LAIATSDNGVKILANTEGIRLLRTVENRTFDASRVASAAVVKAPSIGAFPSNNVTVGTS-  719

Query  1592  NAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLP  1413
                 A+R   V     +N DAR ++ DVKPRI +E+ DKS++WKLTEI+EPS CR+LKLP
Sbjct  720   ---LADRTPPVAAMVGINNDAR-SLADVKPRIVDESLDKSRIWKLTEISEPSQCRSLKLP  775

Query  1412  ENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGI  1233
             + L   ++SRLIYTN G A+LALA+NA+H LWKWQ+ +RN+SGKATA++ PQLWQPSSGI
Sbjct  776   DGLSSMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTSGKATASLQPQLWQPSSGI  835

Query  1232  LMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatfla  1053
             LMTND+ D NPE+AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLA
Sbjct  836   LMTNDIGDTNPEEAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLA  895

Query  1052  FHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL  873
             FHPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL
Sbjct  896   FHPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQL  955

Query  872   FVWSSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECV  696
              VWS+DGWE+Q SKFL +P+GRA    +DTRVQFH DQ H L VHETQ+AIYEA KLEC+
Sbjct  956   CVWSTDGWERQASKFLQMPSGRAPAPLADTRVQFHLDQTHLLAVHETQIAIYEAPKLECL  1015

Query  695   KQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssS  516
             KQWV REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI  +AYL P+ S  
Sbjct  1016  KQWVPREASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRINQTAYLHPNPSLR  1075

Query  515   GVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSD  345
              V+PLV+AAHP + NQFALGL+DGGV V EPLESEG+WG PPP ENG+G +T     VS+
Sbjct  1076  -VYPLVIAAHPSESNQFALGLTDGGVHVLEPLESEGRWGSPPPTENGAGPSTPSGASVSE  1134

Query  344   QPPR  333
             QP R
Sbjct  1135  QPQR  1138



>ref|XP_006594236.1| PREDICTED: topless-related protein 4-like isoform X1 [Glycine 
max]
Length=1133

 Score =  1628 bits (4216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 836/1138 (73%), Positives = 951/1138 (84%), Gaps = 16/1138 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRHNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HP+ S GPIGL+ ++  AA LK PRTPPTN P++DY + 
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAGPIGLAAANNAAAILKRPRTPPTNNPAMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDHV KR R  G+SDEV NLP+N+LPV++ G  H Q+  + DDLPK +  TLNQGS   
Sbjct  301   DSDHVLKRTRPFGLSDEVSNLPVNLLPVAYSGQSHGQSSYSSDDLPKTIVMTLNQGSIVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  RNFKVW+L +CS+ LQ +L  D   S
Sbjct  361   SMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAQRNFKVWELGSCSVALQASLSNDYSAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L  VAYS+HIV IYSY G DD+R HLEI+AH G VNDLAFS+PNKQLCV
Sbjct  421   VNRVVWSPDGTLCSVAYSKHIVHIYSYQGGDDLRNHLEIEAHAGSVNDLAFSYPNKQLCV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  KRS
Sbjct  541   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  MLTS++ADGGL ASP IRFNKDG LLAVS
Sbjct  601   VGVVQFDTTKNRFLAAGDEFMIKFWDMDNTNMLTSVEADGGLLASPCIRFNKDGILLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNA----GFAE  1575
              N++G+K+LAN +GIRLLRT EN  +DA+  AS +  K     I    ++N       A+
Sbjct  661   TNDSGVKILANAEGIRLLRTVENRTFDASRVASAAVVKAPT--IGAFPSTNVTVGTSLAD  718

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R   V     +N D R N+ DVKPRI +E  +KS++WKLTEI EPS CR+LKLP++L   
Sbjct  719   RAPPVAAMVGINNDTR-NLADVKPRIVDEAVEKSRIWKLTEINEPSQCRSLKLPDSLSSM  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             ++SRLIYTN G A+LALA+NA+H LWKWQR ERN++GKATA++ PQLWQPSSGILMTND+
Sbjct  778   RVSRLIYTNQGVAILALAANAVHKLWKWQRNERNTTGKATASIQPQLWQPSSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VWS+D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWSTD  957

Query  854   GWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEKQ SKFL +P+GR     +DTRVQFH DQ H L VHETQ+A+YEA KLEC+KQ+  R
Sbjct  958   GWEKQASKFLQMPSGRPPAPLADTRVQFHLDQTHLLAVHETQIALYEAPKLECIKQFSPR  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
             E A PI+HAT+SCDSQ +Y SF D ++ + T   L LRCRI  SAYL P+ S   VHPLV
Sbjct  1018  E-ANPITHATYSCDSQSIYVSFEDGSIGILTVPALRLRCRINQSAYLHPNPSLR-VHPLV  1075

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             +AAHP +PNQFALGL+DGGV V EPLE+EGKWG PPP ENG+G +TT    VS+Q  R
Sbjct  1076  IAAHPSEPNQFALGLTDGGVHVLEPLEAEGKWGTPPPNENGAGPSTTSGAAVSEQTQR  1133



>ref|XP_006600746.1| PREDICTED: topless-related protein 4-like isoform X2 [Glycine 
max]
Length=1135

 Score =  1627 bits (4214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 837/1140 (73%), Positives = 954/1140 (84%), Gaps = 18/1140 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRHNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQ--PNGARAPSPANNPLLGSVPKPGGFPPLGAHGP  3000
             WQHQLCKNPRPNPDIKTLFVDHSCGQ  PNGARAPSP  NPL+G+VPK GGFPPLGAHGP
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQVQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGP  240

Query  2999  FQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYP  2826
             FQP P  +PT LAGWM+N   V HP+ S GPIGL+ ++  AA LK PRTPP+N P++DY 
Sbjct  241   FQPTPAALPTSLAGWMANPSPVPHPSASAGPIGLAAANNAAAILKRPRTPPSNNPAMDYQ  300

Query  2825  SGDSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSS  2649
             + DSDHV KR R  G+SDEV NLP+N+LPV++ G  H Q+  + DDLPK V  TLNQGS 
Sbjct  301   TADSDHVLKRTRPFGLSDEVSNLPVNLLPVAYSGQSHGQSSYSSDDLPKTVVMTLNQGSI  360

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
               SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  RNFKVW+L ACS+ LQ +L  D  
Sbjct  361   VKSMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAQRNFKVWELGACSVALQASLSNDYS  420

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
              S+N + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQL
Sbjct  421   ASINRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNKQL  480

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             CV+TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAWLY
Sbjct  481   CVVTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAWLY  540

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DNMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  K
Sbjct  541   DNMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGK  600

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             RS GVVQFDTTKNR+LAAGD+F+IKFWDMD+  MLTS++A+GGL ASP IRFNKDG LLA
Sbjct  601   RSVGVVQFDTTKNRFLAAGDEFTIKFWDMDNTNMLTSVEAEGGLLASPCIRFNKDGILLA  660

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNA----GF  1581
             VS N+NG+K+LAN +GIRLLRT EN  +DA+  AS +  K     I    ++N       
Sbjct  661   VSTNDNGVKILANAEGIRLLRTVENRTFDASRVASAAVVKAPT--IGAFPSTNVTVGTSL  718

Query  1580  AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLR  1401
             A+R   V     +N D R N+ DVKPRI +E+ +KS++WKLTEI EPS CR+LKLP++L 
Sbjct  719   ADRAPPVAAMVGINNDTR-NLADVKPRIVDESVEKSRIWKLTEINEPSQCRSLKLPDSLS  777

Query  1400  VTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTN  1221
               ++SRLIYTN G A+LALA+NA+H LWKWQR ERN++GKATA++ PQLWQPSSGILMTN
Sbjct  778   SMRVSRLIYTNQGVAILALAANAVHKLWKWQRNERNTTGKATASIQPQLWQPSSGILMTN  837

Query  1220  DVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQ  1041
             D++D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQ
Sbjct  838   DISDTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQ  897

Query  1040  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWS  861
             DNNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VWS
Sbjct  898   DNNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWS  957

Query  860   SDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWV  684
             +DGWEKQ SKFL +P+GR     +DTRVQFH DQ H L VHETQ+A+YEA KLEC+KQ+ 
Sbjct  958   TDGWEKQASKFLQMPSGRPPAPLADTRVQFHLDQTHLLAVHETQIALYEAPKLECIKQFS  1017

Query  683   QREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHP  504
              RE A PI+HAT+SCDSQ +Y SF D ++ + T   L LRCRI  SAYL P+ S   VHP
Sbjct  1018  PRE-ANPITHATYSCDSQSIYVSFEDGSIGILTVPALRLRCRINQSAYLHPNPSLR-VHP  1075

Query  503   LVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQPPR  333
             LV+AAHP +PNQFALGL+DGGV V EPLE+EGKWG PPP ENG+G +T     VS+QP R
Sbjct  1076  LVIAAHPSEPNQFALGLTDGGVHVLEPLEAEGKWGTPPPNENGAGPSTASGAAVSEQPQR  1135



>ref|XP_007204297.1| hypothetical protein PRUPE_ppa000492mg [Prunus persica]
 gb|EMJ05496.1| hypothetical protein PRUPE_ppa000492mg [Prunus persica]
Length=1130

 Score =  1627 bits (4214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 830/1134 (73%), Positives = 959/1134 (85%), Gaps = 11/1134 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK++VHKLEQESGFFFNM+YF+D V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDSVHKLEQESGFFFNMRYFDDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  N L+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNHLMGAVPKTGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAP  +PT LAGWM+N   V HP+ S GPIGL+ ++  A LK PRTPPTN P++DY + D
Sbjct  241   PAPAALPTSLAGWMANPSPVPHPSASAGPIGLAAANNAAMLKRPRTPPTNNPTMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R  GI+DE N LP+N+LPV+FP   H Q+  + DDLP++V  TL+ GS+  S
Sbjct  301   SEHVLKRSRPFGITDEANNLPVNMLPVAFPNQSHGQSSYSSDDLPRSVVMTLSPGSAVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQ +LLVGTN+GD+ ++E+ S EK+ ++NFKVWDL  CS+ L+  L  D   S+
Sbjct  361   MDFHPVQQIILLVGTNMGDVMIYELPSHEKIAIKNFKVWDLGECSVALKATLASDYTASI  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+ FGVAYS+HIV IYSY G DD+R HLEI+AHVG VNDLAFS+PNKQLCV+
Sbjct  421   NRVMWSPDGTHFGVAYSKHIVHIYSYQGGDDIRNHLEIEAHVGSVNDLAFSYPNKQLCVV  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  G K YTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD +
Sbjct  481   TCGEDRVIKVWDAVTGTKHYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDTV  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+G+S++VEWNESEGAVKRTY G  KR+ 
Sbjct  541   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGDSYLVEWNESEGAVKRTYHGLAKRTV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F++KFWDMD+V  L S DADGGLPASP IRFNK+G LLA S 
Sbjct  601   GVVQFDTTKNRFLAAGDEFTVKFWDMDNVNPLISTDADGGLPASPAIRFNKEGILLAAST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskp-SVNPISVASASNAGFAERVAS  1563
             N+NGIK+LAN+DGIRLLRT E+  +DA+  AS +A K   +     +S       ER A 
Sbjct  661   NDNGIKILANSDGIRLLRTVESRTFDASRAASAAAVKAPPLGTFGSSSIVGTSIGERAAP  720

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             VV    +N D+R+ V DVKPRI +E+ +KS++WKLTEI EPS CR+L+LP++L  T++SR
Sbjct  721   VVAMVGLNSDSRSLV-DVKPRIADESAEKSRIWKLTEINEPSQCRSLRLPDSLTATRVSR  779

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LAL+SNA+H LWKWQR ERN++ KATA+  PQLWQP+SGILMTND++D N
Sbjct  780   LIYTNSGLAVLALSSNAVHKLWKWQRNERNTT-KATASTVPQLWQPASGILMTNDISDTN  838

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAAT+LAFHPQDNNIIA
Sbjct  839   PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATYLAFHPQDNNIIA  898

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VW++DGWEK
Sbjct  899   IGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWNTDGWEK  958

Query  842   QKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q SKFL +P+GRA+   +DTRVQFH DQ   L VHETQ+AIYEA KLEC+KQWV REA+ 
Sbjct  959   QASKFLQIPSGRAAAPLADTRVQFHLDQTLLLAVHETQIAIYEAPKLECLKQWVPREASG  1018

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI P+AYL P+ S   VHPLVVAAH
Sbjct  1019  PITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRILPTAYLPPNPSF--VHPLVVAAH  1076

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             P +PNQFALGL+DGGV V EPLESEG+WG  PP+ENG+G +TT     SDQP R
Sbjct  1077  PSEPNQFALGLTDGGVHVLEPLESEGRWGTSPPIENGAGPSTTSGAAGSDQPQR  1130



>ref|XP_007155033.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27027.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1129

 Score =  1624 bits (4206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/1143 (73%), Positives = 943/1143 (83%), Gaps = 30/1143 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRNNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGL-SVSSIPAALKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HP+ S GP+GL    +  A LK PRTPPTN P++DY + 
Sbjct  241   PTPA-LPTSLAGWMANPSPVPHPSASAGPMGLPGAPAAAAILKRPRTPPTNNPAMDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDHV KR R  GISDEV NLP+N+LPV++    H Q+  + DDLPK V  TL+QGS   
Sbjct  300   DSDHVLKRTRPFGISDEVSNLPVNLLPVAYSSQSHGQSSYSSDDLPKTVVMTLSQGSIVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  +NFKVW+L AC++ LQ +L  D   S
Sbjct  360   SMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHKNFKVWELGACTVALQASLSSDYSAS  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLCV
Sbjct  420   VNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHTGSVNDLAFSYPNKQLCV  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD+
Sbjct  480   VTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDD  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRT+ G  KRS
Sbjct  540   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTFHGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F +KFWDMD+  MLT +DADGGL ASP IRFNKDG LLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFMVKFWDMDNTNMLTGVDADGGLLASPCIRFNKDGILLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
              N+NG+K+LANT+GIRLLRT EN           +     V   +V  A   G       
Sbjct  660   TNDNGVKILANTEGIRLLRTVEN----------RTFDASRVASAAVVKAPTLGSFPSTNV  709

Query  1562  VVGTSV---------MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPE  1410
              VGTS+         MN D R ++ DVKPRI +E  DKS++WKLTEI EPS CR+LKLP+
Sbjct  710   TVGTSLADRAPPVVAMNNDTR-SLADVKPRIVDEAVDKSRIWKLTEINEPSQCRSLKLPD  768

Query  1409  NLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGIL  1230
             +L   ++SRLIYTN G A+LALA+NA+H LWKWQR ERN S KAT N+ PQLWQPSSG+L
Sbjct  769   SLSSMRVSRLIYTNQGVAILALATNAVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGML  828

Query  1229  MTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaF  1050
             MTND++D NPEDAV CFALSKNDSYV+SASGGKISLFNMMTFKTMTTFMPPPPAATFLAF
Sbjct  829   MTNDISDTNPEDAVSCFALSKNDSYVLSASGGKISLFNMMTFKTMTTFMPPPPAATFLAF  888

Query  1049  HPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLF  870
             HPQDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL 
Sbjct  889   HPQDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLC  948

Query  869   VWSSDGWEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVK  693
             VWS+DGWEKQ SKFL +P GR     +DTRVQFHQDQ H L VHETQ+A+YEA KLEC+K
Sbjct  949   VWSTDGWEKQASKFLQIPGGRPPAPLADTRVQFHQDQTHLLAVHETQIALYEAPKLECIK  1008

Query  692   QWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSG  513
             Q+  RE   PI+HAT+SCDSQ +Y SF D +V + T   L LRCRI+ +AYL P+ S   
Sbjct  1009  QFSSRE-NNPITHATYSCDSQSIYVSFEDGSVGILTVPALRLRCRISQTAYLHPNPSMR-  1066

Query  512   VHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQ  342
             V+P+V+AAHP +PNQFALGL+DGGVLV EPLE+EGKWG PPP ENG+G ++T    VS+Q
Sbjct  1067  VYPVVIAAHPSEPNQFALGLTDGGVLVLEPLETEGKWGTPPPNENGAGPSSTSGAAVSEQ  1126

Query  341   PPR  333
             P R
Sbjct  1127  PQR  1129



>ref|XP_007155035.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
 gb|ESW27029.1| hypothetical protein PHAVU_003G167500g [Phaseolus vulgaris]
Length=1132

 Score =  1623 bits (4203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 833/1136 (73%), Positives = 948/1136 (83%), Gaps = 13/1136 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK+DR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKQDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRNNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGAVPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGL-SVSSIPAALKHPRTPPTN-PSVDYPSG  2820
             P P  +PT LAGWM+N   V HP+ S GP+GL    +  A LK PRTPPTN P++DY + 
Sbjct  241   PTPA-LPTSLAGWMANPSPVPHPSASAGPMGLPGAPAAAAILKRPRTPPTNNPAMDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDHV KR R  GISDEV NLP+N+LPV++    H Q+  + DDLPK V  TL+QGS   
Sbjct  300   DSDHVLKRTRPFGISDEVSNLPVNLLPVAYSSQSHGQSSYSSDDLPKTVVMTLSQGSIVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  +NFKVW+L AC++ LQ +L  D   S
Sbjct  360   SMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHKNFKVWELGACTVALQASLSSDYSAS  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLCV
Sbjct  420   VNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHTGSVNDLAFSYPNKQLCV  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD+
Sbjct  480   VTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDD  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRT+ G  KRS
Sbjct  540   MGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTFHGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F +KFWDMD+  MLT +DADGGL ASP IRFNKDG LLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFMVKFWDMDNTNMLTGVDADGGLLASPCIRFNKDGILLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG--FAERV  1569
              N+NG+K+LANT+GIRLLRT EN  +DA+  AS +  K        ++    G   A+R 
Sbjct  660   TNDNGVKILANTEGIRLLRTVENRTFDASRVASAAVVKAPTLGSFPSTNVTVGTSLADRA  719

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
               VV    +N D R ++ DVKPRI +E  DKS++WKLTEI EPS CR+LKLP++L   ++
Sbjct  720   PPVVAMVGINNDTR-SLADVKPRIVDEAVDKSRIWKLTEINEPSQCRSLKLPDSLSSMRV  778

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTN G A+LALA+NA+H LWKWQR ERN S KAT N+ PQLWQPSSG+LMTND++D
Sbjct  779   SRLIYTNQGVAILALATNAVHKLWKWQRNERNPSAKATPNLLPQLWQPSSGMLMTNDISD  838

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPEDAV CFALSKNDSYV+SASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  839   TNPEDAVSCFALSKNDSYVLSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  898

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLNVLVSSGAD+QL VWS+DGW
Sbjct  899   IAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNVLVSSGADSQLCVWSTDGW  958

Query  848   EKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQ SKFL +P GR     +DTRVQFHQDQ H L VHETQ+A+YEA KLEC+KQ+  RE 
Sbjct  959   EKQASKFLQIPGGRPPAPLADTRVQFHQDQTHLLAVHETQIALYEAPKLECIKQFSSRE-  1017

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
               PI+HAT+SCDSQ +Y SF D +V + T   L LRCRI+ +AYL P+ S   V+P+V+A
Sbjct  1018  NNPITHATYSCDSQSIYVSFEDGSVGILTVPALRLRCRISQTAYLHPNPSMR-VYPVVIA  1076

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AHP +PNQFALGL+DGGVLV EPLE+EGKWG PPP ENG+G ++T    VS+QP R
Sbjct  1077  AHPSEPNQFALGLTDGGVLVLEPLETEGKWGTPPPNENGAGPSSTSGAAVSEQPQR  1132



>ref|XP_003609377.1| WD repeat-containing protein [Medicago truncatula]
Length=1132

 Score =  1620 bits (4195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 828/1141 (73%), Positives = 947/1141 (83%), Gaps = 23/1141 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VH+LEQESGFFFNM+YFE+ V NG WDEVEKYL+GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHRLEQESGFFFNMRYFEEMVTNGEWDEVEKYLTGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKGDRSKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LDNFRQNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+  VPK GGFPPL AHGP  
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMAGVPKVGGFPPLSAHGP--  238

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG--PIGLSVSSIPAAL-KHPRTPPTNPSVDYPS  2823
               P  +PT LAGWM+ +P V HP+ S G  PIGL+ ++ PAAL K PRTPP NP++DY +
Sbjct  239   -TPNALPTSLAGWMAASPQVQHPSASAGVGPIGLAQANNPAALLKRPRTPPNNPAMDYQT  297

Query  2822  GDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSP  2646
              DSDHV KR R  GISDEVN LP+N+LPV++    H Q+  + DDLPK    TLNQGS+ 
Sbjct  298   ADSDHVMKRTRPFGISDEVNNLPVNLLPVAYSSQSHGQSSYSSDDLPKTAVMTLNQGSTV  357

Query  2645  MSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGV  2466
              SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  R+FKVWDL  CS+ LQ +L  +   
Sbjct  358   KSMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHRSFKVWDLQVCSVALQASLSNEYSA  417

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             SVN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLC
Sbjct  418   SVNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNKQLC  477

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             V+TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD
Sbjct  478   VVTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYD  537

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             NMGSRVDYDAPG   TTM+YSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  KR
Sbjct  538   NMGSRVDYDAPGHSSTTMSYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGKR  597

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVVQFDTTKNR+LAAGD+F +KFWDMDS  +LTS DADGGL ASP IRFNK+G LLAV
Sbjct  598   STGVVQFDTTKNRFLAAGDEFMVKFWDMDSTNLLTSFDADGGLLASPCIRFNKEGILLAV  657

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------ASNAG  1584
             S ++NG+K+LAN +GIRLLRT EN     A  AS +AS  +V P ++ +      A    
Sbjct  658   STSDNGVKILANAEGIRLLRTVEN----RAFDASRAASAANVKPPTIGAFPSTNVAVGTS  713

Query  1583  FAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENL  1404
              A+R   V     +N D+R ++ DVKPRI +E  +KS++WKLTEI E S CR+LKLP+ L
Sbjct  714   LADRTPPVAAMVGLNNDSR-SLADVKPRIVDEAVEKSRIWKLTEINEQSQCRSLKLPDGL  772

Query  1403  RVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMT  1224
                ++SRLIYTN G A+LALA+NA+H LWKWQ+ +RN+SGKATA++ PQLWQPSSGILMT
Sbjct  773   SSMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTSGKATASLQPQLWQPSSGILMT  832

Query  1223  NDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHP  1044
             N++ D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHP
Sbjct  833   NEIGDTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHP  892

Query  1043  QDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVW  864
             QDNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLN+LVSSGAD+QL VW
Sbjct  893   QDNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNILVSSGADSQLCVW  952

Query  863   SSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW  687
             S+DGWEKQ +KFL +P GRA +  +DTRVQFH DQ H L VHETQ+AIYEA KLEC+KQW
Sbjct  953   STDGWEKQTNKFLQMPNGRALAPLADTRVQFHLDQTHLLAVHETQIAIYEAPKLECLKQW  1012

Query  686   VQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVH  507
             V REA+ PI+HAT+SCDSQ +Y SF D ++ V TA+ L LRCRI  +AYL+P+ S   V+
Sbjct  1013  VPREASGPITHATYSCDSQSIYVSFEDGSIGVLTASTLRLRCRINQTAYLNPNPSLR-VY  1071

Query  506   PLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQPP  336
             PLV+AAHP + NQFALGL+DGGV V EPLESEG+WG PPP ENG G +T     VS+QP 
Sbjct  1072  PLVIAAHPSESNQFALGLTDGGVHVLEPLESEGRWGSPPPTENGVGPSTPSGASVSEQPQ  1131

Query  335   R  333
             R
Sbjct  1132  R  1132



>ref|XP_009803406.1| PREDICTED: topless-related protein 4-like isoform X1 [Nicotiana 
sylvestris]
Length=1137

 Score =  1613 bits (4176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 820/1143 (72%), Positives = 951/1143 (83%), Gaps = 22/1143 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+ VHKLEQESGFFFNM+YF++ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDAVHKLEQESGFFFNMRYFDEMVANGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDRPKAVDILIKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR+IML+ELKKLIEANPLFRDKL FP+LKN+RLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDTKSARSIMLLELKKLIEANPLFRDKLNFPTLKNARLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCG--QPNGARAPSPANNPLLGSVPKPGGFPPLGAHG-  3003
             WQHQLCK+P+PNPDIKTLFVDHSCG  QPNGARAPSP  +PL+G VPKPG FPPLGAHG 
Sbjct  181   WQHQLCKSPKPNPDIKTLFVDHSCGPSQPNGARAPSPVTHPLMGGVPKPGVFPPLGAHGV  240

Query  3002  -PFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA--LKHPRTPPTNPSVD  2832
              PFQ AP  +P  LAGWM+N P VSHP+ S GPIG +  +  AA  LK PRTP  NP+VD
Sbjct  241   NPFQQAPGPLPNALAGWMTNPPQVSHPSASAGPIGFTTPNNAAAAMLKRPRTPTNNPTVD  300

Query  2831  YPSGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQG  2655
             Y + DS+H+ KR R  G+SDEVN +PIN+LP  + G  H+Q+  + DDLPK    TLNQG
Sbjct  301   YQTADSEHMLKRSRPFGVSDEVNNMPINILPGGYSGQSHAQSSYSSDDLPKASVMTLNQG  360

Query  2654  SSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKD  2475
             S+  SMDFHPVQQ LLLVGT  G+I +WE+G RE++  R+FKVWDL  CS+ LQ +L  +
Sbjct  361   SAVKSMDFHPVQQILLLVGTGTGEIMIWELGGRERISHRSFKVWDLGQCSVALQASLASE  420

Query  2474  PGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  2295
                SVN + WSPDG+LFGVAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNK
Sbjct  421   YSASVNRVMWSPDGTLFGVAYSKHIVHIYSYHGGDDLRNHLEIEAHSGSVNDLAFSYPNK  480

Query  2294  QLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAW  2115
             Q+C++TCGDD+ IKVWDA +GAKQYTFEGHEAPVYS+CPHHKEN+QFIFSTA+DGKIKAW
Sbjct  481   QICIVTCGDDRLIKVWDAVSGAKQYTFEGHEAPVYSICPHHKENIQFIFSTAIDGKIKAW  540

Query  2114  LYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  1935
             LYDNMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAV+RT+ G 
Sbjct  541   LYDNMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVRRTFIGL  600

Query  1934  RKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTL  1755
              KR+ GVVQFDTTKNR+LAAGD+F IKFWDMD++ MLTS +A+GG+PASP +RFNK+G L
Sbjct  601   GKRAGGVVQFDTTKNRFLAAGDEFMIKFWDMDNINMLTSTEAEGGIPASPCLRFNKEGIL  660

Query  1754  LAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------AS  1593
             LAVS ++NGIK+LAN DG+RLLR+ EN        AS  AS   V P ++ S      + 
Sbjct  661   LAVSTSDNGIKILANADGLRLLRSMEN----RQFDASRVASASVVKPPTMGSFGPPSTSV  716

Query  1592  NAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLP  1413
              A F +R   +     MNG+ R N+ DV+PR  EET DKS++WK TEI EPS CR+LKLP
Sbjct  717   AASFVDRGVPMTSMVSMNGENR-NLADVRPRAAEETVDKSRIWKPTEINEPSQCRSLKLP  775

Query  1412  ENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGI  1233
             +NL  T+ISRLIYTNSG A+LALASNA+H LWKW R ERN +GKA A++ PQLWQPS+G 
Sbjct  776   DNLTATRISRLIYTNSGLAILALASNAVHKLWKWPRNERNPTGKANASIVPQLWQPSNGT  835

Query  1232  LMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatfla  1053
             LMTND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLA
Sbjct  836   LMTNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLA  895

Query  1052  FHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL  873
             FHPQDNN+IAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVL+S+GAD+QL
Sbjct  896   FHPQDNNVIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLISAGADSQL  955

Query  872   FVWSSDGWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECV  696
              VWS+D WEKQ SK+L +PAGRA+  Q+DTRVQFHQDQ   LVVHETQ+AI+EA+KLEC+
Sbjct  956   CVWSTDAWEKQTSKYLQIPAGRAAAPQADTRVQFHQDQTQLLVVHETQIAIFEASKLECL  1015

Query  695   KQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssS  516
             KQWV REA+ PI+HAT+SCDSQ ++ SF DA+V V +A+ L  RCRI P++YL  + SS 
Sbjct  1016  KQWVPREASGPITHATYSCDSQSIFVSFEDASVGVLSASTLRWRCRINPTSYLPSNPSSR  1075

Query  515   GVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV--SDQ  342
              +HPLV+AAHP DPNQFALGLSDG V+V EPLESEGKWG  PP ENG+G +T+    SDQ
Sbjct  1076  -MHPLVIAAHPSDPNQFALGLSDGAVIVLEPLESEGKWGTLPPAENGAGPSTSGAANSDQ  1134

Query  341   PPR  333
             P R
Sbjct  1135  PQR  1137



>ref|XP_009595072.1| PREDICTED: topless-related protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1137

 Score =  1613 bits (4176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 820/1143 (72%), Positives = 950/1143 (83%), Gaps = 22/1143 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+ VHKLEQESGFFFNM+YF++ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDAVHKLEQESGFFFNMRYFDEMVANGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDRPKAVDILIKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR+IML+ELKKLIEANPLFRDKL FP+LKN+RLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDTKSARSIMLLELKKLIEANPLFRDKLNFPTLKNARLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCG--QPNGARAPSPANNPLLGSVPKPGGFPPLGAHG-  3003
             WQHQLCK+P+PNPDIKTLFVDHSCG  QPNGARAPSP  +PL+G VPKPG FPPLGAHG 
Sbjct  181   WQHQLCKSPKPNPDIKTLFVDHSCGPSQPNGARAPSPVTHPLMGGVPKPGVFPPLGAHGV  240

Query  3002  -PFQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA--LKHPRTPPTNPSVD  2832
              PFQ AP  +P  LAGWM+N P VSHP+ S GPIG +  +  AA  LK PRTP  NP+VD
Sbjct  241   NPFQQAPGPLPNALAGWMTNPPQVSHPSASAGPIGFTTPNNAAAAMLKRPRTPTNNPTVD  300

Query  2831  YPSGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQG  2655
             Y + DS+H+ KR R  G+SDEVN +PIN+LP  + G  H+Q+  + DDLPK    TLNQG
Sbjct  301   YQTADSEHMLKRSRPFGVSDEVNNMPINILPGGYSGQSHAQSSYSSDDLPKASVMTLNQG  360

Query  2654  SSPMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKD  2475
             S+  SMDFHP QQ LLLVGT  G+I +WE+G RE++  R+FKVWDL  CS+ LQ +L  +
Sbjct  361   SAVKSMDFHPAQQILLLVGTGTGEIMIWELGGRERISHRSFKVWDLGQCSVALQASLASE  420

Query  2474  PGVSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNK  2295
                SVN + WSPDG+LFGVAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNK
Sbjct  421   YSASVNRVMWSPDGTLFGVAYSKHIVHIYSYHGGDDLRNHLEIEAHSGSVNDLAFSYPNK  480

Query  2294  QLCVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAW  2115
             Q+C++TCGDD+ IKVWDA +GAKQYTFEGHEAPVYS+CPHHKEN+QFIFSTA+DGKIKAW
Sbjct  481   QICIVTCGDDRLIKVWDAVSGAKQYTFEGHEAPVYSICPHHKENIQFIFSTAIDGKIKAW  540

Query  2114  LYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGF  1935
             LYDNMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRT+ G 
Sbjct  541   LYDNMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTFMGL  600

Query  1934  RKRSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTL  1755
              KR+ GVVQFDTTKNR+LAAGD+F IKFWDMDS+ MLTS +A+GG+PASP +RFNK+G L
Sbjct  601   GKRAGGVVQFDTTKNRFLAAGDEFMIKFWDMDSINMLTSTEAEGGIPASPCLRFNKEGIL  660

Query  1754  LAVSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------AS  1593
             LAVS ++NGIK+LAN DG+RLLR+ EN        AS  AS   V P ++ S      + 
Sbjct  661   LAVSTSDNGIKILANADGLRLLRSMEN----RQFDASRVASASVVKPPTMGSFGPPSTSV  716

Query  1592  NAGFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLP  1413
              A F +R   +     MNG+ R N+ DV+PR  EET DKS++WK TEI EPS CR+LKLP
Sbjct  717   AASFVDRGVPMTSMVSMNGENR-NLADVRPRAAEETVDKSRIWKPTEINEPSQCRSLKLP  775

Query  1412  ENLRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGI  1233
             ++L  T+ISRLIYTNSG A+LALASNA+H LWKW R ERN +GKA A++ PQLWQPS+G 
Sbjct  776   DSLTATRISRLIYTNSGLAILALASNAVHKLWKWPRNERNPTGKANASIVPQLWQPSNGT  835

Query  1232  LMTNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatfla  1053
             LMTND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLA
Sbjct  836   LMTNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLA  895

Query  1052  FHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQL  873
             FHPQDNN+IAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVL+S+GAD+QL
Sbjct  896   FHPQDNNVIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLISAGADSQL  955

Query  872   FVWSSDGWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECV  696
              VWS+D WEKQ SK+L +PAGRA+  Q+DTRVQFHQDQ   LVVHETQ+AI+EA+KLEC+
Sbjct  956   CVWSTDAWEKQTSKYLQIPAGRAAAPQADTRVQFHQDQTQLLVVHETQIAIFEASKLECL  1015

Query  695   KQWVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssS  516
             KQWV REA+ PI+HAT+SCDSQ ++ SF DA+V V +A+ L  RCRI P++YL  + SS 
Sbjct  1016  KQWVPREASGPITHATYSCDSQSIFVSFEDASVGVLSASTLRWRCRINPTSYLPSNPSSR  1075

Query  515   GVHPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV--SDQ  342
              +HPLV+AAHP DPNQFALGLSDG V+V EPLESEGKWG  PP ENG+G +T+    SDQ
Sbjct  1076  -MHPLVIAAHPSDPNQFALGLSDGAVIVLEPLESEGKWGTLPPAENGAGPSTSGAANSDQ  1134

Query  341   PPR  333
             P R
Sbjct  1135  PQR  1137



>ref|XP_006364222.1| PREDICTED: topless-related protein 4-like [Solanum tuberosum]
Length=1132

 Score =  1612 bits (4175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 824/1121 (74%), Positives = 949/1121 (85%), Gaps = 14/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLE+ESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEKESGFFFNMRYFEDSVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDQAKAVEILVKDLKVFSTFNEELFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFR+KLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFREKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQPNGARAPSP  NP++GS+PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQPNGARAPSPVANPIIGSMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPP-TNPSVDYPSG  2820
             PA   + + L GWM+N P++ H A+SGGPIGLS  +  A+ LKHPRTPP TN ++DY + 
Sbjct  241   PAQAPIAS-LGGWMTNPPSMPHQAISGGPIGLSPPTNAASMLKHPRTPPATNAALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H  +  + DDLPK V   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHGHSLHSSDDLPKTVVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WE+G RE+L  +NFKVW++  CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNIGDIAIWEIGGRERLAFKNFKVWEIGNCSMTLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG V+DLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVSDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCG+DK IKVWDA  G+KQYTFEGHEAPVYSVCPH+KE++QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGEDKAIKVWDAATGSKQYTFEGHEAPVYSVCPHYKESIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYVGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LT+ DADGGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFIIKFWDMDNTNLLTTADADGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRAIESRALDPSRVPPGAVAKAPMISTYGASSSTAGTSISIAD  719

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     +NGD R ++ D KPRI EE  +KSK+WKLTEI+EP+  R+ +LP+NL   
Sbjct  720   RTAPVTAIVQLNGDNR-SLQDTKPRIPEEL-EKSKIWKLTEISEPAQVRSSRLPDNLLSV  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             +I RL+YTNSG A+LALA NA+H LWKWQR ERN +GKA+  +PPQLWQPSSGILMTND+
Sbjct  778   RIIRLMYTNSGGAILALAYNAVHKLWKWQRNERNVTGKASTAVPPQLWQPSSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS VLNVLVSSGADAQL VWS D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSSVLNVLVSSGADAQLCVWSMD  957

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQWV  
Sbjct  958   GWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQWVSP  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
               A  ++ AT+SCDSQ ++ASF D +V +FTAA L LRCR+ P+AYL  + SS  V+PLV
Sbjct  1018  NFA--VTDATYSCDSQSIFASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSR-VYPLV  1074

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             VAAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1075  VAAHPSESNQCAVGLTDGGVYVLEPLESEGKWGTPPPNENG  1115



>ref|XP_009772956.1| PREDICTED: topless-related protein 4 isoform X2 [Nicotiana sylvestris]
Length=1132

 Score =  1612 bits (4174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 820/1121 (73%), Positives = 952/1121 (85%), Gaps = 14/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVH+LE+ESGFFFNM+YFED V NG WD+VEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHRLEKESGFFFNMRYFEDSVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDQAKAVEILVKDLKVFSTFNEDLFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQ NGARAPSP  NP++G++PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQANGARAPSPVANPIIGAMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTN-PSVDYPSG  2820
             PAP  + + L GWM+N P++ H A+SGGPIGLS   +  + LKHPRTPP N P++DY + 
Sbjct  241   PAPAPIAS-LGGWMANPPSMPHQAISGGPIGLSPPVNTASMLKHPRTPPANNPALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H+    + DDLPK +   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHAHNLYSSDDLPKTIVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WEVG RE+L  +NFKVW++S CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNLGDIAIWEVGGRERLAFKNFKVWEISNCSMNLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG VNDLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVNDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDK I+VWDA  G+KQYTFEGHEAPVYSVCPH+KEN+QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGDDKAIRVWDAATGSKQYTFEGHEAPVYSVCPHYKENIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYIGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFVIKFWDMDNTNLLTSIDAEGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRAIESRALDPSRVPPAAVAKAPMISTYGASSSTAGTSMSIAD  719

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     +NGD R ++ D KPR+++E  +KSK+WKLTEI+EP+  R+ +LP++L   
Sbjct  720   RTAPVNAVVQLNGDNR-SLQDAKPRVSDEL-EKSKIWKLTEISEPAQVRSSRLPDSLLSV  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             +I RL+YTNSG+A+LALA NA+H LWKW R ERN +GKA+  +PPQLWQPSSGILMTND+
Sbjct  778   RIIRLMYTNSGAAILALAYNAVHKLWKWPRNERNVTGKASTVVPPQLWQPSSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             ++ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS+VLNVLVSSGADAQL VWS D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADAQLCVWSMD  957

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQWV  
Sbjct  958   GWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQWVSP  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
               A  I+ AT+SCDSQ +YASF D +V +FTAA L LRCR+ P+AYL  + SS  V+PLV
Sbjct  1018  NVA--ITDATYSCDSQSIYASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSR-VYPLV  1074

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             +AAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1075  IAAHPSEANQCAVGLTDGGVYVLEPLESEGKWGTPPPKENG  1115



>ref|XP_008337262.1| PREDICTED: topless-related protein 4 [Malus domestica]
 ref|XP_008337263.1| PREDICTED: topless-related protein 4 [Malus domestica]
Length=1131

 Score =  1611 bits (4172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1137 (72%), Positives = 941/1137 (83%), Gaps = 16/1137 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK++VHKLEQESGFFFNM+YFED V  G W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDSVHKLEQESGFFFNMRYFEDMVTTGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDHSCGQPNG RAPSP  N L+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHSCGQPNGTRAPSPVTNHLMGAVPKTGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT-NPSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S GP+GL+  +  A LK PRTPPT NP++DY + D
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAGPLGLAAXNNAAILKRPRTPPTSNPTMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R  GI+DE N LP+N+LPV +P   H Q+  + DDLP++V  TL  GS+  S
Sbjct  301   SEHVLKRSRPFGITDEANNLPVNMLPVVYPNQSHGQSSYSSDDLPRSVVMTLCPGSTVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPV Q LLLVGTN+GD+ ++E+ S EK+ ++NFKVWDL ACS  LQ +L  D   S+
Sbjct  361   MDFHPVLQILLLVGTNMGDVMVYELPSLEKIAIKNFKVWDLGACSAALQASLASDYTASI  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+ FGVAYS+HIV IYSYHG DD+R  LEI+AHVG VNDLAFS PNKQLCVI
Sbjct  421   NRVMWSPDGTXFGVAYSKHIVHIYSYHGGDDLRNXLEIEAHVGSVNDLAFSXPNKQLCVI  480

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCG+D+ IKVWDA  G KQYTFEGHEAPVYSVCPHHKE +QFIFSTA DGKIKAWLYDNM
Sbjct  481   TCGEDRVIKVWDAATGTKQYTFEGHEAPVYSVCPHHKEKIQFIFSTATDGKIKAWLYDNM  540

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADG RLFSCGT+K+G+S++VEWNESEGAVKRT+ G  K + 
Sbjct  541   GSRVDYDAPGYSSTTMAYSADGARLFSCGTNKEGDSYLVEWNESEGAVKRTFHGLAKHTV  600

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F++KFWDMD+V +L S DADGGLPASP IRFNK+G LLA S 
Sbjct  601   GVVQFDTTKNRFLAAGDEFTVKFWDMDNVNLLMSTDADGGLPASPVIRFNKEGILLAAST  660

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASN----AGFAER  1572
             N+NGIK+LAN+DGIRLLRT E+      A  + SA+     P      SN        +R
Sbjct  661   NDNGIKILANSDGIRLLRTVES--RTXDASRAASAAAVKAPPTGTFGPSNIPIGTSIGDR  718

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A V   + +N D R+ V DVKPRI +E+ +KS++WKLTEI+E S CR+L+LP++L   +
Sbjct  719   AAPVAAMAGLNNDNRSLV-DVKPRIADESVEKSRIWKLTEISEQSQCRSLRLPDSLTAMR  777

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRLIYTNSG A+LAL+SNA+H LWKWQR ER    KATA+ PPQ+WQP+SGILMTND++
Sbjct  778   VSRLIYTNSGLAVLALSSNAVHKLWKWQRNERIH--KATASSPPQMWQPASGILMTNDIS  835

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAAT+LAFHPQDNN
Sbjct  836   DTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATYLAFHPQDNN  895

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VW++DG
Sbjct  896   IIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTLNVLVSSGADSQLCVWNTDG  955

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL +P+GRA+   +DTRVQFH DQ H L VHETQ+AIYEA KLEC+KQWV RE
Sbjct  956   WEKQASKFLQMPSGRAAAPLADTRVQFHSDQTHLLAVHETQIAIYEAPKLECLKQWVPRE  1015

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             A+ PI+HA +SCDSQL+Y SF D +V V TA  L LRCRI P+AYL  + S   V+PLVV
Sbjct  1016  ASGPITHAVYSCDSQLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPSNPSLR-VYPLVV  1074

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AAHP +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G +TT     S+QP R
Sbjct  1075  AAHPSEPNQFALGLTDGGVHVLEPLESEGKWGTNPPIENGAGPSTTSGVAGSEQPQR  1131



>ref|XP_009613435.1| PREDICTED: topless-related protein 4 isoform X2 [Nicotiana tomentosiformis]
Length=1132

 Score =  1611 bits (4171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 822/1121 (73%), Positives = 951/1121 (85%), Gaps = 14/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVH+LE+ESGFFFNM+YFED V NG WD+VEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHRLEKESGFFFNMRYFEDSVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDQAKAVEILVKDLKVFSTFNEDLFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQ NGARAPSP  NP++G++PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQANGARAPSPVANPIIGAMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             PAP  + + L GWM+N P++ H A+SGGPIGLS     A+ LKHPRTPP N P++DY + 
Sbjct  241   PAPAPIAS-LGGWMANPPSMPHQAISGGPIGLSPPVNAASMLKHPRTPPANNPALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H+    + DDLPK V   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHAHNLYSSDDLPKTVVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WEVG RE+L  +NFKVW++S CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNLGDIAIWEVGGRERLAFKNFKVWEISNCSMNLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG VNDLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVNDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDK I+VWDA  G+KQYTFEGHEAPVYSVCPH+KEN+QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGDDKAIRVWDAATGSKQYTFEGHEAPVYSVCPHYKENIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYIGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFVIKFWDMDNTNLLTSIDAEGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRAIESRALDPSRVPPGAVAKAPMISTYGASSSTAGTSMSIAD  719

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     +NGD R ++ D KPR+++E  +KSK+WKLTEI+EP+  R+ +LP++L   
Sbjct  720   RTAPVNAVVQLNGDNR-SLQDAKPRVSDEL-EKSKIWKLTEISEPAQVRSSRLPDSLLSV  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             +I RL+YTNSG A+LALA NA+H LWKW R ERN +GKA+  +PPQLWQPSSGILMTND+
Sbjct  778   RIIRLMYTNSGGAILALAYNAVHKLWKWPRNERNVTGKASTAVPPQLWQPSSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             ++ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS+VLNVLVSSGADAQL VWS D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADAQLCVWSMD  957

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQWV  
Sbjct  958   GWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQWVSP  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
               A  I+ AT+SCDSQ +YASF D +V +FTAA L LRCR+ P+AYL  + SS  V+PLV
Sbjct  1018  NVA--ITDATYSCDSQSIYASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSR-VYPLV  1074

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             +AAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1075  IAAHPSEANQCAVGLTDGGVYVLEPLESEGKWGTPPPNENG  1115



>ref|XP_009772955.1| PREDICTED: topless-related protein 4 isoform X1 [Nicotiana sylvestris]
Length=1136

 Score =  1610 bits (4168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1125 (73%), Positives = 953/1125 (85%), Gaps = 18/1125 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVH+LE+ESGFFFNM+YFED V NG WD+VEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHRLEKESGFFFNMRYFEDSVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDQAKAVEILVKDLKVFSTFNEDLFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQ NGARAPSP  NP++G++PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQANGARAPSPVANPIIGAMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVS-SIPAALKHPRTPPTN-PSVDYPSG  2820
             PAP  + + L GWM+N P++ H A+SGGPIGLS   +  + LKHPRTPP N P++DY + 
Sbjct  241   PAPAPIAS-LGGWMANPPSMPHQAISGGPIGLSPPVNTASMLKHPRTPPANNPALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H+    + DDLPK +   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHAHNLYSSDDLPKTIVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WEVG RE+L  +NFKVW++S CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNLGDIAIWEVGGRERLAFKNFKVWEISNCSMNLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG VNDLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVNDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDK I+VWDA  G+KQYTFEGHEAPVYSVCPH+KEN+QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGDDKAIRVWDAATGSKQYTFEGHEAPVYSVCPHYKENIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYIGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFVIKFWDMDNTNLLTSIDAEGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRAIESRALDPSRVPPAAVAKAPMISTYGASSSTAGTSMSIAD  719

Query  1574  RVASVVG----TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
             R A V      T+  NGD R ++ D KPR+++E  +KSK+WKLTEI+EP+  R+ +LP++
Sbjct  720   RTAPVNAVVQLTTFQNGDNR-SLQDAKPRVSDEL-EKSKIWKLTEISEPAQVRSSRLPDS  777

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             L   +I RL+YTNSG+A+LALA NA+H LWKW R ERN +GKA+  +PPQLWQPSSGILM
Sbjct  778   LLSVRIIRLMYTNSGAAILALAYNAVHKLWKWPRNERNVTGKASTVVPPQLWQPSSGILM  837

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND+++ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH
Sbjct  838   TNDISETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH  897

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNNIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS+VLNVLVSSGADAQL V
Sbjct  898   PQDNNIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADAQLCV  957

Query  866   WSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             WS DGWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQ
Sbjct  958   WSMDGWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQ  1017

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             WV    A  I+ AT+SCDSQ +YASF D +V +FTAA L LRCR+ P+AYL  + SS  V
Sbjct  1018  WVSPNVA--ITDATYSCDSQSIYASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSR-V  1074

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             +PLV+AAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1075  YPLVIAAHPSEANQCAVGLTDGGVYVLEPLESEGKWGTPPPKENG  1119



>ref|XP_010318717.1| PREDICTED: protein TOPLESS-like isoform X2 [Solanum lycopersicum]
Length=916

 Score =  1609 bits (4167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 817/916 (89%), Positives = 862/916 (94%), Gaps = 3/916 (0%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSK VEIL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKGVEILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPG FPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGSFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTNPSVDYPSGDS  2814
             P P  V   LAGWMSN PTV+HPAVSGGP+GL  SSIPA+LKHPRTPPTNPS+DYPSG+S
Sbjct  241   PGPAPVAAPLAGWMSNPPTVAHPAVSGGPMGLGPSSIPASLKHPRTPPTNPSIDYPSGES  300

Query  2813  DHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSMD  2634
             DH +KR RSLGISDEVNLP+NVLP+SFPG GH+Q+ +  DDLPK VARTLNQGSSPMSMD
Sbjct  301   DHAAKRTRSLGISDEVNLPVNVLPISFPGQGHNQSLTVPDDLPKTVARTLNQGSSPMSMD  360

Query  2633  FHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVNC  2454
             FHP QQTLLLVGTNVGDIALWEVGSRE+LVLRNFKVWDLSACSMPLQTALVKDPGVSVN 
Sbjct  361   FHPSQQTLLLVGTNVGDIALWEVGSRERLVLRNFKVWDLSACSMPLQTALVKDPGVSVNR  420

Query  2453  ITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVITC  2274
             + WSPDGSLFGVAYSRHIVQIYSYHGNDD+RQH+EIDAHVGGVNDLAFSHPNKQL VITC
Sbjct  421   VIWSPDGSLFGVAYSRHIVQIYSYHGNDDIRQHVEIDAHVGGVNDLAFSHPNKQLSVITC  480

Query  2273  GDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMGS  2094
             GDDKTIKVWDAT+GA+QYTFEGHEAPVYSVCPHHKE +QFIFSTALDGKIKAWLYDN+GS
Sbjct  481   GDDKTIKVWDATSGARQYTFEGHEAPVYSVCPHHKETIQFIFSTALDGKIKAWLYDNLGS  540

Query  2093  RVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFGV  1914
             RVDY+APGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS GV
Sbjct  541   RVDYEAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGV  600

Query  1913  VQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSANE  1734
             VQFDTTKNR+LAAGDDFSIKFWDMD V +LTSIDADGGLPASPRIRFNKDG+LLAVSANE
Sbjct  601   VQFDTTKNRFLAAGDDFSIKFWDMDHVPLLTSIDADGGLPASPRIRFNKDGSLLAVSANE  660

Query  1733  NGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVASVVG  1554
             NGIK+LAN DGIRL+RTFENL     A  +   +KP+VNPISVASA+N+GFA+RVASVVG
Sbjct  661   NGIKILANNDGIRLIRTFENL--AYDASRASETTKPTVNPISVASANNSGFADRVASVVG  718

Query  1553  TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISRLIY  1374
              S MNGDARN V DVKPRI EE NDKSK+WKLTEI+E S CR+LKLPENLRVTKISRLIY
Sbjct  719   ISGMNGDARNPV-DVKPRINEEPNDKSKIWKLTEISESSQCRSLKLPENLRVTKISRLIY  777

Query  1373  TNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKNPED  1194
             TNSG+A+LALASNAIHLLWKWQR ERN+SGKATA++ PQLWQPSSGILMTNDV + N E+
Sbjct  778   TNSGNAVLALASNAIHLLWKWQRNERNTSGKATASVSPQLWQPSSGILMTNDVHEPNHEE  837

Query  1193  AVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIAIGM  1014
             AV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM
Sbjct  838   AVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGM  897

Query  1013  DDSTIQIYNVRVDEVK  966
             DDSTIQIYNVRVDE +
Sbjct  898   DDSTIQIYNVRVDETR  913



>ref|XP_009363995.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
 ref|XP_009363996.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
Length=1129

 Score =  1608 bits (4164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/1137 (72%), Positives = 950/1137 (84%), Gaps = 18/1137 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK++VHKLEQESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDSVHKLEQESGFFFNMRYFEDMVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVF+SFNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFASFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDHSCGQPNG RAPSP  N L+G+VPK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRSNPDIKTLFVDHSCGQPNGTRAPSPVTNHLMGAVPKTGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT-NPSVDYPSGD  2817
             P P  +PT LAGWM+N   V HP+ S GP+GL+ ++  A LK PRTPPT NP++DY + D
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSASAGPLGLAAANTAAILKRPRTPPTGNPTMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+ V KR R  GI DE  NLP+N+LPV++P   H Q+  + DDLP++V  TL+ GS+  S
Sbjct  301   SEFVLKRSRPFGIPDEANNLPVNMLPVAYPNQSHGQSSYSSDDLPRSVVMTLSPGSAVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQ LLLVGTN+GD+ ++++ S+EK  ++NFKVWD+ ACS  LQ +L  D   S+
Sbjct  361   MDFHPVQQILLLVGTNMGDVMIYKLPSQEK-AIKNFKVWDIGACSGALQASLASDYTASI  419

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+L GVAYS+HIV IYSYHG D++R HLEI+AHVG VNDLAFS+PNKQLCV+
Sbjct  420   NRVMWSPDGTLVGVAYSKHIVHIYSYHGGDELRNHLEIEAHVGSVNDLAFSYPNKQLCVV  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDD+ IKVWDA  G KQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN+
Sbjct  480   TCGDDRVIKVWDAATGIKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDNV  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADG RLFSCGT+K+G+S +VEWNESEGAVKRTY G  KR+ 
Sbjct  540   GSRVDYDAPGHSSTTMAYSADGARLFSCGTNKEGDSSLVEWNESEGAVKRTYHGLAKRTV  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F++KFWDMD+V +LTS DADGGLPASP IRFNK+G LLA S 
Sbjct  600   GVVQFDTTKNRFLAAGDEFTVKFWDMDNVNLLTSTDADGGLPASPTIRFNKEGILLAAST  659

Query  1739  NENGIKVLANTDGIRLLRTFE----NLaydaaarasesaskpSVNPISVASASNAGFAER  1572
             N+ GIK+LANTDGIRLLRT E    + +  A+A A ++    +  P S    ++ G  +R
Sbjct  660   ND-GIKILANTDGIRLLRTVESRTFDASRAASAAAVKALPVGTFGPSSTPIGTSIG--DR  716

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A V     +N D R+ V D+KPRI +E+ +K+++WKLTEI+E S CR+L+LP+ L   +
Sbjct  717   AAPVSAMVGLNNDNRSLV-DIKPRIADESVEKARIWKLTEISELSQCRSLRLPDTLTAMR  775

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRLIYTNSG ++LAL+SNA+H LWKWQR ER    KATA+  PQLWQPSSGILMTND++
Sbjct  776   VSRLIYTNSGLSVLALSSNAVHKLWKWQRNERIQ--KATASSLPQLWQPSSGILMTNDIS  833

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAAT+LAFHPQDNN
Sbjct  834   DTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATYLAFHPQDNN  893

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VW++DG
Sbjct  894   IIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHTLNVLVSSGADSQLCVWNTDG  953

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL +P+GRA+   +DTRVQFH DQ+H L VHETQ+AIYEA KLEC+KQWV RE
Sbjct  954   WEKQSSKFLQMPSGRAAAPLADTRVQFHSDQMHLLAVHETQIAIYEAPKLECLKQWVPRE  1013

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
              + PI+HA +SCDSQL+Y SF D +V V TA  L LRCRI P+AYL P+ S   V+PLVV
Sbjct  1014  VSGPITHAVYSCDSQLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPPNPSLR-VYPLVV  1072

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT---PVSDQPPR  333
             AAHP +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G +TT     SDQP R
Sbjct  1073  AAHPSEPNQFALGLTDGGVHVLEPLESEGKWGTNPPIENGAGPSTTSGAAASDQPQR  1129



>ref|XP_009613434.1| PREDICTED: topless-related protein 4 isoform X1 [Nicotiana tomentosiformis]
Length=1136

 Score =  1607 bits (4162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/1125 (73%), Positives = 952/1125 (85%), Gaps = 18/1125 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVH+LE+ESGFFFNM+YFED V NG WD+VEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHRLEKESGFFFNMRYFEDSVTNGEWDDVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDQAKAVEILVKDLKVFSTFNEDLFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQ NGARAPSP  NP++G++PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQANGARAPSPVANPIIGAMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPPTN-PSVDYPSG  2820
             PAP  + + L GWM+N P++ H A+SGGPIGLS     A+ LKHPRTPP N P++DY + 
Sbjct  241   PAPAPIAS-LGGWMANPPSMPHQAISGGPIGLSPPVNAASMLKHPRTPPANNPALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H+    + DDLPK V   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHAHNLYSSDDLPKTVVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WEVG RE+L  +NFKVW++S CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNLGDIAIWEVGGRERLAFKNFKVWEISNCSMNLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG VNDLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVNDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCGDDK I+VWDA  G+KQYTFEGHEAPVYSVCPH+KEN+QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGDDKAIRVWDAATGSKQYTFEGHEAPVYSVCPHYKENIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYIGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LTSIDA+GGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFVIKFWDMDNTNLLTSIDAEGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRAIESRALDPSRVPPGAVAKAPMISTYGASSSTAGTSMSIAD  719

Query  1574  RVASVVG----TSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
             R A V      T+  NGD R ++ D KPR+++E  +KSK+WKLTEI+EP+  R+ +LP++
Sbjct  720   RTAPVNAVVQLTTFQNGDNR-SLQDAKPRVSDEL-EKSKIWKLTEISEPAQVRSSRLPDS  777

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             L   +I RL+YTNSG A+LALA NA+H LWKW R ERN +GKA+  +PPQLWQPSSGILM
Sbjct  778   LLSVRIIRLMYTNSGGAILALAYNAVHKLWKWPRNERNVTGKASTAVPPQLWQPSSGILM  837

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND+++ NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH
Sbjct  838   TNDISETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFH  897

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNNIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS+VLNVLVSSGADAQL V
Sbjct  898   PQDNNIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADAQLCV  957

Query  866   WSSDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             WS DGWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQ
Sbjct  958   WSMDGWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQ  1017

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             WV    A  I+ AT+SCDSQ +YASF D +V +FTAA L LRCR+ P+AYL  + SS  V
Sbjct  1018  WVSPNVA--ITDATYSCDSQSIYASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSR-V  1074

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             +PLV+AAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1075  YPLVIAAHPSEANQCAVGLTDGGVYVLEPLESEGKWGTPPPNENG  1119



>ref|XP_004235952.1| PREDICTED: topless-related protein 4 isoform X1 [Solanum lycopersicum]
 ref|XP_010318757.1| PREDICTED: topless-related protein 4 isoform X1 [Solanum lycopersicum]
Length=1132

 Score =  1607 bits (4162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1121 (73%), Positives = 948/1121 (85%), Gaps = 14/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLE+ESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEKESGFFFNMRYFEDSVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDQAKAVEILVKDLKVFSTFNEELFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFR+KLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFREKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQPNGARAPSP  NP++GS+PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQPNGARAPSPVANPIIGSMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPP-TNPSVDYPSG  2820
             PA   + + L GWM+N P++ H A+SGGPIGLS  +  A+ LKHPRTPP +N ++DY + 
Sbjct  241   PAQAPIAS-LGGWMTNPPSMPHQAISGGPIGLSPPTNAASMLKHPRTPPASNAALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H+ +  + DDLPK V   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHAHSLHSSDDLPKTVVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WE+G RE+L  +NFKVW++  CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNIGDIAIWEIGGRERLAFKNFKVWEIGNCSMTLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG V+DLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVSDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCG+DK IKVWDA  G+K YTFEGHEAPVYSVCPH+KE++QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGEDKAIKVWDAATGSKLYTFEGHEAPVYSVCPHYKESIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYVGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LT+ DADGGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFIIKFWDMDNTNLLTTADADGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRALESRALDPSRGPPGAVAKAPMISTYGASSSTAGTSISIAD  719

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     +NGD R N+ D KPRI +E  +KSK+WKLTEI+EP+  R+ +LP+N    
Sbjct  720   RTAPVTAIVQLNGDNR-NLQDTKPRIPDEL-EKSKIWKLTEISEPAQVRSSRLPDNQLSV  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             +I RL+YTNSG A+LALA NA+H LWKWQR ERN +GKA+  +PPQLWQPSSGILMTND+
Sbjct  778   RIIRLMYTNSGGAILALAYNAVHKLWKWQRNERNVTGKASTAVPPQLWQPSSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS VLNVLVSSGADAQL VWS D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSSVLNVLVSSGADAQLCVWSMD  957

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQWV  
Sbjct  958   GWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQWVSP  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
               A  ++ AT+SCDSQ ++ASF D +V +FTAA L LRCR+ P+AYL  + SS  V+PLV
Sbjct  1018  NFA--VTDATYSCDSQSIFASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPSSR-VYPLV  1074

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             VAAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1075  VAAHPSESNQCAVGLTDGGVYVLEPLESEGKWGTPPPNENG  1115



>ref|XP_010318758.1| PREDICTED: topless-related protein 4 isoform X2 [Solanum lycopersicum]
Length=1130

 Score =  1607 bits (4160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/1121 (73%), Positives = 946/1121 (84%), Gaps = 16/1121 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLE+ESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEKESGFFFNMRYFEDSVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ D++KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRHDQAKAVEILVKDLKVFSTFNEELFKEITLLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFR+KLQFPSLKNSRLRTLINQSLN
Sbjct  121   LQNFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFREKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDH+CGQPNGARAPSP  NP++GS+PK GGFPP+GAHGPFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHACGQPNGARAPSPVANPIIGSMPKVGGFPPIGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA-LKHPRTPP-TNPSVDYPSG  2820
             PA   + + L GWM+N P++ H A+SGGPIGLS  +  A+ LKHPRTPP +N ++DY + 
Sbjct  241   PAQAPIAS-LGGWMTNPPSMPHQAISGGPIGLSPPTNAASMLKHPRTPPASNAALDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KRPR  G+S+EVN LP+N+ PV++PG  H+ +  + DDLPK V   LNQGS+  
Sbjct  300   DSEHVLKRPRPFGMSEEVNNLPVNIFPVTYPGQSHAHSLHSSDDLPKTVVVNLNQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLLLVGTN+GDIA+WE+G RE+L  +NFKVW++  CSM LQ +L  +   +
Sbjct  360   SMDFHPVQQTLLLVGTNIGDIAIWEIGGRERLAFKNFKVWEIGNCSMTLQASLANEYTAT  419

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L GVAYS+HIV +YSYHG DD+R HLEIDAHVG V+DLAFSHPNKQLC+
Sbjct  420   VNRVMWSPDGNLLGVAYSKHIVHLYSYHGGDDLRNHLEIDAHVGNVSDLAFSHPNKQLCI  479

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCG+DK IKVWDA  G+K YTFEGHEAPVYSVCPH+KE++QFIF+TA+DGKIKAWLYDN
Sbjct  480   ITCGEDKAIKVWDAATGSKLYTFEGHEAPVYSVCPHYKESIQFIFATAVDGKIKAWLYDN  539

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADG RLFSCGTSKDGES++VEWNESEGAVKRTY G  KRS
Sbjct  540   MGSRVDYDAPGHSCTTMAYSADGARLFSCGTSKDGESYLVEWNESEGAVKRTYVGLGKRS  599

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+  +LT+ DADGGLPASP IRF+K+GTLLAVS
Sbjct  600   VGVVQFDTTKNRFLAAGDEFIIKFWDMDNTNLLTTADADGGLPASPCIRFSKEGTLLAVS  659

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG----FAE  1575
              +ENG+K+LAN DG+RL+R  E+ A D +     + +K  +     AS+S AG     A+
Sbjct  660   TSENGVKILANADGVRLIRALESRALDPSRGPPGAVAKAPMISTYGASSSTAGTSISIAD  719

Query  1574  RVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVT  1395
             R A V     +NGD R N+ D KPRI +E  +KSK+WKLTEI+EP+  R+ +LP+N    
Sbjct  720   RTAPVTAIVQLNGDNR-NLQDTKPRIPDEL-EKSKIWKLTEISEPAQVRSSRLPDNQLSV  777

Query  1394  KISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDV  1215
             +I RL+YTNSG A+LALA NA+H LWKWQR ERN +GKA+  +PPQLWQPSSGILMTND+
Sbjct  778   RIIRLMYTNSGGAILALAYNAVHKLWKWQRNERNVTGKASTAVPPQLWQPSSGILMTNDI  837

Query  1214  ADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDN  1035
             +D NPE+AVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN
Sbjct  838   SDTNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDN  897

Query  1034  NIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSD  855
             NIIAIGM+DS+IQIYNVRVDEVKSKLKGH KR+TGLAFS VLNVLVSSGADAQL VWS D
Sbjct  898   NIIAIGMEDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSSVLNVLVSSGADAQLCVWSMD  957

Query  854   GWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQR  678
             GWEK+ SKFL +P+GRA +  + TRVQFHQDQ H LVVHETQ+AIYEA+KLECVKQWV  
Sbjct  958   GWEKKASKFLQIPSGRAINPLAQTRVQFHQDQTHLLVVHETQIAIYEASKLECVKQWVSP  1017

Query  677   EAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLV  498
               A  ++ AT+SCDSQ ++ASF D +V +FTAA L LRCR+ P+AYL  +     V+PLV
Sbjct  1018  NFA--VTDATYSCDSQSIFASFDDGSVSIFTAAALKLRCRVNPAAYLPSNPR---VYPLV  1072

Query  497   VAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENG  375
             VAAHP + NQ A+GL+DGGV V EPLESEGKWG PPP ENG
Sbjct  1073  VAAHPSESNQCAVGLTDGGVYVLEPLESEGKWGTPPPNENG  1113



>ref|XP_009803412.1| PREDICTED: topless-related protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=1134

 Score =  1607 bits (4160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1141 (72%), Positives = 949/1141 (83%), Gaps = 21/1141 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+ VHKLEQESGFFFNM+YF++ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDAVHKLEQESGFFFNMRYFDEMVANGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDRPKAVDILIKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR+IML+ELKKLIEANPLFRDKL FP+LKN+RLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDTKSARSIMLLELKKLIEANPLFRDKLNFPTLKNARLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCG--QPNGARAPSPANNPLLGSVPKPGGFPPLGAHGP  3000
             WQHQLCK+P+PNPDIKTLFVDHSCG  QPNGARAPSP  +PL+G VPKPG FPPLGAHG 
Sbjct  181   WQHQLCKSPKPNPDIKTLFVDHSCGPSQPNGARAPSPVTHPLMGGVPKPGVFPPLGAHGV  240

Query  2999  FQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA--LKHPRTPPTNPSVDYP  2826
              Q AP  +P  LAGWM+N P VSHP+ S GPIG +  +  AA  LK PRTP  NP+VDY 
Sbjct  241   NQ-APGPLPNALAGWMTNPPQVSHPSASAGPIGFTTPNNAAAAMLKRPRTPTNNPTVDYQ  299

Query  2825  SGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSS  2649
             + DS+H+ KR R  G+SDEVN +PIN+LP  + G  H+Q+  + DDLPK    TLNQGS+
Sbjct  300   TADSEHMLKRSRPFGVSDEVNNMPINILPGGYSGQSHAQSSYSSDDLPKASVMTLNQGSA  359

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
               SMDFHPVQQ LLLVGT  G+I +WE+G RE++  R+FKVWDL  CS+ LQ +L  +  
Sbjct  360   VKSMDFHPVQQILLLVGTGTGEIMIWELGGRERISHRSFKVWDLGQCSVALQASLASEYS  419

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
              SVN + WSPDG+LFGVAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQ+
Sbjct  420   ASVNRVMWSPDGTLFGVAYSKHIVHIYSYHGGDDLRNHLEIEAHSGSVNDLAFSYPNKQI  479

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             C++TCGDD+ IKVWDA +GAKQYTFEGHEAPVYS+CPHHKEN+QFIFSTA+DGKIKAWLY
Sbjct  480   CIVTCGDDRLIKVWDAVSGAKQYTFEGHEAPVYSICPHHKENIQFIFSTAIDGKIKAWLY  539

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DNMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAV+RT+ G  K
Sbjct  540   DNMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVRRTFIGLGK  599

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             R+ GVVQFDTTKNR+LAAGD+F IKFWDMD++ MLTS +A+GG+PASP +RFNK+G LLA
Sbjct  600   RAGGVVQFDTTKNRFLAAGDEFMIKFWDMDNINMLTSTEAEGGIPASPCLRFNKEGILLA  659

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------ASNA  1587
             VS ++NGIK+LAN DG+RLLR+ EN        AS  AS   V P ++ S      +  A
Sbjct  660   VSTSDNGIKILANADGLRLLRSMEN----RQFDASRVASASVVKPPTMGSFGPPSTSVAA  715

Query  1586  GFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
              F +R   +     MNG+ R N+ DV+PR  EET DKS++WK TEI EPS CR+LKLP+N
Sbjct  716   SFVDRGVPMTSMVSMNGENR-NLADVRPRAAEETVDKSRIWKPTEINEPSQCRSLKLPDN  774

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             L  T+ISRLIYTNSG A+LALASNA+H LWKW R ERN +GKA A++ PQLWQPS+G LM
Sbjct  775   LTATRISRLIYTNSGLAILALASNAVHKLWKWPRNERNPTGKANASIVPQLWQPSNGTLM  834

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLAFH
Sbjct  835   TNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLAFH  894

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNN+IAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVL+S+GAD+QL V
Sbjct  895   PQDNNVIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLISAGADSQLCV  954

Query  866   WSSDGWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             WS+D WEKQ SK+L +PAGRA+  Q+DTRVQFHQDQ   LVVHETQ+AI+EA+KLEC+KQ
Sbjct  955   WSTDAWEKQTSKYLQIPAGRAAAPQADTRVQFHQDQTQLLVVHETQIAIFEASKLECLKQ  1014

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             WV REA+ PI+HAT+SCDSQ ++ SF DA+V V +A+ L  RCRI P++YL  + SS  +
Sbjct  1015  WVPREASGPITHATYSCDSQSIFVSFEDASVGVLSASTLRWRCRINPTSYLPSNPSSR-M  1073

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV--SDQPP  336
             HPLV+AAHP DPNQFALGLSDG V+V EPLESEGKWG  PP ENG+G +T+    SDQP 
Sbjct  1074  HPLVIAAHPSDPNQFALGLSDGAVIVLEPLESEGKWGTLPPAENGAGPSTSGAANSDQPQ  1133

Query  335   R  333
             R
Sbjct  1134  R  1134



>ref|XP_009595073.1| PREDICTED: topless-related protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1134

 Score =  1606 bits (4158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1141 (72%), Positives = 948/1141 (83%), Gaps = 21/1141 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFK+ VHKLEQESGFFFNM+YF++ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKDAVHKLEQESGFFFNMRYFDEMVANGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALD+ DR KAV+IL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDRNDRPKAVDILIKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR+IML+ELKKLIEANPLFRDKL FP+LKN+RLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDTKSARSIMLLELKKLIEANPLFRDKLNFPTLKNARLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCG--QPNGARAPSPANNPLLGSVPKPGGFPPLGAHGP  3000
             WQHQLCK+P+PNPDIKTLFVDHSCG  QPNGARAPSP  +PL+G VPKPG FPPLGAHG 
Sbjct  181   WQHQLCKSPKPNPDIKTLFVDHSCGPSQPNGARAPSPVTHPLMGGVPKPGVFPPLGAHGV  240

Query  2999  FQPAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAA--LKHPRTPPTNPSVDYP  2826
              Q AP  +P  LAGWM+N P VSHP+ S GPIG +  +  AA  LK PRTP  NP+VDY 
Sbjct  241   NQ-APGPLPNALAGWMTNPPQVSHPSASAGPIGFTTPNNAAAAMLKRPRTPTNNPTVDYQ  299

Query  2825  SGDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSS  2649
             + DS+H+ KR R  G+SDEVN +PIN+LP  + G  H+Q+  + DDLPK    TLNQGS+
Sbjct  300   TADSEHMLKRSRPFGVSDEVNNMPINILPGGYSGQSHAQSSYSSDDLPKASVMTLNQGSA  359

Query  2648  PMSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPG  2469
               SMDFHP QQ LLLVGT  G+I +WE+G RE++  R+FKVWDL  CS+ LQ +L  +  
Sbjct  360   VKSMDFHPAQQILLLVGTGTGEIMIWELGGRERISHRSFKVWDLGQCSVALQASLASEYS  419

Query  2468  VSVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQL  2289
              SVN + WSPDG+LFGVAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQ+
Sbjct  420   ASVNRVMWSPDGTLFGVAYSKHIVHIYSYHGGDDLRNHLEIEAHSGSVNDLAFSYPNKQI  479

Query  2288  CVITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLY  2109
             C++TCGDD+ IKVWDA +GAKQYTFEGHEAPVYS+CPHHKEN+QFIFSTA+DGKIKAWLY
Sbjct  480   CIVTCGDDRLIKVWDAVSGAKQYTFEGHEAPVYSICPHHKENIQFIFSTAIDGKIKAWLY  539

Query  2108  DNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRK  1929
             DNMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GES++VEWNESEGAVKRT+ G  K
Sbjct  540   DNMGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESYLVEWNESEGAVKRTFMGLGK  599

Query  1928  RSFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLA  1749
             R+ GVVQFDTTKNR+LAAGD+F IKFWDMDS+ MLTS +A+GG+PASP +RFNK+G LLA
Sbjct  600   RAGGVVQFDTTKNRFLAAGDEFMIKFWDMDSINMLTSTEAEGGIPASPCLRFNKEGILLA  659

Query  1748  VSANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------ASNA  1587
             VS ++NGIK+LAN DG+RLLR+ EN        AS  AS   V P ++ S      +  A
Sbjct  660   VSTSDNGIKILANADGLRLLRSMEN----RQFDASRVASASVVKPPTMGSFGPPSTSVAA  715

Query  1586  GFAERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
              F +R   +     MNG+ R N+ DV+PR  EET DKS++WK TEI EPS CR+LKLP++
Sbjct  716   SFVDRGVPMTSMVSMNGENR-NLADVRPRAAEETVDKSRIWKPTEINEPSQCRSLKLPDS  774

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             L  T+ISRLIYTNSG A+LALASNA+H LWKW R ERN +GKA A++ PQLWQPS+G LM
Sbjct  775   LTATRISRLIYTNSGLAILALASNAVHKLWKWPRNERNPTGKANASIVPQLWQPSNGTLM  834

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND+ D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMP PPAATFLAFH
Sbjct  835   TNDITDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPAPPAATFLAFH  894

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNN+IAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVL+S+GAD+QL V
Sbjct  895   PQDNNVIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLISAGADSQLCV  954

Query  866   WSSDGWEKQKSKFLPLPAGRASV-QSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             WS+D WEKQ SK+L +PAGRA+  Q+DTRVQFHQDQ   LVVHETQ+AI+EA+KLEC+KQ
Sbjct  955   WSTDAWEKQTSKYLQIPAGRAAAPQADTRVQFHQDQTQLLVVHETQIAIFEASKLECLKQ  1014

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             WV REA+ PI+HAT+SCDSQ ++ SF DA+V V +A+ L  RCRI P++YL  + SS  +
Sbjct  1015  WVPREASGPITHATYSCDSQSIFVSFEDASVGVLSASTLRWRCRINPTSYLPSNPSSR-M  1073

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPV--SDQPP  336
             HPLV+AAHP DPNQFALGLSDG V+V EPLESEGKWG  PP ENG+G +T+    SDQP 
Sbjct  1074  HPLVIAAHPSDPNQFALGLSDGAVIVLEPLESEGKWGTLPPAENGAGPSTSGAANSDQPQ  1133

Query  335   R  333
             R
Sbjct  1134  R  1134



>ref|XP_006450874.1| hypothetical protein CICLE_v10007287mg [Citrus clementina]
 ref|XP_006475891.1| PREDICTED: topless-related protein 4-like [Citrus sinensis]
 gb|ESR64114.1| hypothetical protein CICLE_v10007287mg [Citrus clementina]
 gb|KDO80171.1| hypothetical protein CISIN_1g001163mg [Citrus sinensis]
Length=1134

 Score =  1605 bits (4155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 826/1125 (73%), Positives = 943/1125 (84%), Gaps = 8/1125 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQ+SGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQDSGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVFS+FNE+LFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFSAFNEDLFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPR NPDIKTLFVDH+CGQPNGARAPSP  NPL+G+VPK G FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRANPDIKTLFVDHTCGQPNGARAPSPVTNPLMGAVPKAGAFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAAL-KHPRTPPTNPS-VDYPSG  2820
             P P  +PT LAGWM+N   V HP+ S GPI L+ ++  AA+ K PRTPPTN S +DY + 
Sbjct  241   PTPAALPTSLAGWMANPSPVPHPSPSAGPIALTAANNAAAILKRPRTPPTNNSAMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  GISDEVN L +N+LPV++      Q+  + DDLPK V  TLNQGS+  
Sbjct  301   DSEHVLKRSRPFGISDEVNNLSVNILPVAYTPQSLGQSSYSTDDLPKTVVMTLNQGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ LL+VGTN+GD+ LWEVGSRE++ +++FKVW+L ACSMPLQ +L  D   S
Sbjct  361   SMDFHPVQQILLVVGTNMGDVMLWEVGSRERIAVKSFKVWELGACSMPLQASLSSDYTAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYS+HIV +Y+YHG D++R HLEI+AHVG VNDLAFS+PNKQL V
Sbjct  421   VNRVMWSPDGTLFGVAYSKHIVHLYTYHGGDELRNHLEIEAHVGSVNDLAFSYPNKQLSV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  G KQY FEGHE+PVYS+CPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  481   VTCGEDRVIKVWDAVTGTKQYIFEGHESPVYSICPHHKENIQFIFSTATDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             +GSRVDYDAPG   T MAYSADG RLFSCGT+K+GES++VEWNESEGAVKRTY G  KRS
Sbjct  541   LGSRVDYDAPGHSSTMMAYSADGARLFSCGTNKEGESYLVEWNESEGAVKRTYHGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IKFWDMD+V +L SIDADGGL ASP IRFNK+G LLAVS
Sbjct  601   VGVVQFDTTKNRFLAAGDEFMIKFWDMDNVNLLASIDADGGLQASPCIRFNKEGILLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAG--FAERV  1569
              N+NGIK+LAN DGIRLLRT E+  +DA+  AS +  K        ++ +N G    ER 
Sbjct  661   TNDNGIKILANADGIRLLRTVESRTFDASRVASAAIVKAPAIGTFGSANANVGTSLGERT  720

Query  1568  ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKI  1389
             A       M+ D+R N  DVKP+I +E  +KS++WKLTEITEPS CR+L+LP+NL   ++
Sbjct  721   APAAAMVGMSNDSR-NFTDVKPKIADEAVEKSRIWKLTEITEPSQCRSLRLPDNLTAMRV  779

Query  1388  SRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVAD  1209
             SRLIYTNSG A+LALASNA+H LWKW R ERNS+GKAT N  PQLWQP SGILMTND++D
Sbjct  780   SRLIYTNSGLAILALASNAVHKLWKWPRNERNSTGKATTNQAPQLWQPPSGILMTNDISD  839

Query  1208  KNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNI  1029
              NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI
Sbjct  840   TNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNI  899

Query  1028  IAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGW  849
             IAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFS+ LNVLVSSGAD+QL VWS+DGW
Sbjct  900   IAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSNTLNVLVSSGADSQLCVWSTDGW  959

Query  848   EKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREA  672
             EKQ SKFL +P GR AS  +DTRVQFH DQ H L VHETQ+AIYEA KLEC+KQ+V REA
Sbjct  960   EKQASKFLTIPNGRTASALADTRVQFHLDQTHLLAVHETQIAIYEAPKLECLKQFVPREA  1019

Query  671   AAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVA  492
             + PI+HAT+SCDSQ +Y +F + +V V TA+ L LRCRI P+AYL  + S   V+PLV+A
Sbjct  1020  SGPITHATYSCDSQSIYVAFEEGSVGVLTASTLRLRCRINPTAYLPTNPSLR-VYPLVIA  1078

Query  491   AHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
              +P DPNQFALGL+DGGV + EPLE+EG+WG  PP ENG+G +TT
Sbjct  1079  GNPTDPNQFALGLTDGGVYIIEPLEAEGRWGTSPPNENGAGPSTT  1123



>ref|XP_011017797.1| PREDICTED: topless-related protein 4-like isoform X1 [Populus 
euphratica]
Length=1126

 Score =  1603 bits (4152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1127 (72%), Positives = 942/1127 (84%), Gaps = 22/1127 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK+PR NPDIKTLFVDHSCGQPNGARAPSP  N L+G VPK GGFP +  HGPFQ
Sbjct  181   WQHQLCKSPRSNPDIKTLFVDHSCGQPNGARAPSPVTNSLMGGVPKSGGFPSITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAP  +P+ LAGWM+N      P+ S GP+GL+ ++  A LKHPRTPPTN P++DY + D
Sbjct  241   PAPPALPSSLAGWMAN------PSASAGPLGLAPNNTAAILKHPRTPPTNNPAIDYQTAD  294

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             S+HV KRPR+ G+SDEVNLPIN++P+++    H Q   + DDLPKN    LNQGS+  SM
Sbjct  295   SEHVLKRPRAFGLSDEVNLPINIMPIAYTSQNHGQNSYSSDDLPKNPVMALNQGSAVKSM  354

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQ LLLVGTN+G++ LWE+GSRE++  +NFKVWDL+A S  LQ +L  D   S+N
Sbjct  355   DFHPVQQILLLVGTNMGEVLLWELGSRERIAWKNFKVWDLNARSRALQASLSNDYTASIN  414

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYS+HI+ +YSYHG DD+R HLE+DAH G VNDLAF++PNKQL V+T
Sbjct  415   RVVWSPDGTLFGVAYSKHIMHVYSYHGGDDIRNHLEMDAHNGNVNDLAFAYPNKQLVVVT  474

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDD+TI+VWDA  G + + F GH+APVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN G
Sbjct  475   CGDDRTIRVWDAIVGTRLFNFVGHDAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDNAG  534

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KRS G
Sbjct  535   SRVDYNAPGHSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKRSVG  594

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VV+FDTTKNR+LAAGDDF IKFWDMD+  +LT++DA+GGLPASP IRFNK+GTLLAVS N
Sbjct  595   VVKFDTTKNRFLAAGDDFMIKFWDMDNNNLLTTVDAEGGLPASPCIRFNKEGTLLAVSTN  654

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERV----  1569
             +N IK+LAN+DGIRLLRT EN      A  + SA+      I     +NA     +    
Sbjct  655   DNSIKILANSDGIRLLRTVEN--RTFDASRAASAAVAKAPAIGTFPPANATVGTSIDNQA  712

Query  1568  ---ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
                A +VG   M  D R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++L  
Sbjct  713   APAAPMVG---MTSDNRSLV-DVKPKIQDESIEKSRIWKLTEINEPSQCRSLRLPDSLTA  768

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
              ++SRLI+TNSG A+LALASNA+H LWKWQR +RN +GKATA++PPQLWQPSSGILMTND
Sbjct  769   MRVSRLIFTNSGVAILALASNAVHKLWKWQRNDRNLTGKATASVPPQLWQPSSGILMTND  828

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQD
Sbjct  829   ISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHPQD  888

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VWS+
Sbjct  889   NNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVWST  948

Query  857   DGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             D WEKQ SKFL +P GR AS  +DTRVQFH DQIH L VHETQ+AI+EA KLEC+KQWV 
Sbjct  949   DAWEKQASKFLQMPTGRVASSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECLKQWVP  1008

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI  +AYL P+ S   V+PL
Sbjct  1009  REASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRINSTAYLPPNPSLR-VYPL  1067

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT  360
             V+AAHP +P+QFALGL+DGG+ V EPLESEGKWG  PPVENG+G +T
Sbjct  1068  VIAAHPSEPDQFALGLTDGGIHVLEPLESEGKWGTLPPVENGAGPST  1114



>ref|XP_011020160.1| PREDICTED: topless-related protein 4-like isoform X3 [Populus 
euphratica]
Length=1132

 Score =  1601 bits (4146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1129 (73%), Positives = 945/1129 (84%), Gaps = 18/1129 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPP+  HGPFQ
Sbjct  181   WQHQLCKAPRSNPDIKTLFVDHSCGQPNGARAPSPVTNPLMDAVPKAGGFPPITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             P PT +P  LAGWM+N  TV HP+ S GP+GL+  +  A LK PR+PPTN P++DY + D
Sbjct  241   PTPT-IPPSLAGWMANPSTVPHPSASAGPMGLAAPNNAALLKRPRSPPTNNPAIDYQTAD  299

Query  2816  SDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S+HV KR R   +SDEVN LP+N+LP+++P   H Q+  + DDLPKN   TL QGS+  S
Sbjct  300   SEHVLKRSRPF-VSDEVNNLPVNILPIAYPSQNHGQSSYSSDDLPKNPVMTLTQGSAVKS  358

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQ LLLVGT++GD+ +WE+GSRE++  + FKVWD +ACS  LQ +L  D   SV
Sbjct  359   MDFHPLQQILLLVGTSMGDVMVWELGSRERIGWKKFKVWDHNACSRALQASLSSDYTASV  418

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV +Y YHG DD+R HL+IDAH G VNDLAFS+PNKQL ++
Sbjct  419   NRVAWSPDGNLFGVAYSKHIVHVYYYHGGDDIRNHLQIDAHNGSVNDLAFSYPNKQLAIV  478

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             TCGDD+TIKVWDA  G + + F GHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDNM
Sbjct  479   TCGDDRTIKVWDAVAGTRLFNFSGHEAPVYSVCPHHKENIQFIFSTAADGKIKAWLYDNM  538

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KRS 
Sbjct  539   GSRVDYDAPGNSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKRSV  598

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVV+FDTTKNR+LAA D+F IKFWDMD++ +L SIDA+GGLP SP IRFNK+GTLLAVS 
Sbjct  599   GVVKFDTTKNRFLAAVDEFMIKFWDMDNINLLASIDAEGGLPGSPCIRFNKEGTLLAVST  658

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGF-------  1581
             N+N IK+LAN+DGIRLLRT EN  +DA+  AS S  KP   PI     +NA         
Sbjct  659   NDNSIKILANSDGIRLLRTVENRTFDASRAASASVVKPP--PIGSFPPANAPVGTSGDDQ  716

Query  1580  AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLR  1401
             A   A +VG   MN D+R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++L 
Sbjct  717   AALAAPMVG---MNSDSRSLV-DVKPKIQDESVEKSRIWKLTEINEPSQCRSLRLPDSLT  772

Query  1400  VTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTN  1221
               ++SRLIYTNSG A+LALASNA+H LWKWQR +RN SGKA+A++PPQLWQPSSGI MTN
Sbjct  773   SMRVSRLIYTNSGVAILALASNAVHKLWKWQRNDRNLSGKASASVPPQLWQPSSGIFMTN  832

Query  1220  DVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQ  1041
             D++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQ
Sbjct  833   DISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHPQ  892

Query  1040  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWS  861
             DNNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VWS
Sbjct  893   DNNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVWS  952

Query  860   SDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWV  684
             +D WEKQ SK L LP+GR A   +DTRVQFH DQIH L VHETQ+AI+EA KLEC KQW 
Sbjct  953   TDAWEKQASKLLQLPSGRVAPSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECQKQWF  1012

Query  683   QREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHP  504
             ++EA+ PI+HAT+SCDSQ ++ SF D +V V TA+ L LRCRI+ +AYL P+ SS  V+P
Sbjct  1013  RQEASGPITHATYSCDSQSIFVSFEDGSVVVLTASTLRLRCRISSTAYLPPNPSSLRVYP  1072

Query  503   LVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             LV+AAHP +P+QFALGL+DGGV V EPLESEGKWG  PPVENG+G + T
Sbjct  1073  LVIAAHPAEPDQFALGLTDGGVHVLEPLESEGKWGTSPPVENGAGPSAT  1121



>ref|XP_011017798.1| PREDICTED: topless-related protein 4-like isoform X2 [Populus 
euphratica]
Length=1125

 Score =  1599 bits (4141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1127 (72%), Positives = 942/1127 (84%), Gaps = 23/1127 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK+PR NPDIKTLFVDHSCGQPNGARAPSP  N L+G VPK GGFP +  HGPFQ
Sbjct  181   WQHQLCKSPRSNPDIKTLFVDHSCGQPNGARAPSPVTNSLMGGVPKSGGFPSITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAP  +P+ LAGWM+N      P+ S GP+GL+ ++  A LKHPRTPPTN P++DY + D
Sbjct  241   PAPPALPSSLAGWMAN------PSASAGPLGLAPNNT-AILKHPRTPPTNNPAIDYQTAD  293

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             S+HV KRPR+ G+SDEVNLPIN++P+++    H Q   + DDLPKN    LNQGS+  SM
Sbjct  294   SEHVLKRPRAFGLSDEVNLPINIMPIAYTSQNHGQNSYSSDDLPKNPVMALNQGSAVKSM  353

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQ LLLVGTN+G++ LWE+GSRE++  +NFKVWDL+A S  LQ +L  D   S+N
Sbjct  354   DFHPVQQILLLVGTNMGEVLLWELGSRERIAWKNFKVWDLNARSRALQASLSNDYTASIN  413

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYS+HI+ +YSYHG DD+R HLE+DAH G VNDLAF++PNKQL V+T
Sbjct  414   RVVWSPDGTLFGVAYSKHIMHVYSYHGGDDIRNHLEMDAHNGNVNDLAFAYPNKQLVVVT  473

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDD+TI+VWDA  G + + F GH+APVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN G
Sbjct  474   CGDDRTIRVWDAIVGTRLFNFVGHDAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDNAG  533

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KRS G
Sbjct  534   SRVDYNAPGHSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKRSVG  593

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VV+FDTTKNR+LAAGDDF IKFWDMD+  +LT++DA+GGLPASP IRFNK+GTLLAVS N
Sbjct  594   VVKFDTTKNRFLAAGDDFMIKFWDMDNNNLLTTVDAEGGLPASPCIRFNKEGTLLAVSTN  653

Query  1736  ENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERV----  1569
             +N IK+LAN+DGIRLLRT EN      A  + SA+      I     +NA     +    
Sbjct  654   DNSIKILANSDGIRLLRTVEN--RTFDASRAASAAVAKAPAIGTFPPANATVGTSIDNQA  711

Query  1568  ---ASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRV  1398
                A +VG   M  D R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++L  
Sbjct  712   APAAPMVG---MTSDNRSLV-DVKPKIQDESIEKSRIWKLTEINEPSQCRSLRLPDSLTA  767

Query  1397  TKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTND  1218
              ++SRLI+TNSG A+LALASNA+H LWKWQR +RN +GKATA++PPQLWQPSSGILMTND
Sbjct  768   MRVSRLIFTNSGVAILALASNAVHKLWKWQRNDRNLTGKATASVPPQLWQPSSGILMTND  827

Query  1217  VADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQD  1038
             ++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQD
Sbjct  828   ISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHPQD  887

Query  1037  NNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSS  858
             NNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VWS+
Sbjct  888   NNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVWST  947

Query  857   DGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQ  681
             D WEKQ SKFL +P GR AS  +DTRVQFH DQIH L VHETQ+AI+EA KLEC+KQWV 
Sbjct  948   DAWEKQASKFLQMPTGRVASSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECLKQWVP  1007

Query  680   REAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPL  501
             REA+ PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI  +AYL P+ S   V+PL
Sbjct  1008  REASGPITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRINSTAYLPPNPSLR-VYPL  1066

Query  500   VVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT  360
             V+AAHP +P+QFALGL+DGG+ V EPLESEGKWG  PPVENG+G +T
Sbjct  1067  VIAAHPSEPDQFALGLTDGGIHVLEPLESEGKWGTLPPVENGAGPST  1113



>ref|XP_002527178.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF35191.1| WD-repeat protein, putative [Ricinus communis]
Length=1134

 Score =  1599 bits (4140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1126 (73%), Positives = 943/1126 (84%), Gaps = 10/1126 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             M+SLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+YFED V NG WDEVEKYLSGF
Sbjct  1     MTSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRYFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARNIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+G++PK GGFPPL AH PFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMGALPKAGGFPPLSAHVPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPT-NPSVDYPSGD  2817
             P P  +PT LAGWM+N+  V HP+ S GPIGLS  +  A +K PRTPPT NPS+DY + D
Sbjct  241   PTPAALPTSLAGWMANSSAVPHPSASAGPIGLSAPNNAAIIKRPRTPPTNNPSMDYQTAD  300

Query  2816  SDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             S++V KR R  GISDEV NLP+N+LPV++    H Q+  + DDLPK +   LNQGS+  S
Sbjct  301   SENVLKRTRPFGISDEVSNLPVNILPVAYSSQNHGQSSYSSDDLPKTLVMALNQGSAVKS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHPVQQ LLLVGT++GD+ +WE+GSRE++ L+NFKVW+L A S+ LQ +L  D   SV
Sbjct  361   MDFHPVQQILLLVGTSMGDVMVWELGSRERIALKNFKVWELGARSVGLQASLTNDYTASV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYS+HIV +YSYH  DDV+ + EI+AH G VNDLAFS+ + +L VI
Sbjct  421   NRVLWSPDGALFGVAYSKHIVHLYSYHVGDDVKNYREIEAHNGSVNDLAFSY-HDRLSVI  479

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
             +CG+D+ IKVWD   G  ++TFEGHEAPVYSVCPHHKE++QFIFSTA DGKIKAWLYDN+
Sbjct  480   SCGEDRVIKVWDPLTGNPKFTFEGHEAPVYSVCPHHKESIQFIFSTATDGKIKAWLYDNL  539

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
             GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEG VKR+Y G  KRS 
Sbjct  540   GSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGTVKRSYIGLGKRSM  599

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGD+F +KFWDMD++ +LTSIDA+GGLPASP IRFNKDG+LLA+S 
Sbjct  600   GVVQFDTTKNRFLAAGDEFMVKFWDMDNINLLTSIDAEGGLPASPCIRFNKDGSLLAIST  659

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSV---NPISVASA-SNAGFAER  1572
             NEN IK LAN++GIRLLRT EN  +DA+  AS +  K       P   A+A ++    ER
Sbjct  660   NENSIKFLANSEGIRLLRTVENRTFDASRAASAAVVKGPAIGNFPTGNATAGTSISIVER  719

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              A+V     +N D+R  + DVKPRI +E  + S++WKLTE+ EPS CR+L+LP+NL   +
Sbjct  720   AAAVAPMVGINNDSR-ILADVKPRIADEPTENSRIWKLTEVNEPSQCRSLRLPDNLTAMR  778

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             +SRLIYTNSG +LL LASNA+H LWKWQR +RN SGKATA++ PQLWQPSSGILMTND++
Sbjct  779   VSRLIYTNSGLSLLGLASNAVHKLWKWQRNDRNLSGKATASVVPQLWQPSSGILMTNDIS  838

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             D NPED+VPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN
Sbjct  839   DTNPEDSVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNN  898

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             IIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGADAQL VWS+DG
Sbjct  899   IIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADAQLCVWSTDG  958

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEKQ SKFL +P GR S    DTRVQFH DQ H L VHE+++AIYEA KLECVKQW   E
Sbjct  959   WEKQASKFLQIPPGRGSASLVDTRVQFHLDQTHLLAVHESRIAIYEAPKLECVKQWFPWE  1018

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++ PI+HAT+SCDSQ +Y SF DA+V V T++ L LRCRI P+AYL P+ S   V+PLV+
Sbjct  1019  SSGPITHATYSCDSQTIYVSFEDASVGVLTSSTLALRCRINPTAYLPPNPSLR-VYPLVI  1077

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             AAH  +PNQFALGL+DGGV V EPLESEGKWG  PP+ENG+G +TT
Sbjct  1078  AAHTSEPNQFALGLTDGGVYVLEPLESEGKWGTSPPLENGAGPSTT  1123



>ref|XP_002308068.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE91591.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1132

 Score =  1598 bits (4138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/1130 (73%), Positives = 949/1130 (84%), Gaps = 20/1130 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLFVDHSCGQPNGARAPSP  N L+ +VPK GGFPP+  HGPFQ
Sbjct  181   WQHQLCKTPRSNPDIKTLFVDHSCGQPNGARAPSPVTNSLMDAVPKAGGFPPITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSV-SSIPAALKHPRTPPTN-PSVDYPSG  2820
             P PT +P  LAGWM+N  TV HP+ S GP+GL+  ++  A LK PR+PPTN P++DY + 
Sbjct  241   PTPT-IPPSLAGWMANPSTVPHPSASAGPMGLAAPNNAVALLKRPRSPPTNNPAIDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+SDEVN LP+N+LP+++P   H Q+  + DDLPKN   TL QGS+  
Sbjct  300   DSEHVLKRSRPFGLSDEVNNLPVNILPIAYPSQNHGQSSYSSDDLPKNPVMTLAQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGT++GD+ +WE+GSRE++  +NFKVWD +  S  LQ +L  D   S
Sbjct  360   SMDFHPLQQILLLVGTSMGDVMVWELGSRERIGWKNFKVWDHN--SRALQASLSSDYTAS  417

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYS+HIV +YSYHG DD+R HL+IDAH G VNDLAFS+PNKQL +
Sbjct  418   VNRVAWSPDGTLFGVAYSKHIVHVYSYHGGDDIRNHLQIDAHNGSVNDLAFSYPNKQLAI  477

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCGDD+TI+VWDA  G + + F GHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  478   VTCGDDRTIRVWDAVAGTRLFNFLGHEAPVYSVCPHHKENIQFIFSTAADGKIKAWLYDN  537

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KRS
Sbjct  538   MGSRVDYDAPGNSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKRS  597

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              G V+FDTTKNR+LAA D+F IKFWDMD+V +LTSIDA+GGLPASP IRFNK+GTLLAVS
Sbjct  598   VGAVKFDTTKNRFLAAIDEFMIKFWDMDNVNLLTSIDAEGGLPASPCIRFNKEGTLLAVS  657

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGF------  1581
              N+N IK+LAN+DGIRLLRT EN  +DA+  AS S  KP   PI   S +NA        
Sbjct  658   TNDNSIKILANSDGIRLLRTVENRTFDASRAASASVVKPP--PIGNFSPANAPVGTSGDD  715

Query  1580  -AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENL  1404
              A   A +VG   MN D+R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++L
Sbjct  716   QAALAAPMVG---MNSDSRSLV-DVKPKIQDESVEKSRIWKLTEINEPSQCRSLRLPDSL  771

Query  1403  RVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMT  1224
                ++SRLIYTNSG A+LALASNA+H LWKWQR +RN SGKA A++PPQLWQPSSGILMT
Sbjct  772   TSMRVSRLIYTNSGVAILALASNAVHKLWKWQRNDRNPSGKANASVPPQLWQPSSGILMT  831

Query  1223  NDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHP  1044
             ND++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHP
Sbjct  832   NDISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHP  891

Query  1043  QDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVW  864
             QDNNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VW
Sbjct  892   QDNNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVW  951

Query  863   SSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW  687
             S+D WEKQ SKFL +P+GR A   +DTRVQFH DQIH L VHETQ+AI+EA KLEC KQW
Sbjct  952   STDAWEKQASKFLQIPSGRVAPSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECQKQW  1011

Query  686   VQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVH  507
              ++EA+ PI+HAT+SCDSQ ++ SF D +V V TA+ L LRCRI+ +AYL P+ SS  V+
Sbjct  1012  FRQEASGPITHATYSCDSQSIFVSFEDGSVVVLTASTLRLRCRISSTAYLPPNPSSLRVY  1071

Query  506   PLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             PLV+AAHP +P+QFALGL+DGGV V EPLESEGKWG  PPVENG+G + T
Sbjct  1072  PLVIAAHPSEPDQFALGLTDGGVHVLEPLESEGKWGTSPPVENGAGPSAT  1121



>ref|XP_011020157.1| PREDICTED: topless-related protein 4-like isoform X1 [Populus 
euphratica]
Length=1133

 Score =  1595 bits (4131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1131 (73%), Positives = 947/1131 (84%), Gaps = 21/1131 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLFVDHSCGQPNGARAPSP  NPL+ +VPK GGFPP+  HGPFQ
Sbjct  181   WQHQLCKAPRSNPDIKTLFVDHSCGQPNGARAPSPVTNPLMDAVPKAGGFPPITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSV--SSIPAALKHPRTPPTN-PSVDYPS  2823
             P PT +P  LAGWM+N  TV HP+ S GP+GL+   +++P  LK PR+PPTN P++DY +
Sbjct  241   PTPT-IPPSLAGWMANPSTVPHPSASAGPMGLAAPNNAVPL-LKRPRSPPTNNPAIDYQT  298

Query  2822  GDSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSP  2646
              DS+HV KR R   +SDEVN LP+N+LP+++P   H Q+  + DDLPKN   TL QGS+ 
Sbjct  299   ADSEHVLKRSRPF-VSDEVNNLPVNILPIAYPSQNHGQSSYSSDDLPKNPVMTLTQGSAV  357

Query  2645  MSMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGV  2466
              SMDFHP+QQ LLLVGT++GD+ +WE+GSRE++  + FKVWD +ACS  LQ +L  D   
Sbjct  358   KSMDFHPLQQILLLVGTSMGDVMVWELGSRERIGWKKFKVWDHNACSRALQASLSSDYTA  417

Query  2465  SVNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLC  2286
             SVN + WSPDG+LFGVAYS+HIV +Y YHG DD+R HL+IDAH G VNDLAFS+PNKQL 
Sbjct  418   SVNRVAWSPDGNLFGVAYSKHIVHVYYYHGGDDIRNHLQIDAHNGSVNDLAFSYPNKQLA  477

Query  2285  VITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYD  2106
             ++TCGDD+TIKVWDA  G + + F GHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYD
Sbjct  478   IVTCGDDRTIKVWDAVAGTRLFNFSGHEAPVYSVCPHHKENIQFIFSTAADGKIKAWLYD  537

Query  2105  NMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKR  1926
             NMGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KR
Sbjct  538   NMGSRVDYDAPGNSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKR  597

Query  1925  SFGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAV  1746
             S GVV+FDTTKNR+LAA D+F IKFWDMD++ +L SIDA+GGLP SP IRFNK+GTLLAV
Sbjct  598   SVGVVKFDTTKNRFLAAVDEFMIKFWDMDNINLLASIDAEGGLPGSPCIRFNKEGTLLAV  657

Query  1745  SANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGF-----  1581
             S N+N IK+LAN+DGIRLLRT EN  +DA+  AS S  KP   PI     +NA       
Sbjct  658   STNDNSIKILANSDGIRLLRTVENRTFDASRAASASVVKPP--PIGSFPPANAPVGTSGD  715

Query  1580  --AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPEN  1407
               A   A +VG   MN D+R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++
Sbjct  716   DQAALAAPMVG---MNSDSRSLV-DVKPKIQDESVEKSRIWKLTEINEPSQCRSLRLPDS  771

Query  1406  LRVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILM  1227
             L   ++SRLIYTNSG A+LALASNA+H LWKWQR +RN SGKA+A++PPQLWQPSSGI M
Sbjct  772   LTSMRVSRLIYTNSGVAILALASNAVHKLWKWQRNDRNLSGKASASVPPQLWQPSSGIFM  831

Query  1226  TNDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFH  1047
             TND++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFH
Sbjct  832   TNDISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFH  891

Query  1046  PQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFV  867
             PQDNNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL V
Sbjct  892   PQDNNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCV  951

Query  866   WSSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQ  690
             WS+D WEKQ SK L LP+GR A   +DTRVQFH DQIH L VHETQ+AI+EA KLEC KQ
Sbjct  952   WSTDAWEKQASKLLQLPSGRVAPSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECQKQ  1011

Query  689   WVQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGV  510
             W ++EA+ PI+HAT+SCDSQ ++ SF D +V V TA+ L LRCRI+ +AYL P+ SS  V
Sbjct  1012  WFRQEASGPITHATYSCDSQSIFVSFEDGSVVVLTASTLRLRCRISSTAYLPPNPSSLRV  1071

Query  509   HPLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             +PLV+AAHP +P+QFALGL+DGGV V EPLESEGKWG  PPVENG+G + T
Sbjct  1072  YPLVIAAHPAEPDQFALGLTDGGVHVLEPLESEGKWGTSPPVENGAGPSAT  1122



>gb|KEH32128.1| topless-like protein [Medicago truncatula]
Length=1114

 Score =  1595 bits (4131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1140 (72%), Positives = 934/1140 (82%), Gaps = 39/1140 (3%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKE+VH+LEQESGFFFNM+YFE+ V NG WDEVEKYL+GF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKESVHRLEQESGFFFNMRYFEEMVTNGEWDEVEKYLTGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKGDRSKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN
Sbjct  121   LDNFRQNEQLSKYGDTKSARGIMLAELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSP  NPL+  VPK GGFPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPVTNPLMAGVPKVGGFPPLSAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG--PIGLSVSSIPAALKHPRTPPTNPSVDYPSG  2820
             P P  +PT LAGWM+ +P V HP+ S G  PIGL+ ++ P                    
Sbjct  241   PTPNALPTSLAGWMAASPQVQHPSASAGVGPIGLAQANNP--------------------  280

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DSDHV KR R  GISDEVN LP+N+LPV++    H Q+  + DDLPK    TLNQGS+  
Sbjct  281   DSDHVMKRTRPFGISDEVNNLPVNLLPVAYSSQSHGQSSYSSDDLPKTAVMTLNQGSTVK  340

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGTN+GD+ +W++GSRE++  R+FKVWDL  CS+ LQ +L  +   S
Sbjct  341   SMDFHPLQQILLLVGTNMGDVMVWDIGSRERIAHRSFKVWDLQVCSVALQASLSNEYSAS  400

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+L  VAYS+HIV IYSYHG DD+R HLEI+AH G VNDLAFS+PNKQLCV
Sbjct  401   VNRVVWSPDGTLCSVAYSKHIVHIYSYHGGDDLRNHLEIEAHAGSVNDLAFSYPNKQLCV  460

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCG+D+ IKVWDA  GAKQYTFEGHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  461   VTCGEDRVIKVWDAVTGAKQYTFEGHEAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDN  520

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTM+YSADGTRLFSCGT+K+GES +VEWNESEGAVKRTY G  KRS
Sbjct  521   MGSRVDYDAPGHSSTTMSYSADGTRLFSCGTNKEGESFLVEWNESEGAVKRTYHGLGKRS  580

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F +KFWDMDS  +LTS DADGGL ASP IRFNK+G LLAVS
Sbjct  581   TGVVQFDTTKNRFLAAGDEFMVKFWDMDSTNLLTSFDADGGLLASPCIRFNKEGILLAVS  640

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVAS------ASNAGF  1581
              ++NG+K+LAN +GIRLLRT EN     A  AS +AS  +V P ++ +      A     
Sbjct  641   TSDNGVKILANAEGIRLLRTVEN----RAFDASRAASAANVKPPTIGAFPSTNVAVGTSL  696

Query  1580  AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLR  1401
             A+R   V     +N D+R ++ DVKPRI +E  +KS++WKLTEI E S CR+LKLP+ L 
Sbjct  697   ADRTPPVAAMVGLNNDSR-SLADVKPRIVDEAVEKSRIWKLTEINEQSQCRSLKLPDGLS  755

Query  1400  VTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTN  1221
               ++SRLIYTN G A+LALA+NA+H LWKWQ+ +RN+SGKATA++ PQLWQPSSGILMTN
Sbjct  756   SMRVSRLIYTNQGVAILALAANAVHKLWKWQKNDRNTSGKATASLQPQLWQPSSGILMTN  815

Query  1220  DVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQ  1041
             ++ D NPEDAV CFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQ
Sbjct  816   EIGDTNPEDAVSCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQ  875

Query  1040  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWS  861
             DNNIIAIGMDDS+IQIYNVRVDEVK+KLKGH KRITGLAFSHVLN+LVSSGAD+QL VWS
Sbjct  876   DNNIIAIGMDDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHVLNILVSSGADSQLCVWS  935

Query  860   SDGWEKQKSKFLPLPAGRA-SVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWV  684
             +DGWEKQ +KFL +P GRA +  +DTRVQFH DQ H L VHETQ+AIYEA KLEC+KQWV
Sbjct  936   TDGWEKQTNKFLQMPNGRALAPLADTRVQFHLDQTHLLAVHETQIAIYEAPKLECLKQWV  995

Query  683   QREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHP  504
              REA+ PI+HAT+SCDSQ +Y SF D ++ V TA+ L LRCRI  +AYL+P+ S   V+P
Sbjct  996   PREASGPITHATYSCDSQSIYVSFEDGSIGVLTASTLRLRCRINQTAYLNPNPSLR-VYP  1054

Query  503   LVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT---TPVSDQPPR  333
             LV+AAHP + NQFALGL+DGGV V EPLESEG+WG PPP ENG G +T     VS+QP R
Sbjct  1055  LVIAAHPSESNQFALGLTDGGVHVLEPLESEGRWGSPPPTENGVGPSTPSGASVSEQPQR  1114



>ref|XP_002324641.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEF03206.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1125

 Score =  1595 bits (4130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 813/1122 (72%), Positives = 942/1122 (84%), Gaps = 13/1122 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK+PR NPDIKTLFVDHSCGQPNGARAPSP  N L+G VPK GGFP +  HGPFQ
Sbjct  181   WQHQLCKSPRSNPDIKTLFVDHSCGQPNGARAPSPVTNSLMGGVPKSGGFPSITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSGD  2817
             PAP  +P+ LAGWM+N      P+ S GP+GL+ ++  A LKHPRTPPTN P++DY + D
Sbjct  241   PAPAALPSSLAGWMAN------PSASAGPLGLAPNNT-AILKHPRTPPTNNPAIDYQTAD  293

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPMSM  2637
             S+HV KRPR  G+SDEVNLPIN++P+++    H Q   + DDLPKN    LNQGS+  SM
Sbjct  294   SEHVLKRPRPFGLSDEVNLPINIMPMAYTSQNHGQNSYSSDDLPKNPVMALNQGSAVKSM  353

Query  2636  DFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSVN  2457
             DFHPVQQ LLLVGTN+G++ +WE+GSRE++  RNFKVWDL+A S  LQ +L  D   SVN
Sbjct  354   DFHPVQQILLLVGTNMGEVMVWELGSRERIAGRNFKVWDLNARSRALQASLSNDYTASVN  413

Query  2456  CITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVIT  2277
              + WSPDG+LFGVAYS+HI+ +YSYHG DD+R HLE+DAH G VNDLAF++PNKQL V+T
Sbjct  414   RVAWSPDGTLFGVAYSKHIMHVYSYHGGDDIRNHLEMDAHNGNVNDLAFAYPNKQLVVVT  473

Query  2276  CGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNMG  2097
             CGDD+TI+VWDA  G + + F GH+APVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN G
Sbjct  474   CGDDRTIRVWDAIVGTRLFNFVGHDAPVYSVCPHHKENIQFIFSTATDGKIKAWLYDNAG  533

Query  2096  SRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSFG  1917
             SRVDY+APG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KRS G
Sbjct  534   SRVDYNAPGHSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKRSGG  593

Query  1916  VVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSAN  1737
             VV+FDTTKNR+LAAGDDF IKFWDMD+  +LT+IDA+GGLPASP IRFNK+GTLLAVS N
Sbjct  594   VVKFDTTKNRFLAAGDDFMIKFWDMDNNNLLTTIDAEGGLPASPCIRFNKEGTLLAVSTN  653

Query  1736  ENGIKVLANTDGIRLLRTFENLa-ydaaarasesaskpSVNPISVASASNAGFAERVASV  1560
             +N IK+LAN+DGIRLLRT E+     + A ++  A  P++     A+A+     +  A+ 
Sbjct  654   DNSIKILANSDGIRLLRTVESRTFDASRASSAAVAKAPAIGTFPPANATVGTSIDNQAAP  713

Query  1559  VGTSV-MNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
                 V MN D R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++L   ++SR
Sbjct  714   AAPMVGMNSDNRSLV-DVKPKIQDESIEKSRIWKLTEINEPSQCRSLRLPDSLTAMRVSR  772

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LI+TNSG A+LALASNA+H LWKWQR +RN  GKATA++PPQLWQPSSGILMTND++D N
Sbjct  773   LIFTNSGVAILALASNAVHKLWKWQRNDRNLPGKATASVPPQLWQPSSGILMTNDISDTN  832

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHPQDNNIIA
Sbjct  833   PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHPQDNNIIA  892

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VWS+D WEK
Sbjct  893   IGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVWSTDAWEK  952

Query  842   QKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q SKFL +P GR AS  +DTRVQFH DQIH L VHETQ+AI+EA KLEC+KQW  REA+ 
Sbjct  953   QASKFLQIPTGRVASSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECLKQWFPREASG  1012

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HAT+SCDSQ +Y SF D +V V TA+ L LRCRI  +AYL P+ S   V+PLV+AAH
Sbjct  1013  PITHATYSCDSQSIYVSFEDGSVGVLTASTLRLRCRINSTAYLPPNPSLR-VYPLVIAAH  1071

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNT  360
             P +P+QFALGL+DGG+ V EPLESEGKWG  PPVENG+G +T
Sbjct  1072  PSEPDQFALGLTDGGIHVLEPLESEGKWGTSPPVENGAGPST  1113



>ref|XP_006381123.1| hypothetical protein POPTR_0006s06570g [Populus trichocarpa]
 gb|ERP58920.1| hypothetical protein POPTR_0006s06570g [Populus trichocarpa]
Length=1131

 Score =  1594 bits (4127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 822/1130 (73%), Positives = 948/1130 (84%), Gaps = 21/1130 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFL+EEKFKETVH+LEQESGF+FNM+YFE+ V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLEEEKFKETVHRLEQESGFYFNMRYFEEMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVEILVKDLKVFAAFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFR+NEQLSKYGDTKSAR IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRDNEQLSKYGDTKSARGIMLGELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCK PR NPDIKTLFVDHSCGQPNGARAPSP  N L+ +VPK GGFPP+  HGPFQ
Sbjct  181   WQHQLCKTPRSNPDIKTLFVDHSCGQPNGARAPSPVTNSLMDAVPKAGGFPPITGHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSV-SSIPAALKHPRTPPTN-PSVDYPSG  2820
             P PT +P  LAGWM+N  TV HP+ S GP+GL+  ++  A LK PR+PPTN P++DY + 
Sbjct  241   PTPT-IPPSLAGWMANPSTVPHPSASAGPMGLAAPNNAVALLKRPRSPPTNNPAIDYQTA  299

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+SDEVN LP+N+LP+++P   H Q+  + DDLPKN   TL QGS+  
Sbjct  300   DSEHVLKRSRPFGLSDEVNNLPVNILPIAYPSQNHGQSSYSSDDLPKNPVMTLAQGSAVK  359

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHP+QQ LLLVGT++GD+ +WE+GSRE++  +NFKVWD +  S  LQ +L  D   S
Sbjct  360   SMDFHPLQQILLLVGTSMGDVMVWELGSRERIGWKNFKVWDHN--SRALQASLSSDYTAS  417

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDG+LFGVAYS+HIV +YSYHG DD+R HL+IDAH G VNDLAFS+PNKQL +
Sbjct  418   VNRVAWSPDGTLFGVAYSKHIVHVYSYHGGDDIRNHLQIDAHNGSVNDLAFSYPNKQLAI  477

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCGDD+TI+VWDA  G + + F GHEAPVYSVCPHHKEN+QFIFSTA DGKIKAWLYDN
Sbjct  478   VTCGDDRTIRVWDAVAGTRLFNFLGHEAPVYSVCPHHKENIQFIFSTAADGKIKAWLYDN  537

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEGAVKRTY G  KRS
Sbjct  538   MGSRVDYDAPGNSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGAVKRTYNGLAKRS  597

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              G V+FDTTKNR+LAA D+F IKFWDMD+V +LTSIDA+GGLPASP IRFNK+GTLLAVS
Sbjct  598   VGAVKFDTTKNRFLAAIDEFMIKFWDMDNVNLLTSIDAEGGLPASPCIRFNKEGTLLAVS  657

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGF------  1581
              N+N IK+LAN+DGIRLLRT EN  +DA+  AS S  KP   PI   S +NA        
Sbjct  658   TNDNSIKILANSDGIRLLRTVENRTFDASRAASASVVKPP--PIGNFSPANAPVGTSGDD  715

Query  1580  -AERVASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENL  1404
              A   A +VG   MN D+R+ V DVKP+I +E+ +KS++WKLTEI EPS CR+L+LP++L
Sbjct  716   QAALAAPMVG---MNSDSRSLV-DVKPKIQDESVEKSRIWKLTEINEPSQCRSLRLPDSL  771

Query  1403  RVTKISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMT  1224
                ++SRLIYTNSG A+LALASNA+H LWKWQR +RN SGKA A++PPQLWQPSSGILMT
Sbjct  772   TSMRVSRLIYTNSGVAILALASNAVHKLWKWQRNDRNPSGKANASVPPQLWQPSSGILMT  831

Query  1223  NDVADKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHP  1044
             ND++D NPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFM PPPAATFLAFHP
Sbjct  832   NDISDTNPEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMAPPPAATFLAFHP  891

Query  1043  QDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVW  864
             QDNNIIAIGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VW
Sbjct  892   QDNNIIAIGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVW  951

Query  863   SSDGWEKQKSKFLPLPAGR-ASVQSDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQW  687
             S+D WEKQ SKFL +P+GR A   +DTRVQFH DQIH L VHETQ+AI+EA KLEC KQW
Sbjct  952   STDAWEKQASKFLQIPSGRVAPSLADTRVQFHLDQIHLLAVHETQIAIFEAPKLECQKQW  1011

Query  686   VQREAAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVH  507
              ++EA+ PI+HAT+SCDSQ ++ SF D +V V TA+ L LRCRI+ +AYL P+ S   V+
Sbjct  1012  FRQEASGPITHATYSCDSQSIFVSFEDGSVVVLTASTLRLRCRISSTAYLPPNPSLR-VY  1070

Query  506   PLVVAAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             PLV+AAHP +P+QFALGL+DGGV V EPLESEGKWG  PPVENG+G + T
Sbjct  1071  PLVIAAHPSEPDQFALGLTDGGVHVLEPLESEGKWGTSPPVENGAGPSAT  1120



>ref|XP_011073420.1| PREDICTED: topless-related protein 4 [Sesamum indicum]
Length=1126

 Score =  1593 bits (4125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1132 (72%), Positives = 945/1132 (83%), Gaps = 18/1132 (2%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLE+ESGFFFNM+YFED V NG W+EVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEKESGFFFNMRYFEDSVTNGEWEEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRD +KAVEIL KDLKVFS+FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDHAKAVEILAKDLKVFSTFNEELFKEITMLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFREN+QLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LQNFRENDQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNP+PNPDIKTLFVDHSCGQ NGARAPSP  NPL+GS+PK GGFPP+G   PFQ
Sbjct  181   WQHQLCKNPKPNPDIKTLFVDHSCGQSNGARAPSPVTNPLIGSIPKVGGFPPIGGPAPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGGPIGLSV-SSIPAALKHPRTPPTN-PSVDYPSG  2820
              AP  +   LAGWM+N  ++ H A+S GP+GL+  +   + LK PRTPPTN P++DY + 
Sbjct  241   HAPAPLTNSLAGWMANPSSMPHQALSVGPMGLTPPNHAVSMLKRPRTPPTNNPALDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEVN-LPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  G+ +EVN LP+N+LPV +P   H+ +  + DDLPK V   LNQGS   
Sbjct  301   DSEHVLKRSRPFGMPEEVNSLPVNILPVVYPSQSHAHSSYSADDLPKTVVANLNQGSGVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQTLL+VGTN+G++++W+V S EKLV RNFKVWDL +C+M LQ +L  +   S
Sbjct  361   SMDFHPVQQTLLVVGTNIGEVSVWDVSSGEKLVFRNFKVWDLGSCTMTLQASLANEYTAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGS+FGVAYS+HIV +Y+Y+G+DD+R HLEIDAHVG V+D+AFSHPNKQLC+
Sbjct  421   VNRVMWSPDGSIFGVAYSKHIVHLYAYYGSDDLRNHLEIDAHVGSVSDIAFSHPNKQLCI  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             ITCG+DKTIKVWDA +GAKQYTFEGHEAPVYSVCPH+KEN+QFIFSTA+DGKIKAWLYDN
Sbjct  481   ITCGEDKTIKVWDAVSGAKQYTFEGHEAPVYSVCPHYKENIQFIFSTAVDGKIKAWLYDN  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
             MGSRVDYDAPG  CTTMAYSADGTRLFSCGT+KDGES+IVEWNESEGAVKRTY G  KRS
Sbjct  541   MGSRVDYDAPGHSCTTMAYSADGTRLFSCGTNKDGESYIVEWNESEGAVKRTYLGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              GVVQFDTTKNR+LAAGD+F IK+WDMD+V +L +IDADGGLPASP IRF+K+GTLLAVS
Sbjct  601   VGVVQFDTTKNRFLAAGDEFKIKYWDMDNVNLLITIDADGGLPASPCIRFSKEGTLLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGF---AER  1572
              +ENG+KVLAN +GIR++R+ EN A  A+                 AS S AG    A+R
Sbjct  661   TSENGVKVLANAEGIRVMRSVENRAGAASKAPMIGTFG--------ASGSAAGTSVSADR  712

Query  1571  VASVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTK  1392
              +       +NGD R N+ D K RI++E  +KSK+WKLTEI+E S  R+L+LP++L   +
Sbjct  713   SSPRSAAIALNGDGR-NLPDAKTRISDEL-EKSKIWKLTEISEQSQLRSLRLPDSLLSVR  770

Query  1391  ISRLIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVA  1212
             I RLIYTNSG A+LALA NA+H LWKWQR ERN +GKAT  +PPQLWQPSSGILMTND++
Sbjct  771   IIRLIYTNSGGAILALAYNAVHKLWKWQRSERNVTGKATTAVPPQLWQPSSGILMTNDIS  830

Query  1211  DKNPEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNN  1032
             + N E+AVPCFALSKNDSYV+SASGGKISLFNMMTFKTMTTFMPPPPAAT LAFHPQDNN
Sbjct  831   ETNLEEAVPCFALSKNDSYVLSASGGKISLFNMMTFKTMTTFMPPPPAATILAFHPQDNN  890

Query  1031  IIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDG  852
             +IAIGM+DS+IQIYNVRVDEV+SKLKGH KR+TGLAFS+ L+VLVSSGADAQ+ VWS DG
Sbjct  891   VIAIGMEDSSIQIYNVRVDEVRSKLKGHQKRVTGLAFSNALHVLVSSGADAQICVWSLDG  950

Query  851   WEKQKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQRE  675
             WEK+ SKFL +P GRAS   + TRVQFHQDQ HFLVVHETQ+AIYEA KLEC+KQWV RE
Sbjct  951   WEKKASKFLQIPFGRASNHLAPTRVQFHQDQTHFLVVHETQIAIYEAPKLECIKQWVPRE  1010

Query  674   AAAPISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVV  495
             ++  I+ AT+SCDSQ +Y  F D +V VFTA  L LRCRI P+AYL  + SS  V+PLV+
Sbjct  1011  SSPLITDATYSCDSQSIYTCFEDGSVNVFTAVGLKLRCRINPTAYLPSTPSSR-VYPLVI  1069

Query  494   AAHPQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTTPVSDQP  339
              AHP +P+QFALGL+DGGV V EPLE+EGKWG  PP ENG+G + +PV   P
Sbjct  1070  TAHPTEPHQFALGLTDGGVHVLEPLETEGKWGTVPPQENGAGPSMSPVVSAP  1121



>gb|KDP30260.1| hypothetical protein JCGZ_17042 [Jatropha curcas]
Length=1130

 Score =  1593 bits (4124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 812/1123 (72%), Positives = 936/1123 (83%), Gaps = 8/1123 (1%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNM+ FED V NG WDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMRCFEDMVTNGEWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDKRDR+KAV+IL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKRDRAKAVDILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             L+NFR+NEQLSKYGD KSAR+IML ELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LDNFRDNEQLSKYGDAKSARSIMLAELKKLIEANPLFRDKLQFPTLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQ NGARAPSP  NPL+G+VPK G FPPL AHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQSNGARAPSPVTNPLMGAVPKAGVFPPLSAHGPFQ  240

Query  2993  PAPTQ-VPTQLAGWMSNTPTVSHPAVSGGPIGLSVSSIPAALKHPRTPPTN-PSVDYPSG  2820
               P   +PT LAGWM+N   V HP+ S GP+GLS  +  A +K PRTPPTN P++DY + 
Sbjct  241   ATPAAALPTSLAGWMANPSAVPHPSASAGPVGLSAPNNAAIIKRPRTPPTNNPAMDYQTA  300

Query  2819  DSDHVSKRPRSLGISDEV-NLPINVLPVSFPGHGHSQAHSTLDDLPKNVARTLNQGSSPM  2643
             DS+HV KR R  GISDEV NLP+N+LPV++    H Q+  + DDLPK    +LNQGS+  
Sbjct  301   DSEHVLKRTRPFGISDEVSNLPVNILPVAYTSQSHGQSSYSSDDLPKTPVMSLNQGSAVK  360

Query  2642  SMDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVS  2463
             SMDFHPVQQ LLLVGTN+GD+ +WE+GSRE+L ++NFKVW+L A S+ LQ +L  D   S
Sbjct  361   SMDFHPVQQFLLLVGTNMGDVMVWELGSRERLAVKNFKVWELGARSVGLQASLTNDYTAS  420

Query  2462  VNCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCV  2283
             VN + WSPDGSLFGVAYS+HIV +YSYHG DDV+ + EI+AHVG VNDLAFS+PN++L V
Sbjct  421   VNRVVWSPDGSLFGVAYSKHIVHLYSYHGGDDVKNYREIEAHVGSVNDLAFSYPNERLSV  480

Query  2282  ITCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDN  2103
             +TCGDD+ IKVWD   G  ++TFEGH+APVYSVCPHHKE++QFIFSTA DGKIKAWLYD+
Sbjct  481   VTCGDDRVIKVWDPVTGNPKFTFEGHDAPVYSVCPHHKESIQFIFSTATDGKIKAWLYDH  540

Query  2102  MGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRS  1923
              GSRVDYDAPG   TTMAYSADGTRLFSCGT+K+GESH+VEWNESEG VKR Y G  KRS
Sbjct  541   GGSRVDYDAPGHSSTTMAYSADGTRLFSCGTNKEGESHLVEWNESEGTVKRAYIGLGKRS  600

Query  1922  FGVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVS  1743
              G+VQFDTTKNR+LAAGD+F +KFWDMD++ +LTSIDADGGLPASP +RFNK+G LLAVS
Sbjct  601   VGIVQFDTTKNRFLAAGDEFMVKFWDMDNLSLLTSIDADGGLPASPCVRFNKEGALLAVS  660

Query  1742  ANENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPISVASASNAGFAERVAS  1563
              N+N IK+LAN+DGIRLLRT EN    A+A   ++ S    N  S  +       +RVA 
Sbjct  661   TNDNSIKILANSDGIRLLRTVENRDRAASAAIVKAPSIG--NFPSTNATVGTSIGDRVAP  718

Query  1562  VVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKISR  1383
             V     +N D+R+ V D+KPRI +E  + S++WK+TEI EPS CR+L+LP+N+   +I+R
Sbjct  719   VPPMVGINSDSRSLV-DIKPRIGDEPAENSRIWKVTEINEPSQCRSLRLPDNMTAMRIAR  777

Query  1382  LIYTNsgsallalasnaihlLWKWQRGERNSSGKATANMPPQLWQPSSGILMTNDVADKN  1203
             LIYTNSG A+LALASNA+H LWKWQR +RN +GKATAN+ PQLWQP+SGILMTND+++ N
Sbjct  778   LIYTNSGLAILALASNAVHKLWKWQRNDRNPNGKATANVVPQLWQPASGILMTNDISETN  837

Query  1202  PEDAVPCFALSKNDSYVMSASGGKISLFNmmtfktmttfmppppaatflaFHPQDNNIIA  1023
             PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA
Sbjct  838   PEDAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIA  897

Query  1022  IGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSHVLNVLVSSGADAQLFVWSSDGWEK  843
             IGM+DS+IQIYNVRVDEVK+KLKGH KRITGLAFSH LNVLVSSGAD+QL VWS+DGWEK
Sbjct  898   IGMEDSSIQIYNVRVDEVKTKLKGHQKRITGLAFSHSLNVLVSSGADSQLCVWSTDGWEK  957

Query  842   QKSKFLPLPAGRASVQ-SDTRVQFHQDQIHFLVVHETQLAIYEATKLECVKQWVQREAAA  666
             Q SKFL +P GR+S   +DTRVQFH DQ H L VHE+Q+AIYEA KLEC+KQW  RE + 
Sbjct  958   QASKFLQVPQGRSSASLADTRVQFHVDQTHLLAVHESQIAIYEAPKLECLKQWFPREVSG  1017

Query  665   PISHATFSCDSQLVYASFLDATVCVFTAANLCLRCRIapsaylspslssSGVHPLVVAAH  486
             PI+HAT+SCDS  +Y SF D +V V T + L LRCRI P AYL P+ S   V+PLV+AAH
Sbjct  1018  PITHATYSCDSSSIYVSFEDGSVGVLTTSTLRLRCRINPMAYLPPNPSLR-VYPLVIAAH  1076

Query  485   PQDPNQFALGLSDGGVLVFEPLESEGKWGVPPPVENGSGSNTT  357
             P DPNQFALGL DGGV + EPLE+EGKWG  PPVENG+G +TT
Sbjct  1077  PSDPNQFALGLMDGGVHILEPLETEGKWGTSPPVENGAGHSTT  1119



>ref|XP_006584165.1| PREDICTED: protein TOPLESS-like [Glycine max]
Length=1074

 Score =  1593 bits (4124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 857/1130 (76%), Positives = 935/1130 (83%), Gaps = 68/1130 (6%)
 Frame = -3

Query  3713  MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVNNGNWDEVEKYLSGF  3534
             MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEV+NGNWDEVEKYLSGF
Sbjct  1     MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGF  60

Query  3533  TKVDDNRYSMKIFFEIRKQKYLEALDKRDRSKAVEILTKDLKVFSSFNEELFKEITHLLT  3354
             TKVDDNRYSMKIFFEIRKQKYLEALDK DRSKAVEIL KDLKVF++FNEELFKEIT LLT
Sbjct  61    TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFATFNEELFKEITQLLT  120

Query  3353  LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPSLKNSRLRTLINQSLN  3174
             LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFP+LKNSRLRTLINQSLN
Sbjct  121   LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLN  180

Query  3173  WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSVPKPGGFPPLGAHGPFQ  2994
             WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLG++PK GGFPPLGAHGPFQ
Sbjct  181   WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGALPKAGGFPPLGAHGPFQ  240

Query  2993  PAPTQVPTQLAGWMSNTPTVSHPAVSGG-PIGLSVSSIPAALKHPRTPPTNPSVDYPSGD  2817
             P P  VPT LAGWMSN  TV+H AVSGG  IGL   S+PAALKHPRTPPTNPSVDYPSGD
Sbjct  241   PTPAPVPTPLAGWMSNPTTVAHAAVSGGGAIGLGAPSMPAALKHPRTPPTNPSVDYPSGD  300

Query  2816  SDHVSKRPRSLGISDEVNLPINVLPVSFPGHG-HSQAHSTLDDLPKNVARTLNQGSSPMS  2640
             SDHV+KR R +GISDEVNLP+NVL  +FPGHG HSQA +  DD+PK V RTLNQGSSPMS
Sbjct  301   SDHVAKRTRPMGISDEVNLPVNVLSATFPGHGQHSQAFNAPDDIPKTVVRTLNQGSSPMS  360

Query  2639  MDFHPVQQTLLLVGTNVGDIALWEVGSREKLVLRNFKVWDLSACSMPLQTALVKDPGVSV  2460
             MDFHP+QQ+LLLVGTNVGDIALWEVGSRE+LV RNFKVWDLSACSMP Q ALVKDPGVSV
Sbjct  361   MDFHPIQQSLLLVGTNVGDIALWEVGSRERLVSRNFKVWDLSACSMPFQAALVKDPGVSV  420

Query  2459  NCITWSPDGSLFGVAYSRHIVQIYSYHGNDDVRQHLEIDAHVGGVNDLAFSHPNKQLCVI  2280
             N + WSPDG+LFGVAYSRHIVQIYSYHG D      EI  H+                  
Sbjct  421   NRVIWSPDGALFGVAYSRHIVQIYSYHGGD------EIRQHL------------------  456

Query  2279  TCGDDKTIKVWDATNGAKQYTFEGHEAPVYSVCPHHKENVQFIFSTALDGKIKAWLYDNM  2100
                                   + H   V  +   H      + +   D  IK W     
Sbjct  457   --------------------EIDAHVGGVNDLAFSHPNKQLCVITCGDDKTIKVW-----  491

Query  2099  GSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSF  1920
                 D  +  +  T   + A    +        G   ++ WNESEGAVKRTYQGFRKRS 
Sbjct  492   ----DAASGAKQYTFEGHEAPVYSVL-------GNHPLLSWNESEGAVKRTYQGFRKRSL  540

Query  1919  GVVQFDTTKNRYLAAGDDFSIKFWDMDSVQMLTSIDADGGLPASPRIRFNKDGTLLAVSA  1740
             GVVQFDTTKNR+LAAGDDFSIKFWDMD+VQ+LT++DADGGLPASPRIRFNKDGTLLAVSA
Sbjct  541   GVVQFDTTKNRFLAAGDDFSIKFWDMDNVQLLTTVDADGGLPASPRIRFNKDGTLLAVSA  600

Query  1739  NENGIKVLANTDGIRLLRTFENLaydaaarasesaskpSVNPI--SVASASNAGFAERVA  1566
             NENGIK+LAN DGIRL RT EN +   A+RASE+ +KP +NPI  + A+A++A  AER +
Sbjct  601   NENGIKILANGDGIRLSRTLEN-SLYDASRASEALTKPIINPISAAAAAATSAALAERAS  659

Query  1565  SVVGTSVMNGDARNNVGDVKPRITEETNDKSKVWKLTEITEPSHCRALKLPENLRVTKIS  1386
             SVV  + MNGD R N+GDVKPRI+EE+NDKSK+WKLTEI E S CR+LKLPEN+RVTKIS
Sbjct  660   SVVAIAGMNGDTR-NLGDVKPRISEESNDKSKIWKLTEINEQSQCRSLKLPENVRVTKIS  718

Query  1385  RLIYTNsgsallalasnaihl